U.S. patent application number 17/445419 was filed with the patent office on 2021-12-16 for compositions of phosphorylated tau peptides and uses thereof.
The applicant listed for this patent is AC Immune SA, Janssen Pharmaceuticals, Inc.. Invention is credited to Anish Chakkumkal, David Hickman, Elizabeth Anne Ramsburg.
Application Number | 20210388044 17/445419 |
Document ID | / |
Family ID | 1000005800408 |
Filed Date | 2021-12-16 |
United States Patent
Application |
20210388044 |
Kind Code |
A1 |
Ramsburg; Elizabeth Anne ;
et al. |
December 16, 2021 |
Compositions of Phosphorylated Tau Peptides and Uses Thereof
Abstract
Liposomes containing tau peptides, preferably phosphorylated tau
peptides, and conjugates containing tau peptides, preferably
phosphorylated tau peptides, conjugated to an immunogenic carrier
are described. Pharmaceutical compositions and uses of the
liposomes and/or conjugates for treating or preventing a
neurodegenerative disease or disorder, such as Alzheimer's Disease,
are also described.
Inventors: |
Ramsburg; Elizabeth Anne;
(Chalfont, PA) ; Chakkumkal; Anish; (The Hague,
NL) ; Hickman; David; (St- Sulpice, CH) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Janssen Pharmaceuticals, Inc.
AC Immune SA |
Titusville
Lausanne |
NJ |
US
CH |
|
|
Family ID: |
1000005800408 |
Appl. No.: |
17/445419 |
Filed: |
August 19, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16169215 |
Oct 24, 2018 |
11124552 |
|
|
17445419 |
|
|
|
|
62577157 |
Oct 25, 2017 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/55572
20130101; A61K 2039/55516 20130101; A61K 39/0007 20130101; A61K
9/1271 20130101; C07K 14/4711 20130101; A61K 38/1709 20130101; A61K
2039/55561 20130101; A61K 2039/55555 20130101; A61K 2039/6018
20130101; A61K 9/127 20130101; A61K 2039/627 20130101; A61P 25/28
20180101; A61K 39/39 20130101 |
International
Class: |
C07K 14/47 20060101
C07K014/47; A61K 9/127 20060101 A61K009/127; A61P 25/28 20060101
A61P025/28; A61K 39/00 20060101 A61K039/00; A61K 38/17 20060101
A61K038/17; A61K 39/39 20060101 A61K039/39 |
Claims
1. A conjugate comprising a tau phosphopeptide and an immunogenic
carrier conjugated thereto via a linker, the conjugate having the
structure of: ##STR00011## wherein x is an integer of 0 to 10; and
n is an integer of 3 to 15.
2. The conjugate of claim 1, wherein the immunogenic carrier is
selected from the group consisting of keyhole limpet hemocyanin
(KLH), tetanus toxoid, CRM197 and an outer membrane protein mixture
from N. meningitidis (OMP), or a derivative thereof.
3. The conjugate of claim 1, wherein the tau peptide has an amino
acid sequence selected from the group consisting of SEQ ID NO:1 to
SEQ ID NO:12.
4. The conjugate of claim 1, wherein x is 2 to 6.
5. The conjugate of claim 1, wherein n is 3 to 12.
6. The conjugate of claim 4, wherein x is 3.
7. The conjugate of claim 4, wherein n is 3 to 12.
8. The conjugate of claim 6, wherein n is 3 to 12.
9. The conjugate of claim 7, wherein the tau peptide consists of
the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID
NO:3.
10. The conjugate of claim 9, wherein the conjugate has the
structure of formula (I) and the immunogenic carrier is CRM197.
11. The conjugate of claim 9, wherein the conjugate has the
structure of formula (II) and the immunogenic carrier is KLH.
12. A pharmaceutical composition comprising the conjugate of claim
1 and a pharmaceutically acceptable carrier.
13. The pharmaceutical composition of claim 12, further comprising
an adjuvant.
14. The pharmaceutical composition of claim 13, wherein the
adjuvant comprises at least one of an aluminum salt and a CpG.
15. The pharmaceutical composition of claim 14, wherein the
adjuvant comprises the aluminum salt and the CpG.
16. A pharmaceutical composition comprising the conjugate of claim
10 and a pharmaceutically acceptable carrier.
17. A pharmaceutical composition comprising the conjugate of claim
11 and a pharmaceutically acceptable carrier.
18. A conjugate having the structure of: ##STR00012## wherein n is
an integer of 3 to 7.
19. A pharmaceutical composition comprising the conjugate of claim
18 and a pharmaceutically acceptable carrier.
20. The pharmaceutical composition of claim 19, further comprising
an adjuvant.
21. The pharmaceutical composition of claim 20, wherein the
adjuvant comprises at least one of an aluminum salt and a CpG.
22. The pharmaceutical composition of claim 21, wherein the
adjuvant comprises the aluminum salt and the CpG.
23. A conjugate having the structure of: ##STR00013## wherein the
Tau peptide consisting of the amino acid sequence of SEQ ID NO:1 or
SEQ ID NO:3; x is an integer of 0 to 10; and n is an integer of 2
to 15.
24. A pharmaceutical composition comprising the conjugate of claim
23 and a pharmaceutically acceptable carrier.
25. The pharmaceutical composition of claim 24, further comprising
an adjuvant.
26. The pharmaceutical composition of claim 25, wherein the
adjuvant comprises at least one of an aluminum salt and a CpG.
27. The pharmaceutical composition of claim 26, wherein the
adjuvant comprises the aluminum salt and the CpG.
28. A method for inducing an immune response in a subject suffering
from a neurodegenerative disorder, comprising administering to the
subject the pharmaceutical composition of claim 12.
29. A method for treating or preventing a neurodegenerative disease
or disorder in a subject in need thereof, comprising administering
to the subject the pharmaceutical composition of claim 12, wherein
the neurodegenerative disease or disorder is caused by or
associated with the formation of neurofibrillary lesions.
Description
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application is a division of U.S. application Ser. No.
16/169,215, filed on Oct. 24, 2018, which claims the benefit of
U.S. Provisional Application 62/577,157, filed on Oct. 25, 2017,
the disclosure of each of these prior applications is hereby
incorporated by reference herein in its entirety.
REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY
[0002] This application contains a sequence listing, which is
submitted electronically via EFS-Web as an ASCII formatted sequence
listing with a file name "SequenceListing2US4", creation date of
Jul. 28, 2021, and having a size of 22 KB. The sequence listing
submitted via EFS-Web is part of the specification and is herein
incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0003] The present invention is in the field of medicine. The
invention in particular relates to liposomes or conjugates of tau
peptides and the use thereof for preventing or treating tauopathy,
such as Alzheimer's disease.
BACKGROUND
[0004] Alzheimer's disease (AD) is a progressive debilitating
neurodegenerative disease that affects an estimated 44 million
people worldwide (Alzheimers.net). AD therapies that are currently
available in the clinic aim to slow the progression of clinical
symptoms, but do not target the pathogenic processes that underlie
the disease. Unfortunately, these therapies are only minimally
efficacious, and there is therefore an urgent need to develop and
test additional preventive and therapeutic measures.
[0005] The hallmark pathologies for Alzheimer's disease are an
accumulation of extracellular plaques comprising aggregated amyloid
beta protein and intracellular "tangles" or aggregations of
hyperphosphorylated tau protein. The molecular events that lead to
accumulation of these proteins are poorly characterized. For
amyloid, it is hypothesized that aberrant cleavage of the amyloid
precursor protein leads to an accumulation of the aggregation-prone
fragment comprising amino acids 1-42. For tau, it is hypothesized
that dysregulation of either kinases, phosphatases, or both, leads
to aberrant phosphorylation of tau. Once tau becomes
hyperphosphorylated it loses the ability to effectively bind and
stabilize microtubules, and instead accumulates in the cytoplasm of
the affected neuron. The unbound and hyperphosphorylated tau
appears to form first oligomers and then higher order aggregates,
the presence of which presumably negatively affects function of the
neuron in which they form, perhaps via interruption of normal
axonal transport.
[0006] In developed nations, individuals diagnosed with Alzheimer's
disease or other dementing tauopathies are commonly treated with
cholinesterase inhibitors (e.g. Aricept.RTM.) or memantines (e.g.
Namenda.TM.). These drugs, although reasonably well tolerated, have
very modest efficacy. For example, Aricept.RTM. delays the
worsening of symptoms for 6-12 months in approximately 50% of
treated individuals. The remainder of treatment is
non-pharmacologic, and focuses on making patients more capable of
managing day to day tasks as their cognitive ability declines.
[0007] Several published studies (Asuni A A et al, J Neurosci. 2007
Aug. 22; 27(34):9115-29., Theunis C et al., PLoS One. 2013; 8(8):
e72301., Kontsekova E et al., Alzheimers Res Ther. 2014 Aug. 1;
6(4):44) demonstrate that active vaccines containing tau peptides
can induce anti-tau immune responses in mice or rats; reduce the
accumulation of pathologic tau aggregates in the brain of rodents;
and reduce the rate of progression of cognitive decline in animal
models of Alzheimer's disease. An active vaccine against
pathological tau proteins was shown to be immunogenic in human
patients with Alzheimer's disease (Novak P et al., Lancet Neurology
2017, 16:123-134). WO2010/115843 describes antigenic phosphopeptide
mimicking a major pathological phospho-epitope of protein tau and
related compositions for the therapeutic and diagnostic use in the
treatment of tauopathies including Alzheimer's Disease. However, at
present there are still no approved efficacious vaccines on the
market to prevent the onset of tau-mediated disease. Neither are
there efficacious drugs on the market to intercept or slow the
course of disease once it begins. There is therefore a pressing
need to identify new preventative measures (e.g. vaccines) that can
prevent these diseases.
SUMMARY OF THE INVENTION
[0008] In one general aspect, the invention relates to a liposome,
comprising:
[0009] a. a tau peptide, preferably the tau peptide is a tau
phosphopeptide; and
[0010] b. a helper T-cell epitope,
[0011] wherein the tau peptide is presented on the surface of the
liposome.
[0012] In one embodiment, the liposome further comprises at least
one adjuvant comprising a toll-like receptor ligand. Preferably,
the liposome further comprises at least one of a toll-like receptor
4 ligand and a toll-like receptor 9 ligand.
[0013] In a preferred embodiment, the invention relates to a
liposome, comprising:
[0014] a. a tau peptide, preferably the tau peptide is a tau
phosphopeptide;
[0015] b. a helper T-cell epitope; and
[0016] c. at least one of [0017] i. a toll-like receptor 9 ligand,
preferably a lipidated CpG oligonucleotide; and [0018] ii. a
toll-like receptor 4 ligand, preferably a toll-like receptor 4
agonist,
[0019] wherein the tau peptide is presented on the surface of the
liposome.
[0020] In a further preferred embodiment, the invention relates to
a liposome, comprising:
[0021] a. a tau phosphopeptide;
[0022] b. a helper T-cell epitope;
[0023] c. a lipidated CpG oligonucleotide; and
[0024] d. an adjuvant containing a toll-like receptor 4 ligand;
[0025] wherein the tau phosphopeptide is presented on the surface
of the liposome.
[0026] In another general aspect, the invention relates to a
conjugate comprising a tau peptide, preferably a tau
phosphopeptide, and an immunogenic carrier conjugated thereto,
wherein the tau peptide is conjugated to the carrier via a linker.
The linker can comprise one or more of polyethylene glycol (PEG),
succinimidyl 3-(bromoacetamido)propionate (SBAP), and
m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS). Examples of
the immunogenic carrier useful for the invention include, but are
not limited to, keyhole limpet hemocyanin (KLH), tetanus toxoid
(TT), CRM197, and an outer membrane protein mixture from N.
meningitidis (OMP), or a derivative thereof.
[0027] In one preferred embodiment, the invention relates to a
conjugate having the structure of formula (I):
##STR00001##
or the structure of formula (II):
##STR00002##
wherein
[0028] x is an integer of 0 to 10, preferably 2 to 6, most
preferably 3; and
[0029] n is an integer of 2 to 11, preferably 3 to 11.
[0030] Further aspects of the invention relate to a pharmaceutical
composition comprising a liposome or a conjugate of the invention
and a pharmaceutically acceptable carrier, methods of preparing the
pharmaceutical composition, and the use of the pharmaceutical
composition in inducing an immune response against tau, or treating
or preventing a neurodegenerative disease or disorder in a subject
in need thereof.
[0031] In one embodiment, the invention relates to a method for
inducing an immune response in a subject suffering from a
neurodegenerative disorder, or for treating or preventing a
neurodegenerative disease or disorder in a subject in need thereof.
The method comprises administering to the subject a pharmaceutical
composition comprising a liposome of the invention and a
pharmaceutically acceptable carrier, or a pharmaceutical
composition comprising a conjugate of the invention and a
pharmaceutically acceptable carrier. Preferably, the method
comprises administering to the subject a pharmaceutical composition
of the invention for priming immunization, and a pharmaceutical
composition of the invention for boosting immunization.
[0032] Further aspects, features and advantages of the present
invention will be better appreciated upon a reading of the
following detailed description of the invention and claims.
BRIEF DESCRIPTION OF THE FIGURES
[0033] The foregoing summary, as well as the following detailed
description of preferred embodiments of the present application,
will be better understood when read in conjunction with the
appended drawings. It should be understood, however, that the
application is not limited to the precise embodiments shown in the
drawings.
[0034] FIG. 1 illustrates novel vaccines according to embodiments
of the invention: a tau liposome according to an embodiment of the
invention (top), and a tau conjugate according to an embodiment of
the invention (bottom);
[0035] FIG. 2 illustrates that a vaccine comprising a liposome
according to an embodiment of the invention (2nd generation
liposome) which contains an encapsulated helper T-cell epitope
(e.g., tetanus polypeptide (tet)) activates helper T-cells;
[0036] FIG. 3 illustrates that a vaccine comprising a conjugate
according to an embodiment of the invention which contains non-self
or immunogenic carrier protein activates helper T-cells;
[0037] FIG. 4 shows that tau vaccines according to embodiments of
the invention induce sustained high titer anti-phosphorylated tau
antibodies in Rhesus macaque: the geometric mean of end-point
titers per group, as measured by enzyme-linked immunosorbent assay
(ELISA), over time, is higher for a vaccine comprising a liposome
(Liposome Z) according to an embodiment of the invention or a
vaccine comprising a conjugate (Conjugate A) according to an
embodiment of the invention, as compared to a control liposomal
vaccine without the helper T-cell epitope;
[0038] FIG. 5 shows that serum from Rhesus macaques immunized with
a liposome (Liposome Z) according to an embodiment of the invention
binds to pathological tau structures in human AD brain sections
(left panel) as compared to healthy human brain sections (right
panel);
[0039] FIG. 6 shows that serum from Rhesus macaques immunized with
a conjugate (Conjugate A) according to an embodiment of the
invention formulated in a composition containing soluble CpG and
alum hydroxide binds to pathological tau structures in human AD
brain sections (top row), as compared to healthy human brain
sections (bottom row);
[0040] FIGS. 7A, 7B, 7C, and 7D show the titers of
anti-phosphorylated tau antibodies in Rhesus macaques induced by
liposomal vaccines according to embodiments of the invention,
Liposomes X, Y and Z, each of which contains encapsulated T-cell
epitope T50 and one or more adjuvants; the titers were measured by
ELISA and presented in end point titers over time in individual
monkeys. In particular:
[0041] FIG. 7A shows the titers of anti-phosphorylated tau
antibodies induced by Liposome X with a TLR4 ligand, MPLA
(3D-(6-acyl) PHAD.RTM.) alone as the adjuvant;
[0042] FIG. 7B shows the titers of anti-phosphorylated tau
antibodies induced by Liposome Y with a TLR9 ligand (lipidated CpG
oligonucleotide) alone as the adjuvant;
[0043] FIG. 7C shows the titers of anti-phosphorylated tau
antibodies induced by Liposome Z with a combination of a TLR4
ligand, MPLA (3D-(6-acyl) PHAD.RTM.) and a TLR9 ligand (lipidated
CpG oligonucleotide) as the adjuvants, which also shows that the
combination of two adjuvants induces less variability in antibody
titers among individual monkeys;
[0044] FIG. 7D presents the geometric mean of antibody titers of
the above-mentioned immunization groups and a control liposomal
vaccine with a TLR4 ligand, MPLA, but without T-cell epitope, and
shows that the vaccines according to embodiments of the invention
result in higher antibody titers of anti-phosphorylated tau
antibodies than a control liposomal vaccine: titers were measured
by ELISA and are presented in geometric mean+/-95% confidence
interval of end point titers per group over time;
[0045] FIG. 8 shows that immunization using a liposomal vaccine
(e.g., Liposome X, Y or Z) or a conjugate vaccine (Conjugate A)
according to an embodiment of the invention induces antibody IgG
titers specific for enriched paired helical filaments (ePHF)
isolated from the post mortem brain of Alzheimer's disease
patients: antibody titers were measured by Meso Scale Discovery
(MSD) technology and are presented as values for individual monkeys
on Day 50 and the geometric mean+/-95% CI after the first
immunization;
[0046] FIGS. 9A and 9B show that immunization with a liposomal
vaccine according to an embodiment of the invention (Liposome Z)
containing encapsulated T50 and a combination of a TLR4 ligand
(3D-(6-acyl) PHAD.RTM.) and a TLR9 ligand (lipidated CpG
oligonucleotide) as adjuvants induces antibodies that mostly bind
the N-terminus of phosphorylated tau peptide of SEQ ID NO: 2 (FIG.
9A), whereas monkeys immunized with a conjugate vaccine according
to an embodiment of the invention (Conjugate A) generate IgG
antibodies that bind mostly to the C-terminal part of the peptide,
for both phosphorylated peptide (left) and non-phosphorylated
peptide (right) (FIG. 9B);
[0047] FIGS. 10A and 10B show that vaccination with a liposomal
vaccine according to an embodiment of the invention containing
encapsulated T-cell epitope T50 and TLR4 ligand (3D-(6-acyl)
PHAD.RTM.) as adjuvant (Liposome S) induces significantly higher
antibody titers than the control liposomal vaccine (with a TLR4
ligand, 3D-(6-acyl) PHAD.RTM., but without T-cell epitope T50,
Liposome R) and also the liposomal vaccine according to an
embodiment of the invention containing surface T-cell epitope T57
(dipalmitoylated T50) and TLR4 ligand (3D-(6-acyl) PHAD.RTM.,
Liposome T) in mice: antibody titers at day 21 (FIG. 10A) and 35
(FIG. 10B) after the first immunization were measured by ELISA and
presented as individual values and the geometric mean per group
.+-.95% CI; (**: p<0.01, ***: p<0.001);
[0048] FIGS. 11A and 11B show that encapsulation of T-cell peptides
T48 or T52 into the liposome (Liposome M or N, respectively)
induces a T-cell response specific to the encapsulated peptide in
mice: T-cell response was evaluated by IFN-.gamma. (FIG. 11A) and
IL-4 (FIG. 11B) ELISPOT;
[0049] FIG. 12 shows that liposomal vaccine containing an
encapsulated T-cell epitope (Liposome L) and liposomal vaccine
containing an anchored T-cell epitope (Liposome O) each induced
higher tau phosphopeptide-specific antibody titers than the control
liposomal vaccine without T-cell epitope; each of Liposome L,
Liposome O and control liposome further contains MPLA as
adjuvant;
[0050] FIGS. 13A, 13B, 13C, 13D, 13E, 13F, 13G, and 13H show that
Tau conjugate (KLH-TAUVAC-p7.1 or KLH-TAUVAC-p22.1) induces TfH
cells and robust Ab titers against tau peptide in wild-type mice,
in particular:
[0051] FIG. 13A illustrates that groups of adult female Balb/C mice
(n=14 per group) were immunized a total of four times with 100 ug
adjuvanted KLH-tau conjugate vaccine (KLH-TAUVAC-p7.1 or
KLH-TAUVAC-p22.1), an active placebo vaccine (KLH plus alum or
Ribi), or an inactive placebo (PBS) according to the schedule
shown: four animals from each immunization group were sacrificed
seven days after the primary immunization, and the lymph nodes
draining the injection site were collected;
[0052] FIG. 13B shows the geometric mean percent of TfHs by
immunization group (n=4 mice per group analyzed individually) in
the draining nodes: all groups receiving active vaccines or
placebos had measurable TfHs; moreover, animals receiving vaccine
KLH-TAUVAC-p7.1, KLH-TAUVAC-p22.1 or active placebo KLH plus alum,
had significantly more TfHs than the animals given an inactive
placebo (p=0.0044 for KLH-TAUVAC-p7.1; p=0.0482 for
KLH-TAUVAC-p22.1; p=0.0063 for KLH, using an ANOVA test followed by
a Dunnett's adjustment for multiple comparisons);
[0053] FIGS. 13C, 13D, 13E, 13F, 13G, and 13H show change in serum
titers from baseline (day 0) at four timepoints after immunization
(days 14, 28, 56, and 84) for the group means (n=5-10) with 95%
confidence interval: asterisk indicates time points at which
KLH-TAUVAC-induced antibody response is significantly higher than
the one induced by active placebos (p0.05, measured using ANOVA
test followed by Tukey's adjustment for multiple comparisons), more
specifically:
[0054] FIG. 13C shows binding titers to the phosphorylated tau
peptide p7.1;
[0055] FIG. 13D shows binding titers to the phosphorylated tau
peptide p22.1;
[0056] FIG. 13E shows binding titers to the non-phosphorylated tau
peptide 7.1;
[0057] FIG. 13F shows binding titers to the non-phosphorylated tau
peptide 22.1; and
[0058] FIGS. 13G and 13H each show binding titers to the carrier
protein KLH;
[0059] FIG. 14 shows that sera from mice immunized with Tau
conjugate also bound pathological tau structures from other
tauopathies: pooled sera (n=6) from each vaccination group 84 days
after primary immunization were used to stain brain tissue from a
frontal temporal dementia case with a MAPT mutation (MAPT P301S,
frontal cortex), a case with Pick's disease (frontal cortex),
progressive supranuclear palsy (PSP, caudate nucleus) and primary
age-related tauopathy (PART, hippocampus); sera from animals
receiving the active vaccines highlighted the tau-related
structures typical of each tauopathy, while sera from animals
immunized with an active placebo (KLH-alum or KLH-Ribi) or the
inactive one (PBS), did not stain any of those structures; as
reference an immunostaining with AT8 of the corresponding area is
shown; scale bar=50 um;
[0060] FIGS. 15A, 15B, and 15C show that vaccine-induced antibodies
reduce aggregated tau in an accelerated tauopathy model, in
particular:
[0061] FIG. 15A: three month old P301L transgenic mice (n=15 per
group) received a stereotactic injection of human ePHF
pre-incubated with purified IgG from mice immunized with either
KLH-TAUVAC-p7.1 plus RIBI or with the active placebo KLH plus RIBI;
two months after the injection, all mice were sacrificed and the
amount of aggregated tau in the mice was determined in total and
sarkosyl-insoluble fractions;
[0062] FIGS. 15B and 15C: the total fractions (FIG. 15B) and
sarkosyl-insoluble fractions (FIG. 15C) collected from the injected
hemisphere of each animal: graphs show the amount of tau measured
by MSD; in both the total fraction and the insoluble fraction,
brains of mice receiving ePHF pre-incubated with IgG from
KLH-TAUVAC-p7.1 immunized mice had significantly less aggregated
tau than did mice receiving ePHF pre-incubated with control
antibodies. (p<0.0001, using an ANOVA test followed by
Holm-Bonferroni adjustment for multiple comparisons); and
[0063] FIGS. 16A, 16B, 16C, 16D, and 16E show that Tau conjugate
(Conjugate B) according to an embodiment of the invention induces
high titers of antibodies against phosphorylated Tau and ePHF in
non-human primates: Rhesus macaques were immunized with alum and
CpG adjuvanted KLH-TAUVAC-p7.1 (n=6) or with KLH (n=2) at day 1,
29, 85 and 169; blood was collected every 14 days, in
particular:
[0064] FIG. 16A: sera from animals immunized with KLH-TAUVAC-p7.1
were tested for reactivity on the immunizing peptide p7.1 using
ELISA;
[0065] FIG. 16B: sera collected from all animals 50 days following
primary immunization had measurable antibody levels against human
ePHF using MSD, with 3 out of 6 animals showing high reactivity on
this antigen;
[0066] FIG. 16C: sera collected from animals 50 days following
primary immunization were applied to human brain sections from
healthy individuals or from AD patients, post-immune sera from
KLH-TAUVAC-p7.1 group stained pathological tau structures, namely
neurofibrillary tangles, neuropil threads and neuritic plaques in
AD brain tissue, while sera from KLH-immunized mice did not show
any reactivity, and no staining was observed on control tissue;
[0067] FIG. 16D: when tested in the tau immunodepletion assay,
animals receiving KLH-TAUVAC-p7.1 had antibodies able to bind and
deplete tau seed (p=0.03 at day 50 using an ANOVA test followed by
Dunnett's adjustment for multiple comparisons), while immunization
with KLH did not trigger such antibodies;
[0068] FIG. 16E: pre- and post-immunization sera were also tested
in the neutralization assay as serially diluted individual samples;
changes from baseline (CFB) were calculated as difference between
FRET counts for readings at day -14 prior to vaccination (baseline)
and post vaccination days 50, 106 and 190 respectively. Response at
a specific post vaccination day (dayi) was then computed as
follows: Response=% FRET_day.sub.i-% FRET_baseline; a general
linear mixed model on aforementioned responses, with animal as
random effect, was applied with variables vaccine groups, day and
serum levels treated as categorical variables and all their
interactions;
[0069] FIGS. 17A and 17B show that mice immunized with a conjugate
vaccine (Conjugate A) according to an embodiment of the invention
and a combination with alum hydroxide (alum) and oligo CpG (CpG)
adjuvant results in higher titer antibody responses to the vaccine
peptide: adult female C57BL/6 mice (n=5-6 per group) were immunized
intramuscularly with either 2 ug or 0.2 ug of the Conjugate A
vaccine, and the conjugate vaccine was either administered alone,
with alum, with CpG, or with alum and CpG combined; all mice
received a primary immunization on day 0 of the study followed by a
single booster immunization on day 28; doses for the alum adjuvant
was 500 ug per mouse per injection, and doses for the CpG adjuvant
was 20 ug/mouse per injection; the graphs show the results of
binding ELISA using serum collected from immunized mice with
vaccine peptide T3.5 as the coating antigen, with T3.5 specific
mean endpoint titers per group plotted, before immunization (day 0)
and at two time points after immunization (day 28 and 42), and with
error bars representing standard error; the tables show the
statistical analysis of the results, in which antibody titers were
compared using the non-parametric Kruskal-Wallis Test, and pairwise
group comparisons were assessed using the Wilcoxon Signed Rank test
as post-hoc to the Kruskal Wallis test; in particular:
[0070] FIG. 17A: mice were immunized with 2 ug of the Conjugate A
vaccine; and
[0071] FIG. 17B: mice were immunized with 0.2 ug of the Conjugate A
vaccine; and
[0072] FIG. 18 shows that tau vaccines according to embodiments of
the invention with different ratios of Tau peptide to T-cell
epitope induce sustained high titer anti-phosphorylated tau
antibodies in Rhesus macaques.
DETAILED DESCRIPTION OF THE INVENTION
[0073] Various publications, articles and patents are cited or
described in the background and throughout the specification; each
of these references is herein incorporated by reference in its
entirety. Discussion of documents, acts, materials, devices,
articles or the like which has been included in the present
specification is for the purpose of providing context for the
invention. Such discussion is not an admission that any or all of
these matters form part of the prior art with respect to any
inventions disclosed or claimed.
[0074] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood to one of
ordinary skill in the art to which this invention pertains.
Otherwise, certain terms used herein have the meanings as set forth
in the specification.
[0075] It must be noted that as used herein and in the appended
claims, the singular forms "a," "an," and "the" include plural
reference unless the context clearly dictates otherwise.
[0076] Unless otherwise stated, any numerical values, such as a
concentration or a concentration range described herein, are to be
understood as being modified in all instances by the term "about."
Thus, a numerical value typically includes .+-.10% of the recited
value. For example, a concentration of 1 mg/mL includes 0.9 mg/mL
to 1.1 mg/mL. Likewise, a concentration range of 1% to 10% (w/v)
includes 0.9% (w/v) to 11% (w/v). As used herein, the use of a
numerical range expressly includes all possible subranges, all
individual numerical values within that range, including integers
within such ranges and fractions of the values unless the context
clearly indicates otherwise.
[0077] Unless otherwise indicated, the term "at least" preceding a
series of elements is to be understood to refer to every element in
the series. Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the invention described
herein. Such equivalents are intended to be encompassed by the
invention.
[0078] As used herein, the terms "comprises," "comprising,"
"includes," "including," "has," "having," "contains" or
"containing," or any other variation thereof, will be understood to
imply the inclusion of a stated integer or group of integers but
not the exclusion of any other integer or group of integers and are
intended to be non-exclusive or open-ended. For example, a
composition, a mixture, a process, a method, an article, or an
apparatus that comprises a list of elements is not necessarily
limited to only those elements but can include other elements not
expressly listed or inherent to such composition, mixture, process,
method, article, or apparatus. Further, unless expressly stated to
the contrary, "or" refers to an inclusive or and not to an
exclusive or. For example, a condition A or B is satisfied by any
one of the following: A is true (or present) and B is false (or not
present), A is false (or not present) and B is true (or present),
and both A and B are true (or present).
[0079] It should also be understood that the terms "about,"
"approximately," "generally," "substantially" and like terms, used
herein when referring to a dimension or characteristic of a
component of the preferred invention, indicate that the described
dimension/characteristic is not a strict boundary or parameter and
does not exclude minor variations therefrom that are functionally
the same or similar, as would be understood by one having ordinary
skill in the art. At a minimum, such references that include a
numerical parameter would include variations that, using
mathematical and industrial principles accepted in the art (e.g.,
rounding, measurement or other systematic errors, manufacturing
tolerances, etc.), would not vary the least significant digit.
[0080] As used herein, the term "tau" or "tau protein", also known
as microtubule-associated protein tau, MAPT, neurofibrillary tangle
protein, paired helical filament-tau, PHF-tau, MAPTL, MTBT1, refers
to an abundant central and peripheral nervous system protein having
multiple isoforms. In the human central nervous system (CNS), six
major tau isoforms ranging in size from 352 to 441 amino acids in
length exist due to alternative splicing (Hanger et al., Trends Mol
Med. 15:112-9, 2009). Examples of tau include, but are not limited
to, tau isoforms in the CNS, such as the 441-amino acid longest tau
isoform (4R2N) that has four repeats and two inserts and the
352-amino acid long shortest (fetal) isoform (3RON) that has three
repeats and no inserts. Examples of tau also include the "big tau"
isoform expressed in peripheral nerves that contains 300 additional
residues (exon 4a). Friedhoff et al., Biochimica et Biophysica Acta
1502 (2000) 122-132. Examples of tau include a human big tau that
is a 758 amino acid-long protein encoded by an mRNA transcript 6762
nucleotides long (NM_016835.4), or isoforms thereof. The amino acid
sequence of the exemplified human big tau is represented in GenBank
Accession No. NP_058519.3. As used herein, the term "tau" includes
homologs of tau from species other than human, such as Macaca
Fascicularis (cynomolgous monkey) or Pan troglodytes (chimpanzee).
As used herein, the term "tau" includes proteins comprising
mutations, e.g., point mutations, fragments, insertions, deletions
and splice variants of full length wild type tau. The term "tau"
also encompasses post-translational modifications of the tau amino
acid sequence. Post-translational modifications include, but are
not limited to, phosphorylation.
[0081] As used herein, the term "peptide" or "polypeptide" refers
to a polymer composed of amino acid residues, related naturally
occurring structural variants, and synthetic non-naturally
occurring analogs thereof linked via peptide bonds. The term refers
to a peptide of any size, structure, or function. Typically, a
peptide is at least three amino acids long. A peptide can be
naturally occurring, recombinant, or synthetic, or any combination
thereof. Synthetic peptides can be synthesized, for example, using
an automated polypeptide synthesizer. Examples of tau peptides
include any peptide of tau protein of about 5 to about 30 amino
acids in length, preferably of about 10 to about 25 amino acids in
length, more preferably of about 16 to about 21 amino acids in
length. In the present disclosure, peptides are listed from N to C
terminus using the standard three or one letter amino acid
abbreviation, wherein phosphoresidues are indicated with "p".
Examples of tau peptides useful in the invention include, but are
not limited to, tau peptides comprising the amino acid sequence of
any of SEQ ID NOs: 1-12, or tau peptides having an amino acid
sequence that is at least 75%, 80%, 85%, 90% or 95% identical to
the amino acid sequence of any of SEQ ID NOs: 1-12.
[0082] As used herein, the term "phosphopeptide" or
"phospho-epitope" refers to a peptide that is phosphorylated at one
or more amino acid residues. Examples of tau phosphopeptides
include any tau peptide comprising one or more phosphorylated amino
acid residue. Examples of tau phosphopeptides useful in the
invention include, but are not limited to, tau phosphopeptides
comprising the amino acid sequence of any of SEQ ID NOs: 1-3 or
5-12, or tau phosphopeptides having an amino acid sequence that is
at least 75%, 80%, 85%, 90% or 95% identical to the amino acid
sequence of any of SEQ ID NOs: 1-3 or 5-12.
[0083] The tau peptides of the present invention can be synthesized
by solid phase peptide synthesis or by recombinant expression
systems. Automatic peptide synthesizers are commercially available
from numerous suppliers, such as Applied Biosystems (Foster City,
Calif.). Recombinant expression systems can include bacteria, such
as E. coli, yeast, insect cells, or mammalian cells. Procedures for
recombinant expression are described by Sambrook et al., Molecular
Cloning: A Laboratory Manual (C.S.H.P. Press, NY 2d ed., 1989).
[0084] Tau is a human "self" protein. This means that, in
principle, all lymphocytes bearing a receptor specific for tau
should have been deleted during development (central tolerance) or
rendered unresponsive by a peripheral tolerance mechanism. This
problem has proved to be a significant roadblock to the development
of vaccines against self or "altered self" proteins (e.g. tumor
antigens).
[0085] Generating high-quality antibodies against an antigen (self
or infectious) requires the action of not only B lymphocytes, which
produce the antibody, but also of CD4+ T "helper" lymphocytes. CD4+
T-cells provide critical survival and maturation signals to B
lymphocytes, and CD4+ T-cell deficient animals are profoundly
immunosuppressed. CD4+ T-cells are also subject to tolerance
mechanisms, and an additional roadblock to generating strong
anti-self (e.g., anti-tau) antibody responses is that tau-reactive
CD4+ T-cells are also likely to be rare to non-existent in the
human/animal repertoire.
[0086] While not wishing to be bound by theory, it is believed, but
in no way limiting the scope of the present invention, that this
problem is circumvented by vaccine compositions of the present
invention.
[0087] In one embodiment, a liposome comprising a tau peptide (one
example is shown in FIG. 1; top) is produced that also comprises a
T-cell epitope that is capable of binding most or all HLA DR (Human
Leukocyte Antigen--antigen D Related) molecules. The T-cell epitope
is then able to activate CD4+ T-cells and provides essential
maturation and survival signals to the tau-specific B-cells (FIG.
2). In another embodiment, a conjugate of a tau peptide with a
carrier protein is produced (one example is shown in FIG. 1;
bottom), which generates a strong helper T-cell response (FIG. 3).
In this embodiment "non-linked recognition" is used, in which
carrier-specific T-cells provide survival and maturation signals to
self-reactive B-cells. Accordingly, the tau-specific B-cells
receive crucial signals to trigger affinity maturation,
immunoglobulin class switching, and to establish a long-term memory
pool. The tau liposomes and tau conjugates can be used to generate
high-quality antibodies against the tau antigen in homologous or
heterologous immunization schemes, with either liposome or
conjugate used in the prime and/or in the boost.
[0088] Liposomes
[0089] In one general aspect, the invention relates to a liposome,
comprising:
[0090] a. a tau peptide, preferably the tau peptide is a tau
phosphopeptide; and
[0091] b. a helper T-cell epitope,
[0092] wherein the tau peptide is presented on the surface of the
liposome.
[0093] Liposomes according to embodiments of the invention are also
referred to herein as "improved liposomes," "improved liposomal
vaccines" or "liposomal vaccines according to embodiments of the
invention" or "Tau liposomes" or "optimized liposomal vaccines" of
"2.sup.nd generation liposomes".
[0094] As used herein, the term "liposome" refers generally to a
lipid vesicle that is made of materials having high lipid content,
e.g., phospholipids, cholesterol. The lipids of these vesicles are
generally organized in the form of lipid bilayers. The lipid
bilayers generally encapsulate a volume which is either
interspersed between multiple onion-like shells of lipid bilayers,
forming multilamellar lipid vesicles (MLVs) or contained within an
amorphous central cavity. Lipid vesicles having an amorphous
central cavity are unilamellar lipid vesicles, i.e., those with a
single peripheral bilayer surrounding the cavity. Large unilamellar
vesicles (LUVs) generally have a diameter of 100 nm to few
micrometer, such as 100-200 nm or larger, while small unilamellar
lipid vesicles (SUV) generally have a diameter of less than 100 nm,
such as 20-100 nm, typically 15-30 mm.
[0095] According to particular embodiments, the liposome comprises
one or more tau peptides. According to particular embodiments, the
tau peptides in the liposome can be the same or different.
[0096] Any suitable tau peptide known to those skilled in the art
can be used in the invention in view of the present disclosure.
According to particular embodiments, one or more of the tau
peptides comprise the amino acid sequence of one of SEQ ID NOs:
1-12. In other embodiments, one or more of the tau peptides
comprise an amino acid sequence that is at least 75%, 80%, 85%, 90%
or 95% identical to the amino acid sequence of one of SEQ ID NOs:
1-12, wherein none of the amino acid residues are phosphorylated,
or one or more amino acid residues are phosphorylated.
[0097] According to particular embodiments, one or more of the tau
peptides is a tau phosphopeptide. According to particular
embodiments, the one or more tau phosphopeptides comprise the amino
acid sequence of one of SEQ ID NOs: 1-3 or 5-12, or an amino acid
sequence that is at least 75%, 80%, 85%, 90% or 95% identical to
the amino acid sequence of one of SEQ ID NOs: 1-3 or 5-12, wherein
one or more of the indicated amino acid residues are
phosphorylated. Preferably, the tau phosphopeptide comprises the
amino acid sequence of one of SEQ ID Nos: 1-3. The tau peptide can
have the C-terminus amidated.
[0098] According to embodiments of the application, a tau peptide
is presented on the surface of the liposome. A tau peptide,
preferably a tau phosphopeptide, can be presented on the surface of
the liposome using methods known in the art in view of the present
disclosure. See, for example, the relevant disclosure in U.S. Pat.
Nos. 8,647,631 and 9,687,447, the content of which is incorporated
herein by reference. According to particular embodiments, the one
or more tau peptides, including phosphopeptides, further comprise
one or more modifications, such as palmitoylation or dodecyl
modification to allow the tau peptides to be presented on the
surface of the liposome. Additional amino acid residues, such as
Lys, Cys, or sometimes Ser or Thr, can be added to the tau peptide
to facilitate the modification. It was reported that the position
of lipid anchors induces different conformations of the peptide
sequence (Hickman et al., J. Biol. Chem. vol. 286, NO. 16, pp.
13966-13976, Apr. 22, 2011). While not wishing to be bound by
theory, it is believed that adding hydrophobic moieties at both
termini may increase the pathological beta-sheet conformation of
the tau peptide. Thus, the one or more tau peptides further
comprise hydrophobic moieties at both termini. The modified tau
peptide can have the C-terminus amidated. Preferably, a tau peptide
presented on the surface of the liposome consists of the amino acid
sequence of one of SEQ ID NO:27 to SEQ ID NO:38.
[0099] As used herein, the term "helper T-cell epitope" refers to a
polypeptide comprising an epitope that is capable of recognition by
a helper T-cell. Examples of helper T-cell epitopes include, but
are not limited to, tetanus toxoid (e.g., the P2 and P30 epitopes,
also named, respectively as T2 and T30), Hepatitis B surface
antigen, cholera toxin B, toxoid, diphtheria toxoid, measles virus
F protein, Chlamydia trachomatis major outer membrane protein,
Plasmodium falciparum circumsporozite T, P. falciparum CS antigen,
Schistosoma mansoni triose phosphate isomerase, Bordetella
pertussis, Clostridium tetani, Pertusaria trachythallina,
Escherichia coli TraT, and Influenza virus hemagglutinin (HA).
[0100] Any suitable helper T-cell epitope known to those skilled in
the art can be used in the invention in view of the present
disclosure. According to particular embodiments, the helper T-cell
epitope comprises at least one amino acid sequence selected from
the group consisting of SEQ ID NO:23 to SEQ ID NO:26. Preferably,
the helper T-cell epitope comprises two or more of the amino acid
sequences of SEQ ID NO:23 to SEQ ID NO:26 fused together via a
linker, such as a peptide linker comprising one or more amino
acids, e.g., Val (V), Ala (A), Arg (R), Gly (G), Ser (S), Lys (K).
The length of the linker can vary, preferably 1-5 amino acids.
Preferably, the helper T-cell epitope comprises three or more of
the amino acid sequences of SEQ ID NO:23 to SEQ ID NO:26 fused
together via one or more linkers selected from the group consisting
of VVR, GS, RR, RK. The helper T-cell epitope can have its
C-terminus amidated.
[0101] According to embodiments of the application, the helper
T-cell epitopes can be incorporated on the liposomal surface, e.g.
anchored by a covalently bound hydrophobic moiety wherein said
hydrophobic moiety is an alkyl group, a fatty acid, a triglyceride,
diglyceride, steroid, sphingolipid, glycolipid or a phospholipid,
particularly an alkyl group or a fatty acid, particularly with a
carbon backbone of at least 3 carbon atoms, particularly of at
least 4 carbon atoms, particularly of at least 6 carbon atoms,
particularly of at least 8 carbon atoms, particularly of at least
12 carbon atoms, particularly of at least 16 carbon atoms. In one
embodiment of the invention, the hydrophobic moiety is palmitic
acid. Alternatively, the helper T-cell epitopes can be encapsulated
in the liposomes. According to particular embodiments, the helper
T-cell epitope is encapsulated in the liposome.
[0102] The helper T-cell epitope can be modified for its desired
location in the liposomes using methods known in the art in view of
the present disclosure. According to particular embodiments, the
helper T-cell epitope useful for the invention comprises an amino
acid sequence of one of SEQ ID NO:39 to SEQ ID NO:44. Preferably,
the helper T cell epitope consists of an amino acid sequence
selected from the group consisting of SEQ ID NO:13 to SEQ ID
NO:17.
[0103] According to particular embodiments, the liposome comprises
a tau peptide and a helper T-cell epitope ata weight ratio of 1:1,
2:1, 3:1, 4:1, 5:1 or 6:1.
[0104] In an embodiment, the liposome further comprises at least
one adjuvant comprising a toll-like receptor ligand. Thus, in
another general aspect, the invention relates to a liposome,
comprising:
[0105] a. a tau peptide, preferably a tau phosphopeptide;
[0106] b. a helper T-cell epitope; and
[0107] c. at least one of [0108] i. a toll-like receptor 9 ligand,
and [0109] ii. a toll-like receptor 4 ligand.
[0110] As used herein, the term "toll-like receptor" or "TLR"
refers to a class of pattern recognition receptor (PRR) proteins
that play a key role in the innate immune response. TLRs recognize
pathogen-associated molecular patterns (PAMPs) from microbial
pathogens, such as bacteria, fungi, parasites and viruses, which
can be distinguished from host molecules. TLRs are
membrane-spanning proteins that typically function as dimers and
are expressed by cells involved in the innate immune response,
including antigen-presenting dendritic cells and phagocytic
macrophages. There are at least ten human TLR family members, TLR1
to TLR10, and at least twelve murine TLR family members, TLR1 to
TLR9 and TLR11 to TLR13, and they differ in the types of antigens
they recognize. For example, TLR4 recognizes lipopolysaccharides
(LPS), a component present in many Gram-negative bacteria, as well
as viral proteins, polysaccharide, and endogenous proteins such as
low-density lipoprotein, beta-defensins and heat shock protein; and
TLR9 is a nucleotide-sensing TLR which is activated by unmethylated
cytosine-phosphate-guanine (CpG) single-stranded or double-stranded
dinucleotides, which are abundant in prokaryotic genomes but rare
in vertebrate genomes. Activation of TLRs leads to a series of
signaling events resulting in the production of type I interferons
(IFNs), inflammatory cytokines, and chemokines, and the induction
of immune responses. Eventually, this inflammation also activates
the adaptive immune system, which then results in the clearance of
the invading pathogens and the infected cells.
[0111] As used herein, the term "ligand" refers to a molecule that
forms a complex with a biomolecule (e.g., a receptor) to serve a
biological purpose. According to particular embodiments, the
toll-like receptor ligand is a toll-like receptor agonist.
[0112] As used herein, the term "agonist" refers to a molecule that
binds to one or more TLRs and induces a receptor mediated response.
For example, an agonist can induce, stimulate, increase, activate,
facilitate, enhance, or up regulate the activity of the receptor.
Such activities are referred to as "agonistic activities." For
example, a TLR4 or TLR9 agonist can activate or increase cell
signaling through the bound receptor. Agonists include, but are not
limited to nucleic acids, small molecules, proteins, carbohydrates,
lipids or any other molecules that bind or interact with receptors.
Agonists can mimic the activity of a natural receptor ligand.
Agonists can be homologous to these natural receptor ligands with
respect to sequence, conformation, charge or other characteristics
such that they can be recognized by the receptors. This recognition
can result in physiologic and/or biochemical changes within the
cell, such that the cell reacts to the presence of the agonist in
the same manner as if the natural receptor ligand were present.
According to particular embodiments, the toll-like receptor agonist
is at least one of a toll-like receptor 4 agonist and a toll-like
receptor 9 agonist.
[0113] As used herein, the term "toll-like receptor 4 agonist"
refers to any compound that acts as an agonist of TLR4. Any
suitable toll-like receptor 4 agonist known to those skilled in the
art in view of the present disclosure can be used in the invention.
Examples of toll-like receptor 4 ligand useful for the invention
include TLR4 agonist, including, but not limited to, monophosphoryl
lipid A (MPLA). As used herein, the term "monophosphoryl lipid A"
or MPLA'' refers to a modified form of lipid A, which is the
biologically active part of Gram-negative bacterial
lipopolysaccharide (LPS) endotoxin. MPLA is less toxic than LPS
while maintaining the immunostimulatory activity. As a vaccine
adjuvant, MPLA stimulates both cellular and humoral responses to
the vaccine antigen. Examples of MPLA include, but are not limited
to, 3-O-desacyl-4'-monophosphoryl lipid A, monophosphoryl hexa-acyl
lipid A, 3-deacyl, monophosphoryl 3-deacyl lipid A, and
structurally related variants thereof. MPLA useful for the
invention can be obtained using methods known in the art, or from a
commercial source, such as 3D-(6-acyl) PHAD.RTM., PHAD.RTM.,
PHAD.RTM.-504, 3D-PHAD.RTM. from Avanti Polar Lipids (Alabaster,
Ala., USA) or MPLTM from various commercial sources. According to
particular embodiments, the toll-like receptor 4 agonist is
MPLA.
[0114] As used herein, the term "toll-like receptor 9 agonist"
refers to any compound that acts as an agonist of TLR9. Any
suitable toll-like receptor 9 agonist known to those skilled in the
art in view of the present disclosure can be used in the invention.
Examples of toll-like receptor 9 ligand useful for the invention
include TLR9 agonist including, but not limited to, CpG
oligonucleotides.
[0115] As used herein, the term "CpG oligonucleotide", "CpG
oligodeoxynucleotide" or "CpG ODN" refers to an oligonucleotide
comprising at least one CpG motif. As used herein,
"oligonucleotide," "oligodeoxynucleotide" or "ODN" refers to a
polynucleotide formed from a plurality of linked nucleotide units.
Such oligonucleotides can be obtained from existing nucleic acid
sources or can be produced by synthetic methods. As used herein,
the term "CpG motif" refers to a nucleotide sequence which contains
unmethylated cytosine-phosphate-guanine (CpG) dinucleotides (i.e.,
a cytosine (C) followed by a guanine (G)) linked by a phosphate
bond or a phosphodiester backbone or other internucleotide
linkages.
[0116] According to particular embodiments, the CpG oligonucleotide
is lipidated, i.e. conjugated (covalently linked) to a lipid
moiety.
[0117] As used herein, a "lipid moiety" refers to a moiety
containing a lipophilic structure. Lipid moieties, such as an alkyl
group, a fatty acid, a triglyceride, diglyceride, steroid,
sphingolipid, glycolipid or a phospholipid, particularly a sterol
such as cholesterol, or fatty acids, when attached to highly
hydrophilic molecules, such as nucleic acids, can substantially
enhance plasma protein binding and consequently circulation
half-life of the hydrophilic molecules. In addition, binding to
certain plasma proteins, such as lipoproteins, has been shown to
increase uptake in specific tissues expressing the corresponding
lipoprotein receptors (e.g., LDL-receptor HDL-receptor or the
scavenger receptor SR-B1). In particular, a lipid moiety conjugated
to the phosphopeptides and/or CpG oligonucleotide allows anchoring
the said peptides and/or oligonucleotides into the membrane of a
liposome via a hydrophobic moiety.
[0118] According to particular embodiments, in view of the present
disclosure, the CpG oligonucleotide can comprise any suitable
internucleotide linkages.
[0119] As used herein, the term "internucleotide linkage" refers to
a chemical linkage to join two nucleotides through their sugars
consisting of a phosphorous atom and a charged or neutral group
between adjacent nucleosides. Examples of internucleotide linkage
include phosphodiester (po), phosphorothioate (ps),
phosphorodithioate (ps2), methylphosphonate (mp), and
methylphosphorothioate (rp). Phosphorothioate, phosphorodithioate,
methylphosphonate and methylphosphorothioate are stabilizing
internucleotide linkages, while phosphodiester is a
naturally-occurring internucleotide linkage. Oligonucleotide
phosphorothioates are typically synthesized as a random racemic
mixture of Rp and Sp phosphorothioate linkages.
[0120] Any suitable CpG oligonucleotide known to those skilled in
the art can be used in the invention in view of the present
disclosure. Examples of such CpG oligonucleotides include, but are
not limited to CpG2006 (also known as CpG 7909), CpG 1018, CpG2395,
CpG2216 or CpG2336.
[0121] A CpG oligonucleotide can be lipidated using methods known
in the art in view of the present disclosure. In some embodiments,
3' terminus of a CpG oligonucleotide is covalently linked to a
cholesterol molecule through a phosphate bond, optionally via a PEG
linker. Other lipophilic moiety can also be covalently linked to
the 3' terminus of a CpG oligonucleotide. For example a CpG
oligonucleotide can be covalently linked to a lipid anchor of the
same length as the phospholipids from liposome: one palmitic acid
chain (using Pal-OH or similar, activated for coupling) or two
palmitic acids (e.g., using
1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-(succinyl) or
similar, activated for coupling), optionally via a PEG linker. See,
e.g., relevant disclosure in U.S. Pat. No. 7,741,297, the content
of which is incorporated herein by reference. The length of PEG can
vary, from example, from 1 to 5 PEG units.
[0122] Other linkers can also be used to covalently connect a CpG
oligonucleotide to a lipophilic moiety (such as a cholesterol
molecule), examples of which include, but are not limited to an
alkyl spacer having 3 to 12 carbons. A short linker compatible with
oligonucleotide chemistry is needed as aminodiol. In some
embodiment, no linker is used for the covalent bonding. See e.g.,
Ries et al., "Convenient synthesis and application of versatile
nucleic acid lipid membrane anchors in the assembly and fusion of
liposomes, Org. Biomol. Chem., 2015, 13, 9673, the relevant
disclosure of which is incorporated herein by reference.
[0123] According to particular embodiments, lipidated CpG
oligonucleotide useful for the invention comprises a nucleotide
sequence selected from the group consisting of SEQ ID NO:18 to SEQ
ID NO:22, wherein the nucleotide sequence comprises one or more
phosphorothioate internucleotide linkages, and the nucleotide
sequence is covalently linked to at least one cholesterol via a
linker. Any suitable linkers can be used to covalently link a CpG
oligonucleotide to a cholesterol molecule. Preferably, the linker
comprises polyethylene glycol (PEG).
[0124] According to particular embodiments, the liposome
comprises:
[0125] a. a tau phosphopeptide;
[0126] b. a helper T-cell epitope;
[0127] c. a lipidated CpG oligonucleotide; and
[0128] d. a toll-like receptor 4 ligand;
[0129] wherein the tau phosphopeptide is presented on the surface
of the liposome, and the helper T-cell epitope is encapsulated in
the liposome.
[0130] According to particular embodiments, the liposome comprises:
[0131] a. a tau peptide having an amino acid sequence selected from
the group consisting of SEQ ID NO:27 to SEQ ID NO:38; [0132] b. a
helper T cell epitope having an amino acid sequence selected from
the group consisting of SEQ ID NO:39 to SEQ ID NO:44, preferably,
the helper T cell epitope consisting of an amino acid sequence
selected from the group consisting of SEQ ID NO:13 to SEQ ID NO:17;
[0133] c. a lipidated CpG oligonucleotide having a nucleotide
sequence selected from the group consisting of SEQ ID NO:18 to SEQ
ID NO:22, wherein the CpG oligonucleotide comprises one or more
phosphorothioate internucleotide linkages, and the CpG
oligonucleotide is covalently linked to at least one cholesterol
via a linker; and [0134] d. monophosphoryl lipid A (MPLA).
[0135] According to particular embodiments, the liposome further
comprises one or more lipids selected from the group consisting of
1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC),
1,2-dimyristoyl-sn-glycero-3-phosphoryl-3'-rac-glycerol (DMPG), and
cholesterol.
[0136] According to particular embodiments, the liposome further
comprises a buffer. Any suitable buffer known to those skilled in
the art in view of the present disclosure can be used in the
invention. In one embodiment, the liposome comprises a
phosphate-buffered saline. According to particular embodiments, the
buffer comprises histidine and sucrose.
[0137] According to particular embodiments, the liposome comprises
DMPC, DMPG, cholesterol, tau phosphopeptide and helper T-cell
epitope at a molar ratio of 9:1:7:0.07:0.04.
[0138] Liposomes of the invention can be made using methods known
in the art in view of the present disclosure. 1001.061 An exemplary
liposome of the present application is illustrated in FIG. 1. More
specifically, a tau tetrapalmitoylated phosphopeptide (pTau Peptide
T3, SEQ ID NO: 28) is presented on the surface of the liposome via
two palmitic acids at each terminus of the tau peptide. A TLR-9
ligand comprising lipidated CpG (Adjuvant CpG7909-Chol) is
incorporated into the liposome membrane via the covalently linked
cholesterol. A TLR-4 ligand (Adjuvant 3D-(6-acyl) PHAD.RTM.) is
also incorporated into the membrane. A helper T-cell epitope
(PAN-DR binder T50) is encapsulated.
[0139] Conjugates
[0140] In one general aspect, the invention relates to a conjugate
comprising a tau peptide and an immunogenic carrier conjugated
thereto.
[0141] According to particular aspects, the conjugate has the
following structure:
##STR00003##
or the structure of formula (II):
##STR00004##
wherein
[0142] x is an integer of 0 to 10; and
[0143] n is an integer of 2 to 15, preferably 3-11.
[0144] According to particular embodiments, x is an integer of 1 to
10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4, or 2 to 3.
According to particular embodiments, x is 3.
[0145] According to particular embodiments, n is 2 to 15, 3 to 11,
3 to 9, 3 to 8, or 3 to 7.
[0146] According to particular embodiments, the conjugate comprises
one or more tau peptides. According to particular embodiments, the
tau peptides of the conjugate can be the same or different.
[0147] According to particular embodiments, in view of the present
disclosure, any suitable tau peptides can be used in the invention.
According to particular embodiments, one or more of the tau
peptides comprise the amino acid sequence of one of SEQ ID NOs:
1-12, or an amino acid sequence that is at least 75%, 80%, 85%, 90%
or 95% identical to the amino acid sequence of one of SEQ ID NOs:
1-12, wherein none, one or more of the amino acid residues are
phosphorylated.
[0148] According to particular embodiments, one or more of the tau
peptides is a tau phosphopeptide. According to particular
embodiments, the one or more tau phosphopeptides comprise the amino
acid sequence of one of SEQ ID NOs: 1-3 or 5-12, or an amino acid
sequence that is at least 75%, 80%, 85%, 90% or 95% identical to
the amino acid sequence of one of SEQ ID NOs: 1-3 or 5-12, wherein
one or more of the indicated amino acid residues are
phosphorylated.
[0149] According to particular embodiments, the tau phosphopeptide
consists of the amino acid sequence of one of SEQ ID NOs: 1-3.
[0150] As used herein, the term "immunogenic carrier" refers to an
immunogenic substance that can be coupled to a tau peptide. An
immunogenic moiety coupled to a tau peptide can induce an immune
response and elicit the production of antibodies that can
specifically bind the tau peptide. Immunogenic moieties are
operative moieties that include proteins, polypeptides,
glycoproteins, complex polysaccharides, particles, nucleic acids,
polynucleotides, and the like that are recognized as foreign and
thereby elicit an immunologic response from the host. Any suitable
immunogenic carrier known to those skilled in the art in view of
the present disclosure can be used in the invention. According to
particular embodiments, the immunogenic carrier is keyhole limpet
hemocyanin (KLH), tetanus toxoid, CRM197 (a non-toxic form of
diphtheria toxin), an outer membrane protein mixture from N.
meningitidis (OMP), or a derivative thereof. According to
particular embodiments, the immunogenic carrier is KLH or
CRM197.
[0151] According to particular embodiments, the tau peptide is
conjugated to the carrier via a linker. As used herein, the term
"linker" refers to a chemical moiety that joins a immunogenic
carrier to a tau peptide. Any suitable linker known to those
skilled in the art in view of the present disclosure can be used in
the invention. The linkers can be, for example, a single covalent
bond, a substituted or unsubstituted alkyl, a substituted or
unsubstituted heteroalkyl moiety, a polyethylene glycol (PEG)
linker, a peptide linker, a sugar-based linker, or a cleavable
linker, such as a disulfide linkage or a protease cleavage site, or
an amino acid, or a combination thereof. Examples of the linker can
comprises one or more of polyethylene glycol (PEG), succinimidyl
3-(bromoacetamido)propionate (SBAP),
m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), or one or more
amino acids such as Cys, Lys or sometimes Ser or Thr, or a
combination thereof.
[0152] According to particular embodiments, the linker comprises
(C2H4O)x-cysteine-acetamidopropionamide or
m-maleimidobenzoyl-N-hydroxysuccinimide ester--cysteine--(C2H4O)x,
wherein x is an integer of 0 to 10, such as 0, 1, 2, 3, 4, 5, 6, 7,
8, 9, or 10.
[0153] According to particular embodiments, the carrier is
covalently linked to the N-terminus of the tau peptide, via a
linker.
[0154] According to other particular embodiments, the carrier is
covalently linked to the C-terminus of the tau peptide, via a
linker.
[0155] According to particular embodiments, the conjugate has the
structure of:
##STR00005##
[0156] wherein n is an integer of 2 to 15, preferably 3-11, more
preferably 3-7.
[0157] Conjugates of the invention can be made by methods known in
the art in view of the present disclosure. For example, the above
conjugate can be formed by reacting
succinimidyl-3-(bromoacetamido)propionate (SBAP):
##STR00006##
with an amino group of CRM197 to form an amide linkage. This CRM197
precursor can be subsequently reacted with the tau peptide (e.g.,
the phosphorylated tau peptide of SEQ ID NO: 2) conjugated at its
N-terminus or at its C-terminus to a PEG-cysteine linker with a
free nucleophilic thiol group to form the tau phosphopeptide
conjugate.
[0158] An exemplary conjugate according to an embodiment of the
present application is illustrated in FIG. 1. More specifically,
multiple tau phosphopeptides (pTau Peptide T3.76) are covalently
linked to a carrier protein CRM197.
[0159] Pharmaceutical Compositions
[0160] In one general aspect, the invention relates to
pharmaceutical compositions comprising a therapeutically effective
amount of liposome or conjugate of the invention, together with a
pharmaceutically acceptable excipient and/or carrier.
Pharmaceutically acceptable excipients and/or carriers are well
known in the art (see Remington's Pharmaceutical Science (15th
ed.), Mack Publishing Company, Easton, Pa., 1980). The preferred
formulation of the pharmaceutical composition depends on the
intended mode of administration and therapeutic application. The
compositions can include pharmaceutically-acceptable, non-toxic
carriers or diluents, which are defined as vehicles commonly used
to formulate pharmaceutical compositions for animal or human
administration. The diluent is selected so as not to affect the
biological activity of the combination. Examples of such diluents
are distilled water, physiological phosphate-buffered saline,
Ringer's solutions, dextrose solution, and Hank's solution. In
addition, the pharmaceutical composition or formulation may also
include other carriers, adjuvants, or nontoxic, nontherapeutic,
non-immunogenic stabilizers, and the like. It will be understood
that the characteristics of the carrier, excipient or diluent will
depend on the route of administration for a particular
application.
[0161] The pharmaceutical composition can contain a mixture of the
same immunogenic tau peptide. Alternatively, the pharmaceutical
composition can contain a mixture of different immunogenic tau
peptides of the present invention.
[0162] Another problem associated with vaccines against neuronal
diseases is that exceptionally high antibody titers are likely to
be necessary to assure efficacy. This is because the target antigen
for the vaccine is located in the brain. The brain is separated
from the circulation by a specialized cellular structure called the
blood-brain barrier (BBB). The BBB restricts passage of substances
from the circulation into the brain. This prevents the entry of
toxins, microbes, etc. into the central nervous system. The BBB
also has the potentially less desirable effect of preventing the
efficient entry of immune mediators (such as antibodies) into the
interstitial and cerebrospinal fluid that surrounds the brain.
[0163] Approximately 0.1% of antibodies that are present in the
systemic circulation cross the BBB and enter the brain. This means
that systemic titers induced by a vaccine targeting a CNS antigen
must be at least 1000 times greater than the minimal effective
titer to be efficacious in the brain.
[0164] According to particular embodiments, the pharmaceutical
compositions of the present invention therefore further comprise
one or more suitable adjuvants. Thus, the tau peptides of the
present invention, present in the liposome or the conjugate, can be
administered in combination with a suitable adjuvant to achieve the
desired immune response in the subject. Suitable adjuvants can be
administered before, after, or concurrent with administration of
liposome or conjugate of the present invention. Preferred adjuvants
augment the intrinsic response to an immunogen without causing
conformational changes in the immunogen that affect the qualitative
form of the response. Examples of adjuvants are the aluminum salts
(alum), such as aluminum hydroxide, aluminum phosphate, and
aluminum sulfate. Such adjuvants can be used with or without other
specific immunostimulating agents, such as MPLA Class (3
De-O-acylated monophosphoryl lipid A (MPLTM), monophosphoryl
hexa-acyl Lipid A 3-deacyl synthetic (3D-(6-acyl) PHAD.RTM.),
PHADTM, PHAD.RTM.-504, 3D-PHAD.RTM.) lipid A), polymeric or
monomeric amino acids, such as polyglutamic acid or polylysine.
Such adjuvants can be used with or without other specific
immunostimulating agents, such as muramyl peptides (e.g.,
N-acetylmuramyl-L-threonyl-D-isoglutamine (thr-MDP),
N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP),
N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'dipalmitoyl-sn-
-glycero-3-hydroxyphosphoryloxy)-ethylamine (MTP-PE),
N-acetylglucsaminyl-N-acetylmuramyl-L-Al-D-isoglu-L-Ala-dipalmitoxy
propylamide (DTP-DPP) TheramideTM), or other bacterial cell wall
components. Oil-in-water emulsions include MF59 (see WO 90/14837),
containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally
containing various amounts of MTP-PE) formulated into submicron
particles using a microfluidizer; SAF, containing 10% Squalene,
0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP,
either microfluidized into a submicron emulsion or vortexed to
generate a larger particle size emulsion; and the RibiTM adjuvant
system (RAS) (Ribi ImmunoChem, Hamilton, Mont.) 0.2% Tween 80, and
one or more bacterial cell wall components selected from the group
consisting of monophosphoryl lipid A (MPLTM), trehalose dimycolate
(TDM), and cell wall skeleton (CWS), preferably 1MPLTM+CWS
(DetoxTM). Other adjuvants include Complete Freund's Adjuvant
(CFA), and cytokines, such as interleukins (IL-1, IL-2, and IL-12),
macrophage colony stimulating factor (M-CSF), and tumor necrosis
factor (TNF).
[0165] As used herein, the term "in combination," in the context of
the administration of two or more therapies to a subject, refers to
the use of more than one therapy. The use of the term "in
combination" does not restrict the order in which therapies are
administered to a subject. For example, a first therapy (e.g., a
composition described herein) can be administered prior to (e.g., 5
minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4
hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours,
96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8
weeks, or 12 weeks before), concomitantly with, or subsequent to
(e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2
hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72
hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6
weeks, 8 weeks, or 12 weeks after) the administration of a second
therapy to a subject.
[0166] Pharmaceutical compositions of the present invention can be
formulated according to methods well known in the art. The optimal
ratios of each component in the compositions can be determined by
techniques well known to those skilled in the art in view of the
present disclosure.
[0167] Methods of Use
[0168] Another general aspect of the invention relates to methods
for inducing an immune response against tau protein in a subject
suffering from a neurodegenerative disease, disorder, or condition,
comprising administering to the subject a pharmaceutical
composition according to an embodiment of the invention. According
to particular aspects, the immune response is induced against
phosphorylated tau protein, preferably ePHF.
[0169] Another general aspect of the invention relates to methods
for treating or preventing a neurodegenerative disease, disorder,
or condition, comprising administering to the subject a
pharmaceutical composition according to an embodiment of the
invention.
[0170] As used herein, the terms "induce" and "stimulate" and
variations thereof refer to any measurable increase in cellular
activity. Induction of an immune response can include, for example,
activation, proliferation, or maturation of a population of immune
cells, increasing the production of a cytokine, and/or another
indicator of increased immune function. In certain embodiments,
induction of an immune response can include increasing the
proliferation of B cells, producing antigen-specific antibodies,
increasing the proliferation of antigen-specific T cells, improving
dendritic cell antigen presentation and/or an increasing expression
of certain cytokines, chemokines and co-stimulatory markers.
[0171] The ability to induce or stimulate an anti-tau immune
response upon administration in an animal or human organism can be
evaluated either in vitro or in vivo using a variety of assays
which are standard in the art. For a general description of
techniques available to evaluate the onset and activation of an
immune response, see for example Coligan et al. (1992 and 1994,
Current Protocols in Immunology; ed. J Wiley & Sons Inc,
National Institute of Health). Measurement of cellular immunity can
be performed by methods readily known in the art, e.g., by
measurement of cytokine profiles secreted by activated effector
cells including those derived from CD4+ and CD8+ T-cells (e.g.
quantification of IL-4 or IFN gamma-producing cells by ELISPOT), by
determination of the activation status of immune effector cells
(e.g. T-cell proliferation assays by a classical [3H] thymidine
uptake), by assaying for antigen-specific T lymphocytes in a
sensitized subject (e.g. peptide-specific lysis in a cytotoxicity
assay, etc.).
[0172] The ability to stimulate a cellular and/or a humoral
response can be determined by testing a biological sample (e.g.,
blood, plasma, serum, PBMCs, urine, saliva, feces, CSF or lymph
fluid) from the subject for the presence of antibodies directed to
the immunogenic tau peptide(s) administered in the pharmaceutical
composition (see for example Harlow, 1989, Antibodies, Cold Spring
Harbor Press). For example, titers of antibodies produced in
response to administration of a composition providing an immunogen
can be measured by enzyme-linked immunosorbent assay (ELISA), dot
blots, SDS-PAGE gels, ELISPOT or Antibody-Dependent Cellular
Phagocytosis (ADCP) Assay.
[0173] As used herein, the term "subject" refers to an animal.
According to particular embodiments, the subject is a mammal
including a non-primate (e.g., a camel, donkey, zebra, cow, pig,
horse, goat, sheep, cat, dog, rat, rabbit, guinea pig or mouse) or
a primate (e.g., a monkey, chimpanzee or human). According to
particular embodiments, the subject is a human.
[0174] As used herein, the term "therapeutically effective amount"
refers to an amount of an active ingredient or component that
elicits the desired biological or medicinal response in a subject.
A therapeutically effective amount can be determined empirically
and in a routine manner, in relation to the stated purpose. For
example, in vitro assays can optionally be employed to help
identify optimal dosage ranges. Selection of a particular effective
dose can be determined (e.g., via clinical trials) by those skilled
in the art based upon the consideration of several factors,
including the disease to be treated or prevented, the symptoms
involved, the patient's body mass, the patient's immune status and
other factors known by the skilled artisan. The precise dose to be
employed in the formulation will also depend on the route of
administration, and the severity of disease, and should be decided
according to the judgment of the practitioner and each patient's
circumstances. Effective doses can be extrapolated from
dose-response curves derived from in vitro or animal model test
systems.
[0175] As used herein, the terms "treat", "treating", and
"treatment" are all intended to refer to an amelioration or
reversal of at least one measurable physical parameter related to a
neurodegenerative disease, disorder, or condition, which is not
necessarily discernible in the subject, but can be discernible in
the subject. The terms "treat", "treating", and "treatment" can
also refer to causing regression, preventing the progression, or at
least slowing down the progression of the disease, disorder, or
condition. In a particular embodiment, "treat", "treating", and
"treatment" refer to an alleviation, prevention of the development
or onset, or reduction in the duration of one or more symptoms
associated with the neurodegenerative disease, disorder, or
condition. In a particular embodiment, "treat", "treating", and
"treatment" refer to prevention of the recurrence of the disease,
disorder, or condition. In a particular embodiment, "treat",
"treating", and "treatment" refer to an increase in the survival of
a subject having the disease, disorder, or condition. In a
particular embodiment, "treat", "treating", and "treatment" refer
to elimination of the disease, disorder, or condition in the
subject.
[0176] According to particular embodiments, a therapeutically
effective amount refers to the amount of therapy which is
sufficient to achieve one, two, three, four, or more of the
following effects: (i) reduce or ameliorate the severity of the
disease, disorder or condition to be treated or a symptom
associated therewith; (ii) reduce the duration of the disease,
disorder or condition to be treated, or a symptom associated
therewith; (iii) prevent the progression of the disease, disorder
or condition to be treated, or a symptom associated therewith; (iv)
cause regression of the disease, disorder or condition to be
treated, or a symptom associated therewith; (v) prevent the
development or onset of the disease, disorder or condition to be
treated, or a symptom associated therewith; (vi) prevent the
recurrence of the disease, disorder or condition to be treated, or
a symptom associated therewith; (vii) reduce hospitalization of a
subject having the disease, disorder or condition to be treated, or
a symptom associated therewith; (viii) reduce hospitalization
length of a subject having the disease, disorder or condition to be
treated, or a symptom associated therewith; (ix) increase the
survival of a subject with the disease, disorder or condition to be
treated, or a symptom associated therewith; (x) inhibit or reduce
the disease, disorder or condition to be treated, or a symptom
associated therewith in a subject; and/or (xi) enhance or improve
the prophylactic or therapeutic effect(s) of another therapy.
[0177] As used herein a "neurodegenerative disease, disorder, or
condition" includes any neurodegenerative disease, disorder, or
condition known to those skilled in the art in view of the present
disclosure. Examples of neurodegenerative diseases, disorders, or
conditions include neurodegenerative diseases or disorders caused
by or associated with the formation of neurofibrillary lesions,
such as tau-associated diseases, disorders or conditions, referred
to as tauopathies. According to particular embodiments, the
neurodegenerative disease, disorder, or condition includes any of
the diseases or disorders which show co-existence of tau and
amyloid pathologies including, but not is limited to, Alzheimer's
Disease, Parkinson's Disease, Creutzfeldt-Jacob disease, Dementia
pugilistica, Down's Syndrome, Gerstmann-Straussler-Scheinker
disease, inclusion body myositis, prion protein cerebral amyloid
angiopathy, traumatic brain injury, amyotrophic lateral sclerosis,
parkinsonism-dementia complex of Guam, Non-Guamanian motor neuron
disease with neurofibrillary tangles, argyrophilic grain dementia,
corticobasal degeneration, Dementia Lewy Amyotrophic Lateral
sclerosis, diffuse neurofibrillary tangles with calcification,
frontotemporal dementia, preferably frontotemporal dementia with
parkinsonism linked to chromosome 17 (FTDP-17), frontotemporal
lobar dementia, Hallevorden-Spatz disease, multiple system atrophy,
Niemann-Pick disease type C, Pick's disease, progressive
subcortical gliosis, progressive supranuclear palsy, Subacute
sclerosing panencephalitis, Tangle only dementia, Postencephalitic
Parkinsonism, Myotonic dystrophy, chronic traumatic encephalopathy
(CTE), Primary age-related tauopathy (PART), or Lewy body dementia
(LBD). According to particular embodiments, the neurodegenerative
disease, disorder, or condition is Alzheimer's disease or another
tauopathy.
[0178] The present invention also provides a method for promoting
clearance of tau aggregates from the brain of a subject, said
method comprising administering to the subject a pharmaceutical
composition according to an embodiment of the invention, under
conditions effective to promote clearance of the tau aggregates
from the brain of the subject. According to particular embodiments,
the tau aggregates are neurofibrillary tangles or their
pathological tau precursors.
[0179] The present invention also provides a method for slowing
progression of a tau-pathology related behavioral phenotype in a
subject, said method comprising administering to the subject a
pharmaceutical composition according to an embodiment of the
invention, under conditions effective to slow the progression of
the tau-pathology related behavioral phenotype in the subject.
[0180] In a preferred embodiment of the present invention,
administration of a tau peptide, via administration of a
pharmaceutical composition according to an embodiment of the
invention, induces an active immune response in the subject to the
tau peptide and to the pathological form of tau, thereby
facilitating the clearance of related tau aggregates, slowing the
progression of tau-pathology related behavior and/or treating the
underlying tauopathy. In accordance with this aspect of the present
invention, an immune response involves the development of a
beneficial humoral (antibody mediated) response directed against
the tau peptide and a cellular (mediated by antigen-specific T
cells or their secretion products) response directed against the
T-cell epitope or the immunogenic carrier.
[0181] As used herein, a tau-pathology related behavioral phenotype
includes, without limitation, cognitive impairments, early
personality change and disinhibition, apathy, abulia, mutism,
apraxia, perseveration, stereotyped movements/behaviors,
hyperorality, disorganization, inability to plan or organize
sequential tasks, selfishness/callousness, antisocial traits, a
lack of empathy, halting, agrammatic speech with frequent
paraphasic errors but relatively preserved comprehension, impaired
comprehension and word-finding deficits, slowly progressive gait
instability, retropulsions, freezing, frequent falls, non-levodopa
responsive axial rigidity, supranuclear gaze palsy, square wave
jerks, slow vertical saccades, pseudobulbar palsy, limb apraxia,
dystonia, cortical sensory loss, and tremor.
[0182] In carrying out the methods of the present invention, it is
preferable to select a subject having or at risk of having
Alzheimer's disease or other tauopathy, a subject having tau
aggregates in the brain, or a subject exhibiting a tangle related
behavioral phenotype prior to administering the immunogenic
peptides or antibodies of the present invention. Subjects amenable
to treatment include individuals at risk of disease but not showing
symptoms, as well as patients presently showing symptoms. In the
case of Alzheimer's disease, virtually anyone is at risk of
suffering from Alzheimer's disease. Therefore, the present methods
can be administered prophylactically to the general population
without the need for any assessment of the risk of the subject
patient. The present methods are especially useful for individuals
who have a known genetic risk of Alzheimer's disease. Such
individuals include those having relatives who have experienced the
disease, and those whose risk is determined by analysis of genetic
or biochemical markers.
[0183] In asymptomatic patients, treatment can begin at any age
(e.g., 10, 20, 30 years of age). Usually, however, it is not
necessary to begin treatment until a patient reaches 40, 50, 60, or
70 years of age. Treatment typically entails multiple dosages over
a period of time. Treatment can be monitored by assaying antibody,
or activated T-cell or B-cell responses to the therapeutic agent
over time. If the response decreases, a booster dosage is
indicated.
[0184] In prophylactic applications, pharmaceutical compositions
containing the tau peptides are administered to a patient
susceptible to, or otherwise at risk of, Alzheimer's disease or
other tauopathy in an amount sufficient to eliminate or reduce the
risk, lessen the severity, or delay the outset of the disease,
including biochemical, histologic and/or behavioral symptoms of the
disease, its complications and intermediate pathological phenotypes
presented during development of the disease. In therapeutic
applications, pharmaceutical compositions containing a tau peptide
are administered to a patient suspected of, or already suffering
from, such a disease in an amount sufficient to cure, or at least
partially arrest, the symptoms of the disease (biochemical,
histologic and/or behavioral), including its complications and
intermediate pathological phenotypes in development of the
disease.
[0185] Effective doses of a pharmaceutical composition of the
invention, for the prevention and/or treatment of the
neurodegenerative disease, disorder, or condition vary depending
upon many different factors, including mode of administration,
target site, physiological state of the patient, other medications
administered, and whether treatment is prophylactic or therapeutic.
The amount of peptides depends on whether adjuvant is also
administered, with higher dosages being required in the absence of
adjuvant. The timing of injections can vary significantly from once
a day, to once a year, to once a decade. A typical regimen consists
of an immunization followed by booster injections at time
intervals, such as 6 week intervals. Another regimen consists of an
immunization followed by booster injections 1, 2, 6, 9 and 12
months later. Another regimen entails an injection every two months
for life. Alternatively, booster injections can be on an irregular
basis as indicated by monitoring of immune response.
[0186] It is readily appreciated by those skilled in the art that
the regimen for the priming and boosting administrations can be
adjusted based on the measured immune responses after the
administrations. For example, the boosting compositions are
generally administered weeks or months after administration of the
priming composition, for example, about 2-3 weeks or 4 weeks, or 8
weeks, or 16 weeks, or 20 weeks, or 24 weeks, or 26 weeks, or 28
weeks, or 30 weeks or 32 weeks or 36 weeks or one to two years
after administration of the priming composition.
[0187] The peptides can be administered by parenteral, topical,
intravenous, oral, subcutaneous, intra-arterial, intracranial,
intraperitoneal, intradermal, intranasal, or intramuscular means
for prophylactic and/or therapeutic treatment. The most typical
route of administration of an immunogenic agent is subcutaneous or
intramuscular injection. This latter type of injection is most
typically performed in the arm or leg muscles.
[0188] According to particular aspects, one or more boosting
immunizations can be administered. The antigens in the respective
priming and boosting compositions, however many boosting
compositions are employed, need not be identical, but should share
antigenic determinants or be substantially similar to each
other.
[0189] The composition can, if desired, be presented in a kit, pack
or dispenser, which can contain one or more unit dosage forms
containing the active ingredient. The kit, for example, can
comprise metal or plastic foil, such as a blister pack. The kit,
pack, or dispenser can be accompanied by instructions for
administration.
[0190] According to particular embodiments, the kit comprises at
least one of a pharmaceutical composition comprising a liposome
according to an embodiment of the invention and a pharmaceutical
composition comprising a conjugate according to an embodiment of
the invention.
EMBODIMENTS
[0191] The invention provides also the following non-limiting
embodiments.
[0192] Embodiment 1 is a liposome, comprising:
[0193] a. a tau peptide; and
[0194] b. a helper T cell epitope;
[0195] wherein the tau peptide is presented on the surface of the
liposome.
[0196] Embodiment 2 is the liposome of Embodiment 1, wherein the
tau peptide is a tau phosphopeptide.
[0197] Embodiment 3 is the liposome of Embodiment 1 or 2, further
comprising a toll-like receptor ligand.
[0198] Embodiment 4 is the liposome of Embodiment 3, wherein the
toll-like receptor ligand comprises at least one of a toll-like
receptor 4 ligand and toll-like receptor 9 ligand.
[0199] Embodiment 5 is the liposome of Embodiment 3 or 4, wherein
the toll-like receptor ligand is a toll-like receptor 4 ligand.
100.1621 Embodiment 6 is the liposome of Embodiment 5, wherein the
toll-like receptor 4 ligand comprises monophosphoryl lipid A
(MPLA).
[0200] Embodiment 7 is the liposome of Embodiment 3 or 4, wherein
the toll-like receptor ligand is a toll-like receptor 9 ligand.
[0201] Embodiment 8 is the liposome of Embodiment 7, wherein the
toll-like receptor 9 ligand comprises a lipidated CpG
oligonucleotide.
[0202] Embodiment 9 is the liposome of Embodiment 1,
comprising:
[0203] a. a tau peptide;
[0204] b. a helper T cell epitope; and
[0205] c. at least one of [0206] i. a toll-like receptor 9 ligand,
and [0207] ii. a toll-like receptor 4 ligand.
[0208] Embodiment 10 is the liposome of Embodiment 9, wherein the
tau peptide is a tau phosphopeptide.
[0209] Embodiment 11 is the liposome of Embodiment 9 or 10, wherein
the toll-like receptor 9 ligand is a lipidated CpG
oligonucleotide.
[0210] Embodiment 12 is the liposome of any of Embodiments 9 to 11,
wherein the liposome comprises the toll-like receptor 4 ligand and
toll-like receptor 9 ligand.
[0211] Embodiment 13 is the liposome of Embodiment 12, wherein the
toll-like receptor 4 ligand comprises monophosphoryl lipid A
(MPLA).
[0212] Embodiment 14 is a liposome, comprising:
[0213] a. a tau phosphopeptide;
[0214] b. a helper T-cell epitope;
[0215] c. a lipidated CpG oligonucleotide; and
[0216] d. an adjuvant containing a toll-like receptor 4 ligand;
[0217] wherein the tau phosphopeptide is presented on the surface
of the liposome.
[0218] Embodiment 15 is the liposome of Embodiment 14, wherein the
toll-like receptor 4 ligand comprises monophosphoryl lipid A
(MPLA).
[0219] Embodiment 16 is the liposome of any of Embodiments 1 to 15,
wherein the helper T cell epitope is encapsulated in the
liposome.
[0220] Embodiment 16a is the liposome of any of Embodiments 1 to
15, wherein the helper T cell epitope is incorporated in the
membrane of the liposome.
[0221] Embodiment 16b is the liposome of any of Embodiments 1 to
15, wherein the helper T cell epitope is presented on the surface
of the liposome.
[0222] Embodiment 17 is a liposome composition, comprising:
[0223] a. a tau phosphopeptide;
[0224] b. a helper T cell epitope;
[0225] c. a lipidated CpG oligonucleotide; and
[0226] d. a monophosphoryl lipid A (MPLA);
[0227] wherein the tau phosphopeptide is presented on the surface
of the liposome, and
[0228] the T-cell epitope is encapsulated in the liposome.
[0229] Embodiment 17a is the liposome of Embodiment 17, wherein the
MPLA is 3-O-desacyl-4'-monophosphoryl lipid A, preferably
MPLTM.
[0230] Embodiment 17b is the liposome of Embodiment 17, wherein the
MPLA is monophosphoryl hexa-acyl lipid A, 3-deacyl, preferably
3D-(6-acyl) PHAD.RTM..
[0231] Embodiment 17c is the liposome of Embodiment 17, wherein the
MPLA is monophosphoryl 3-deacyl lipid A, preferably
3D-PHAD.RTM..
[0232] Embodiment 18 is the liposome of any of Embodiments 1 to
17c, further comprising one or more lipids selected from the group
consisting of 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC),
1,2-dimyristoyl-sn-glycero-3-phosphoryl-3'-rac-glycerol (DMPG), and
cholesterol.
[0233] Embodiment 19 is the liposome of any of Embodiments 1 to 18,
wherein the tau peptide has an amino acid sequence selected from
the group consisting of SEQ ID NO:1 to SEQ ID NO:12, or at least
85%, 90% or 95% identical to an amino acid sequence selected from
the group consisting of SEQ ID NO:1 to SEQ ID NO:12.
[0234] Embodiment 19-1 is the liposome of Embodiment 19, wherein
the tau peptide is a phosphopeptide comprising an amino acid
sequence selected from the group consisting of SEQ ID NOs: 1-3 and
5-12.
[0235] Embodiment 19-2 is the liposome of Embodiment 19-1, wherein
the tau phosphopeptide comprises the amino acid sequence of SEQ ID
NO:1.
[0236] Embodiment 19-3 is the liposome of Embodiment 19-1, wherein
the tau phosphopeptide comprises the amino acid sequence of SEQ ID
NO:2.
[0237] Embodiment 19-4 is the liposome of Embodiment 19-1, wherein
the tau phosphopeptide comprises the amino acid sequence of SEQ ID
NO:3.
[0238] Embodiment 19a is the liposome of any one of Embodiments 19,
19-1, 19-2, 19-3 and 19-4, wherein the amino acid sequence further
comprises one or more modifications to allow the tau peptide to be
presented on the surface of the liposome.
[0239] Embodiment 19b is the liposome of Embodiment 19a, wherein
the one or more modifications comprise at least one of
palmitoylation and dodecyl modification.
[0240] Embodiment 19c is the liposome of Embodiment 19a or 19b,
wherein the tau peptide is modified at its N-terminus by the one or
more modifications.
[0241] Embodiment 19d is the liposome of any of Embodiments 19a to
19c, wherein the tau peptide is modified at its C-terminus by the
one or more modifications.
[0242] Embodiment 19e is the liposome of Embodiment 19d, wherein
the tau peptide is palmitoylated at both of its N-terminus and
C-terminus.
[0243] Embodiment 19f is the liposome of any of Embodiments
19a-19e, wherein the tau peptide further comprises one or more
additional amino acids to facilitate the one or more
modifications.
[0244] Embodiment 19g is the liposome of Embodiment 19f, wherein
the one or more additional amino acids are selected from the group
consisting of Lys, Cys, Ser and Thr.
[0245] Embodiment 19h is the liposome of any of Embodiments 19 to
19g, wherein the tau peptide is amidated at its C-terminus.
[0246] Embodiment 19i is the liposome of any of Embodiments 19 to
19h, wherein the tau peptide consists of an amino acid sequence
selected from the group consisting of SEQ ID NO:27 to SEQ ID
NO:38.
[0247] Embodiment 19j is the liposome of any of Embodiments 19-19i,
wherein the tau peptide consists of the amino acid sequence of SEQ
ID NO:27.
[0248] Embodiment 19k is the liposome of any of Embodiments 19-19i,
wherein the tau peptide consists of the amino acid sequence of SEQ
ID NO:28.
[0249] Embodiment 19l is the liposome of any of Embodiments 19-19i,
wherein the tau peptide consists of the amino acid sequence of SEQ
ID NO:29.
[0250] Embodiment 20 is the liposome of any of Embodiments 1 to
19l, wherein the helper T cell epitope comprises at least one amino
acid sequence selected from the group consisting of: SEQ ID NO:23
to SEQ ID NO:26.
[0251] Embodiment 20a is the liposome of Embodiment 20, wherein
helper T cell epitope comprises at least two amino acid sequences
selected from the group consisting of: SEQ ID NO:23 to SEQ ID
NO:26.
[0252] Embodiment 20b is the liposome of Embodiment 20, wherein
helper T cell epitope comprises at least three amino acid sequences
selected from the group consisting of: SEQ ID NO:23 to SEQ ID
NO:26.
[0253] Embodiment 20c is the liposome of Embodiment 20, wherein
helper T cell epitope comprises the four amino acid sequences of:
SEQ ID NO:23 to SEQ ID NO:26.
[0254] Embodiment 20d is the liposome of any of Embodiments 20a to
20c, wherein the two or more amino acid sequences selected from the
group consisting of SEQ ID NO:23 to SEQ ID NO:26 are covalently
linked by a linker.
[0255] Embodiment 20e is the liposome of Embodiment 20d, wherein
the linker comprises one or more amino acids selected from the
group consisting of Val (V), Ala (A), Arg (R), Gly (G), Ser (S),
Lys (K).
[0256] Embodiment 20f is the liposome of Embodiment 20e, wherein
the linker comprises an amino acid sequence selected from the group
consisting of VVR, GS, RR and RK.
[0257] Embodiment 20g is the liposome of any of Embodiments 20 to
20f, wherein the helper T cell epitope is amidated at its
C-terminus.
[0258] Embodiment 20h is the liposome of any of Embodiments 20 to
20g, wherein the helper T cell epitope is modified for insertion
into the membrane of the liposome, presentation on the surface of
the liposome or encapsulation in the liposome, depending on the
intended location of the helper T cell epitope.
[0259] Embodiment 20i is the liposome of any of Embodiments 20 to
20h, wherein the helper T cell epitope consisting of an amino acid
sequence selected from the group consisting of SEQ ID NO:13 to SEQ
ID NO:17.
[0260] Embodiment 20j is the liposome of any of Embodiments 1 to
20i, wherein liposome comprises the tau peptide and the helper T
cell epitope at a weight ratio of 6:1.
[0261] Embodiment 20k is the liposome of any of Embodiments 1 to
20i, wherein liposome comprises the tau peptide and the helper T
cell epitope at a weight ratio of 5:1.
[0262] Embodiment 20l is the liposome of any of Embodiments 1 to
20i, wherein liposome comprises the tau peptide and the helper T
cell epitope at a weight ratio of 4:1.
[0263] Embodiment 20m is the liposome of any of Embodiments 1 to
20i, wherein liposome comprises the tau peptide and the helper T
cell epitope at a weight ratio of 3:1.
[0264] Embodiment 20n is the liposome of any of Embodiments 1 to
20i, wherein liposome comprises the tau peptide and the helper T
cell epitope at a weight ratio of 2:1.
[0265] Embodiment 20o is the liposome of any of Embodiments 1 to
20i, wherein liposome comprises the tau peptide and the helper T
cell epitope at a weight ratio of 1:1.
[0266] Embodiment 21 is the liposome of any of Embodiments 1 to
20o, wherein the lipidated CpG oligonucleotide comprises the
nucleotide sequence selected from the group consisting of SEQ ID
NO:18 to SEQ ID NO:22.
[0267] Embodiment 21a is the liposome of Embodiment 21, wherein the
CpG oligonucleotide has one or more phosphorothioate
internucleotide linkages.
[0268] Embodiment 21b is the liposome of Embodiment 21a, wherein
the CpG oligonucleotide has all phosphorothioate internucleotide
linkages.
[0269] Embodiment 21c is the liposome of any of Embodiments 21 to
21b, wherein lipidated CpG oligonucleotide comprises the CpG
oligonucleotide covalently linked to at least one lipophilic group
via a linker.
[0270] Embodiment 21d is the liposome of Embodiment 21c, wherein
the linker comprises (C2H4O)n, wherein n is an integer of 0 to
10.
[0271] Embodiment 21e is the liposome of Embodiment 21c, wherein
the linker comprises an alkyl spacer having 3 to 12 carbons.
[0272] Embodiment 21f is the liposome of any of Embodiments 21 to
21e, wherein the at least one lipophilic group is cholesterol.
[0273] Embodiment 21g is the liposome of any of Embodiments 21 to
21f, wherein the lipidated CpG oligonucleotide comprises the
nucleotide sequence of SEQ ID NO:18 or SEQ ID NO:19 covalently
linked to a cholesterol molecule via a linker comprising (C2H4O)n,
wherein n is an integer of 3 to 5.
[0274] Embodiment 22 is a liposome, comprising: [0275] a. a tau
peptide having an amino acid sequence selected from the group
consisting of SEQ ID NO:27 to SEQ ID NO:38; [0276] b. a helper T
cell epitope having an amino acid sequence selected from the group
consisting of SEQ ID NO:39 to SEQ ID NO:44, preferably, the helper
T cell epitope consisting of an amino acid sequence selected from
the group consisting of SEQ ID NO:13 to SEQ ID NO:17; [0277] c. a
lipidated CpG oligonucleotide having a nucleotide sequence selected
from the group consisting of SEQ ID NO:18 to SEQ ID NO:22, wherein
the CpG oligonucleotide comprises one or more phosphorothioate
internucleotide linkages, and the CpG oligonucleotide is covalently
linked to at least one cholesterol via a linker; and [0278] d.
monophosphoryl lipid A (MPLA).
[0279] Embodiment 22a is a liposome of Embodiment 22, comprising:
[0280] a. a tau phosphopeptide consisting of the amino acid
sequence of SEQ ID NO:27, SEQ ID NO:28 or SEQ ID NO:29; [0281] b. a
helper T cell epitope consisting of the amino acid sequence of SEQ
ID NO:13 [0282] c. a lipidated CpG oligonucleotide consisting of
the nucleotide sequence of SEQ ID NO: 18 or SEQ ID NO:19 covalently
linked to a cholesterol via a linker comprising (C2H4O)n, wherein n
is an integer of 3 to 7; and [0283] d. monophosphoryl lipid A
(MPLA).
[0284] Embodiment 22b is the liposome of Embodiment 22 or 22a,
wherein the MPLA is 3-O-desacyl-4'-monophosphoryl lipid A,
preferably MPLTM.
[0285] Embodiment 22c is the liposome of Embodiment 22 or 22a,
wherein the MPLA is monophosphoryl hexa-acyl lipid A, 3-deacyl,
preferably 3D-(6-acyl) PHAD.RTM..
[0286] Embodiment 22d is the liposome of Embodiment 22 or 22a,
wherein the MPLA is monophosphoryl 3-deacyl lipid A, preferably
3D-PHAD.RTM..
[0287] Embodiment 23 is the liposome of any one of Embodiments 22
to 22d, wherein the helper T cell epitope is encapsulated in the
liposome.
[0288] Embodiment 24 is a pharmaceutical composition comprising the
liposome of any of Embodiments 1 to 23 and a pharmaceutically
acceptable carrier.
[0289] Embodiment 25 is a conjugate comprising a tau phosphopeptide
and an immunogenic carrier conjugated thereto via a linker, having
the following structure:
##STR00007##
[0290] wherein x is an integer of 0 to 10; and
[0291] n is an integer of 2 to 15.
[0292] Embodiment 25a is a conjugate comprising a tau
phosphopeptide and an immunogenic carrier conjugated thereto via a
linker, having the structure of formula (II):
##STR00008##
[0293] wherein [0294] x is an integer of 0 to 10; and [0295] n is
an integer of 2 to 15.
[0296] Embodiment 26 is the conjugate of Embodiment 25 or 25a,
wherein x is an integer of 2 to 6.
[0297] Embodiment 27 is the conjugate of Embodiment 25 or 25a,
wherein x is 3.
[0298] Embodiment 28 is the conjugate of any of Embodiments 25 to
25a, wherein n is 3 to 7.
[0299] Embodiment 29 is the conjugate of any of Embodiments 25 to
28, wherein the carrier is an immunogenic carrier selected from the
group consisting of keyhole limpet hemocyanin (KLH), tetanus
toxoid, CRM197, and an outer membrane protein mixture from N.
meningitidis (OMP), or a derivative thereof.
[0300] Embodiment 30 is the conjugate of any of Embodiments 25 to
29, wherein the tau phosphopeptide consists of the amino acid
sequence selected from the group consisting of SEQ ID NO:1 to SEQ
ID NO:12.
[0301] Embodiment 30a is the conjugate of Embodiment 30, wherein
the tau phosphopeptide consists of the amino acid sequence of SEQ
ID NO:1, SEQ ID NO:2 or SEQ ID NO:3.
[0302] Embodiment 31 is the conjugate of any of Embodiments 25 to
30, wherein the carrier is CRM197.
[0303] Embodiment 32 is the conjugate of Embodiment 25, having the
structure of:
##STR00009##
[0304] wherein n is 3-7.
[0305] Embodiment 32a is the conjugate of Embodiment 25, wherein
the [0306] KLH-[m-maleimidobenzoyl-N-hydroxysuccinimide
ester--cysteine--(C.sub.2H.sub.4O)x-Tau peptide].sub.n
##STR00010##
[0307] wherein [0308] the Tau peptide consisting of SEQ ID NO:1 or
SEQ ID NO:3; [0309] x is an integer of 0 to 10; and [0310] n is an
integer of 2 to 15.
[0311] Embodiment 33 is a pharmaceutical composition comprising the
conjugate of any of Embodiments 25 to 32a and a pharmaceutically
acceptable carrier.
[0312] Embodiment 33a is the pharmaceutical composition of
embodiment 33, further comprising an adjuvant.
[0313] Embodiment 33b is the pharmaceutical composition of
embodiment 33a, wherein the adjuvant comprises at least one of a
TLR-4 ligand and a TLR-9 ligand.
[0314] Embodiment 34 is a method for inducing an immune response in
a subject suffering from a neurodegenerative disorder, comprising
administering to the subject at least one of the pharmaceutical
compositions of Embodiments 24 and 33 to 33b.
[0315] Embodiment 35 is the method of Embodiment 34, comprising
administering to the subject at least one of the pharmaceutical
compositions of Embodiments 24 and 33 to 33b for priming
immunization, and administering to the subject at least one of the
pharmaceutical compositions of Embodiments 24 and 33 to 33b for
boosting immunization.
[0316] Embodiment 36 is a method for treating or preventing a
neurodegenerative disease or disorder in a subject in need thereof,
comprising administering to the subject at least one of the
pharmaceutical compositions of Embodiment 24 or 33.
[0317] Embodiment 37 is the method of Embodiment 36, comprising
administering to the subject at least one of the pharmaceutical
compositions of Embodiments 24 and 33 to 33b for priming
immunization, and administering to the subject at least one of the
pharmaceutical compositions of Embodiments 24 and 33 to 33b for
boosting immunization.
[0318] Embodiment 38 is the method of any of Embodiments 34 to 37,
wherein the neurodegenerative disease or disorder is caused by or
associated with the formation of neurofibrillary lesions.
[0319] Embodiment 39 is the method of any of Embodiments 34 to 38,
wherein the neurodegenerative disease or disorder is Alzheimer's
Disease, Parkinson's Disease, Creutzfeldt-Jacob disease, Dementia
pugilistica, Down's Syndrome, Gerstmann-Straussler-Scheinker
disease, inclusion body myositis, prion protein cerebral amyloid
angiopathy, traumatic brain injury, amyotrophic lateral sclerosis,
parkinsonism-dementia complex of Guam, Non-Guamanian motor neuron
disease with neurofibrillary tangles, argyrophilic grain dementia,
corticobasal degeneration, Dementia Lewy Amyotrophic Lateral
sclerosis, diffuse neurofibrillary tangles with calcification,
frontotemporal dementia, preferably frontotemporal dementia with
parkinsonism linked to chromosome 17 (FTDP-17), frontotemporal
lobar dementia, Hallevorden-Spatz disease, multiple system atrophy,
Niemann-Pick disease type C, Pick's disease, progressive
subcortical gliosis, progressive supranuclear palsy, Subacute
sclerosing panencephalitis, Tangle only dementia, Postencephalitic
Parkinsonism, Myotonic dystrophy, chronic traumatic encephalopathy
(CTE), Primary age-related tauopathy (PART), or Lewy body dementia
(LBD).
[0320] Embodiment 40 is the method of any of Embodiments 34 to 39,
wherein the neurodegenerative disease or disorder is Alzheimer's
disease, Parkinson's Disease, Down's Syndrome, progressive
supranuclear palsy (PSP), frontotemporal dementia and parkinsonism
linked to chromosome 17 (FTDP-17), Pick's disease, Corticobasal
Degeneration, Dementia Lewy Amyotrophic Lateral sclerosis, Myotonic
disphasy, chronic traumatic encephalopathy (CTE), Cerebral
angiopahty, Primary age-related tauopathy (PART), or Lewy body
dementia (LBD).
[0321] Embodiment 40b is the method of any of Embodiments 34 to 39,
wherein the neurodegenerative disease or disorder is Alzheimer's
disease, progressive supranuclear palsy (PSP), frontotemporal
dementia and parkinsonism linked to chromosome 17 (FTDP-17), or
Pick's disease and PART (primary age-related tauopathy).
[0322] Embodiment 40c is the method of any of Embodiments 34 to 39,
wherein the neurodegenerative disease or disorder is Alzheimer's
disease, Parkinson's Disease, Down's Syndrome, frontotemporal
dementia and parkinsonism linked to chromosome 17 (FTDP-17),
Corticobasal Degeneration, Dementia Lewy Amyotrophic Lateral
sclerosis, Myotonic disphasy, chronic traumatic encephalopathy
(CTE), Cerebral angiopahty, Primary age-related tauopathy (PART),
or Lewy body dementia (LBD).
[0323] Embodiment 41 is a kit comprising at least one of the
pharmaceutical composition of Embodiment 24 and the pharmaceutical
composition of Embodiment 33, 33a or 33b.
[0324] Embodiment 42 is a helper T cell epitope consisting of an
amino acid sequence selected from the group consisting of SEQ ID
NO:13 to SEQ ID NO:17.
[0325] Embodiment 43 is a pharmaceutical composition comprising the
helper T cell epitope of Embodiment 42.
[0326] Embodiment 44 is a method of enhancing an immune response to
an antigen in a subject in need thereof, comprising administering
to the subject the antigen together with the pharmaceutical
composition of Embodiment 43.
EXAMPLES
[0327] The following examples of the invention are to further
illustrate the nature of the invention. It should be understood
that the following examples do not limit the invention and that the
scope of the invention is to be determined by the appended
claims.
[0328] The experimental methods used in the following examples,
unless otherwise indicated, are all ordinary methods. The reagents
used in the following embodiments, unless otherwise indicated, are
all purchased from ordinary reagent suppliers.
Example 1: Preparation of Liposomal Vaccines
[0329] Preparation of the Control Liposomal Vaccine (Ethanol
Injection Technique)
[0330] The control liposomal vaccine was produced by Ethanol (EtOH)
Injection technique followed by extrusion. First, DMPC (Lipoid
GmbH, Ludwigshafen, Germany), DMPG (Lipoid GmbH, Ludwigshafen,
Germany), cholesterol (Dishman, Netherlands) and MPLA (Avanti Polar
Lipids, AL, USA) were solubilized at a molar ratio of 9:1:7:0.05 in
a 20:1 (V/V) mixture of EtOH and tert-butanol (t-BuOH) at
60.degree. C. The lipid/ethanol solution was diluted in phosphate
buffer saline (PBS) pH 7.4 at 60.degree. C. to maintain 10% EtOH
concentration and resulting in the formation of multilamellar
liposome vesicles (MLVs). The MLVs were then submitted to 5
sequential passes of extrusion through three polycarbonate filters
(Whatman) with a pore size of 0.08 um in series using Emulsiflex-05
(Avestin, Canada). The resulting liposomes were diluted in PBS pH
7.4 and heated to 60.degree. C. to obtain a liposome solution prior
to tau peptide addition.
[0331] An acetate tetrapalmitoylated phosphorylated tau peptide of
SEQ ID NO: 2 (Bachem AG, Switzerland), herein referred to as the
active pharmaceutical ingredient (API), was dissolved in PBS at pH
11.4 with 2.0% octyl .beta.-D-glucopyranoside (Sigma-Aldrich, USA)
at a concentration of 1 mg/mL, and the peptide solution was
injected into the liposome solution at 60.degree. C. followed by
stirring for 30 minutes at 60.degree. C. Concentration was done
through ultrafiltration to a target final volume, and buffer
exchange was carried out 10 times with PBS pH 7.4 during
diafiltration. The resulting liposomes, with the API presented on
the surface of the liposomes, were then sterile filtered by passing
through two 0.2 um polycarbonate syringe filters in series, and the
final product was stored at 5.degree. C.
[0332] Preparation of the Liposome X, Y, Z and Z.sup.+ Vaccines
[0333] The Liposome X and Y vaccines were produced by thin-lipids
film technology followed by homogenization and extrusion.
[0334] The Liposome Z+ vaccines, with a final API concentration of
1200 ug/ml and final T50 concentration of 1200 ug/ml were produced
by Ethanol Injection technique followed by extrusion and the
liposome Z vaccines, with a final API concentration of 400 ug/ml
and final T50 concentration of 100 ug/ml, were produced by
thin-lipids film technology followed by homogenization and
extrusion.
[0335] The Liposome Z++ vaccine, with a final API concentration of
400 ug/ml and final T50 concentration of 400 ug/ml, was produced by
thin-lipids film technology followed by homogenization and
extrusion.
[0336] The Liposome Z+++ vaccine, with a final API concentration of
1200 ug/ml and final T50 concentration of 300 ug/ml, were produced
by Ethanol Injection technique followed by extrusion.
[0337] Preparation of Liposome X, Y, Z and Z++ Vaccines by Thin
Lipid Film Technique
[0338] The Liposome X, Y, Z and Z++ vaccines were produced by
thin-lipids film technology followed by homogenization and
extrusion. First, DMPC (Lipoid GmbH, Ludwigshafen, Germany), DMPG
(Lipoid GmbH, Ludwigshafen, Germany), cholesterol (Dishman,
Netherlands) and monophosphoryl hexa-acyl Lipid A 3-deacyl
synthetic (3D-(6-acyl) PHAD.RTM.) (Avanti Polar Lipids, AL, USA)
were solubilized at a molar ratio of 9:1:7:0.05 in EtOH at
60.degree. C., with the exception of Liposome Y, which did not
contain 3D-(6-acyl) PHAD.RTM.. Ethanol was evaporated under vacuum
rotavapor to obtain thin lipid film.
[0339] Lipid film was rehydrated with PBS pH 7.4, 5% DMSO (all
Sigma-Aldrich) containing 0.15 mg/mL T50 peptide (Peptides &
Elephants, Germany). The sample was gently stirred for 15 min and
was further vigorously vortexed to dissolve the thin lipid film.
Resulting multilamellar vesicles were subjected to 10 freeze-thaw
cycles (liquid N2 and waterbath at 37.degree. C.) and submitted to
homogenization followed by sequential extrusion through
polycarbonate membranes (Whatman, UK) with a pore size of 0.08 um.
Both the homogenization and extrusion steps were done in an
EmulsiFlex-05 (Avestin, Canada). Extruded liposomes with
encapsulated T50 peptide were concentrated by ultrafiltration, and
buffer was exchanged to PBS pH 7.4 by diafiltration. The resulting
liposomes were diluted in PBS pH 7.4 and heated to 60.degree. C. to
obtain a liposome solution prior to tau peptide and adjuvant
addition.
[0340] CpG2006-Cholesterol (CpG2006-Chol) (Microsynth, Switzerland)
is a DNA oligonucleotide with all internucleotide linkages as
thiophosphate that is modified at 5' terminus with a Cholesterol
molecule through a phosphate bond by means of a PEG spacer.
CpG2006-Cholesterol (CpG2006-Chol) (Microsynth, Switzerland) was
dissolved in PBS pH 7.4 at 1 mg/mL and injected into the liposome
solutions (with the exception of Liposome X, which does not contain
CpG2006-Chol) followed by incubation for 15 minutes before
insertion of the API.
[0341] The API (Bachem AG, Switzerland) was dissolved in PBS pH
11.4 with 2% Octyl B-D-glucopyranoside (Sigma-Aldrich, USA) at a
concentration of 1 mg/mL, and the peptide solution was injected
into the liposome solution at 60.degree. C. followed by stirring
for 30 min at 60.degree. C. Concentration was done through
ultrafiltration to obtain the target value (400 ug/ml API and 100
ug/ml T50 for liposome X, Y, Z; and 400 ug/ml API and 400 ug/ml T50
for Liposome Z++), and buffer exchange was carried out 10 times
with PBS pH 7.4 during diafiltration. The resulting liposomes with
the API presented on the surface of the liposomes were then sterile
filtered by passing through 0.2 um polycarbonate syringe filters,
and the final product was stored at 5.degree. C.
[0342] Preparation of Liposome O by Ethanol Injection Technique
[0343] The Liposome O vaccine was produced by Ethanol (EtOH)
Injection technique followed by extrusion. First, DMPC (Lipoid
GmbH, Ludwigshafen, Germany), DMPG (Lipoid GmbH, Ludwigshafen,
Germany), cholesterol (Dishman, Netherlands) and MPLA (Avanti Polar
Lipids, AL, USA) were solubilized at a molar ratio of 9:1:7:0.05 in
a 20:1 (V/V) mixture of EtOH and tert-butanol (t-BuOH) at
60.degree. C. The lipid/ethanol solution was diluted in phosphate
buffer saline (PBS) pH 7.4 at 60.degree. C. to maintain 10% EtOH
concentration and resulting in the formation of multilamellar
liposome vesicles (MLVs). The MLVs were then submitted to 5
sequential passes of extrusion through three polycarbonate filters
(Whatman) with a pore size of 0.08 um in series using Emulsiflex-C5
(Avestin, Canada). The resulting liposomes were diluted in PBS pH
7.4 and heated to 60.degree. C. to obtain a liposome solution prior
to tau peptide addition.
[0344] T46 peptide (Pepscan, the Netherlands) was dissolved in PBS
pH 7.4 at 1 mg/mL and injected into the liposome solutions followed
by incubation for 15 minutes before insertion of the API.
[0345] The API (Bachem, Switzerland) was dissolved in PBS pH 11.4
with 2% Octyl B-D-glucopyranoside (Sigma-Aldrich, USA) at a
concentration of 1 mg/mL, and the peptide solution was injected
into the liposome solution at 60.degree. C. followed by stirring
for 30 min at 60.degree. C. Concentration was done through
ultrafiltration to obtain the target value (400 ug/ml API and 100
ug/ml T46), and buffer exchange was carried out 10 times with PBS
pH 7.4 during diafiltration. The resulting liposomes with the API
presented on the surface of the liposomes were then sterile
filtered by passing through 0.2 um polycarbonate syringe filters,
and the final product was stored at 5.degree. C.
[0346] Preparation of Liposome Z.sup.+ and Liposome Z.sup.+++
Vaccines by Ethanol Injection
[0347] The Liposome Z.sup.+ and Liposome Z.sup.+++ vaccines were
produced using an ethanol injection based process. First, DMPC
(Lipoid GmbH, Ludwigshafen, Germany), DMPG (Lipoid GmbH,
Ludwigshafen, Germany), cholesterol (Dishman, Netherlands) and
3D-(6-acyl) PHAD.RTM. (Avanti Polar Lipids, AL, USA) were
solubilized at a molar ratio of approximately 9:1:7:0.04 in EtOH at
60.degree. C. T50 peptide (Bachem AG, Switzerland) was dissolved in
10 mM His/270 mM sucrose (pH 5.8-6.0). Then, the lipid ethanol
solution was injected into the solution containing T50 peptide and
gently stirred for 15 min, resulting in multilamellar vesicles
(MLVs). MLVs were submitted to homogenization (6 times for Liposome
Z.sup.+, and no homogenization for Liposome Z.sup.+++) followed by
sequential extrusion through polycarbonate membranes (Whatman, UK)
with a pore size of 0.08 um (5 passes for Liposome Z.sup.+, 3-5
times for Liposome Z.sup.+++). Both the homogenization and
extrusion steps were done in an EmulsiFlex-05 (Avestin, Canada) for
Liposome Z.sup.+. Extrusion of Liposome Z.sup.+++ was done using
LIPEX filter extruder. Extruded liposomes were concentrated by
ultrafiltration, and buffer was exchanged to 20 mM His/145 mM NaCL
pH 7.4 by diafiltration. The resulting liposomes with encapsulated
T50 peptide were diluted in 20 mM His/145 mM NaCL pH 7.4 and heated
to 60.degree. C. to obtain a liposome solution prior to the
additions of the API and the adjuvant.
[0348] CpG2006-Chol (Microsynth, Switzerland for Liposome Z+;
Avecia, USA for Liposome Z+++) was dissolved in 20 mM His/145 mM
NaCl pH 7.4 at 1 mg/mL and injected into the liposome solution
followed by incubation for 15 minutes before insertion of the
API.
[0349] The API (Bachem AG, Switzerland) was dissolved in carbonate
buffer pH 10.2 with 1% Octyl B-D-glucopyranoside (Sigma-Aldrich,
USA), at a concentration of 1 mg/mL, and the peptide solution was
injected into the liposome Z+ solution at 60.degree. C. followed by
stirring for 30 min at 60.degree. C. The peptide solution was mixed
into the liposome Z+ solution using T-Line Mixing at 60.degree. C.
followed by stirring for 30 min at 60.degree. C. Concentration was
done through ultrafiltration to obtain the target value (1200 ug/ml
API and 1200 ug/ml T50 for Liposome Z+; and 1200 ug/ml API and 300
ug/ml T50 for Liposome Z+++), and buffer exchange was carried out
10 times with 10 mM His/270 mM Sucrose pH 6.5 during diafiltration.
The resulting Z+ liposomes with the API presented on the surface of
the liposomes and the resulting Z+++ liposomes with the API
presented on the surface of the liposomes were then sterile
filtered by passing through 0.2 um polycarbonate syringe/capsule
filters, and the final product was stored at 5.degree. C.
[0350] Preparation of the Liposome L, M, & N Vaccines
[0351] The Liposome L, M, and N vaccines were produced by
thin-lipids film technology followed by homogenization and
extrusion. First, DMPC (Lipoid GmbH, Ludwigshafen, Germany), DMPG
(Lipoid GmbH, Ludwigshafen, Germany), cholesterol (Dishman,
Netherlands), and MPLA (Avanti Polar Lipids, AL, USA) were
solubilized at a molar ratio of 9:1:7:0.05 in EtOH at 60.degree. C.
Ethanol was evaporated under vacuum rotavapor in order to obtain
thin lipid film.
[0352] Lipid film was rehydrated with PBS pH 7.4, 5% DMSO (all
Sigma-Aldrich) containing either: [0353] 0.15 mg/mL T48 peptide
(Peptides&Elephants, Germany)--for Liposome M; or [0354] 0.13
mg/mL T50 peptide (Peptides&Elephants, Germany)--for Liposome
L; or [0355] 0.15 mg/mL T52 peptide (Peptides&Elephants,
Germany)--for Liposome N.
[0356] The sample was gently stirred for 15 min and was further
vigorously vortexed to dissolve the thin lipid film. Resulting
multilamellar vesicles were subjected to 10 freeze-thaw cycles
(liquid N2 and waterbath at 37.degree. C.) and submitted to
homogenization followed by sequential extrusion through
polycarbonate membranes (Whatman, UK) with a pore size of 0.08 um.
Both the homogenization and extrusion steps were done in an
EmulsiFlex-05 (Avestin, Canada). Extruded liposomes were
concentrated by ultrafiltration, and buffer was exchanged to PBS pH
7.4 by diafiltration. The resulting liposomes with encapsulated
T48, T50 or T52 peptide were diluted in PBS pH 7.4 and heated to
60.degree. C. to obtain a liposome solution prior to tau peptide
addition.
[0357] The API (Bachem AG, Switzerland) was dissolved in PBS pH
11.4 with 2% Octyl B-D-glucopyranoside (Sigma-Aldrich, USA) at a
concentration of 1 mg/mL and the peptide solution was injected into
the liposome solution at 60.degree. C. followed by stirring for 30
min at 60.degree. C. Concentration was done through ultrafiltration
to obtain a target value (400 ug/ml API and 100 ug/ml T48, T50 or
T52) and buffer exchange was carried out 10 times with PBS pH 7.4
during diafiltration. The resulting liposomes with the API
presented on the surface of the liposomes were then sterile
filtered by passing through 0.2 um polycarbonate syringe filters
and the final product was stored at 5.degree. C.
[0358] Preparation of the Liposome R, S and T Vaccines
[0359] The Liposome R, S and T vaccines were produced using an
ethanol injection based process followed by extrusion. First, DMPC
(Lipoid GmbH, Ludwigshafen, Germany), DMPG (Lipoid GmbH,
Ludwigshafen, Germany), cholesterol (Dishman, Netherlands) and
3D-(6-acyl) PHAD.RTM. (Avanti Polar Lipids, AL, USA) were
solubilized at a molar ratio of 9:1:7:0.04 in EtOH at 60.degree. C.
For Liposome R and T, the above lipid ethanol solution was mixed to
the 10 mM histidine pH 5.8 supplemented by 270 mM sucrose to reach
10% solvent (EtOH) and then incubated for 30 minutes at 60.degree.
C. For Liposome S, T50 peptide (Bachem AG, Switzerland) was
dissolved in 10 mM His/270 mM sucrose (pH 5.8-6.0). Lipid-buffer
mix related to Liposome R, S and T were gently stirred for 15 min,
resulting in multilamellar vesicles (MLVs). The resulting multi
lamellar vesicles were submitted to extrusion through polycarbonate
membranes (Whatman, UK) with a pore size of 0.08 um (5.times.) done
in an EmulsiFlex-05 high pressure system (Avestin, Canada).
[0360] Extruded liposomes were concentrated by ultrafiltration, and
buffer was exchanged to 20 mM His/145 mM NaCL pH 7.4 by
diafiltration. The resulting liposomes with encapsulated T50 for
Liposome S and the resulting Liposomes R and T were further diluted
in 20 mM His/145 mM NaCL pH 7.4 and heated to 60.degree. C. to
obtain a liposome solution prior to the additions of the API and
T57 for Liposome T.
[0361] For Liposome T, T57 was dissolved to 1 mg/mL in 1% Octyl
B-D-glucopyranoside (Sigma-Aldrich, USA) in deionized distilled
water and inserted in liposome followed by incubation for 15
minutes at 60.degree. C. before API insertion.
[0362] The API (Bachem AG, Switzerland) was dissolved in carbonate
buffer pH 10.2 with 1% Octyl B-D-glucopyranoside (Sigma-Aldrich,
USA), at a concentration of 1 mg/mL, and the peptide solution was
mixed into the liposome solution at 60.degree. C. followed by
stirring for 30 min at 60.degree. C. Concentration was done through
ultrafiltration to obtain the following target value: [0363] 1200
ug/ml API for Liposome R; [0364] 1200 ug/ml API and 300 ug/ml T50
for Liposome S; and [0365] 1200 ug/ml API and 300 ug/ml T57 for
Liposome T;
[0366] Buffer exchange was carried out 10 times with 10 mM His/270
mM Sucrose pH 6.5 during diafiltration. The resulting liposomes
with the API presented on the surface of the liposomes were then
sterile filtered by passing through 0.2 um polycarbonate syringe
filters, and the final product was stored at 5.degree. C.
Example 2: Preparation of Conjugate Vaccine
[0367] Peptides and Adjuvants
[0368] Sequences of two multi-phosphorylated peptide epitopes
(TAUVAC-p7.1 and TAUVAC-p22.1 which have three and two
phosphorylated amino acids, respectively) were refined by
optimizing the length such that they might better bind surface
immunoglobulin of B cells, and such that the sequences did not
contain epitopes predicted to bind human HLA class I A, B, and C
molecules with high affinity. The latter criterion was important to
avoid the induction of a cytotoxic CD8+ T cell response against tau
that could potentially cause significant neuronal damage. Using the
T cell epitope prediction tool of the Immune Epitope Database and
Analysis Resources, peptide TAUVAC-p7.1 showed no predicted
epitopes capable of binding to human HLA class I A, B, C and HLA
class II DQ and DR molecules with high affinity, while peptide
TAUVAC-p22.1 was predicted to contain epitopes binding to HLA class
II DQ and DR molecules with intermediate/high affinity (data not
shown).
[0369] Phosphorylated tau peptides (SEQ ID NO: 1, SEQ ID NO: 2, SEQ
ID NO: 3) used in this study were produced synthetically (Pepscan,
NL) with the phospho-residues added during synthesis. A conjugate
comprising phosphorylated tau peptide having the amino acid
sequence of SEQ ID NO: 1 or SEQ ID NO: 3 covalently linked to a KLH
carrier via a linker is herein referred to as Conjugate B or
Conjugate C, respectively. A conjugate comprising phosphorylated
tau peptide having the amino acid sequence of SEQ ID NO: 2
covalently linked to a CRM carrier via a linker is herein referred
to as Conjugate A.
[0370] To manufacture Conjugates B and C, vaccine peptides were
conjugated to the carrier protein KLH via a
m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS) linker and an
extra cysteine on the N-terminus of the peptide. The unbound
peptide was removed using a Sephadex G25 column before
concentrating the conjugate. Conjugates were mixed before injection
to either a potent multicomponent adjuvant (Sigma Adjuvant System,
Sigma-Aldrich) or a single component depot adjuvant (aluminum
hydroxide, Alhydrogel.RTM., Invivogen) following manufacturer's
instructions.
[0371] Vaccine peptides were conjugated to the carrier protein
CRM197 via a polyethylene glycol
(PEG)-cysteine-acetamidopropionamide linker. Phosphorylated tau
peptide having the amino acid sequence of SEQ ID NO: 2 was produced
synthetically (Polypeptide Laboratories SAS), with phospho-residues
and PEG3 spacer added during synthesis. Conjugate A was
manufactured by conjugating the carrier protein CRM197 via a
succinimidyl 3-(bromoacetamide) propionate (SBAP) linker to a
cysteine on the N-terminus of the peptide. SBAP was ligated to
CRM197 protein primary amines (--NH2) via NHS ester reaction
chemistry. The excess SBAP linker was removed using ultrafiltration
and diafiltration (UF/DF). The CRM197-SBAP intermediate was
conjugated to the phosphorylated tau peptide, and once the reaction
was completed, the conjugation reaction was terminated by adding
excess amount of L-cystine to quench the reaction. The crude
CRM197-peptide conjugated product was purified using a Capto Q
ImpRes (GE Healthcare) chromatography column and eluted using a
salt isocratic method. The purified CRM197-peptide product was then
formulated into 20 mM Tris, 250 mM Sucrose, pH 8.1 to a
concentration of 0.5 mg/mL using UF/DF. The CRM197-tau peptide Drug
Substance (DS) was generated by adding a 10% PS80 stock buffer to
reach a final concentration of 0.01% PS80. The solution was
thoroughly mixed prior to filtering.
Example 3: Vaccine Induced IgG Antibodies Specific to Tau
Phosphopeptide
[0372] All animal experiments were approved and performed in
accordance with local legislation on animal experiments. Rhesus
macaques (Macaca mulatta) were obtained from Kunming Biomed
International Ltd, China, Yunnan Yinmore Bio-Tech Co. LTD, China
and Yunnan Laboratory Primates Inc., China. Animals were two to
five years old at the start of immunization, and their minimum
weight was 2.5 kg. A detailed clinical examination was performed
prior to initiation of the treatment and weekly thereafter.
Moreover, macaques were observed twice per day, and clinical signs
were recorded.
[0373] Adult Rhesus macaques (n=3 males and 3 females per group)
were immunized subcutaneously with 1800 .mu.g of acetate
tetrapalmitoylated phosphorylated tau peptide of SEQ ID NO: 2 per
dose of the control liposomal vaccine (liposome with
tetrapalmitoylated phosphorylated tau peptide of SEQ ID NO: 2 and
MPLA) or a liposomal vaccine according to embodiment of the
application, e.g., Liposome Z (liposome with tetrapalmitoylated
phosphorylated tau peptide of SEQ ID NO: 2, 3D-(6-acyl) PHAD.RTM.,
lipidated CpG oligonucleotide CpG 2006 and T-cell peptide T50) or
15 .mu.g per dose of a conjugate vaccine according to an embodiment
of the invention (e.g., Conjugate A, phosphorylated tau peptide of
SEQ ID NO: 2 linked to CRM197) co-injected with alum and CpG
oligonucleotide CpG 2006 at days 1, 29 and 85. Bleedings were
performed before immunization and at days 8, 22, 36, 50, 64, 78,
92, 106, 120, 134 and 148, and the sera were isolated.
[0374] Specific IgG antibody titers were determined by ELISA, using
phosphorylated tau peptide of SEQ ID NO: 2 as the coating antigen.
Serum from individual immunized monkey was serially diluted in
assay buffer (PBS, 0.05% Tween20, 1% BSA) and applied to 96-well
plates that had been coated with the relevant peptide. After two
hour incubation, samples were removed and plates washed in PBST
(PBS, 0.05% Tween20). Antibodies were detected using an HRP
conjugated anti-monkey IgG (KPL), followed by ABTS substrate
(Roche). All samples were run in eight two-fold dilutions, with
positive and negative control samples included on each plate. The
data was expressed as geometric mean of end-point titers (last
serum dilution inducing a positive response) per group.
[0375] As shown in FIG. 4, both the Liposome Z vaccine and the
Conjugate A induced higher phosphopeptide-specific IgG titers, as
compared to the control liposomal vaccine.
Example 4: Vaccine Induced Antibodies Specific to Pathological Tau
Structures in Human Brain
[0376] All brain tissues were obtained from the Netherlands Brain
Bank (NBB) and were collected from donors following signature of an
informed consent for a brain autopsy and the use of the samples as
well as their clinical information for research purposes. Paraffin
sections from non-demented controls (healthy), Alzheimer's disease
(AD), frontal temporal dementia with tau pathology (FTD-tau),
Pick's disease, primary age-related tauopathy (PART) and
progressive supranuclear palsy (PSP) were used. Brain regions
included parietal cortex, middle frontal gyms, hippocampus or the
caudate nucleus.
[0377] In particular, formalin-fixed paraffin embedded sections
from parietal cortices of a control human subject (healthy) and a
human subject suffering from Alzheimer's disease (AD Braak V/VI)
were stained with post-immune macaque serum diluted 1:100 in normal
antibody diluent (Immunologic). The sections were then washed and
stained with a Goat anti-monkey-HRP (Abcam). The staining was
finally visualized using 3,3'-diaminobenzidine (DAB; Dako) which
deposits a brown specific stain in the presence of horse radish
peroxidase (HRP). Slides were counterstained with haematoxylin,
dehydrated and mounted with Quick D mounting medium (Klinipath).
Pictures were taken with a Leica DC500 microscope.
[0378] Results in FIG. 5 show that post-immune sera from Rhesus
macaques immunized with Liposome Z (liposome with
tetrapalmitoylated phosphorylated tau peptide of SEQ ID NO: 2,
3D-(6-acyl) PHAD.RTM., lipidated CpG oligonucleotide CpG 2006 and
T-cell peptide T50) stained pathological tau structures in human
brain sections. Serum was collected from Rhesus macaques at day 106
after the primary immunization with the improved liposomes. This
macaque received immunizations at month 0, 1, and 3 prior to serum
collection. The left (AD Braak V/VI) panel shows staining of
parietal cortex from a Braak Stage V donor. Arrows indicate
staining of tau tangles. The right (Healthy) panel shows staining
of parietal cortex from a Braak Stage 0 donor. Serum was applied to
sections at a 1:100 dilution, followed by goat anti-monkey antibody
at 1:100, and staining was visualized using a DAB developer.
[0379] Results in FIG. 6 show that serum from Rhesus macaques
immunized with Conjugate A which contains phosphorylated tau
peptide of SEQ ID NO: 2 plus soluble CpG and alum hydroxide binds
to pathological tau structures in human AD brain sections. Serum
was collected at day 106 after the primary immunization with the
CRM conjugate vaccine. These macaques received immunizations at
month 0, 1, and 3 prior to serum collection. The upper (AD) panels
show staining of parietal cortex, including tau tangles, from a
Braak Stage V donor. The lower (CTRL) panels show staining of
parietal cortex from a Braak Stage 0 donor. Serum was applied to
sections at a 1:100 dilution, followed by goat anti-monkey antibody
at 1:100, and staining was visualized using a DAB developer.
Example 5: Liposomal Vaccines with One or Two Adjuvants
[0380] Addition of two adjuvants in the improved liposomal vaccine
increases the level of tau phosphopeptide-specific IgG antibody
titers, as well as the consistency of antibody response between
individuals.
[0381] Adult Rhesus macaques (n=3 males and 3 females per group)
were immunized subcutaneously at days 1, 29, 85 and 169 with 1800
.mu.g of acetate tetrapalmitoylated phosphorylated tau peptide of
SEQ ID NO: 2 per dose of the control liposomal vaccine or the
improved liposomal vaccine with encapsulated T50 T-cell epitope,
containing either 3D-(6-acyl) PHAD.RTM. adjuvant alone (Liposome X,
FIG. 7A), lipidated CpG 2006 oligonucleotide adjuvant alone
(Liposome Y, FIG. 7B), or both 3D-(6-acyl) PHAD.RTM. and lipidated
CpG 2006 oligonucleotide adjuvants (Liposome Z, FIG. 7C). Bleedings
were performed before immunization and at days 8, 22, 36, 50, 64,
78, 92, 106, 120, 134, 148, 162, 176 and 190 and the sera were
isolated. Specific IgG antibody titers in the sera were determined
by ELISA, using phosphorylated tau peptide of SEQ ID NO: 2 as the
coating antigen and an anti-monkey IgG secondary antibody.
Resulting antibody levels are presented as end-point titers (last
serum dilution inducing a positive response) for each individual
monkey over time. Each immunization group is represented in one
panel (FIGS. 7A, 7B, and 7C). Geometric mean of end-point titers
per group .+-.95% confidence interval is presented in FIG. 7D. In
summary, FIGS. 7A, 7B, 7C, and 7D show that inclusion of two
adjuvants in the liposomal vaccine containing encapsulated T50
improved the level and consistency of antibody response to tau
phosphopeptide, resulting in less variability in antibody response
among individual monkeys. More specifically, as shown in FIG. 7D,
improved liposomal vaccines with phosphorylated tau peptide of SEQ
ID NO: 2, T50 T-cell epitope (Liposome X, Y and Z) and 1 or 2
adjuvants, induced higher titers against the tau phosphopeptide
than the control liposomal vaccine with no T-cell epitope. All
monkeys were responders when injected with each of the improved
liposomal vaccines, while 4 out of 6 animals were responders with
the control liposomal vaccine.
Example 6: Vaccines Induced Antibodies Specific to the Enriched
Paired Helical Filaments (ePHF)
[0382] Groups of Rhesus macaques (n=3 males and 3 females per
group) were immunized subcutaneously by vaccination at day 1 and
day 29 with (i) the improved liposomal vaccine containing the T50
T-cell epitope and 3D-(6-acyl) PHAD.RTM. adjuvant alone (Liposome
X), (ii) the improved liposomal vaccine containing the T50 T-cell
epitope and lipidated CpG 2006 adjuvant alone (Liposome Y), (iii)
the improved liposomal vaccine containing the T50 T-cell epitope
and two adjuvants (3D-(6-acyl) PHAD.RTM. and lipidated CpG2006,
Liposome Z), or (iv) the conjugate vaccine (phosphorylated tau
peptide of SEQ ID NO: 2 linked to CRM197) co-injected with alum and
CpG oligonucleotide CpG 2006 (Conjugate A).
[0383] Preparations of enriched paired helical filaments (ePHF)
were obtained from post-mortem brain tissues of histologically
confirmed AD subjects by sarcosyl extraction of insoluble tau,
using a modified method of Greenberg and Davies (Greenberg and
Davies, 1991, Proc Natl Acad Sci USA, 87(15):5827-31). Antibody
titers specific for enriched paired helical filaments (ePHF) were
evaluated using the Mesoscale Discovery (MSD) platform. MSD
streptavidin plates were coated with the biotinylated anti-tau
capturing antibody (HT7-biotin, ThermoScientific) before incubation
with ePHF isolated from Alzheimer's disease patients, while the IgG
antibodies specific for ePHF were further detected using a
SulfoTag-labelled anti-human IgG antibody that cross-reacts with
monkey IgG antibodies. More specifically, ePHF was added to MSD
Gold small spot streptavidin 96-well plates (MSD) previously
saturated with 1% BSA and coated with biotinylated HT-7 (Thermo
Scientific). After one hour of incubation, plates were washed with
PBST and serial dilutions of sera were added and incubated for two
hours. Bound antibodies were detected using a SulfoTag labelled
anti-human IgG antibody followed by a fixation step in 1% PFA
before adding the Read Buffer T. Plates were analyzed using a
Sector Imager (MSD). Results were expressed in Arbitrary units per
milliliter (AU/mL) for each individual monkey, together with the
geometric mean per group. Antibody titers specific for ePHF at Day
50 after the first immunization are represented.
[0384] FIG. 8 shows that all of the vaccines induced high titers of
ePHF-specific IgG antibodies.
[0385] Similar results with high titers of ePHF-specific IgG
antibodies were also obtained with other liposomes, such as
Liposome Z+, administered to Rhesus macaques via intramuscular
administration.
Example 7: The Breadth of Tau Phosphopeptide-Specific Antibody
Induced by the Liposomal Vaccine and Conjugate Vaccine in Rhesus
Monkeys
[0386] Groups of Rhesus macaques (n=3 males and 3 females per
group) were immunized subcutaneously at days 1 and 29 with (i) the
improved liposomal vaccine containing encapsulated T50 and two
adjuvants: TLR4 ligand (3D-(6-acyl) PHAD.RTM.) and lipidated CpG
2006 oligonucleotide (Liposome Z), and (ii) the conjugate vaccine
(phosphorylated tau peptide of SEQ ID NO: 2 linked to CRM)
(Conjugate A) co-injected with alum and CpG oligonucleotide CpG
2006. The epitope recognition profile of antibodies was determined
by epitope mapping ELISA three weeks after the second immunization
(Day 50) using a library of N-terminally biotinylated 8-mer
peptides, shifted by one amino acid and covering the sequence of
phosphorylated tau peptide of SEQ ID NO: 2, as well as the sequence
of SEQ ID NO: 4 (VYKSPVVSGDTSPRHL, non-phosphorylated tau peptide
having the same amino acid sequence as SEQ ID NO: 2) and the
corresponding biotinylated full length peptides.
[0387] FIGS. 9A and 9B show that monkeys immunized with liposome Z
produced IgG antibodies that bind mostly to the N-terminal part of
the phosphorylated peptide of SEQ ID NO: 2 (FIG. 9A), whereas
monkeys immunized with the conjugate vaccine (phosphorylated tau
peptide of SEQ ID NO: 2 linked to CRM) generated IgG antibodies
that bind mostly to the C-terminal part of the tau peptide of SEQ
ID NO: 2 (FIG. 9B).
Example 8: Increased Titers of IgG Antibodies Specific to Tau
Phosphopeptide Induced by Liposomal Vaccine with Encapsulated
T-Cell Epitope
[0388] Three groups of C57BL/6J mice (n=10 per group) were
immunized subcutaneously at days 0 and 14 with i) liposomal vaccine
containing TLR4 agonist (3D-(6-acyl) PHAD.RTM.), (Liposome R), ii)
liposomal vaccine containing encapsulated T-cell epitope T50 and
TLR4 ligand (3D-(6-acyl) PHAD.RTM.) as adjuvant, (Liposome S), or
iii) liposomal vaccine containing anchored T-cell epitope T57 on
the liposomal surface (i.e. dipalmitoylated T50) and TLR4 ligand
(3D-(6-acyl) PHAD.RTM.) as adjuvant, (Liposome T). Level of IgG
antibodies specific to phosphorylated tau peptide of SEQ ID NO: 2
was measured 21 and 35 days after the first injection in mouse
plasma by ELISA; results were presented as values of individual
mice, together with the geometric mean per group .+-.95% CI
expressed in arbitrary units (AU) per mL. As shown in FIG. 10A,
vaccination with the liposomal vaccine containing encapsulated T50
(Liposome S) induced significantly higher antibody titers than the
control liposomal vaccine (Liposome R) and the liposomal vaccine
containing anchored T-cell epitope (Liposome T) 21 days after the
first immunization (Kruskal-Wallis test: p=0.0089 and p=0002,
respectively) and also higher antibody titers than the control
liposomal vaccine and significantly higher antibody titers than the
liposomal vaccine containing anchored T-cell epitope 35 days after
the first immunization (Kruskal-Wallis test: p=0.7591 and p=0053,
respectively) (FIG. 10B).
Example 9: Liposomal Vaccines Induced T-Cell Response Specific to
the Incorporated T-Cell Epitope
[0389] Three groups of C57BL/6J mice (n=5 per group) were immunized
subcutaneously at days 0, 14 and 28 with (i) the improved liposomal
vaccine with encapsulated T-cell peptide T48 (containing T-cell
epitopes PADRE, T2, T30 and T17 separated with the GS linker,) and
a TLR4 agonist as adjuvant (MPLA) (Liposome M), (ii) the improved
liposomal vaccine with encapsulated T52 (containing T-cell epitopes
PADRE, T2 and T30 separated with the RK linker) and a TLR4 agonist
(MPLA) as adjuvant (Liposome N) or (iii) PBS. Spleens from mice
were harvested 42 days after the first immunization for the
analysis of T-cell responses by IL-4 and IFN-.gamma. ELISPOT.
Single cell suspensions were incubated with medium, T48 or T52
peptide at 10 ug/mL for 48 hours. Plates were incubated with a
biotinylated anti-mouse IL-4 or IFN-.gamma. monoclonal antibodies
and with streptavidin alkaline phosphatase (AP). Spots were
developed by adding the AP substrate. FIGS. 11A and 11B show that
the restimulation of mouse splenocytes with the same peptide as the
one encapsulated in the liposome induced IL-4 (FIG. 11B) and IFN-y
spot forming cells (FIG. 11A), while the splenocytes of
PBS-injected mice did not. This confirmed that the addition of
T-cell epitope to the vaccine induced the activation of specific
T-cells, allowing them to further provide the help in antibody
production to the tau-specific B-cells.
Example 10: Liposomal Vaccines Containing Encapsulated T-Cell
Epitope and Anchored T-Cell Epitope
[0390] Groups of Rhesus macaques (n=6 per group) were immunized
subcutaneously at days 1, 29, 85 and 169 with (i) liposomal vaccine
containing encapsulated T-cell epitope T50 and TLR4 ligand (MPLA)
as adjuvant (liposome L), (ii) liposomal vaccine containing
anchored T-cell epitope T46 and TLR4 ligand (MPLA) as adjuvant
(liposome 0) and (iii) control liposomal vaccine containing a TLR4
ligand (MPLA) as adjuvant and no T-cell epitope. Bleedings were
performed before immunization (at day -14) and at days 8, 22, 36,
50, 64, 78, 92, 106, 120, 134, 148, 162, 176 and 190, and the sera
were isolated. Specific IgG antibody titers were determined by
ELISA, using phosphorylated tau peptide of SEQ ID NO: 2 as the
coating antigen and an anti-monkey IgG secondary antibody.
Resulting antibody levels were calculated as end-point titers (last
serum dilution inducing a positive response), and the data was
expressed as geometric mean per group. As shown in FIG. 12,
liposomal vaccine containing an encapsulated T-cell epitope
(Liposome L) and liposomal vaccine containing an anchored T-cell
epitope (Liposome 0) each induced higher tau
phosphopeptide-specific antibody titers than the control liposomal
vaccine without T-cell epitope.
Example 11: Antibody Response in Mice Induced by Conjugate
Vaccine
[0391] Female BALB/c mice (14 mice per group) were immunized with
Conjugate B or Conjugate C (containing SEQ ID NO:1 or SEQ ID NO: 3
covalently linked to KLH) following the schedule depicted in FIG.
13A and using the vaccine candidates adjuvated with either a potent
multicomponent adjuvant (Sigma Adjuvant System.RTM., Sigma-Aldrich,
from here on referred to as Ribi) or a single component depot
adjuvant (Alhydrogel.RTM. adjuvant 2% or aluminum hydroxide gel,
InvivoGen, from here on referred to as alum). The amino acid
sequence of SEQ ID NO:1 contains only one amino acid difference
compared to that in the mouse protein, while the sequence of SEQ ID
NO:3 is 100% conserved between humans and mice. Thus, the selected
epitopes can be reasonably considered "self" proteins for mice and
mice should be a relevant model to investigate the limitations that
immune tolerance might place on immunogenicity.
[0392] As a first measure of vaccine immunogenicity flow cytometry
was used to measure induction of T follicular helper cells (TfHs)
in the cervical lymph nodes draining the vaccine injection site
(four mice per group). TfHs are a specialized population of CD4+ T
cells characterized by the expression of CXCR5, PD-1 and ICOS among
other molecules. TfHs expand after exposure to a vaccine or other
immune stimuli and support affinity maturation of B cells in the
germinal center (Crotty, 2011, Annual Reviews of Immunology. Vol
29:p621-663). The number of TfHs induced correlates positively with
the protective efficacy of vaccines in humans (Bentebibel et al.,
2013, Sci Transl Med., 5(176):176ra32; Spensieri et al., 2013, Proc
Natl Acad Sci USA., 110(35):14330-5) and small animals. As shown in
FIG. 13B, both vaccines, as well as the KLH plus adjuvant control
immunization induced measurable TfHs in vaccinated mice. Moreover,
all the animals receiving active vaccine (Conjugate B and Conjugate
C groups) or active placebo (KLH) plus alum, had significantly more
TfHs than the animals given an inactive placebo (PBS group), when
draining cervical lymph nodes were harvested seven days after the
first immunization (P=0.0044 for KLH-TAUVAC-p7.1; P=0.0482 for
KLH-TAUVAC-p22.1; P=0.0063 for KLH, using an ANOVA test followed by
Dunnett's adjustment for multiple comparisons).
[0393] ELISA was conducted to determine the serum titer of
antibodies binding to the tau phosphopeptides and to KLH at Day 0
and at four additional time points after immunization (days 14, 28,
56, and 84, see FIGS. 13C, 13D, 13G and 13H). As shown in FIG. 13C,
immunization with Conjugate B induced binding antibodies reactive
against the corresponding vaccine peptide. For animals immunized
with Conjugate B and Ribi adjuvant, binding titers against the
vaccine peptide were significantly higher than the binding titers
induced by the active placebo (compare Conjugate B plus Ribi to KLH
plus Ribi) at all time points measured (P<0.001 using an ANOVA
test followed by Tukey's adjustment for multiple comparisons). For
the alum adjuvanted group the difference was significant only at
days 56 and 84 (P=0.001 and 0.012 respectively).
[0394] The tau specific antibody response to Conjugate C (FIG. 13D)
was of overall lower magnitude than was the response to Conjugate
B, although the assay differences (different coating peptide)
preclude making a direct statistical comparison between the two
vaccines. Nonetheless, antibody titers against Conjugate C were
significantly higher in mice vaccinated with Conjugate C plus Ribi
than in mice receiving active placebo KLH Ribi at days 28 and 84
(P=0.001 and 0.008 respectively) after immunization; titers of the
alum adjuvanted group were not significantly different than those
of the active placebo.
[0395] Although the carrier protein protects the phosphopeptide
from degradation in vivo to some extent, it was likely that
phosphatase digestion of the peptide antigens in vivo would expose
some non-phosphorylated peptide to the immune system. To determine
whether that exposure resulted in generation of antibodies capable
of binding non-phosphorylated peptide in Conjugate B and Conjugate
C, ELISA was performed using non-phosphorylated peptides as the
coating antigen. As shown in FIGS. 13E and 13F, the response to
non-phosphorylated tau peptides was low, comparable to the response
of the active placebos to the same non-phosphorylated peptide.
Moreover, in animals immunized with Conjugate B and Ribi, binding
titers against the phosphorylated peptide were significantly higher
than the binding titers against the non-phosphorylated peptide at
all timepoints measured (P=0.009 at day 14; P<0.0001 at day 28,
56 and 84 using an ANOVA test). For the alum adjuvanted group the
difference was significant only at days 56 and 84 (P=0.0002 and
0.001 respectively). For animals immunized with Conjugate C,
responses to the phosphorylated peptide were higher only when Ribi
adjuvant was used (P<0.0001 at day 28; P=0.0001 at day 56 and
84).
Example 12: Antibodies Induced by Conjugate Vaccines Bind to
Physiologically Relevant Forms of Altered Tau
[0396] To further determine whether the vaccine induced antibodies
could bind to physiologically relevant forms of altered tau, we
used post-immune sera from vaccinated mice to stain post-mortem
human brain sections collected either from Alzheimer's disease
patients (5 AD cases), from patients affected by other tauopathies
(3 cases of PART, FTD, PICK and PSP), or from age-matched healthy
controls (5 control cases, CTRL). As expected, sera from control
animals (PBS and active placebo groups) did not bind the brain
sections, while ATB, a monoclonal antibody that binds to pTau
[pSer202, pThr 205] obtained from a murine clone, showed strong
immunoreactivity of tau pathology in an adjacent tissue section of
the corresponding area (FIG. 14). Sera from animals immunized with
the active vaccines Conjugate B and Conjugate C bound pathological
tau structures not only in the AD sections (data not shown), but
also in those from other tauopathies (FIG. 14). Conjugate B induced
antibodies reacted with (pre-)tangles, neuropil threads and
neuritic plaques in AD cases. These post-immune sera were also able
to immunoreact with neurofibril tangles and neuropil threads in
PART brain tissue, neuronal inclusions and neuropil threads in
FTD-tau (MAPT P301S) tissue, inclusions and astrocytes in some of
the Pick's disease cases and finally the neuronal inclusions,
neuropil threads and astrocytes typical of PSP. Conjugate C induced
polyclonal sera also reacted to pathological tau structures
characteristics of each tauopathy. In the AD cases, the staining
was mainly focused on neurofibrillary tangles, and to less extent
on neuritic plaques and neuropil threads. Lower magnification of
the corresponding areas showed similar results (Data not
known).
Example 13: Vaccine-Induced Antibodies are Functional in Mice
[0397] The protective efficacy of Conjugate B vaccine was tested in
an injection model of tauopathy (Peeraer et al., 2015, Neurobiol
Dis., 73:83-95). In this model, mice made susceptible to tauopathy
via a genetic mutation (P301L) receive an intracerebral injection
of enriched PHF isolated from human AD brain following the
timelines indicated in FIG. 15A. The injection, which is performed
before the onset of transgene-induced tauopathy, accelerates the
development of tauopathy in these animals. Conversely, when the
ePHF "seed" is pre-mixed with an antibody capable of suppressing
tau seeding activity like ATB, the induction of tauopathy is
reduced (unpublished data, not shown).
[0398] Following the scheme in FIG. 15A, we assessed the
development of tauopathy after stereotaxic injection of enriched
human PHF pre-mixed with IgG purified from serum of animals
immunized with Conjugate B, Ribi or with the active control KLH
Ribi. Two months after the injection, the brains of these mice were
harvested and the amount of aggregated tau in total and
sarkosyl-insoluble fractions was determined using standard
biochemical analysis. Data obtained showed that when mice were
injected with ePHF that had been pre-mixed with IgG from mice
vaccinated with Conjugate B, there was significantly less
aggregated phospho-tau in both total (FIG. 15B) and
sarkosyl-insoluble (FIG. 15C) fractions compared to animals
receiving the control injection (p<0.0001 KLH Ribi vs
KLH-TAUVAC-p7.1 Ribi using an ANOVA test followed by
Holm-Bonferroni adjustment for multiple comparisons). The
sarkosyl-insoluble tau being well accepted to correlate with the
pathological features of tauopathy, this result demonstrates that
antibodies induced by vaccination with KLH-TAUVAC-p7.1 are
protective in vivo.
Example 14: Vaccine-Induced Antibodies are Functional in Non-Human
Primates
[0399] Rhesus macaques were immunized with alum and CpG
oligonucleotide adjuvated Conjugate B (n=6) or with KLH (n=2) at
day 1, 29, 85 and 169. Blood was collected every 14 days and sera
from animals immunized with Conjugate B tested for reactivity on
the immunizing peptide using ELISA (FIG. 16A) and human ePHF using
MSD (FIG. 16B). Immunization with Conjugate B resulted in a
sustained and consistent antibody response against the vaccine
phosphopeptide. Moreover, all animals had measurable antibody
levels against human ePHF with 3 out of 6 animals showing high
reactivity on this antigen. Sera collected from animals 50 days
following primary immunization were applied to human brain sections
from healthy individuals or from AD patients (FIG. 16C).
Post-immune sera from Conjugate B group stained pathological tau
structures, namely neurofibrillary tangles, neuropil threads and
neuritic plaques in AD brain tissue, while sera from KLH-immunized
mice did not show any reactivity. No staining was observed on
control tissue. When tested in the tau immunodepletion assay,
animals receiving Conjugate B had antibodies able to bind and
deplete tau seed (p=0.03 at day 50 using an ANOVA test followed by
Dunnett's adjustment for multiple comparisons), while immunization
with KLH did not trigger such antibodies (FIG. 16D). Pre- and
post-immunization sera were also tested in the neutralization assay
as serially diluted individual samples (FIG. 16E). Changes from
baseline (CFB) were calculated as difference between FRET counts
for readings at day -14 prior to vaccination (baseline) and post
vaccination days 50, 106 and 190 respectively. Response at a
specific post vaccination day (day,) was then computed as
follows:
Response=% FRET_day.sub.i-% FRET_baseline
[0400] A general linear mixed model on aforementioned responses,
with animal as random effect, was applied with variables vaccine
groups, day and serum levels treated as categorical variables and
all their interactions. Given the exploratory nature of the study,
no multiple testing adjustment was considered. Hypothesis testing
was performed at the 5% level of significance.
Example 15: Mice Immunized with the Conjugate Vaccine in
Combination of Alum and CpG Oligonucleotide Adjuvants Resulted in
Higher Titer Antibody Responses to the Vaccine Peptide
[0401] Adult female C57BL/6 mice (n=5-6 per group) were immunized
intramuscularly with either 2 ug (FIG. 17A) or 0.2 ug (FIG. 17B) of
the Conjugate A vaccine. The conjugate vaccine was either
administered alone (no adjuvant), with alum hydroxide, with CpG
oligonucleotide, or with alum and CpG oligonucleotide combined. All
mice received a primary immunization on day 0 of the study followed
by a single booster immunization on day 28. The dose for the alum
adjuvant was 500 ug per mouse per injection, and the dose for the
CpG oligonucleotide adjuvant was 20 ug/mouse per injection. The
graphs in FIGS. 17A and 17B show the results of binding ELISA using
serum collected from mice before immunization (day 0) and at two
time points after immunization (day 28 and 42) with vaccine peptide
T3.5 as the coating antigen. T3.5 specific mean endpoint titers per
group were plotted, with error bars representing standard error.
The tables show the statistical analysis of the results, in which
antibody titers were compared using the non-parametric
Kruskal-Wallis Test, and pairwise group comparisons were assessed
using the Wilcoxon Signed Rank test as post-hoc to the Kruskal
Wallis test.
[0402] The results shown in FIGS. 17A and 17B illustrate that at
both doses, the non-adjuvanted vaccine failed to induce a strong
immune response. Use of alum or CpG oligonucleotide or a
combination of both improved the magnitude of the antibody response
(p<0.0152). Moreover, for animals immunized with 2 ug of
vaccine, the adjuvant combination gave significantly higher
antibody titers than single adjuvants at day 28 (p=0.0028). The
combination alum-CpG oligonucleotide also performed better than CpG
oligonucleotide alone for animals immunized with 0.2 ug of vaccine
at day 42 (p=0.0497). These data support the use of the alum and
CpG oligonucleotide adjuvant combination.
Example 16: Liposomal Vaccines with Different Ratios Tau Peptide:
T-Cell Epitopes Induce High and Sustained Level of Tau
Phosphopeptide-Specific IgG Antibody Titers
[0403] Adult Rhesus macaques (n=6 per group) were immunized
subcutaneously at days 1, 29, 85 and 169 with 1800 .mu.g of acetate
tetrapalmitoylated phosphorylated tau peptide of SEQ ID NO: 2 per
dose in the improved liposomal vaccine with encapsulated T50 T-cell
epitope, containing both 3D-(6-acyl) PHAD.RTM. and lipidated CpG
2006 oligonucleotide adjuvant with: i) 400 ug/mL of phosphorylated
tau peptide of SEQ ID NO: 2 and 100 ug/mL of T50 (Liposome Z), ii)
1200 ug/mL of phosphorylated tau peptide of SEQ ID NO: 2 and 1200
ug/mL of T50 (Liposome Z.sup.+), iii) 400 ug/mL of phosphorylated
tau peptide of SEQ ID NO: 2 and 400 ug/mL of T50 (Liposome
Z.sup.++), iv) 1200 ug/mL of phosphorylated tau peptide of SEQ ID
NO: 2 and 300 ug/mL of T50 (Liposome Z.sup.+++). Bleedings were
performed before immunization and at days 8, 22, 36, 50, 64, 78,
92, 106, 120, 134, 148, 162, 176 and 190 and the sera were
isolated. Specific IgG antibody titers in the sera were determined
by ELISA, using phosphorylated tau peptide of SEQ ID NO: 2 as the
coating antigen and an anti-monkey IgG secondary antibody.
Resulting antibody levels were calculated as end-point titers (last
serum dilution inducing a positive response) for each individual
monkey over time. Geometric mean of end-point titers per group
.+-.95% confidence interval is presented in FIG. 18, showing that
all four tested liposomal vaccines induced high and sustained
titers against the tau phospho-peptide.
TABLE-US-00001 SEQUENCE LISTING phospho-tau peptide (7.1) SEQ ID
NO: 1 GDRSGYS[pS]PG[pS]PG[pT]PGSRSRT SEQ ID NO: 2-phospho-tau
peptide (T3.5) VYK[pS]PVVSGDT[pS]PRHL SEQ ID NO: 3-phospho-tau
peptide (22.1) SSTGSIDMVD[pS]PQLA[pT]LA SEQ ID NO: 4-tau peptide
VYKSPVVSGDTSPRHL SEQ ID NO: 5-phospho-tau peptide
RENAKAKTDHGAEIVYK[pS]PVVSGDT[pS]PRHL SEQ ID NO: 6-phospho-tau
peptide RQEFEVMEDHAGT[pY]GL SEQ ID NO: 7-phospho-tau peptide
PGSRSR[pT]P[pS]LPTPPTR SEQ ID NO: 8-phospho-tau peptide
GYSSPG[pS]PG[pT]PGSRSR SEQ ID NO: 9-phospho-tau peptide
GDT[pS]PRHL[pS]NVSSTGSID SEQ ID NO: 10-phospho-tau peptide
PG[pS]PG[pT]PGSRSR[pT]P[pS]LP SEQ ID NO: 11-phospho-tau peptide
HL[pS]NVSSTGSID SEQ ID NO: 12-phospho-tau peptide VSGDT[pS]PRHL SEQ
ID NO: 13-T50 T cell epitope
AKFVAAWTLKAAAVVRQYIKANSKFIGITELVVRFNNFTVSFWLRVPKVSASHLE-NH.sub.2
SEQ ID NO: 14-T46 T cell epitope
AKFVAAWTLKAAAGSQYIKANSKFIGITELGSFNNFTVSFWLRVPKVSASHLEK(Pal)K
(Pal)-NH.sub.2 SEQ ID NO: 15-T48 helper T cell epitope
AKFVAAWTLKAAAGSQYIKANSKFIGITELGSFNNFTVSFWLRVPKVSASHLEGSLINST
KIYSYFPSVISKVNQ-NH.sub.2 SEQ ID NO: 16-T51 helper T cell epitope
AKFVAAWTLKAAARRQYIKANSKFIGITELRRFNNFTVSFWLRVPKVSASHLE-NH.sub.2 SEQ
ID NO: 17-T52 helper T cell epitope
AKFVAAWTLKAAARKQYIKANSKFIGITELRKFNNFTVSFWLRVPKVSASHLE-NH.sub.2 SEQ
ID NO: 18-CpG 2006 (also known as CpG 7909)
5'-tcgtcgttttgtcgttttgtcgtt-3' wherein lower case means
phosphorothioate (ps) intemucleotide linkages SEQ ID NO: 19- CpG
1018 5'-tgactgtgaacgttcgagatga-3' wherein lower case means
phosphorothioate internucleotide linkages SEQ ID NO: 20-CpG2395
5'-tcgtcgttttcggcgcgcgccg-3' wherein lower case means
phosphorothioate internucleotide linkages SEQ ID NO: 21-CpG2216
5'-ggGGGACGATCGTCgggggg-3' wherein lower case means
phosphorothioate internucleotide linkages and capital letters means
phosphodiester (po) linkages SEQ ID NO: 22-CpG2336
5'-gggGACGACGTCGTGgggggg-3', wherein lower case means
phosphorothioate internucleotide linkages and capital letters means
phosphodiester linkages SEQ ID NO: 23-Pan DR epitope (PADRE)
peptide AKFVAAWTLKAAA SEQ ID NO: 24-P2 QYIKANSKFIGITEL SEQ ID NO:
25-P30 ENNFTVSEWLRVPKVSASHLE SEQ ID NO: 26-TT.sub.586-605
LINSTKIYSYFPSVISKVNQ SEQ ID NO: 27-palmitoylated phospho-tau
peptide (palmitoylated 7.1)
K(pal)K(pal)GDRSGYS[pS]PG[pS]PG[pT]PGSRSRTK(pal)K(pal) SEQ ID NO:
28-palmitoylated phospho-tau peptide (T3, palmitoylated T3.5)
K(pal)K(pal)VYK[pS]PVVSGDT[pS]PRHLK(pal)K(pal) SEQ ID NO:
29-palmitoylated phospho-tau peptide (palmitoylated 22.1)
K(pal)K(pal)SSTGSIDMVD[pS]PQLA[pT]LAK(pal)K(pal) SEQ ID NO:
30-palmitoylated tau peptide
K(pal)K(pal)VYKSPVVSGDTSPRHLK(pal)K(pal) SEQ ID NO:
31-palmitoylated phospho-tau peptide
K(pal)K(pal)RENAKAKTDHGAEIVYK[pS]PVVSGDT[pS]PRHLK(pal)K(pal) SEQ ID
NO: 32-palmitoylated phospho-tau peptide
K(pal)K(pal)RQEFEVMEDHAGT[pY]GLK(pal)K(pal) SEQ ID NO:
33-palmitoylated phospho-tau peptide
K(pal)K(pal)PGSRSR[pT]P[pS]LPTPPTRK(pal)K(pal) SEQ ID NO:
34-palmitoylated phospho-tau peptide
K(pal)K(pal)GYSSPG[pS]PG[pT]PGSRSRK(pal)K(pal) SEQ ID NO:
35-palmitoylated phospho-tau peptide
K(pal)K(pal)GDT[pS]PRHL[pS]NVSSTGSIDK(pal)K(pal) SEQ ID NO:
36-palmitoylated phospho-tau peptide
K(pal)K(pal)PG[pS]PG[pT]PGSRSR[pT]P[pS]LPK(pal)K(pal) SEQ ID NO:
37-palmitoylated phospho-tau peptide
K(pal)K(pal)HL[pS]NVSSTGSIDK(pal)K(pal) SEQ ID NO: 38-palmitoylated
phospho-tau peptide K(pal)K(pal)VSGDT[pS]PRHLK(pal)K(pal) SEQ ID
NO: 39-T50 without the C-terminal amide
AKFVAAWTLKAAAVVRQYIKANSKFIGITELVVRFNNFTVSFWLRVPKVSASHLE SEQ ID NO:
40-T46 without the -Lys(Pal)-Lys(Pal)-NH.sub.2 at the C-terminal
AKFVAAWTLKAAAGSQYIKANSKFIGITELGSFNNFTVSFWLRVPKVSASHLE SEQ ID NO:
41-T48 without the C-terminal amide
AKFVAAWTLKAAAGSQYIKANSKFIGITELGSFNNFTVSFWLRVPKVSASHLEGSLINST
KIYSYFPSVISKVNQ SEQ ID NO: 42-T51 without the C-terminal amide
AKFVAAWTLKAAARRQYIKANSKFIGITELRRFNNFTVSFWLRVPKVSASHLE SEQ ID NO:
43-T52 without the C-terminal amide
AKFVAAWTLKAAARKQYIKANSKFIGITELRKFNNFTVSFWLRVPKVSASHLE SEQ ID NO:
44- T57 AKFVAAWTLKAAAVVRQYIKANSKFIGITELVVRFNNFTVSFWLRVPKVSASHLE-
K(Pal)K(Pal)-NH2
REFERENCES
[0404] Asuni A A et al, J Neurosci. 2007 Aug. 22; 27(34):9115-29
[0405] Bentebibel et al., 2013, Sci Transl Med., 5(176):176ra32
[0406] Crotty, 2011, Annual Reviews of Immunology. Vol 29:p621-663
[0407] Friedhoff et al., Biochimica et Biophysica Acta 1502 (2000)
122-132 [0408] Greenberg and Davies, 1991, Proc Natl Acad Sci USA,
87(15):5827-31 [0409] Hanger et al., Trends Mol Med. 15:112-9, 2009
[0410] Hickman et al., J. Biol. Chem. vol. 286, NO. 16, pp.
13966-13976, Apr. 22, 2011 [0411] Kontsekova E et al., Alzheimers
Res Ther. 2014 Aug. 1; 6(4):44 [0412] Novak P et al., Lancet
Neurology 2017, 16:123-134 [0413] Peeraer et al., 2015, Neurobiol
Dis., 73:83-95 [0414] Ries et al., 2015, Org. Biomol. Chem.,
13:9673 [0415] Spensieri et al., 2013, Proc Natl Acad Sci USA.,
110(35):14330-5 [0416] Theunis C et al., PLoS One. 2013; 8(8):
e72301 [0417] U.S. Pat. No. 7,741,297 [0418] U.S. Pat. No.
8,647,631 [0419] U.S. Pat. No. 9,687,447 [0420] WO90/14837 [0421]
WO2010/115843
Sequence CWU 1
1
44121PRTArtificial Sequencephospho-tau peptide 7.1phosphorylated
serine(8)..(8)phosphorylated serine(11)..(11)phosphorylated
threonine(14)..(14) 1Gly Asp Arg Ser Gly Tyr Ser Ser Pro Gly Ser
Pro Gly Thr Pro Gly1 5 10 15Ser Arg Ser Arg Thr 20216PRTArtificial
Sequencephospho-tau peptide T3.5phosphorylated
serine(4)..(4)phosphorylated serine(12)..(12) 2Val Tyr Lys Ser Pro
Val Val Ser Gly Asp Thr Ser Pro Arg His Leu1 5 10
15318PRTArtificial Sequencephospho-tau peptide 22.1phosphorylated
serine(11)..(11)phosphorylated threonine(16)..(16) 3Ser Ser Thr Gly
Ser Ile Asp Met Val Asp Ser Pro Gln Leu Ala Thr1 5 10 15Leu
Ala416PRTArtificial Sequencetau peptide 4Val Tyr Lys Ser Pro Val
Val Ser Gly Asp Thr Ser Pro Arg His Leu1 5 10 15530PRTArtificial
Sequencephospho-tau peptidephosphorylated
serine(18)..(18)phosphorylated serine(26)..(26) 5Arg Glu Asn Ala
Lys Ala Lys Thr Asp His Gly Ala Glu Ile Val Tyr1 5 10 15Lys Ser Pro
Val Val Ser Gly Asp Thr Ser Pro Arg His Leu 20 25
30616PRTArtificial Sequencephospho-tau peptidephosphorylated
tyrosine(14)..(14) 6Arg Gln Glu Phe Glu Val Met Glu Asp His Ala Gly
Thr Tyr Gly Leu1 5 10 15716PRTArtificial Sequencephospho-tau
peptidephosphorylated threonine(7)..(7)phosphorylated
serine(9)..(9) 7Pro Gly Ser Arg Ser Arg Thr Pro Ser Leu Pro Thr Pro
Pro Thr Arg1 5 10 15816PRTArtificial Sequencephospho-tau
peptidephosphorylated serine(7)..(7)phosphorylated
threonine(10)..(10) 8Gly Tyr Ser Ser Pro Gly Ser Pro Gly Thr Pro
Gly Ser Arg Ser Arg1 5 10 15918PRTArtificial Sequencephospho-tau
peptidephosphorylated serine(4)..(4)phosphorylated serine(9)..(9)
9Gly Asp Thr Ser Pro Arg His Leu Ser Asn Val Ser Ser Thr Gly Ser1 5
10 15Ile Asp1017PRTArtificial Sequencephospho-tau
peptidephosphorylated serine(3)..(3)phosphorylated
threonine(6)..(6)phosphorylated threonine(13)..(13)phosphorylated
serine(15)..(15) 10Pro Gly Ser Pro Gly Thr Pro Gly Ser Arg Ser Arg
Thr Pro Ser Leu1 5 10 15Pro1112PRTArtificial Sequencephospho-tau
peptidephosphorylated serine(3)..(3) 11His Leu Ser Asn Val Ser Ser
Thr Gly Ser Ile Asp1 5 101210PRTArtificial Sequencephospho-tau
peptidephosphorylated serine(6)..(6) 12Val Ser Gly Asp Thr Ser Pro
Arg His Leu1 5 101355PRTArtificial SequenceT50 T cell
epitopeC-terminal amide(55)..(55) 13Ala Lys Phe Val Ala Ala Trp Thr
Leu Lys Ala Ala Ala Val Val Arg1 5 10 15Gln Tyr Ile Lys Ala Asn Ser
Lys Phe Ile Gly Ile Thr Glu Leu Val 20 25 30Val Arg Phe Asn Asn Phe
Thr Val Ser Phe Trp Leu Arg Val Pro Lys 35 40 45Val Ser Ala Ser His
Leu Glu 50 551455PRTArtificial SequenceT46 T cell
epitopepalmitoylated lysine(54)..(54)palmitoylated
lysine(55)..(55)C-terminal amide(55)..(55) 14Ala Lys Phe Val Ala
Ala Trp Thr Leu Lys Ala Ala Ala Gly Ser Gln1 5 10 15Tyr Ile Lys Ala
Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu Gly Ser 20 25 30Phe Asn Asn
Phe Thr Val Ser Phe Trp Leu Arg Val Pro Lys Val Ser 35 40 45Ala Ser
His Leu Glu Lys Lys 50 551575PRTArtificial SequenceT48 helper T
cell epitopeC-terminal amide(75)..(75) 15Ala Lys Phe Val Ala Ala
Trp Thr Leu Lys Ala Ala Ala Gly Ser Gln1 5 10 15Tyr Ile Lys Ala Asn
Ser Lys Phe Ile Gly Ile Thr Glu Leu Gly Ser 20 25 30Phe Asn Asn Phe
Thr Val Ser Phe Trp Leu Arg Val Pro Lys Val Ser 35 40 45Ala Ser His
Leu Glu Gly Ser Leu Ile Asn Ser Thr Lys Ile Tyr Ser 50 55 60Tyr Phe
Pro Ser Val Ile Ser Lys Val Asn Gln65 70 751653PRTArtificial
SequenceT51 helper T cell epitopeC-terminal amide(53)..(53) 16Ala
Lys Phe Val Ala Ala Trp Thr Leu Lys Ala Ala Ala Arg Arg Gln1 5 10
15Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu Arg Arg
20 25 30Phe Asn Asn Phe Thr Val Ser Phe Trp Leu Arg Val Pro Lys Val
Ser 35 40 45Ala Ser His Leu Glu 501753PRTArtificial SequenceT52
helper T cell epitopeC-terminal amide(53)..(53) 17Ala Lys Phe Val
Ala Ala Trp Thr Leu Lys Ala Ala Ala Arg Lys Gln1 5 10 15Tyr Ile Lys
Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu Arg Lys 20 25 30Phe Asn
Asn Phe Thr Val Ser Phe Trp Leu Arg Val Pro Lys Val Ser 35 40 45Ala
Ser His Leu Glu 501824DNAArtificial SequenceCpG
2006phosphorothioate (ps) internucleotide linkages(1)..(24)
18tcgtcgtttt gtcgttttgt cgtt 241922DNAArtificial SequenceCpG
1018phosphorothioate (ps) internucleotide linkages(1)..(22)
19tgactgtgaa cgttcgagat ga 222022DNAArtificial SequenceCpG
2395phosphorothioate (ps) internucleotide linkages(1)..(22)
20tcgtcgtttt cggcgcgcgc cg 222120DNAArtificial SequenceCpG
2216phosphorothioate (ps) internucleotide
linkages(1)..(3)phosphodiester (po) internucleotide
linkages(3)..(14)phosphorothioate (ps) internucleotide
linkages(14)..(20) 21gggggacgat cgtcgggggg 202221DNAArtificial
SequenceCpG 2336phosphorothioate (ps) internucleotide
linkages(1)..(4)phosphodiester (po) internucleotide
linkages(4)..(15)phosphorothioate (ps) internucleotide
linkages(15)..(21) 22ggggacgacg tcgtgggggg g 212313PRTArtificial
SequencePan DR epitope (PADRE) peptide 23Ala Lys Phe Val Ala Ala
Trp Thr Leu Lys Ala Ala Ala1 5 102415PRTArtificial SequenceP2 24Gln
Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu1 5 10
152521PRTArtificial SequenceP30 25Phe Asn Asn Phe Thr Val Ser Phe
Trp Leu Arg Val Pro Lys Val Ser1 5 10 15Ala Ser His Leu Glu
202620PRTArtificial SequenceTT586-605 26Leu Ile Asn Ser Thr Lys Ile
Tyr Ser Tyr Phe Pro Ser Val Ile Ser1 5 10 15Lys Val Asn Gln
202725PRTArtificial Sequencepalmitoylated phospho-tau peptide
(palmitoylated 7.1)palmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(10)..(10)phosphorylated
serine(13)..(13)phosphorylated threonine(16)..(16)palmitoylated
lysine(24)..(24)palmitoylated lysine(25)..(25) 27Lys Lys Gly Asp
Arg Ser Gly Tyr Ser Ser Pro Gly Ser Pro Gly Thr1 5 10 15Pro Gly Ser
Arg Ser Arg Thr Lys Lys 20 252820PRTArtificial
Sequencepalmitoylated phospho-tau peptide (T3, palmitoylated
T3.5)palmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(6)..(6)phosphorylated
serine(14)..(14)palmitoylated lysine(19)..(19)palmitoylated
lysine(20)..(20) 28Lys Lys Val Tyr Lys Ser Pro Val Val Ser Gly Asp
Thr Ser Pro Arg1 5 10 15His Leu Lys Lys 202922PRTArtificial
Sequencepalmitoylated phospho-tau peptide (palmitoylated
22.1)palmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(13)..(13)phosphorylated
threonine(18)..(18)palmitoylated lysine(21)..(21)palmitoylated
lysine(22)..(22) 29Lys Lys Ser Ser Thr Gly Ser Ile Asp Met Val Asp
Ser Pro Gln Leu1 5 10 15Ala Thr Leu Ala Lys Lys 203020PRTArtificial
Sequencepalmitoylated tau peptidepalmitoylated
lysine(1)..(1)palmitoylated lysine(2)..(2)palmitoylated
lysine(19)..(19)palmitoylated lysine(20)..(20) 30Lys Lys Val Tyr
Lys Ser Pro Val Val Ser Gly Asp Thr Ser Pro Arg1 5 10 15His Leu Lys
Lys 203134PRTArtificial Sequencepalmitoylated phospho-tau
peptidepalmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(20)..(20)phosphorylated
serine(28)..(28)palmitoylated lysine(33)..(33)palmitoylated
lysine(34)..(34) 31Lys Lys Arg Glu Asn Ala Lys Ala Lys Thr Asp His
Gly Ala Glu Ile1 5 10 15Val Tyr Lys Ser Pro Val Val Ser Gly Asp Thr
Ser Pro Arg His Leu 20 25 30Lys Lys3220PRTArtificial
Sequencepalmitoylated phospho-tau peptidepalmitoylated
lysine(1)..(1)palmitoylated lysine(2)..(2)phosphorylated
tyrosine(16)..(16)palmitoylated lysine(19)..(19)palmitoylated
lysine(20)..(20) 32Lys Lys Arg Gln Glu Phe Glu Val Met Glu Asp His
Ala Gly Thr Tyr1 5 10 15Gly Leu Lys Lys 203320PRTArtificial
Sequencepalmitoylated phospho-tau peptidepalmitoylated
lysine(1)..(1)palmitoylated lysine(2)..(2)phosphorylated
threonine(9)..(9)phosphorylated serine(11)..(11)palmitoylated
lysine(19)..(19)palmitoylated lysine(20)..(20) 33Lys Lys Pro Gly
Ser Arg Ser Arg Thr Pro Ser Leu Pro Thr Pro Pro1 5 10 15Thr Arg Lys
Lys 203420PRTArtificial Sequencepalmitoylated phospho-tau
peptidepalmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(9)..(9)phosphorylated
threonine(12)..(12)palmitoylated lysine(19)..(19)palmitoylated
lysine(20)..(20) 34Lys Lys Gly Tyr Ser Ser Pro Gly Ser Pro Gly Thr
Pro Gly Ser Arg1 5 10 15Ser Arg Lys Lys 203522PRTArtificial
Sequencepalmitoylated phospho-tau peptidepalmitoylated
lysine(1)..(1)palmitoylated lysine(2)..(2)phosphorylated
serine(6)..(6)phosphorylated serine(11)..(11)palmitoylated
lysine(21)..(21)palmitoylated lysine(22)..(22) 35Lys Lys Gly Asp
Thr Ser Pro Arg His Leu Ser Asn Val Ser Ser Thr1 5 10 15Gly Ser Ile
Asp Lys Lys 203621PRTArtificial Sequencepalmitoylated phospho-tau
peptidepalmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(5)..(5)phosphorylated
threonine(8)..(8)phosphorylated threonine(15)..(15)phosphorylated
serine(17)..(17)palmitoylated lysine(20)..(20)palmitoylated
lysine(21)..(21) 36Lys Lys Pro Gly Ser Pro Gly Thr Pro Gly Ser Arg
Ser Arg Thr Pro1 5 10 15Ser Leu Pro Lys Lys 203716PRTArtificial
Sequencepalmitoylated phospho-tau peptidepalmitoylated
lysine(1)..(1)palmitoylated lysine(2)..(2)phosphorylated
serine(5)..(5)palmitoylated lysine(15)..(15)palmitoylated
lysine(16)..(16) 37Lys Lys His Leu Ser Asn Val Ser Ser Thr Gly Ser
Ile Asp Lys Lys1 5 10 153814PRTArtificial Sequencepalmitoylated
phospho-tau peptidepalmitoylated lysine(1)..(1)palmitoylated
lysine(2)..(2)phosphorylated serine(8)..(8)palmitoylated
lysine(13)..(13)palmitoylated lysine(14)..(14) 38Lys Lys Val Ser
Gly Asp Thr Ser Pro Arg His Leu Lys Lys1 5 103955PRTArtificial
SequenceT50 without the C-terminal amide 39Ala Lys Phe Val Ala Ala
Trp Thr Leu Lys Ala Ala Ala Val Val Arg1 5 10 15Gln Tyr Ile Lys Ala
Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu Val 20 25 30Val Arg Phe Asn
Asn Phe Thr Val Ser Phe Trp Leu Arg Val Pro Lys 35 40 45Val Ser Ala
Ser His Leu Glu 50 554053PRTArtificial SequenceT46 without the
palmitoylated lysines and C-terminal amide 40Ala Lys Phe Val Ala
Ala Trp Thr Leu Lys Ala Ala Ala Gly Ser Gln1 5 10 15Tyr Ile Lys Ala
Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu Gly Ser 20 25 30Phe Asn Asn
Phe Thr Val Ser Phe Trp Leu Arg Val Pro Lys Val Ser 35 40 45Ala Ser
His Leu Glu 504175PRTArtificial SequenceT48 without the C-terminal
amide 41Ala Lys Phe Val Ala Ala Trp Thr Leu Lys Ala Ala Ala Gly Ser
Gln1 5 10 15Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu
Gly Ser 20 25 30Phe Asn Asn Phe Thr Val Ser Phe Trp Leu Arg Val Pro
Lys Val Ser 35 40 45Ala Ser His Leu Glu Gly Ser Leu Ile Asn Ser Thr
Lys Ile Tyr Ser 50 55 60Tyr Phe Pro Ser Val Ile Ser Lys Val Asn
Gln65 70 754253PRTArtificial SequenceT51 without the C-terminal
amide 42Ala Lys Phe Val Ala Ala Trp Thr Leu Lys Ala Ala Ala Arg Arg
Gln1 5 10 15Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu Leu
Arg Arg 20 25 30Phe Asn Asn Phe Thr Val Ser Phe Trp Leu Arg Val Pro
Lys Val Ser 35 40 45Ala Ser His Leu Glu 504353PRTArtificial
SequenceT52 without the C-terminal amide 43Ala Lys Phe Val Ala Ala
Trp Thr Leu Lys Ala Ala Ala Arg Lys Gln1 5 10 15Tyr Ile Lys Ala Asn
Ser Lys Phe Ile Gly Ile Thr Glu Leu Arg Lys 20 25 30Phe Asn Asn Phe
Thr Val Ser Phe Trp Leu Arg Val Pro Lys Val Ser 35 40 45Ala Ser His
Leu Glu 504457PRTArtificial SequenceT57palmitoylated
lysine(56)..(56)palmitoylated lysine(57)..(57)C-terminal
amide(57)..(57) 44Ala Lys Phe Val Ala Ala Trp Thr Leu Lys Ala Ala
Ala Val Val Arg1 5 10 15Gln Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly
Ile Thr Glu Leu Val 20 25 30Val Arg Phe Asn Asn Phe Thr Val Ser Phe
Trp Leu Arg Val Pro Lys 35 40 45Val Ser Ala Ser His Leu Glu Lys Lys
50 55
* * * * *