U.S. patent application number 17/346974 was filed with the patent office on 2021-11-11 for binding agonist for treatment of neurological and other disorders.
The applicant listed for this patent is GlaxoSmithKline Intellectual Property Development Limited. Invention is credited to Tejinder Kaur BHINDER, Chong DING, Xu FENG, Wenqing JIANG, Alan Peter LEWIS, Yingli MA, Guhan NAGAPPAN, Radha Shah PARMAR, Yangsheng QIU, Liuqing YANG, Qing ZHANG, Yanjiao ZHOU.
Application Number | 20210347902 17/346974 |
Document ID | / |
Family ID | 1000005712377 |
Filed Date | 2021-11-11 |
United States Patent
Application |
20210347902 |
Kind Code |
A1 |
BHINDER; Tejinder Kaur ; et
al. |
November 11, 2021 |
BINDING AGONIST FOR TREATMENT OF NEUROLOGICAL AND OTHER
DISORDERS
Abstract
The present invention relates to TrkB binding agonists, and to
the use of such agonists in the treatment of neurological disorders
and other disorders. The present invention also relates to specific
TrkB binding agonists comprising CDRs, variable regions, heavy and
light chains, and variant sequences thereof.
Inventors: |
BHINDER; Tejinder Kaur;
(Stevenage, GB) ; DING; Chong; (Shanghai, CN)
; FENG; Xu; (Shanghai, CN) ; JIANG; Wenqing;
(Shanghai, CN) ; LEWIS; Alan Peter; (Stevenage,
GB) ; MA; Yingli; (Shanghai, CN) ; NAGAPPAN;
Guhan; (Collegeville, PA) ; PARMAR; Radha Shah;
(Stevenage, GB) ; QIU; Yangsheng; (Shanghai,
CN) ; YANG; Liuqing; (Shanghai, CN) ; ZHANG;
Qing; (Shanghai, CN) ; ZHOU; Yanjiao;
(Shanghai, CN) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
GlaxoSmithKline Intellectual Property Development Limited |
Middlesex |
|
GB |
|
|
Family ID: |
1000005712377 |
Appl. No.: |
17/346974 |
Filed: |
June 14, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15776493 |
May 16, 2018 |
11078287 |
|
|
PCT/EP2016/077644 |
Nov 15, 2016 |
|
|
|
17346974 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 16/2878 20130101;
C07K 2317/565 20130101; C07K 2317/24 20130101; A61P 27/16 20180101;
A61K 2039/505 20130101; C07K 16/2863 20130101; C07K 2317/75
20130101; A61P 25/00 20180101; C07K 2317/33 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61P 25/00 20060101 A61P025/00; A61P 27/16 20060101
A61P027/16 |
Foreign Application Data
Date |
Code |
Application Number |
Nov 17, 2015 |
CN |
PCT/CN2015/094779 |
Aug 16, 2016 |
CN |
PCT/CN2016/095545 |
Nov 8, 2016 |
GB |
1618814.6 |
Claims
1-55. (canceled)
56. A TrkB binding agonist that either: a) interacts with one or
more residues of human TrkB: Thr290, Glu293, Ser294, Asp358,
Ser375, Lys372, Gln373 and Glu341; b) approaches to less than or
equal to 4.5 .ANG. one or more residues of human TrkB: T288, 1289,
T290, F291, L292, E293, S294, K308, D358, E371, K372, Q373, I374,
and S375; c) binds to human TrkB extracellular domain in which a
residue from E210, F285, T288, T290, F291, E293, D370 and K372
(numbering according to full length human TrkB) is mutated with an
altered affinity compared to human TrkB extracellular domain with
no mutation; d) binds to human TrkB and results in peptides derived
from human TrkB containing part or the whole of the sequence from
residues 284-291 (numbering according to full length human TrkB)
being more resistant to deuterium incorporation compared to
corresponding peptides derived from uncomplexed human TrkB; or e)
binds to a peptide having the amino acid sequence set forth in SEQ
ID NO: 71.
57. The TrkB binding agonist of claim 56, wherein the TrkB binding
agonist binds to human TrkB and results in peptides derived from
human TrkB containing part or the whole of the sequence from
residues 284-291 (numbering according to full length human TrkB)
being more resistant to deuterium incorporation compared to
corresponding peptides derived from uncomplexed human TrkB.
58. The TrkB binding agonist of claim 56, wherein the TrkB binding
agonist binds to a peptide having the amino acid sequence set forth
in SEQ ID NO: 71.
59. The TrkB binding agonist of claim 56, wherein the TrkB binding
agonist does not compete with BDNF and/or NT-4 for binding to
TrkB.
60. The TrkB binding agonist of claim 56, wherein the TrkB binding
agonist potentiates BDNF-induced and/or NT-4 induced agonism of
TrkB.
61. The TrkB binding agonist of claim 60, wherein the potentiation
is measured by an increased activation of TrkB in the presence of a
saturating concentration of BDNF or NT-4 in the presence of the
TrkB binding agonist, compared with the absence of the TrkB binding
agonist.
62. The TrkB binding agonist of claim 61, wherein the increased
activation of TrkB is measured by an increased level of
phosphorylation of TrkB.
63. The TrkB binding agonist of claim 62, wherein the
phosphorylation of TrkB in the presence of a saturating
concentration of BDNF or NT-4 is 100% in the absence of the TrkB
binding agonist, compared with the increased level of at least
110%, at least 115%, at least 120%, at least 125%, at least 130%,
at least 135%, at least 140%, at least 145%, or at least 150% in
the presence of the TrkB binding agonist.
64. The TrkB binding agonist of claim 56, wherein the TrkB binding
agonist exhibits less than or equal to a 5 fold difference in EC50
between phosphorylation of human and cynomolgus TrkB.
65. The TrkB binding agonist of claim 56, wherein the TrkB binding
agonist maintains TrkB levels on a cell surface.
66. One or more nucleic acid sequences encoding the TrkB binding
agonist of claim 56.
67. The one or more nucleic acid sequences of claim 66, comprising
SEQ ID NO: 44 encoding a heavy chain and/or SEQ ID NO: 45 encoding
a light chain.
68. One or more expression vectors comprising the one or more
nucleic acid sequences of claim 66.
69. A recombinant host cell comprising the one or more nucleic acid
sequences of claim 66.
70. A method for the production of a TrkB binding agonist,
comprising culturing the recombinant host cell of claim 69, under
conditions suitable for expression of the one or more nucleic acid
sequences.
71. A pharmaceutical composition comprising the TrkB binding
agonist of claim 56, and one or a combination of a pharmaceutically
acceptable carrier, a pharmaceutically acceptable excipient, and a
pharmaceutically acceptable diluent.
72. A method of treating a sensorineural hearing loss in a subject
in need thereof, comprising administering to the subject a
therapeutically effective amount of the TrkB binding agonist of
claim 56.
73. The method of claim 72, wherein the hearing loss results from
an acoustic trauma.
74. The method of claim 72, wherein the hearing loss is a sensory
hearing loss.
75. The method of claim 72, wherein the hearing loss is an 8.sup.th
nerve related hearing loss.
76. The method of claim 72, wherein the hearing loss is a hidden
hearing loss.
77. The method of claim 72, wherein the hearing loss is
tinnitus.
78. The method of claim 72, wherein the hearing loss is
presbycusis.
79. The method of claim 72, wherein the hearing loss is ototoxic
hearing loss, sudden sensorineural hearing loss, cochlear deafness,
or caused by a bacterial or viral infection.
80. The method of claim 72, wherein the TrkB agonist is used in
combination with a cochlear implant.
81. The method of claim 72, wherein the TrkB agonist is used in
combination with a steroid.
82. The method of claim 72, wherein the TrkB agonist is
administered in a sustained release formulation.
83. The method of claim 72, wherein the TrkB agonist is
administered by an injection.
84. The method of claim 72, wherein the TrkB agonist is
administered in an infusion.
85. The method of claim 72, wherein the TrkB agonist is
administered intracochlearly.
86. The method of claim 72, wherein the TrkB agonist is
administered transtympanically.
87. A TrkB binding agonist that competes for binding to TrkB with a
reference antibody having: (a) a heavy chain sequence of SEQ ID NO:
27 and a light chain sequence of SEQ ID NO: 28, wherein the
competition is determined by more than 60% binding of the TrkB
binding agonist to the TrkB in the presence of the reference
antibody.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional application of U.S.
application Ser. No. 15/776,493 filed May 16, 2018, which is a 371
National Stage Entry of International Application No.
PCT/EP2016/077644 filed Nov. 15, 2016, which claims priority to and
the benefit of International Application No. PCT/CN2015/094779
filed Nov. 17, 2015, International Application No.
PCT/CN2016/095545 filed Aug. 16, 2016 and Great Britain Application
No. GB1618814.6 filed Nov. 8, 2016, all of which are incorporated
herein by reference in their entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to TrkB binding agonists, and
to the use of such agonists in the treatment of neurological
disorders and other disorders. The present invention also relates
to specific TrkB binding agonists comprising CDRs, variable
regions, heavy and light chains, and variant sequences thereof.
BACKGROUND OF THE INVENTION
[0003] Neurological disorders are increasing in incidence and
prevalence worldwide, and as such therapies are in imminent need.
However, neurological disorders are phenotypically heterogeneous,
both in familial and sporadic forms, and often have an unknown
etiology. Thus targeting a single pathological mechanism, is less
likely to provide disease modification with a significant clinical
benefit, unless the nature of the pathological mechanism is the key
"driver" of the disease.
[0004] Several mechanisms and pathways have been implicated in
neurological disorders such as neurological diseases, including
accumulation of neurotoxic substances, inflammation, lipid
metabolism, oxidative stress, autophagy, protein degradation and
mitochondrial dysfunction. However, it remains unclear whether they
are the cause of the disease or the consequence of the primary
and/or secondary damage. Consequently, therapies based on some of
these individual mechanisms have not been clinically successful.
Many efforts to develop disease-modifying therapies for
neurological diseases have followed a toxin-reducing approach given
that accumulation of misfolded toxic proteins in the brain is
considered to be a key pathogenic factor for some neurodegenerative
diseases. However, clinical success by lowering toxic proteins has
been limited, such as AB in Alzheimer's Disease, although recent
trials in patients with mild disease show encouraging results.
[0005] Targeting pathogenesis (the biological mechanism(s) that
lead to the diseased state) may be a suitable approach for
prophylactic or preventative treatment; however, targeting
pathophysiology (the endogenous biological mechanisms operating
within the diseased state) may be a better approach for therapeutic
intervention in a neurological disorder that is already
present.
[0006] It is possible to use this alternative pathophysiological
therapeutic approach by targeting the endogenous neurotrophic and
neuroprotective pathways that play a role in neuronal survival,
function, plasticity, and homeostasis. There is evidence indicating
that endogenous mechanisms can be significantly down regulated in
neurological disorders.
[0007] Neurotrophins are endogenous growth factors that regulate
the development, maintenance and functions of the central and
peripheral nervous systems (CNS and PNS respectively). The Nerve
Growth Factor (NGF) family of ligands primarily signal through a
high-affinity Trk receptor [TrkA for NGF, TrkB for BDNF (Brain
Derived Neurotrophic Factor) and NT-4 (Neurotrophin 4, NT-4/5),
TrkC for NT-3 (Neurotrophin 3)] and also by binding to the
low-affinity pan-neurotrophin receptor, p75.sup.NTR. Signal
transduction through Trk receptors usually enhance cell survival,
whereas signalling of neurotrophins through p75.sup.NTR, in absence
of Trk receptors, in general, facilitate apoptosis.
[0008] There is preclinical evidence supporting the role of the
BDNF-TrkB pathway in promoting the survival and function of CNS
neurons both in vitro and in vivo. Further, four clinical trials
using BDNF have been conducted in ALS. In addition, a phase I,
double-blind, placebo-controlled single ascending dose study in
healthy volunteers with subcutaneous injection of a TrkB agonist
antibody (Clinical Trial NCT01262690, sponsor: Pfizer) was
terminated due to the emergent safety concern of sensory symptoms
(no study results were published).
[0009] In summary, there remains a need for treatment of
neurological disorders and other disorders where restoring or
enhancing the BDNF-TrkB pathway by activating TrkB can be
beneficial.
SUMMARY OF THE INVENTION
[0010] The present invention provides a TrkB binding agonist,
wherein the agonist potentiates BDNF-induced and/or NT-4-induced
agonism of TrkB. In one embodiment, the invention provides a TrkB
binding agonist, wherein the agonist potentiates BDNF-induced
agonism of TrkB.
[0011] The present invention also provides a TrkB binding agonist
that binds to an epitope comprised within beta sheets A and G, and
the region between beta sheets A and A', of the D5 domain of TrkB.
In this context, the term "epitope" refers to that portion of the
antigen (TrkB) that makes contact with the TrkB binding protein,
for example that portion of TrkB that approaches the TrkB binding
protein to less than or equal to 4.5 .ANG.. In one embodiment, this
TrkB binding agonist does not compete with BDNF. Agonists binding
to this region of TrkB may:
a) interact with one or more of the following residues of human
TrkB: Thr290, Glu293, Ser294, Asp358, Ser375, Lys372, GIn373,
Glu341; b) approach to less than or equal to 4.5 .ANG. a residue
from human TrkB selected from the group consisting of: T288, 1289,
T290, F291, L292, E293, S294, K308, D358, E371, K372, Q373, I374,
and S375; c) bind to human TrkB in which a residue selected from
the group: E210, F285, T288, T290, F291, E293, D370 and K372 are
mutated with an altered affinity in comparison with human TrkB with
no mutations; d) bind to human TrkB and results in peptides derived
from human TrkB containing part or the whole of the sequence from
residues 284-291 (numbering according to full length human TrkB)
being more resistant to deuterium incorporation compared to
corresponding peptides derived from uncomplexed human TrkB or e)
bind to a peptide having the amino acid sequence set forth in SEQ
ID NO: 71.
[0012] The present invention also provides a TrkB binding agonist
that does binds to an epitope comprised within the juxta-membrane
region (W381-H430) of TrkB. In this context, the term "epitope"
refers to that portion of the antigen (TrkB) that makes contact
with the TrkB binding protein, for example that portion of TrkB
that approaches the TrkB binding protein to less than or equal to
4.5 .ANG.. In one embodiment, this TrkB binding agonist does not
compete with BDNF. Agonists binding to this region may:
a) binds to human TrkB extracellular domain in which a residue
selected from the group: N389, D394, V395, I396, Y397, E398, D399,
Y400 and T402 is mutated with an altered affinity in comparison
with human TrkB extracellular domain with no mutations; b) binds to
human TrkB and results in peptides derived from human TrkB
containing part or the whole of the sequence from residues 385-398
(numbering according to full length human TrkB) being more
resistant to deuterium incorporation compared to corresponding
peptides derived from uncomplexed human TrkB; or c) binds to a
peptide having the amino acid sequence set forth in SEQ ID NO:
69.
[0013] The present invention also provides a TrkB binding agonist
that competes for binding to TrkB with a reference antibody having:
(a) a heavy chain sequence of SEQ ID NO: 27 and a light chain
sequence of SEQ ID NO: 28; or (b) a heavy chain sequence of SEQ ID
NO: 29 and a light chain sequence of SEQ ID NO: 30; or (c) a heavy
chain sequence of SEQ ID NO: 31 and a light chain sequence of SEQ
ID NO: 32. In one embodiment, this TrkB binding agonist does not
compete with BDNF. The present invention also provides a TrkB
binding agonist that maintains levels of TrkB on the cell surface.
In one embodiment, the agonist activates TrkB in the absence of
BDNF.
[0014] The present invention also provides a TrkB binding agonist
comprising (i) any one or a combination of CDRs selected from
CDRH1, CDRH2, CDRH3 from SEQ ID NO: 27, and/or CDRL1, CDRL2, CDRL3
from SEQ ID NO:28; or (ii) a CDR variant of (i), wherein the
variant has 1, 2, or 3 amino acid modifications in each CDR. In
certain embodiments, particular CDRs are as present in SEQ ID NO:
27 or SEQ ID NO: 28 whilst other CDRs are variants of those present
in SEQ ID NO: 27 or SEQ ID NO: 28. In one embodiment, the invention
provides a TrkB binding agonist comprising:
(a) CDRL1 as present in SEQ ID NO: 28 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; (b) CDRL3 as
present in SEQ ID NO: 28 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications; and (c) CDRH3 as present in SEQ ID
NO: 27 or a variant thereof, which variant has 1, 2 or 3 amino acid
modifications.
[0015] The present invention also provides a TrkB binding agonist
comprising any one or a combination of the following CDRs: (a)
CDRH1 of SEQ ID NO: 6; (b) CDRH2 of SEQ ID NO: 7; (c) CDRH3 of SEQ
ID NO: 8; (d) CDRL1 of SEQ ID NO: 3; (e) CDRL2 of SEQ ID NO: 4;
and/or (f) CDRL3 of SEQ ID NO: 5.
[0016] The present invention also provides a TrkB binding agonist
comprising a VH region comprising a sequence at least 80% identical
to the sequence of SEQ ID NO: 40 and/or a VL region comprising a
sequence at least 76% identical to the sequence of SEQ ID NO:
41.
[0017] The present invention also provides a TrkB binding agonist
comprising: (a) a Heavy Chain (HC) sequence at least 90% identical
to SEQ ID NO: 42; and/or (b) a Light Chain (LC) sequence at least
85% identical to SEQ ID NO: 43.
[0018] The present invention also provides one or more nucleic acid
sequences which encode the TrkB binding agonist as defined herein.
In one embodiment, the present invention provides a nucleic acid
sequence which encodes a TrkB binding agonist as defined
herein.
[0019] The present invention also provides one or more expression
vectors comprising the one or more nucleic acid sequences as
defined herein. In one embodiment, the present invention provides
an expression vector comprising a nucleic acid sequence which
encodes a TrkB binding agonist as defined herein.
[0020] The present invention also provides a recombinant host cell
comprising the one or more nucleic acid sequences as defined
herein, or one or more expression vectors as defined herein. In one
embodiment, the present invention provides a recombinant host cell
comprising a nucleic acid sequence which encodes a TrkB binding
agonist as defined herein, or an expression vector comprising a
nucleic acid sequence which encodes a TrkB binding agonist as
defined herein.
[0021] The present invention also provides a method for the
production of the TrkB binding agonist as defined herein, which
method comprises culturing the host cell as defined herein under
conditions suitable for expression of said nucleic acid sequence or
vector. In one embodiment of this method, the TrkB binding agonist
is expressed and purified.
[0022] The present invention also provides a TrkB binding agonist
produced by the method described herein.
[0023] The present invention also provides a pharmaceutical
composition comprising the binding agonist as defined herein, and
one or a combination of pharmaceutically acceptable carriers,
excipients or diluents.
[0024] The present invention also provides a method of treating a
neurological disorder in a subject in need thereof comprising
administering to said subject a therapeutically effective amount of
the TrkB binding agonist as defined herein, or the pharmaceutical
composition as defined herein to the subject. In one embodiment,
the subject is human.
[0025] The present invention also provides a method of treating a
neurological disorder or other disorder where restoring or
enhancing the BDNF-TrkB pathway by activating TrkB can be
beneficial, in a subject in need thereof comprising administering
to said subject a therapeutically effective amount of the TrkB
binding agonist as defined herein, or the pharmaceutical
composition as defined herein to the subject. In one embodiment,
the subject is human.
[0026] The present invention also provides a method of treating a
neurological disorder in a subject in need thereof comprising
administering to said subject a therapeutically effective amount of
a potentiator of BDNF-induced agonism of TrkB to the subject. In
one embodiment, the subject is human.
[0027] The present invention also provides a method of treating a
neurological disorder or other disorder where restoring or
enhancing the BDNF-TrkB pathway by activating TrkB can be
beneficial, in a subject in need thereof comprising administering
to said subject a therapeutically effective amount of a potentiator
of BDNF-induced agonism of TrkB to the subject. In one embodiment,
the subject is human.
[0028] The present invention also provides a TrkB binding agonist
as defined herein, or a pharmaceutical composition as defined
herein for use in therapy.
[0029] The present invention also provides a TrkB binding agonist
as defined herein, or a pharmaceutical composition as defined
herein for use in the treatment of a neurological disorder or other
disorder where restoring or enhancing the BDNF-TrkB pathway by
activating TrkB can be beneficial.
[0030] The present invention also provides a TrkB binding agonist
as defined herein, or a pharmaceutical composition as defined
herein for use in the treatment of a neurological disorder.
[0031] The present invention also provides a potentiator of
BDNF-induced agonism of TrkB, for use in therapy.
[0032] The present invention also provides a potentiator of
BDNF-induced agonism of TrkB, for use in the treatment of a
neurological disorder or other disorder where restoring or
enhancing the BDNF-TrkB pathway by activating TrkB can be
beneficial.
[0033] The present invention also provides a use of a TrkB binding
agonist as defined herein, or a pharmaceutical composition as
defined herein, in the manufacture of a medicament for the
treatment of a neurological disorder.
[0034] The present invention also provides a use of a TrkB binding
agonist as defined herein, or a pharmaceutical composition as
defined herein, in the manufacture of a medicament for the
treatment of neurological disorder or other disorder where
restoring or enhancing the BDNF-TrkB pathway by activating TrkB can
be beneficial.
[0035] The present invention also provides a use of a potentiator
of BDNF-induced agonism of TrkB, in the manufacture of a medicament
for the treatment of a neurological disorder.
[0036] The present invention also provides a use of a potentiator
of BDNF-induced agonism of TrkB, in the manufacture of a medicament
for the treatment of a neurological disorder or other disorder
where restoring or enhancing the BDNF-TrkB pathway by activating
TrkB can be beneficial.
[0037] The present invention also provides a method of treatment, a
TrkB binding agonist, or the use, as described herein, wherein
treatment comprises enhancement of: cell survival, and/or neuronal
repair, and/or neuronal plasticity.
BRIEF DESCRIPTION OF THE FIGURES
[0038] FIG. 1A: Western Blot of BDNF and 1G11 induced TrkB
phosphorylation and TrkB downstream signalling and cell surface
levels of TrkB in rat cortical neurons over time. Rat cortical
neurons in culture (7 days in vitro) were treated with 0.8 nM BDNF
or 7.3 nM 1G11 as indicated at 37.degree. C. Cell lysates (30 .mu.g
protein) were resolved on a SDS-PAGE under reducing conditions and
immunoblotted with antibodies as indicated.
Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) was used as
internal control. For measuring cell surface levels of TrkB, rat
cortical neurons following treatment with 1G11 were treated with
sulfo-NHS-biotin for 1 hour on ice followed by lysis and isolation
of biotinylated proteins using streptavidin agarose beads. Isolated
proteins were resolved and immunoblotted with anti-TrkB antibody.
Note: Ctrl, untreated zero time control with medium change.
[0039] FIG. 1B: BDNF and 1G11 induced cell surface levels of TrkB
as a proportion of total cellular TrkB over time. Rat cortical
neurons in culture (7 days in vitro) were treated with 0.8 nM BDNF
or 7.3 nM 1G11 as indicated at 37.degree. C. The relative surface
levels of TrkB compared to total TrkB was determined by
densitometric analysis. The ratio of surface TrkB to total TrkB is
shown as fold change compared to untreated control at zero time
point.
[0040] FIG. 2: Representative data showing TrkB agonist antibodies
with different properties--potentiators and non-competitors (3A3,
1G11, 8E5), competitors (5D11), non-competitors (2A1, 3A4, 5C7).
100% activity represents TrkB activation at saturating
concentration of BDNF i.e. 10 nM EC100.
[0041] FIG. 3: Structural interactions between the BDNF/NT-4
homodimer and two TrkB D5 domains showing various secondary
structures (beta sheets, loops, N-terminus "Nt", and C-terminus
"Ct"), based on published structures.
[0042] FIGS. 4A and 4B: Structural interactions between the
BDNF/NT-4 homodimer and two TrkB D5 domains and 1G11. The residues
identified by alanine scanning are shown in FIG. 4A, and the
residues identified by co-crystal X-ray crystallography are shown
in FIG. 4B.
[0043] FIG. 5: Further structural analysis of the BDNF/NT-4
homodimer and two TrkB D5 domains and 1G11 shows that the
N-terminus of NT-4/BDNF potentially protrudes into a space between
TrkB and the Heavy Chain of the 1G11 Fab.
[0044] FIG. 6: addition of molecular surfaces to the structural
analysis of the BDNF/NT-4 homodimer and two TrkB D5 domains and
1G11 shows that the V.sub.K CDRs L1 and L3, and CDRH3 interact
closely with TrkB, and there is a cleft between TrkB and CDRs H1
and H2 which could be envisaged to potentially accommodate the
N-terminus of BDNF.
[0045] FIG. 7: structural interactions between the BDNF/NT-4
homodimer and two TrkB D5 domains and 3A3. The residues identified
by alanine scanning are shown, which are all in the JM region
(C-terminal to the D5 domain and N-terminal to the transmembrane
region). The JM residues were extended using beta-strand
geometry.
[0046] FIG. 8: structural interactions between the BDNF/NT-4
homodimer and two TrkB D5 domains and 5D11. The residues identified
by alanine scanning are shown, which are at the ligand binding
site.
[0047] FIG. 9 shows the fractional difference in deuterium update
between TrkB peptides derived from
MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His alone or in complex with
1G11.
[0048] FIG. 10 shows the fractional difference in deuterium update
between TrkB peptides derived from
MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His alone or in complex with
3A3.
DETAILED DESCRIPTION OF THE INVENTION
[0049] "TrkB" as used herein refers to naturally occurring,
endogenous or recombinant TrkB protein. TrkB is a receptor for the
ligand brain-derived neurotrophic factor (BDNF) or neurotrophin-4
(NT-4/NT-4/5). Both BDNF and NT-4 can bind to TrkB, and can
activate many common signalling pathways. The non-covalent
homodimeric ligand BDNF or NT-4 activates TrkB, which is a receptor
tyrosine kinase. Activated TrkB can regulate (a) cell survival, (b)
neuronal repair, and/or (c) neuronal plasticity.
[0050] As described above, TrkB-BDNF signalling plays an important
role in promoting the survival, repair, and plasticity of cells in
the Central Nervous System (CNS) and Peripheral Nervous System
(PNS). Though the causal factor/mechanisms in most neurological
disorders are different, the survival and function of the different
types of cells that can undergo degeneration are dependent on an
efficient BDNF-TrkB signalling mechanism. Therefore, restoring or
enhancing the BDNF-TrkB pathway by activating TrkB using an agonist
is expected to promote cell survival, neuronal repair and neuronal
plasticity to offer a differentiating treatment for disorders.
Activating TrkB may mediate both central and peripheral mechanism
of action.
[0051] BDNF levels have been reported to be decreased in many
neurological and pathophysiological diseases and the
phenotypes/deficits can be attributed to this reduction. Under BDNF
deficient pathophysiological conditions, where TrkB receptor levels
remain unaltered, a physiological cellular/system response could
still be elicited if the administered therapeutic can: (i) activate
(agonise) TrkB, (ii) not compete with the reduced levels of BDNF,
(iii) potentiate the cellular signalling induced by the reduced
physiological levels of BDNF, and/or (iv) maintain the cell surface
levels of TrkB, which otherwise may potentially result in temporary
desensitization to the therapeutic.
[0052] In the context of the present invention, the term "TrkB
binding agonist" refers to a molecule that agonises or activates
human full length TrkB (having the sequence set out in SEQ ID NO:
2) in the absence of BDNF or NT-4. The TrkB binding agonist may
produce a similar biological effect as the natural ligand BDNF/NT-4
when it binds to the receptor. TrkB is a receptor tyrosine kinase
and therefore elicits multiple cellular signalling pathways.
Agonism may be measured by activation of TrkB, including measuring
increased phosphorylated levels of TrkB (pTrkB), increased
phosphorylated levels of Akt (p-Akt), increased phosphorylated
levels of Erk (p-Erk), and/or increased phosphorylated levels of
Creb (p-Creb). For example, the TrkB binding agonist may activate
the TrkB receptor in the absence of BDNF or NT-4 resulting in pTrkB
levels of at least 10%, at least 20% at least 25%, at least 30%, at
least 40%, at least 50% or at least 60%, relative to BDNF maximal
response (set at 100%). In one embodiment, the TrkB binding agonist
may activate the TrkB receptor in the absence of BDNF or NT-4
resulting in pTrkB levels of at least 10%, at least 20% at least
25%, at least 30%, at least 40%, at least 50% or at least 60%,
relative to NT-4 maximal response (set at 100%).
[0053] Affinity is the strength of binding of one molecule, e.g.
the TrkB binding agonist, to another, e.g. its target antigen, at a
single binding site. The binding affinity of a TrkB binding agonist
to TrkB may be determined by equilibrium methods (e.g.
enzyme-linked immunoabsorbent assay (ELISA) or radioimmunoassay
(RIA)), or kinetics (e.g. BIACORE.TM. analysis). For example, the
Biacore.TM. methods described in Example 1.1 (and data in Table 1)
may be used to measure binding affinity.
[0054] Certain TrkB binding agonists of the invention exhibit an
equilibrium dissociation constant to human TrkB or human TrkB ECD
of (KD) of 100 nM or less, 50 nM or less, 25 nM or less, or 10 nM
or less. The smaller the KD numerical value, the stronger the
binding. The reciprocal of KD (i.e. 1/KD) is the equilibrium
association constant (KA) having units M-1. A skilled person will
appreciate that the larger the KA numerical value, the stronger the
binding. The dissociation rate constant (kd) or "k.sub.off"
describes the stability of the TrkB binding agonist: TrkB complex,
i.e. the fraction of complexes that decay per second. For example,
the dissociation rate constant k.sub.off between certain TrkB
agonists and human TrkB or human TrkB ECD is 10.times.10.sup.-4/s
or less, 9.times.10.sup.-4/s or less, 8.times.10.sup.-4/s or less,
7.times.10.sup.-4/s or less, 6.times.10.sup.-4/s or less,
5.times.10.sup.-4/s or less, or 4.times.10.sup.-4/s or less. The
association rate constant (ka) or "k.sub.on" describes the rate of
TrkB binding agonist: TrkB complex formation. For example, the
association rate constant k.sub.on between certain TrkB agonists
and human TrkB or human TrkB ECD is 3.times.10.sup.4/Ms or more,
4.times.10.sup.4/Ms or more, 5.times.10.sup.4/Ms or more,
6.times.10.sup.4/Ms or more, or 7.times.10.sup.4/Ms or more.
[0055] In one embodiment, the TrkB binding agonist specifically
binds to full length human TrkB and does not bind to human TrkA or
human TrkC or human p75NTR. The term "specifically binds" means
that the TrkB binding agonist binds to TrkB with no or
insignificant binding to other (for example, unrelated) proteins.
The TrkB binding agonist described herein may bind to TrkB with at
least 10, 25, 50, 100, or 1000 fold greater affinity than they bind
to TrkA, TrkC and/or p75NTR. It will be appreciated that this
distinguishes these TrkB binding agonists from BDNF, which can
activate both TrkB and p75NTR (which facilitates cell death).
[0056] Certain TrkB agonists of the invention potentiate
BDNF-induced and/or NT-4-induced TrkB agonism. "Potentiate" is used
herein to mean that BDNF-induced agonism and/or NT-4-induced
agonism of TrkB is more effective in the presence of the TrkB
agonist. BDNF-induced agonism can be measured by assessing
activation of TrkB, for example cellular signalling. A saturating
concentration (i.e. EC100) of BDNF or NT-4 can be used to benchmark
100% activation of TrkB for each ligand in the absence of the TrkB
binding agonist. Potentiation of BDNF-induced agonism can be
defined as BDNF-induced activation of TrkB of more than 100% in the
presence of a TrkB binding agonist and a saturating concentration
(EC100) of BDNF. A saturating concentration of BDNF that can be
used is 10 nM (EC100). In one example, 100% activation of TrkB
represents TrkB activation using BDNF at 10 nM EC100. Potentiation
of NT-4-induced agonism can be defined as NT-4-induced activation
of TrkB of more than 100% in the presence of a TrkB binding agonist
and a saturating concentration (EC100) of NT-4. Activation of TrkB
can be measured by determining the level of phosphorylation of TrkB
(pTrkB). The phosphorylation of TrkB in the presence of a
saturating concentration of BDNF may be at least 110% in the
presence of the TrkB binding agonist, compared with 100% in the
absence of the TrkB binding agonist. For example, the
phosphorylation of TrkB in the presence of a saturating
concentration of BDNF may be at least 115%, at least 120%, at least
125%, at least 130%, at least 135%, at least 140%, at least 145%,
or at least 150% in the presence of the TrkB binding agonist,
compared with 100% in the absence of the TrkB binding agonist.
pTrkB levels may be around 130% in the presence of the TrkB binding
agonist and in the presence of a saturating concentration of BDNF.
pTrkB levels may be around 160% in the presence of the TrkB binding
agonist and in the presence of a saturating concentration of BDNF.
pTrkB levels may be around 120% in the presence of the TrkB binding
agonist and in the presence of a saturating concentration of
BDNF.
[0057] It should be noted that although the potentiation effect can
only be measured in vitro in the presence of a saturating
concentration of BDNF, this saturating concentration of BDNF is not
thought to be necessary in a clinical setting. It is hypothesised
that the potentiation effect of the TrkB binding agonist should be
present at any concentration of BDNF. Under BDNF deficient
pathophysiological conditions, where TrkB receptor levels remain
unaltered, a physiological response will be beneficial if the TrkB
binding agonist can potentiate the cellular signalling induced by
the reduced physiological levels of BDNF.
[0058] Certain TrkB agonists of the invention maintain TrkB levels
on the cell surface. Activated tyrosine kinase receptors typically
undergo endocytosis followed by degradation resulting in down
regulation of the cell surface receptors thereby becoming
non-responsive to the ligand temporarily to maintain cellular
homeostasis, which is the case for BDNF's activation effect upon
TrkB. The TrkB binding agonist may maintain the cell surface levels
of TrkB over time in the presence of the agonist. For example, the
cell surface levels of TrkB may be maintained for at least 2 hours,
at least 4 hours, at least 6 hours, at least 8 hours, or at least
10 hours. The TrkB binding agonist may increase the cell surface
levels of TrkB over time in the presence of the agonist. For
example, the cell surface levels of TrkB may be enhanced for at
least 5 hours, at least 10 hours, at least 15 hours, at least 20
hours, or at least 25 hours. The TrkB binding agonist may increase
the available cell surface levels of TrkB to be activated by
agonist; and/or (b) inhibit activated TrkB receptor endocytosis and
degradation. Under BDNF deficient pathophysiological conditions,
where TrkB receptor levels remain unaltered, a physiological
response will be beneficial if the therapeutic TrkB binding agonist
could activate TrkB without altering the cell surface levels of
TrkB, which otherwise may potentially result in temporary
desensitization to the TrkB agonist.
[0059] Certain TrkB binding agonist does not compete with BDNF
and/or NT-4 for binding to TrkB. Competition between the TrkB
binding agonist and BDNF or NT-4 may be determined by a functional
assay to assess activation of TrkB, for example, by measuring the
TrkB binding agonist's activation effect on TrkB by TrkB
phosphorylation both in the presence and absence of BDNF or NT-4.
In one embodiment, a TrkB binding agonist that does not compete
with BDNF will cause no change in TrkB phosphorylation upon
increasing concentrations of the agonist in the presence of
saturating BDNF concentration (e.g. 10 nM, EC100). A TrkB binding
agonist that does compete with BDNF will cause reduced TrkB
phosphorylation upon increasing concentrations of the agonist in
the presence of saturating BDNF concentration (e.g. 10 nM, EC100).
In one embodiment, the TrkB binding agonist is non competitive with
BDNF where the total levels of phosphorylated TrkB in presence of
agonist and a saturating concentration (EC100) BDNF is similar to
the levels of phosphorylatedTrkB in presence of the saturating
concentration of BDNF alone. i.e. Total pTrkB
(EC.sub.100BDNF+agonist).apprxeq.Total pTrkB (EC.sub.100BDNF).
Similarly, in one embodiment, the TrkB binding agonist is non
competitive with NT-4 where the total levels of phosphorylated TrkB
in presence of agonist and a saturating concentration (EC100) NT-4
is similar to the levels of phosphorylatedTrkB in presence of the
saturating concentration of NT-4 alone. i.e. Total pTrkB
(EC.sub.100NT-4+agonist).apprxeq.Total pTrkB (EC.sub.100NT-4).
Levels of phosphorylated TrkB are considered to be similar where
the mean total pTrkB measured in the presence of agonist and
saturating levels of either BDNF or NT-4 is within the range (mean
total pTrkB measured in the presence of saturating levels of either
BDNF or NT-.+-.3 standard deviations). In one embodiment, mean
total pTrkB measured in the presence of agonist and saturating
levels of either BDNF or NT-4 is within the range (mean total pTrkB
measured in the presence of saturating levels of either BDNF or
NT-4.+-.2 standard deviations). In another embodiment, mean total
pTrkB measured in the presence of agonist and saturating levels of
either BDNF or NT-4 is within the range (mean total pTrkB measured
in the presence of saturating levels of either BDNF or NT-4.+-.1
standard deviation). In the foregoing embodiment, the mean total
levels of phosphorylated pTrkB are calculated based on at least
three readings, and the larger of the two standard deviations (i.e.
the standard deviation calculated in the presence of agonist and
the standard deviation calculated in the absence of agonist) is
used. In another embodiment, levels of phosphorylated TrkB are
considered to be similar where the mean total pTrkB measured in the
presence of agonist and saturating levels of either BDNF or NT-4
and the mean total pTrkB measured in the presence of saturating
levels of BDNF or NT-4 differ by less than 10%. In another
embodiment, levels of phosphorylated TrkB are considered to be
similar where the mean total pTrkB measured in the presence of
agonist and saturating levels of either BDNF or NT-4 and the mean
total pTrkB measured in the presence of saturating levels of BDNF
or NT-4 differ by less than 5%. A TrkB binding agonist that does
not compete with BDNF or NT-4 for binding to TrkB is beneficial in
a clinical setting, since the TrkB agonist could activate TrkB and
not compete with the reduced levels of BDNF (or NT-4). Thus, BDNF
and NT-4 can continue to play a physiological role, in addition to
the TrkB binding agonist.
[0060] Alternatively, competition between the TrkB binding agonist
and BDNF or NT-4 may be determined by competition ELISA, FMAT or
BIAcore assays designed to test whether the TrkB binding agonist
and BDNF bind to the same or overlapping epitopes, whether there is
steric inhibition of binding, or whether binding of the first
molecule induces a conformational change in TrkB that prevents or
reduces binding of the second molecule. Competition between the
TrkB binding agonist and BDNF or NT-4 for binding to TrkB may be
none or minimal (i.e. partial). In one embodiment, TrkB-ECD may be
immobilized on a chip surface and either BDNF or NT-4 injected into
flow cells. The TrkB binding agonist was then injected and its
binding capacity to TrkB-ECD in presence of the BDNF or NT-4 was
assessed. Competition may be categorised as: "no" with less than
20% binding of the TrkB agonist; "partial" with 20-60% binding of
the TrkB agonist; and "yes" with more than 60% binding of the TrkB
agonist.
[0061] Certain TrkB binding agonists of the invention may show
cross-reactivity between human TrkB and TrkB from another species.
For example, the TrkB binding agonist specifically binds human,
murine, rat, and cynomolgus TrkB. This is particularly useful,
since drug development typically requires testing of lead drug
candidates in mouse systems before the drug is tested in humans.
The provision of a drug that can bind human, murine, rat, and
cynomolgus species allows one to test results in these system and
make side-by-side comparisons of data using the same drug. This
avoids the complication of needing to find a drug that works for
example against mouse TrkB and a separate drug that works against
human TrkB, and also avoids the need to compare results using
non-identical drugs. Certain TrkB binding agonists exhibit less
than or equal to a 5 fold difference, or less than or equal to a
2-fold difference in EC50 in the phosphorylation of human and rat
TrkB. Certain TrkB binding agonists exhibit less than or equal to a
5 fold difference, or less than or equal to a 2-fold difference in
EC50 in the phosphorylation of human and mouse TrkB. Certain TrkB
binding agonists exhibit less than or equal to a 5 fold difference,
or less than or equal to a 2-fold difference in EC50 in the
phosphorylation of human and cynomolgus TrkB. In one embodiment,
the EC50 values are the mean of at least 3 experiments.
[0062] The TrkB binding agonist may bind to a TrkB epitope that is
in close proximity to the BDNF binding site of TrkB, in particular
close to the specificity patch that binds to the N-terminus of the
ligand. The TrkB binding agonist may bind to TrkB and enhance or
stabilise further binding between BDNF and TrkB (trimeric complex
of agonist:ligand:receptor). The TrkB binding agonist may be a
TrkB-BDNF potentiator, which is non-competitive with BDNF. The TrkB
binding agonist may bind to specific epitopes comprised within the
D5 domain of TrkB and/or JuxtaMembrane (JM) region of TrkB; and/or
compete for binding to TrkB with a reference antibody. It is
possible that binding to these epitopes stabilises TrkB in an
active conformation. The TrkB agonists may (a) increase the
available cell surface levels of TrkB; and/or (b) inhibit activated
TrkB receptor endocytosis and degradation.
[0063] Therefore a TrkB binding agonist is described that: (i)
activates TrkB in the absence of BDNF, (ii) does not compete with
BDNF, (iii) potentiates BDNF-induced or NT-4-induced agonism of
TrkB, and/or (iv) maintains the cell surface level of TrkB.
[0064] The TrkB primary amino acid sequence is highly conserved
across mouse, rat, cynomolgus and human (95% across the full-length
sequence), and particularly conserved in the extracellular domain
(TrkB-ECD). The TrkB-ECD includes 5 domains (D1-D3: C32-C194; D4:
G195-V283; D5: H284-G380) and a short juxtamembrane JM region
(W381-H430). The D5 domain of TrkB can replace full length TrkB for
binding to the ligand (BDNF/NT-4). There are two contact regions
within the ligand binding domain (LBD) of TrkB: the "conserved
patch" and the "specificity patch". The contact residues of TrkB D5
in the conserved patch are from the loops between AB, C'D and EF
beta sheets, and the C-terminus of the D5 domain. The conserved
patch of TrkB binds to the stalk of the ligand (BDNF/NT-4). The
contact residues of TrkB D5 in the specificity patch are from the
external face of the ABED beta sheet. The specificity patch of TrkB
binds to the N-terminus of the ligand (BDNF/NT-4) which is
disordered in the unliganded form and becomes ordered upon binding
to TrkB.
[0065] Most definitions of the term "epitope" specify that the
epitope is the part of the antigen that is in contact with a
binding protein, such as the TrkB agonist (see, for example,
Essential Immunology, Sixth Edition, Blackwell Scientific
Publishing, 1988, Ed. Roitt, Chapter 4). Other definitions refer to
the part of the antigen that is bound by the binding protein. The
terms "contact" and "bound" might imply that an epitope should
properly only consist of residues that directly interact with the
antibody or fragment via non-covalent interactions such as
electrostatics (hydrogen bonding, ionic), Van de Waals forces,
n-effects and hydrophobic bonds. On such a strict interpretation,
an epitope would not include residues that do not interact, but are
in other ways critical for the interaction between antigen and
binding protein. For example, certain residues in the antigen might
be required to be very small (e.g. glycine) to permit the close
interaction required to facilitate direct interaction between other
residues of the antigen and antibody (or fragment). Similarly,
certain residues (e.g. proline) may be required for the antigen
sequence to adopt the correct conformation to permit binding.
[0066] In fact, most of the techniques typically performed in order
to identify "epitope" information do not (and cannot) distinguish
between interacting residues and residues that are critical in
other ways. The following techniques are commonly used: [0067] 1.
Binding of antibodies or fragments thereof to peptides derived from
the antigen (wherein peptides that exhibit significant binding are
considered to contain "the epitope"). [0068] 2. Hydrogen deuterium
exchange (wherein peptides derived from complexed antigen that are
resistant to deuterium incorporation compared to uncomplexed
antigen are deemed to contain "the epitope") [0069] 3. Mutagenesis
studies (e.g. alanine scanning mutagenesis, wherein mutated
positions in the antigen significantly alter binding to the binding
protein are deemed to form part of "the epitope").
[0070] As will be apparent to the skilled person, only techniques
with atomic level resolution (e.g. X-ray crystallography, NMR,
electron microscopy) are capable of distinguishing between residues
that interact and those that are in other ways important. However,
even though these are the only techniques capable of giving
information on the epitope according to a strict definition, it is
submitted that the other techniques nonetheless provide useful
information on residues/sequences that are important for binding to
the target.
[0071] The TrkB binding agonist, 1G11, described in the examples
has several desirable properties as follows: [0072] 1. Potentiates
BDNF-induced and NT-4-induced agonism [0073] 2. Maintains cell
surface levels of TrkB [0074] 3. Cross reactivity with cynomolgus
TrkB
[0075] 1G11 has been shown by X ray crystallography to closely
approach residues T288, F291, K372 and E293. T288 and T291 are
located in D5 beta sheet A; E293 is located between D5 beta sheets
A and A'; and K372 is located in D5 beta sheet G. For example, the
TrkB binding agonist may bind to an epitope which comprises
residues T288, F291, K372, E293, F285, T290 and D370.F285 and T290
are located in D5 beta sheet A. D370 is located in D5 beta sheet G.
Thus, the "epitope" would appear to be comprised within beta sheets
A and G, and the region between beta sheets A and A' of the D5
domain of TrkB. Other TrkB binding agonists contacting this same
"epitope" may be expected to have similar biological activity. Such
binding proteins would be highly desirable.
[0076] Accordingly, in one embodiment, the TrkB binding agonist
may:
a) interact with one or more of the following residues of human
TrkB: Thr290, Glu293, Ser294, Asp358, Ser375, Lys372, GIn373 and
Glu341; b) approach to less than or equal to 4.5 .ANG. a residue
from human TrkB selected from the group consisting of: T288, 1289,
T290, F291, L292, E293, S294, K308, D358, E371, K372, Q373, I374,
and S375; c) bind to human TrkB extracellular domain in which a
residue selected from the group: E210, F285, T288, T290, F291,
E293, D370 and K372 (numbering according to full length human TrkB)
is mutated with an altered affinity in comparison with human TrkB
extracellular domain with no mutations; d) bind to human TrkB and
results in peptides derived from human TrkB containing part or the
whole of the sequence from residues 284-291 (numbering according to
full length human TrkB) being more resistant to deuterium
incorporation compared to corresponding peptides derived from
uncomplexed human TrkB; or e) bind to a peptide having the amino
acid sequence set forth in SEQ ID NO: 71.
[0077] In one embodiment, the TrkB binding agonist may interact
with one or more, two or more, or three or more of the following
residues of human TrkB: Thr290, Glu293, Ser294, Asp358, Ser375,
Lys372, GIn373 and Glu341. In one embodiment, the invention
provides a TrkB binding agonist that interacts with Glu293 and
optionally with one or more, or two or more further residues
selected from the group consisting of: Thr290, Ser294, Asp358,
Ser375, Lys372, GIn373, Glu341. In another embodiment, the
invention provides a TrkB binding agonist that interacts with
Thr290 and Glu 293, or Glu293 and Ser 294, or Thr290, Glu293 and
Ser294.
[0078] In the above embodiments, the interaction may be a direct
interaction or an indirect interaction via water. In one
embodiment, the interaction is a direct interaction. In the context
of this invention, a direct interaction is a hydrogen bond between
the TrkB binding agonist and the named residue(s) of full length
human TrkB. However, it should be noted that the information on
interacting residues need not be derived from full length human
TrkB. For example, human TrkB extracellular domain or the D5-JM
domain of human TrkB may be used. Interacting residues may be
identified by any technique capable of atomic level resolution. In
one embodiment, interacting residues are identified by X-ray
crystallography.
[0079] In one embodiment, the invention provides a TrkB binding
agonist that approaches to less than or equal to 4.5 .ANG. one or
more, two or more or three or more residues from human TrkB
selected from the group consisting of: T288, 1289, T290, F291,
L292, E293, S294, K308, D358, E371, K372, Q373, I374, and S375. In
one embodiment, the invention provides a TrkB binding agonist that
approaches to less than or equal to 4.5 .ANG. Glu293 and optionally
one or more, or two or more further residues selected from the
group consisting of: T288, 1289, T290, F291, L292, S294, K308,
D358, E371, K372, Q373, I374, and S375. In one embodiment, the
invention provides a TrkB binding agonist that approaches to less
than or equal to 4.5 .ANG. Thr290 and Glu 293, or Glu293 and Ser
294, or Thr290, Glu293 and Ser294. In the above embodiment, the
proximity analysis may be conducted on structures identified by any
technique capable of atomic level resolution e.g. X ray
crystallography. The residues of TrkB are numbered as they would be
in full length human TrkB. However, it should be noted that the
information on proximity to the TrkB binding agonist need not be
derived from full length human TrkB. For example, human TrkB
extracellular domain or the D5-JM domain of human TrkB may be
used.
[0080] In one embodiment, the invention provides a TrkB binding
agonist that binds to human TrkB extracellular domain in which a
residue selected from the group: E210, F285, T288, T290, F291,
E293, D370 and K372 (numbering according to full length human TrkB)
is mutated with an altered affinity in comparison with human TrkB
extracellular domain with no mutations. In one embodiment, the
invention provides a TrkB binding agonist that binds to human TrkB
extracellular domain in which a residue selected from the group:
E210, T288, F291, E293, D370 and K372 is mutated with an altered
affinity in comparison with human TrkB extracellular domain with no
mutations. In one embodiment, the invention provides a TrkB binding
agonist that binds to human TrkB extracellular domain in which a
residue selected from the group: F291 and E293 is mutated with an
altered affinity in comparison with human TrkB extracellular domain
with no mutations. Binding may be assessed by any suitable method,
for example, SPR or ELISA. The TrkB may be tagged (e.g.
biotinylated) to facilitate the binding assay, but its sequence may
not be extended by additional amino acids. The term "altered
affinity" refers to the situation where the TrkB binding agonist
exhibits substantially reduced or substantially increased affinity
for the mutated version when compared with human wild type TrkB
extracellular domain. A substantial increase in affinity is where
the mean K.sub.D for the mutated version measured on the basis of
at least three readings is less than or equal to the mean K.sub.D
for human wild type TrkB extracellular domain measured on the basis
of at least three readings minus one standard deviation (the larger
of the standard deviations for the wild type or mutated version
should be used). In one embodiment, a substantial increase in
affinity is where the mean K.sub.D for the mutated version measured
on the basis of at least three readings is less than or equal to
the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings minus two standard
deviations (the larger of the standard deviations for the wild type
or mutated version should be used). In a further embodiment, a
substantial increase in affinity is where the mean K.sub.D for the
mutated version measured on the basis of at least three readings is
less than or equal to the mean K.sub.D for human wild type TrkB
extracellular domain measured on the basis of at least three
readings minus three standard deviations (the larger of the
standard deviations for the wild type or mutated version should be
used). In one embodiment, a substantial increase in affinity is
where the mean K.sub.D for the mutated version measured on the
basis of at least three readings is at least 3 fold less than the
mean K.sub.D for human wild type TrkB extracellular domain measured
on the basis of at least three readings. In another embodiment, a
substantial increase in affinity is where the mean K.sub.D for the
mutated version measured on the basis of at least three readings is
at least 5 fold less than the mean K.sub.D for human wild type TrkB
extracellular domain measured on the basis of at least three
readings. In yet another embodiment, a substantial increase in
affinity is where the mean K.sub.D for the mutated version measured
on the basis of at least three readings is at least 10 fold less
than the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings. A substantial
decrease in affinity is where the mean K.sub.D for the mutated
version measured on the basis of at least three readings is greater
than or equal to the mean K.sub.D for human wild type TrkB
extracellular domain measured on the basis of at least three
readings plus one standard deviation (the larger of the standard
deviations for the wild type or mutated version should be used). In
one embodiment, a substantial decrease in affinity is where the
mean K.sub.D for the mutated version measured on the basis of at
least three readings is greater than or equal to the mean K.sub.D
for human wild type TrkB extracellular domain measured on the basis
of at least three readings plus two standard deviations (the larger
of the standard deviations for the wild type or mutated version
should be used). In a further embodiment, a substantial decrease in
affinity is where the mean K.sub.D for the mutated version measured
on the basis of at least three readings is greater than or equal to
the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings plus three
standard deviations (the larger of the standard deviations for the
wild type or mutated version should be used). In one embodiment, a
substantial decrease in affinity is where the mean K.sub.D for the
mutated version measured on the basis of at least three readings is
at least 3 fold greater than the mean K.sub.D for human wild type
TrkB extracellular domain measured on the basis of at least three
readings. In another embodiment, a substantial decrease in affinity
is where the mean K.sub.D for the mutated version measured on the
basis of at least three readings is at least 5 fold greater than
the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings. In yet another
embodiment, a substantial decrease in affinity is where the mean
K.sub.D for the mutated version measured on the basis of at least
three readings is at least 10 fold greater than the mean K.sub.D
for human wild type TrkB extracellular domain measured on the basis
of at least three readings. In one embodiment, altered affinity
refers to reduced affinity.
[0081] In one embodiment, the invention provides a TrkB binding
protein that binds to human TrkB and results in peptides derived
from human TrkB containing part or the whole of the sequence from
residues 284-291 (numbering according to full length human TrkB)
being more resistant to deuterium incorporation compared to
corresponding peptides derived from uncomplexed human TrkB. In one
embodiment, resistance to deuterium incorporation is assessed at a
time point of between 15 and 300 seconds after dilution into
deuterated buffer (e.g. at one of 15, 60 or 300 seconds).
[0082] Whilst the data from alanine scanning mutagenesis and X-ray
crystallography points to a discontinuous epitope for 1G11, it is
noted that most interactions would appear to be in the most
N-terminal portion of this discontinuous epitope. This is also the
portion that is most strongly protected from hydrogen deuterium
exchange. For this reason, it is expected that binding proteins
binding just to this N-terminal region of the epitope of 1G11 may
have similar properties to 1G11. Accordingly, in one embodiment,
the invention provides a TrkB binding agonist that binds to a
peptide having the amino acid sequence set forth in SEQ ID NO: 71
(a peptide comprising the N-terminal region of the discontinuous
epitope of antibody 1G11). In this context, the term "binds to"
requires a binding response substantially greater than observed for
any non-overlapping peptide of equivalent length derived from human
TrkB extracellular domain. Binding may be assessed by any suitable
method, for example ELISA. The peptides may be tagged (e.g.
biotinylated) to facilitate the binding assay, but the sequence may
not be extended by additional amino acids. It should be noted that
the requirement to bind to a peptide having the sequences specified
does not necessarily mean that the binding protein may not interact
with residues outside of this sequence or, for example, protect
them from e.g. deuterium uptake provided that an "all or nothing"
binding response is achieved (i.e. the levels of binding achieved
by peptides having the sequence set forth in SEQ ID NO:71 being
substantially greater than levels achieved by other,
non-overlapping TrkB peptides). A substantially greater binding
response in the context of this invention refers to the situation
where the mean K.sub.D for a peptide containing the sequence set
forth in SEQ ID NO: 69 (or 70) on the basis of at least three
readings is less than or equal to the mean K.sub.D for the
non-overlapping TrkB peptides measured on the basis of at least
three readings minus one standard deviation (the largest standard
deviation observed for any peptide being used). In one embodiment,
the mean K.sub.D for a peptide containing the sequence set forth in
SEQ ID NO: 71 on the basis of at least three readings is less than
or equal to the mean K.sub.D for the non-overlapping TrkB peptides
measured on the basis of at least three readings minus two standard
deviations (the largest standard deviation observed for any peptide
being used). In a further embodiment, the mean K.sub.D for a
peptide containing the sequence set forth in SEQ ID NO: 71 on the
basis of at least three readings is less than or equal to the mean
K.sub.D for the non-overlapping TrkB peptides measured on the basis
of at least three readings minus three standard deviations (the
largest standard deviation observed for any peptide being used). In
one embodiment, the mean K.sub.D for a peptide containing the
sequence set forth in SEQ ID NO: 71 on the basis of at least three
readings is at least 3 fold lower than the mean K.sub.D for the
non-overlapping TrkB peptides measured on the basis of at least
three readings. In another embodiment, the mean K.sub.D for a
peptide containing the sequence set forth in SEQ ID NO: 71 on the
basis of at least three readings is at least 5 fold lower than the
mean K.sub.D for the non-overlapping TrkB peptides measured on the
basis of at least three readings. In another embodiment, the mean
K.sub.D for a peptide containing the sequence set forth in SEQ ID
NO: 71 on the basis of at least three readings is at least 10 fold
lower than the mean K.sub.D for the non-overlapping TrkB peptides
measured on the basis of at least three readings.
[0083] 1G11 and TrkB binding agonists binding to a similar epitope
may bind to an epitope which is located on TrkB D5 domain proximal
to the BDNF/NT4 "conserved patch" ligand binding site (loops
between AB, C'D and EF beta sheets, and the C-terminus of the D5
domain), and close to the BDNF/NT4 "specificity patch" ligand
binding site (external face of the ABED beta sheet). The N-terminus
of BDNF potentially protrudes into a space between TrkB and these
TrkB binding agonist. Such TrkB binding agonist might be able to
interact with the N-terminus of BDNF, in addition to binding to
TrkB, possibly stabilising the ternary complex leading to
potentiation of the BDNF functional response. Alternatively, such
TrkB binding agonist may stabilise the interaction between TrkB and
BDNF, by binding not at the ligand binding domain, but close to
it.
[0084] The TrkB binding agonists, 3A3 and 8E5 described in the
examples are also capable of potentiating BDNF-induced agonism.
Alanine scanning mutagenesis identifies certain residues in TrkB
critical for 3A3 binding. Because 3A3 and 8E5 share certain
properties and compete for binding to TrkB, it is believed that
they may have overlapping "epitopes". Based on the data for 3A3,
the "epitope" comprises residues E398, Y397, D399, Y400, D394, and
I396. For example, the TrkB binding agonist may bind to an epitope
which comprises residues E398, Y397, D399, and Y400. For example,
the TrkB binding agonist may bind to an epitope which comprises
residues E398, Y397, D399, Y400, D394, I396, V395, N389, and T402.
These residues fall in the juxta-membrane (JM) region (W381-H430).
The JM region is, in the absence of any crystal structure, assumed
to be a long flexible linker region. It is thought that the JM
region may also be important for binding to the ligand. Other TrkB
binding agonists contacting this same "epitope" may be expected to
have similar biological activity. Such binding proteins would be
highly desirable.
[0085] Accordingly, in one embodiment, the TrkB binding agonist
may:
a) bind to human TrkB extracellular domain in which a residue
selected from the group: N389, D394, V395, I396, Y397, E398, D399,
Y400 and T402 is mutated with an altered affinity in comparison
with human TrkB extracellular domain with no mutations; b) bind to
human TrkB and results in peptides derived from human TrkB
containing part or the whole of the sequence from residues 385-398
(numbering according to full length human TrkB) being more
resistant to deuterium incorporation compared to corresponding
peptides derived from uncomplexed human TrkB; or c) bind to a
peptide having the amino acid sequence set forth in SEQ ID NO:
69.
[0086] In one embodiment, the invention provides a TrkB binding
agonist that binds to human TrkB extracellular domain in which a
residue selected from the group: N389, D394, V395, I396, Y397,
E398, D399, Y400 and T402 (numbering according to full length human
TrkB) is mutated with an altered affinity in comparison with human
TrkB extracellular domain with no mutations. In one embodiment, the
invention provides a TrkB binding agonist that binds to human TrkB
extracellular domain in which a residue selected from the group:
D394, I396, Y397, E398, D399 and Y400 is mutated with an altered
affinity in comparison with human TrkB extracellular domain with no
mutations. In one embodiment, the invention provides a TrkB binding
agonist that binds to human TrkB extracellular domain in which a
residue selected from the group: Y397, E398, D399 and Y400 is
mutated with an altered affinity in comparison with human TrkB
extracellular domain with no mutations. Binding may be assessed by
any suitable method, for example, SPR or ELISA. The TrkB may be
tagged (e.g. biotinylated) to facilitate the binding assay, but its
sequence may not be extended by additional amino acids. The term
"altered affinity" refers to the situation where the TrkB binding
agonist exhibits substantially reduced or substantially increased
affinity for the mutated version when compared with human wild type
TrkB extracellular domain. A substantial increase in affinity is
where the mean K.sub.D for the mutated version measured on the
basis of at least three readings is less than or equal to the mean
K.sub.D for human wild type TrkB extracellular domain measured on
the basis of at least three readings minus one standard deviation
(the larger of the standard deviations for the wild type or mutated
version should be used). In one embodiment, a substantial increase
in affinity is where the mean K.sub.D for the mutated version
measured on the basis of at least three readings is less than or
equal to the mean K.sub.D for human wild type TrkB extracellular
domain measured on the basis of at least three readings minus two
standard deviations (the larger of the standard deviations for the
wild type or mutated version should be used). In a further
embodiment, a substantial increase in affinity is where the mean
K.sub.D for the mutated version measured on the basis of at least
three readings is less than or equal to the mean K.sub.D for human
wild type TrkB extracellular domain measured on the basis of at
least three readings minus three standard deviations (the larger of
the standard deviations for the wild type or mutated version should
be used). In one embodiment, a substantial increase in affinity is
where the mean K.sub.D for the mutated version measured on the
basis of at least three readings is at least 3 fold less than the
mean K.sub.D for human wild type TrkB extracellular domain measured
on the basis of at least three readings. In another embodiment, a
substantial increase in affinity is where the mean K.sub.D for the
mutated version measured on the basis of at least three readings is
at least 5 fold less than the mean K.sub.D for human wild type TrkB
extracellular domain measured on the basis of at least three
readings. In yet another embodiment, a substantial increase in
affinity is where the mean K.sub.D for the mutated version measured
on the basis of at least three readings is at least 10 fold less
than the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings. A substantial
decrease in affinity is where the mean K.sub.D for the mutated
version measured on the basis of at least three readings is greater
than or equal to the mean K.sub.D for human wild type TrkB
extracellular domain measured on the basis of at least three
readings plus one standard deviation (the larger of the standard
deviations for the wild type or mutated version should be used). In
one embodiment, a substantial decrease in affinity is where the
mean K.sub.D for the mutated version measured on the basis of at
least three readings is greater than or equal to the mean K.sub.D
for human wild type TrkB extracellular domain measured on the basis
of at least three readings plus two standard deviations (the larger
of the standard deviations for the wild type or mutated version
should be used). In a further embodiment, a substantial decrease in
affinity is where the mean K.sub.D for the mutated version measured
on the basis of at least three readings is greater than or equal to
the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings plus three
standard deviations (the larger of the standard deviations for the
wild type or mutated version should be used). In one embodiment, a
substantial decrease in affinity is where the mean K.sub.D for the
mutated version measured on the basis of at least three readings is
at least 3 fold greater than the mean K.sub.D for human wild type
TrkB extracellular domain measured on the basis of at least three
readings. In another embodiment, a substantial decrease in affinity
is where the mean K.sub.D for the mutated version measured on the
basis of at least three readings is at least 5 fold greater than
the mean K.sub.D for human wild type TrkB extracellular domain
measured on the basis of at least three readings. In yet another
embodiment, a substantial decrease in affinity is where the mean
K.sub.D for the mutated version measured on the basis of at least
three readings is at least 10 fold greater than the mean K.sub.D
for human wild type TrkB extracellular domain measured on the basis
of at least three readings. In one embodiment, altered affinity
refers to reduced affinity.
[0087] In one embodiment, the invention provides a TrkB binding
protein that binds to human TrkB and results in peptides derived
from human TrkB containing part or the whole of the sequence from
residues 385-398 (numbering according to full length human TrkB)
being more resistant to deuterium incorporation compared to
corresponding peptides derived from uncomplexed human TrkB. In one
embodiment, resistance to deuterium incorporation is assessed at a
time point of between 15 and 60 seconds after dilution into
deuterated buffer (e.g. at one of 15 or 60 seconds).
[0088] In one embodiment, the invention provides a TrkB binding
agonist that binds to a peptide having the amino acid sequence set
forth in SEQ ID NO: 69 (a peptide within the juxta-membrane region
containing all the residues identified by alanine scanning
mutagenesis as important for binding to antibody 3A3). In this
context, the term "binds to" requires a binding response
substantially greater than observed for any non-overlapping peptide
of equivalent length derived from human TrkB extracellular domain.
Binding may be assessed by any suitable method, for example ELISA.
The peptides may be tagged (e.g. biotinylated) to facilitate the
binding assay, but the sequence may not be extended by additional
amino acids. In one embodiment, the peptide may have the sequence
set forth as SEQ ID NO: 70 (a smaller peptide, still containing the
residues identified by alanine scanning mutagenesis as important
for binding to antibody 3A3). It should be noted that the
requirement to bind to a peptide having the sequences specified
does not necessarily mean that the binding protein may not interact
with residues outside of this sequence or, for example, protect
them from e.g. deuterium uptake provided that an "all or nothing"
binding response is achieved (i.e. the levels of binding achieved
by peptides having the sequence set forth in SEQ ID NO:69 (or 70)
being substantially greater than levels achieved by other,
non-overlapping TrkB peptides). A substantially greater binding
response in the context of this invention refers to the situation
where the mean K.sub.D for a peptide containing the sequence set
forth in SEQ ID NO: 69 (or 70) on the basis of at least three
readings is less than or equal to the mean K.sub.D for the
non-overlapping TrkB peptides measured on the basis of at least
three readings minus one standard deviation (the largest standard
deviation observed for any peptide being used). In one embodiment,
the mean K.sub.D for a peptide containing the sequence set forth in
SEQ ID NO: 69 (or 70) on the basis of at least three readings is
less than or equal to the mean K.sub.D for the non-overlapping TrkB
peptides measured on the basis of at least three readings minus two
standard deviations (the largest standard deviation observed for
any peptide being used). In a further embodiment, the mean K.sub.D
for a peptide containing the sequence set forth in SEQ ID NO: 69
(or 70) on the basis of at least three readings is less than or
equal to the mean K.sub.D for the non-overlapping TrkB peptides
measured on the basis of at least three readings minus three
standard deviations (the largest standard deviation observed for
any peptide being used). In one embodiment, the mean K.sub.D for a
peptide containing the sequence set forth in SEQ ID NO: 69 (or 70)
on the basis of at least three readings is at least 3 fold lower
than the mean K.sub.D for the non-overlapping TrkB peptides
measured on the basis of at least three readings. In another
embodiment, the mean K.sub.D for a peptide containing the sequence
set forth in SEQ ID NO: 69 (or 70) on the basis of at least three
readings is at least 5 fold lower than the mean K.sub.D for the
non-overlapping TrkB peptides measured on the basis of at least
three readings. In another embodiment, the mean K.sub.D for a
peptide containing the sequence set forth in SEQ ID NO: 69 (or 70)
on the basis of at least three readings is at least 10 fold lower
than the mean K.sub.D for the non-overlapping TrkB peptides
measured on the basis of at least three readings.
[0089] Although the TrkB JM region epitope appears to be distinct
to the TrkB D5 epitope, it is important to note that TrkB binding
agonists 1G11, 3A3 and 8E5 can (at least partially) compete with
each other for binding to TrkB, and therefore the epitopes may be
overlapping. It is possible that the long flexible linker of the
juxta-membrane (JM) region may actually be in close proximity to
the D5 beta sheets A and G, and the region between beta sheets A
and A'. It is possible that when a TrkB binding agonist that binds
to the JM region epitope, it has some additional interactions with
BDNF (for example via the N-terminus of the ligand), and/or
similarly stabilises the ternary complex of receptor plus ligand
plus agonist. Interestingly, residues D394, I396, and Y400 in the
juxta-membrane region confer human TrkB receptor specificity
because these residues are different in rat TrkB (Glu, Leu, Trp
respectively). It is possible that other TrkB binding agonists
binding the same region but making different contacts may exhibit
cross reactivity.
[0090] In some embodiments, the TrkB binding agonist epitope on
TrkB does not overlap with the BDNF ligand binding domain (LBD).
The TrkB binding agonist may bind to an epitope on TrkB that allows
for binding of BDNF to TrkB to form a ternary complex (TrkB agonist
binding agonist+TrkB+BDNF).
[0091] Certain TrkB binding agonist epitopes on TrkB may overlap
with the epitope on TrkB to which a reference antibody binds. In
one embodiment, the invention provides TrkB binding agonists that
compete for binding to TrkB with a reference antibody. In one
embodiment, the TrkB binding agonist competes for binding to TrkB
with a reference antibody, and does not compete for binding to TrkB
with BDNF. The reference antibody may have (a) a heavy chain
sequence of SEQ ID NO: 27 and a light chain sequence of SEQ ID NO:
28; or (b) a heavy chain sequence of SEQ ID NO: 29 and a light
chain sequence of SEQ ID NO: 30; or (c) a heavy chain sequence of
SEQ ID NO: 31 and a light chain sequence of SEQ ID NO: 32.
[0092] The TrkB binding agonists may agonise cellular signalling of
TrkB to enhance (a) cell survival, (b) neuronal repair, and/or (c)
neuronal plasticity. Enhancement is an improved biological function
or response in the presence of the agonist compared with the
absence of the agonist.
[0093] "Cell survival" includes maintaining or promoting growth of
cells in which TrkB is expressed. TrkB is expressed in both the
central (CNS) and peripheral nervous systems (PNS). In CNS, high
levels of TrkB are expressed in cerebral cortex, hippocampus,
thalamus, choroid plexus, and granular layer of the cerebellum,
brain stem, retina and spinal cord. In PNS, TrkB is expressed in
cranial ganglia, vestibular system, sub-maxillary glands and the
dorsal root ganglia. TrkB is widely expressed in the fetal brain.
TrkB is also expressed in other tissues such as skeletal muscle,
kidney and pancreas. TrkB is also expressed in Meissner corpuscles.
Activating TrkB in central nervous system (CNS) and at the
neuromuscular interface in skeletal muscles may regulate cerebral
and spinal cord motor neuron survival and progenitor muscle cell
differentiation. In one example, cell survival includes neuronal
cell survival.
[0094] For example, TrkB binding agonists of the invention may
promote the neuronal survival, for example survival of rat PC12
neuroblastoma cell line stably expressing human full length TrkB
receptor. The TrkB binding agonists 1G11, humanised 1G11, 8E5 and
3A3 can promote the survival of cells (in a rat PC12 neuroblastoma
cell line stably expressing human full length TrkB receptor) in a
concentration-dependent manner with an average EC.sub.50 of
0.006-0.025 nM.
[0095] The TrkB binding agonist may activate endogenously expressed
TrkB receptors in rat brain and/or spinal cord derived neurons,
mouse brain derived neurons, and/or recombinantly expressed
cynomolgus TrkB in CHO cells.
[0096] TrkB can regulate neuronal repair, including axon
regeneration and growth, neurite outgrowth, the rate and extent of
nerve myelination, and muscle regeneration. Repair may be
physiological to maintain homeostasis (i.e. maintaining balance in
response to biological inputs), or as a result of injury and/or
damage. For example, TrkB binding agonist may induce neurite
outgrowth, for example neurite outgrowth in the rat PC12
neuroblastoma cell line stably expressing human full length TrkB
receptor. The TrkB binding agonists 1G11, humanised 1G11 and 8E5
induced neurite outgrowth (in a rat PC12 neuroblastoma cell line
stably expressing human full length TrkB receptor) in a
concentration-dependent manner with an average EC.sub.50 of
0.07-1.58 nM.
[0097] TrkB can regulate neuronal plasticity (neuroplasticity),
encompassing both synaptic plasticity and non-synaptic plasticity.
Neuronal plasticity refers to changes in neural pathways and
synapses due to changes in behaviour, environment, neural
processes, thinking, emotions, and changes resulting from injury
and/or damage. For example, TrkB can regulate synaptic plasticity
functions. Activating TrkB in the central nervous system (CNS) and
at the neuromuscular interface in skeletal muscles may stabilise
the neuromuscular junction (NMJ), and regulate acetyl choline (ACh)
transmission at NMJ.
[0098] The TrkB binding agonist may be a peptide, polypeptide,
protein, RNA aptamer, or a polysaccharide. For example the TrkB
binding agonist is an antigen binding protein. The term "antigen
binding protein" as used herein refers to an antibody, and
alternative antibody formats which are capable of binding to
TrkB.
[0099] The term "antibody" is used herein in the broadest sense to
refer to molecules with an immunoglobulin-like domain (for example
IgG, IgM, IgA, IgD or IgE) and includes monoclonal, recombinant,
synthetic, polyclonal, chimeric, human, humanised, multispecific
antibodies, including bispecific antibodies, and heteroconjugate
antibodies; a single variable domain, antigen binding antibody
fragments (e.g. Fab, F(ab')2, Fv, disulphide linked Fv, single
chain Fv, disulphide-linked scFv, diabodies, TANDAB.TM., etc.) and
modified versions of any of the foregoing. In one embodiment, the
antibody has an IgG, or IgA scaffold. In one embodiment, the
antibody has an IgG scaffold, which may be a four chain or two
chain antibody. The IgG scaffold may comprise some or all the
domains of an antibody (i.e. CH1, CH2, CH3, VH, VL). The antigen
binding protein may comprise an IgG scaffold selected from IgG1,
IgG2, IgG3, IgG4 or IgG4PE. For example, the scaffold may be IgG1.
The scaffold may consist of, or comprise, the Fc region of an
antibody, or a part thereof. The TrkB binding agonist may comprise
a Fc region that is disabled. For example, the Fc region may be
modified with mutations L235A and G237A (EU numbering). This
modification of the Fc region diminishes antibody binding to
Fc.gamma. receptors and C1q, therefore reducing the potential of
the antibody to induce depletion of TrkB positive cells by
antibody-dependent cytotoxicity (ADCC) or complement dependent
cytotoxicity (CDC). This is commonly described as Fc-disablement.
It should be noted that Fc effector function is not critical to the
biological function of the TrkB binding agonist.
[0100] The term "domain" refers to a folded protein structure which
retains its tertiary structure independent of the rest of the
protein. Generally domains are responsible for discrete functional
properties of proteins and in many cases may be added, removed or
transferred to other proteins without loss of function of the
remainder of the protein and/or of the domain. The term "single
variable domain" refers to a folded polypeptide domain comprising
sequences characteristic of antibody variable domains. It therefore
includes complete antibody variable domains such as VH, VHH and VL
and modified antibody variable domains, for example, in which one
or more loops have been replaced by sequences which are not
characteristic of antibody variable domains, or antibody variable
domains which have been truncated or comprise N- or C-terminal
extensions, as well as folded fragments of variable domains which
retain at least the binding activity and specificity of the
full-length domain. A single variable domain that is capable of
binding an antigen or epitope independently of a different variable
region or domain may be referred to as a "domain antibody" or
"dAbr)". A single variable domain may be a human single variable
domain, but also includes single variable domains from other
species such as rodent, nurse shark and Camelid VHH dAbs.TM..
Camelid VHH are immunoglobulin single variable domain polypeptides
that are derived from species including camel, llama, alpaca,
dromedary, and guanaco, which produce heavy chain antibodies
naturally devoid of light chains. Such VHH domains may be humanised
according to standard techniques available in the art, and such
domains are considered to be "single variable domains". As used
herein VH includes camelid VHH domains.
[0101] Alternative antibody formats are those where the CDRs of the
TrkB binding agonist are arranged onto a suitable
non-immunoglobulin protein scaffold or skeleton. The
non-immunoglobulin scaffold may be a derived from the group
consisting of CTLA-4, lipocalin, Protein A derived molecules such
as Z-domain of Protein A (Affibody, SpA), A-domain
(Avimer/Maxibody); heat shock proteins such as GroEl and GroES;
transferrin (trans-body); ankyrin repeat protein (DARPin); peptide
aptamer; C-type lectin domain (Tetranectin); human
.gamma.-crystallin and human ubiquitin (affilins); PDZ domains; LDL
receptor class A domains; EGF domains; scorpion toxin kunitz type
domains of human protease inhibitors; and fibronectin/adnectin.
[0102] The HC and LC domains of the 1G11 TrkB binding agonist are
set out in SEQ ID NO: 27 and SEQ ID NO: 28 respectively. The VH and
VL domains of the humanised 1G11 TrkB binding agonist are set out
in SEQ ID NO: 40 and SEQ ID NO: 41 respectively.
[0103] "CDRs" are defined as the complementarity determining region
amino acid sequences of an antigen binding protein. These are the
hypervariable regions of immunoglobulin heavy and light chains.
There are three heavy chain and three light chain CDRs (or CDR
regions) in the variable portion of an immunoglobulin.
[0104] The CDR regions for SEQ ID NO.27, SEQ ID NO. 28, SEQ ID NO:
40 and SEQ ID NO 41 can be defined by any numbering convention, for
example the Kabat, Chothia, AbM and contact conventions. The CDR
regions for SEQ ID NO.27, SEQ ID NO. 28, SEQ ID NO: 40 and SEQ ID
NO 41 defined by each method are set out in Table 1. It is noted
that with the exception of CDRH2 defined by the Contact method, the
CDR sequences of the mouse 1G11 and humanised 1G11 are identical.
Throughout this specification, amino acid residues are numbered
according to the Kabat numbering convention.
TABLE-US-00001 TABLE 1 Sequence of CDR Kabat Chothia AbM Contact
CDRH1 from SYYIN GYTFTSY (SEQ GYTFTSYYIN TSYYIN SEQ ID (SEQ ID NO:
6) ID NO: 58) (SEQ ID NO: (SEQ ID NO: 62) NOs: 27 and 60) 40 CDRH2
from RIAPGNTYYNEIFKG APGN RIAPGNTY CIGRIAPGNTY SEQ ID NO: (SEQ ID
NO: 7) (SEQ ID NO: (SEQ ID NO: (SEQ ID NO: 63) 27 59) 61) CDRH2
from RIAPGNTYYNEIFKG APGN RIAPGNTY SMGRIAPGNTY SEQ ID NO: (SEQ ID
NO: 7) (SEQ ID NO: (SEQ ID NO: 61) (SEQ ID NO: 64) 40 59) CDRH3
from RGYEGALDY RGYEGALDY RGYEGALDY ARRGYEGALD SEQ ID Nos: (SEQ ID
NO: 8) (SEQ ID NO: 8) (SEQ ID NO: 8) (SEQ ID NO: 65) 27 and 40
CDRL1 from RASQRISNNLH RASQRISNNLH RASQRISNNLH SNNLHWY SEQ ID NOs:
(SEQ ID NO: 3) (SEQ ID NO: 3) (SEQ ID NO: 3) (SEQ ID NO: 66) 28 and
41 CDRL2 from YVSQSIS YVSQSIS YVSQSIS LLIKYVSQSI SEQ ID NOs: (SEQ
ID NO: 4) (SEQ ID NO: 4) (SEQ ID NO: 4) (SEQ ID NO: 67) 28 and 41
CDRL3 from QQSNSWPLT QQSNSWPLT QQSNSWPLT QQSNSWPL SEQ ID NOs: (SEQ
ID NO: 5) (SEQ ID NO: 5) (SEQ ID NO: 5) (SEQ ID NO: 68) 28 and
41
[0105] The main binding residues in the 1G11 TrkB binding agonist
paratope and presumably the humanised 1G11 TrkB binding agonist
paratope are within CDRs L1 (bold residues represent those
approaching the epitope within 4.5 .ANG., underlined residues
represent those that interact directly or indirectly (via water)
with the epitope: RASQRISNNLH/SEQ ID NO:3), L3 (bold residues
represent those approaching the epitope within 4.5 .ANG.,
underlined residues represent those that interact directly or
indirectly (via water) with the epitope: QQSNSWPLT/SEQ ID NO:5) and
H3 (bold residues represent those approaching the epitope within
4.5 .ANG., underlined residues represent those that interact
directly or indirectly (via water) with the epitope: RG{right arrow
over (YE)}GALDY/SEQ ID NO:8). There are only two residues in CDRH2
approaching the epitope within 4.5 .ANG. and only one direct
interaction (bold residues represent those approaching the epitope
within 4.5 .ANG., underlined residues represent those that interact
directly or indirectly (via water) with the epitope:
RIAPGNTYYNEIFKG/SEQ ID NO:7). There is only and a single residue in
CDRH1 that approaches or (indirectly) contacts the epitope (bold
residues represent those approaching the epitope within 4.5 .ANG.,
underlined residues represent those that interact directly or
indirectly (via water) with the epitope: SYYIN/SEQ ID NO:6) and a
single residue in CDRL2 that approaches the epitope (bold residues
represent those approaching the epitope within 4.5 .ANG.,
underlined residues represent those that interact directly or
indirectly (via water) with the epitope: YVSQSIS/SEQ ID NO:4).
Therefore, from a ranking point of view, CDRs L1, L3 and H3 are
most important for binding, followed by CDRH2, then CDRL2 and
CDRH1.
[0106] In one embodiment, the TrkB binding agonist comprises: (a)
CDRL1 as present in SEQ ID NO: 28 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; (b) CDRL3 as
present in SEQ ID NO: 28 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications; and (c) CDRH3 as present in SEQ ID
NO: 27 or a variant thereof, which variant has 1, 2 or 3 amino acid
modifications.
[0107] In one embodiment, CDRL1 is as present in SEQ ID NO: 3 or
SEQ ID NO: 66, or a variant of SEQ ID NO: 3 or SEQ ID NO: 66, which
variant has 1, 2 or 3 amino acid modifications. In a further
embodiment, CDRL1 is as present in SEQ ID NO: 3 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications. In
one embodiment, the modifications within CDRL1 are not in residues
R28, S30 and N32 (numbering from SEQ ID NO: 28). In certain
embodiments, in addition to not modifying R28, S30 and N32, the
modifications within CDRL1 are not in residue 129 and/or in residue
N31 (numbering from SEQ ID NO: 28). In one embodiment, CDRL1 is as
present in SEQ ID NO: 3 or SEQ ID NO: 66. In one embodiment, CDRL1
is as present in SEQ ID NO: 3.
[0108] In one embodiment, CDRL3 is as present in SEQ ID NO: 5 or
SEQ ID NO: 68, or a variant of SEQ ID NO: 5 or SEQ ID NO: 68, which
variant has 1, 2 or 3 amino acid modifications. In a further
embodiment, CDRL3 is as present in SEQ ID NO: 5 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications. In
one embodiment, the modifications within CDRL3 are not in residues
N92 and S93 (numbering from SEQ ID NO: 28). In certain embodiments,
in addition to not modifying N92 and S93, the modifications within
CDRL3 are not in residues S91 and W94 (numbering from SEQ ID NO:
28). In one embodiment, CDRL3 is as present in SEQ ID NO: 5 or SEQ
ID NO: 68. In one embodiment, CDRL3 is as present in SEQ ID NO:
5.
[0109] In one embodiment, CDRH3 is as present in SEQ ID NO: 8 or
SEQ ID NO: 65, or a variant of SEQ ID NO: 8 or SEQ ID NO: 65, which
variant has 1, 2 or 3 amino acid modifications. In a further
embodiment, CDRH3 is as present in SEQ ID NO: 8 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications. In
one embodiment, the modifications in CDRH3 are not in residues R97,
Y99 and E100 (numbering from SEQ ID NO: 27). In one embodiment,
CDRH3 is as present in SEQ ID NO: 8 or SEQ ID NO: 65. In one
embodiment, CDRH3 is as present in SEQ ID NO: 8,
[0110] In one embodiment, in addition to comprising CDRL1, CDRL3
and CDRH3 as defined above, the TrkB binding agonist additionally
comprises CDRH2 as present in SEQ ID NO: 27 or a variant thereof,
or SEQ ID NO: 40 or a variant thereof, wherein variants have 1, 2
or 3 amino acid modifications. In one embodiment, CDRH2 is as
present in SEQ ID NO: 7, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO:
63 or SEQ ID NO: 64, or a variant of SEQ ID NO: 7, SEQ ID NO: 59,
SEQ ID NO: 61, SEQ ID NO: 63 or SEQ ID NO: 64, which variant has 1,
2 or 3 amino acid modifications. In a further embodiment, CDRH3 is
as present in SEQ ID NO: 7 or a variant thereof, which variant has
1, 2 or 3 amino acid modifications. In one embodiment, the
modifications within CDRH2 are not in residue R50 and/or residue
Y57 (numbering from SEQ ID NO: 27). In one embodiment, CDRH2 is as
present in SEQ ID NO: 7, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO:
63 or SEQ ID NO: 64. In one embodiment, CDRH2 is as present in SEQ
ID NO: 7.
[0111] The TrkB binding agonist may comprise CDRL1 (SEQ ID NO:3),
CDRL3 (SEQ ID NO:5), and CDRH3 (SEQ ID NO:8). The TrkB binding
agonist may comprise CDRL1 (SEQ ID NO:3), CDRL3 (SEQ ID NO:5),
CDRH2 (SEQ ID NO:7) and CDRH3 (SEQ ID NO:8).
[0112] In one embodiment, in addition to comprising CDRL1, CDRL3,
CDRH3 and CDRH2 as defined above, the TrkB binding agonist
additionally comprises CDRL2 as present in SEQ ID NO: 28 or a
variant thereof, and CDRH1 as present in SEQ ID NO: 27 or a variant
thereof, wherein variants have 1, 2 or 3 amino acid
modifications.
[0113] In one embodiment, CDRL2 is as present in SEQ ID NO: 4 or
SEQ ID NO: 67, or a variant of SEQ ID NO: 4 or SEQ ID NO: 67, which
variant has 1, 2 or 3 amino acid modifications. In a further
embodiment, CDRL2 is as present in SEQ ID NO: 4 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications. In
one embodiment, the modifications within CDRL2 are not in residue
Y50 (numbering from SEQ ID NO: 28). In one embodiment, CDRL2 is as
present in SEQ ID NO: 4 or SEQ ID NO: 67. In one embodiment, CDRL2
is as present in SEQ ID NO: 4.
[0114] In one embodiment, CDRH1 is as present in SEQ ID NO: 6, SEQ
ID NO: 58, SEQ ID NO: 60 or SEQ ID NO: 62, or a variant of SEQ ID
NO: 6, SEQ ID NO: 58, SEQ ID NO: 60 or SEQ ID NO: 62, which variant
has 1, 2 or 3 amino acid modifications. In a further embodiment,
CDRH1 is as present in SEQ ID NO: 6 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications. In one embodiment,
the modifications within CDRH1 are not in residue Y33 (numbering
from SEQ ID NO: 27). In certain embodiments, in addition to not
modifying Y33, the modifications within CDRH1 are not in residue
S31 (numbering from SEQ ID NO: 27). In one embodiment, CDRH1 is as
present in SEQ ID NO: 6, SEQ ID NO: 58, SEQ ID NO: 60 or SEQ ID NO:
62. In one embodiment, CDRH1 is as present in SEQ ID NO: 6.
[0115] The TrkB binding agonist may comprise CDRH1 of SEQ ID NO: 6;
CDRH2 of SEQ ID NO: 7; CDRH3 of SEQ ID NO: 8; CDRL1 of SEQ ID NO:
3; CDRL2 of SEQ ID NO: 4; and CDRL3 of SEQ ID NO: 5.
[0116] In the foregoing embodiments, certain CDRs may be a variant
sequences with up to 3 amino acid modifications. Each modification
may be independently a substitution, addition or deletion. For
example, a variant sequence may have one addition, one deletion and
one substitution. In one embodiment, each variant sequence has 1
amino acid modification. In another embodiment, each variant
sequence has up to 2 amino acid modifications. In one embodiment,
the modification is a substitution, particularly a conservative
substitution, for example as shown in Table 2.
TABLE-US-00002 TABLE 2 Side chain Members Hydrophobic Met, Ala,
Val, Leu, Ile Neutral hydrophilic Cys, Ser, Thr Acidic Asp, Glu
Basic Asn, Gln, His, Lys, Arg Residues that influence chain
orientation Gly, Pro Aromatic Trp, Tyr, Phe
[0117] The CDRs L1, L2, L3, H1 and H2 tend to structurally exhibit
one of a finite number of main chain conformations. The particular
canonical structure class of a CDR is defined by both the length of
the CDR and by the loop packing, determined by residues located at
key positions in both the CDRs and the framework regions
(structurally determining residues or SDRs). Cluster analysis is
used to define the canonical classes for sets of CDRs, and
canonical templates are then identified by analysing buried
hydrophobics, hydrogen-bonding residues, and conserved glycines and
prolines. The CDRs of antibody sequences can be assigned to
canonical classes by comparing the sequences to the key residue
templates and scoring each template using identity or similarity
matrices.
[0118] There may be multiple variant CDR canonical positions per
CDR, per variable region, per heavy or light chain, and therefore
any combination of substitution may be present in the TrkB binding
agonist, provided that the canonical structure of the CDR is
maintained such that the agonist is capable of binding TrkB.
[0119] The TrkB binding agonist CDR variant may comprise:
(a) a variant of CDRH1 having any one or a combination of: Y32
substituted by I, H, F, T, N, C, E, or D; 134 substituted by V, M
or W; and N35 substituted by H, E, Q, S, Y or T; and/or (b) a
variant of CDRH2 having 151 substituted by L, V, T, S or N; and/or
(c) a variant of CDRH3 having Y102 substituted by H, V, I, S, D or
G; and/or (d) a variant of CDRL1 having any one or a combination
of: L33 substituted by M, V, I or F; and H34 substituted by A, G,
N, S, V or F; and/or (e) a variant of CDRL2 having V51 substituted
by A, T or G; and/or (f) a variant of CDRL3 having any one or a
combination of: Q89 substituted by S, G, F or L; Q90 substituted by
H or N; L96 substituted by P, Y, R, I, W or F.
[0120] The TrkB binding agonist may comprise: a humanised VH
region, or a humanised Heavy Chain (HC) sequence; and/or a
humanised VL region, or a humanised Light Chain (LC) sequence.
[0121] The TrkB binding agonist may comprise: a VH region as set
forth in SEQ ID NO: 40 or a variant thereof, which variant has up
to 10 amino acid modifications; and/or a VL region as set forth in
SEQ ID NO: 41 or a variant thereof, which variant has up to 10
amino acid modifications. The TrkB binding agonist may comprise: a
VH region as set forth in SEQ ID NO: 40 or a variant thereof, which
variant has up to 10 amino acid modifications; and a VL region as
set forth in SEQ ID NO: 41 or a variant thereof, which variant has
up to 10 amino acid modifications. In one embodiment, the variant
VH region has 1, 2 3, 4, 5, 6, 7, 8, 9 or 10 amino acid
modifications. In one embodiment, the variant VL region has 1, 2 3,
4, 5, 6, 7, 8, 9 or 10 amino acid modifications.
[0122] The TrkB binding agonist may comprise: a HC as set forth in
SEQ ID NO: 42 or a variant thereof, which variant has up to 10
amino acid modifications; and/or a LC region as set forth in SEQ ID
NO: 43 or a variant thereof, which variant has up to 10 amino acid
modifications. The TrkB binding agonist may comprise: a HC as set
forth in SEQ ID NO: 42 or a variant thereof, which variant has up
to 10 amino acid modifications; and a LC region as set forth in SEQ
ID NO: 43 or a variant thereof, which variant has up to 10 amino
acid modifications. In one embodiment, the variant HC has 1, 2 3,
4, 5, 6, 7, 8, 9 or 10 amino acid modifications. In one embodiment,
the variant LC has 1, 2 3, 4, 5, 6, 7, 8, 9 or 10 amino acid
modifications.
[0123] The modifications to the VH, VL, HC and LC may be
independently a substitution, addition or deletion such that any
particular variant sequence may contain substitutions, additions
and deletions. Typically, the variation is a substitution,
particularly a conservative substitution, for example as shown in
Table 2 above.
[0124] In certain embodiments, the modification(s) to the VH, VL,
HC and LC may exclude the CDRs such that the CDRs are intact and
the variation is in the remaining portion of the VH, VL, HC or LC
sequence. The variant sequence substantially retains the biological
characteristics of the unmodified TrkB binding agonist.
[0125] The TrkB binding agonist may comprise a VH region comprising
a sequence at least 80% identical to the sequence of SEQ ID NO: 40
and/or a VL region comprising a sequence at least 76% identical to
the sequence of SEQ ID NO: 41. In one embodiment, the VH region
comprises a sequence at least 85% identical, at least 90%
identical, at least 95% identical, at least 97% identical, at least
98% identical, or at least 99% identical to the sequence of SEQ ID
NO: 40. In one embodiment, the VL region comprises a sequence at
least 80% identical, at least 85% identical, at least 90%
identical, at least 95% identical, at least 97% identical, at least
98% identical, or at least 99% identical to the sequence of SEQ ID
NO: 41.
[0126] The TrkB binding agonist may comprise VH region wherein
position 47 is Cys or Ser. The TrkB binding agonist may comprise VH
region wherein position 47 is Cys, Ser, Gly, Ala, Val, Thr or
Asn.
[0127] "Percent identity" between a query sequence and a subject
sequence can be calculated using the "Identities" value, expressed
as a percentage, that is calculated by the BLASTP algorithm when a
subject amino acid sequence has 100% query coverage with a query
amino acid sequence after a pair-wise BLASTP alignment is
performed. Such pair-wise BLASTP alignments between a query amino
acid sequence and a subject amino acid sequence can be performed by
using the default settings of the BLASTP algorithm available on the
National Center for Biotechnology Institute's website with the
filter for low complexity regions turned off.
[0128] The query sequence may be 100% identical to the subject
sequence, or it may include up to a certain integer number of amino
acid or nucleotide alterations as compared to the subject sequence
such that the % identity is less than 100% as set forth above. Such
alterations include at least one amino acid deletion, substitution
(including conservative and non-conservative substitution), or
insertion, and wherein said alterations may occur at the amino- or
carboxy-terminal positions of the query sequence or anywhere
between those terminal positions, interspersed either individually
among the amino acids or nucleotides in the query sequence or in
one or more contiguous groups within the query sequence.
[0129] The % identity may be determined across the entire length of
the query sequence, including the CDRs. Alternatively, the %
identity may exclude the CDRs, for example the CDRs are 100%
identical to the subject sequence and the % identity variation is
in the remaining portion of the query sequence (i.e. SEQ ID NO: 40
or SEQ ID NO: 41), so that the CDR sequence is fixed/intact.
Alternatively, the CDR sequences are as set forth in any of the
foregoing embodiments and % identity variation is calculated over
the remaining portion of the query sequence. The variant sequence
substantially retains the biological characteristics of the
unmodified TrkB binding agonist.
[0130] The present invention also provides a TrkB binding agonist
comprising: (a) a VH region of SEQ ID NO: 40; and/or (b) a VL
region of SEQ ID NO: 41. In one embodiment, the invention provides
a TrkB binding agonist comprising: (a) a VH region of SEQ ID NO:
40; and (b) a VL region of SEQ ID NO: 41.
[0131] The present invention also provides a TrkB binding agonist
comprising: (a) a Heavy Chain (HC) sequence at least 90% identical
to SEQ ID NO: 42; and/or (b) a Light Chain (LC) sequence at least
85% identical to SEQ ID NO: 43. In one embodiment, the HC comprises
a sequence at least 95% identical, at least 97% identical, at least
98% identical, or at least 99% identical to the sequence of SEQ ID
NO: 42. In one embodiment, the LC comprises a sequence at least 90%
identical, at least 95% identical, at least 97% identical, at least
98% identical, or at least 99% identical to the sequence of SEQ ID
NO: 42.
[0132] The TrkB binding agonist may comprise HC region wherein
position 47 is Cys or Ser. The TrkB binding agonist may comprise HC
region wherein position 47 is Cys, Ser, Gly, Ala, Val, Thr or
Asn.
[0133] "Percent identity" is calculated as set out above. Again,
the % identity may be determined across the entire length of the
query sequence, including the CDRs. Alternatively, the % identity
may exclude the CDRs, for example the CDRs are 100% identical to
the subject sequence and the % identity variation is in the
remaining portion of the query sequence (i.e. SEQ ID NO: 40 or SEQ
ID NO: 41), so that the CDR sequence is fixed/intact.
Alternatively, the CDR sequences are as set forth in any of the
foregoing embodiments and % identity variation is calculated over
the remaining portion of the query sequence. The variant sequence
substantially retains the biological characteristics of the
unmodified TrkB binding agonist.
[0134] The present invention also provides a TrkB binding agonist
comprising: (a) a Heavy Chain (HC) sequence of SEQ ID NO: 42;
and/or (b) a Light Chain (LC) sequence of SEQ ID NO: 43. In one
embodiment, the invention provides a TrkB binding agonist
comprising: (a) a Heavy Chain (HC) sequence of SEQ ID NO: 42; and
(b) a Light Chain (LC) sequence of SEQ ID NO: 43.
[0135] The HC and LC domains of the 3A3 TrkB binding agonist are
set out in SEQ ID NO: 29 and SEQ ID NO: 30 respectively. The VH and
VL domains of the humanised 3A3 TrkB binding agonist are set out in
SEQ ID NO: 46 and SEQ ID NO: 47 respectively.
[0136] The TrkB binding agonist may comprise any one or a
combination of CDRs selected from CDRH1, CDRH2, CDRH3 from SEQ ID
NO: 29, and/or CDRL1, CDRL2, CDRL3 from SEQ ID NO:30; or a CDR
variant, wherein the variant has 1, 2, or 3 amino acid
modifications in each CDR. For example, the TrkB binding agonist
may comprise 1, 2, 3, 4, 5, or 6 CDRs selected from CDRH1, CDRH2,
CDRH3 from SEQ ID NO: 29, and/or CDRL1, CDRL2, CDRL3 from SEQ ID
NO:30; or a CDR variant, wherein the variant has 1, 2, or 3 amino
acid modifications in each CDR. In certain embodiments, particular
CDRs are as present in SEQ ID NO: 29 or SEQ ID NO: 30 whilst other
CDRs are variants of those present in SEQ ID NO: 29 or SEQ ID NO:
30. In one embodiment, the invention provides a TrkB binding
agonist comprising one of more of the following CDRs:
(a) CDRL1 as present in SEQ ID NO: 30 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; (b) CDRL2 as
present in SEQ ID NO: 30 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications; (c) CDRL3 as present in SEQ ID NO:
30 or a variant thereof, which variant has 1, 2 or 3 amino acid
modifications; (d) CDRH1 as present in SEQ ID NO: 29 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications; (e)
CDRH2 as present in SEQ ID NO: 29 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; and (f) CDRH3 as
present in SEQ ID NO: 29 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications.
[0137] In one embodiment, the TrkB binding agonist comprises at
least two CDRs, at least three CDRs, at least four CDRs or at least
five CDRs or all six CDRs selected from the group:
(a) CDRL1 as present in SEQ ID NO: 30 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; (b) CDRL2 as
present in SEQ ID NO: 30 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications; (c) CDRL3 as present in SEQ ID NO:
30 or a variant thereof, which variant has 1, 2 or 3 amino acid
modifications; (d) CDRH1 as present in SEQ ID NO: 29 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications; (e)
CDRH2 as present in SEQ ID NO: 29 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; and (f) CDRH3 as
present in SEQ ID NO: 29 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications.
[0138] In embodiments relating to 3A3, certain CDRs may be a
variant sequences with up to 3 amino acid modifications. Each
modification may be independently a substitution, addition or
deletion. For example, a variant sequence may have one addition,
one deletion and one substitution. In one embodiment, each variant
CDR may have 1 amino acid modification. In another embodiment, each
variant sequence has up to 2 amino acid modifications. In one
embodiment, the modification is a substitution, particularly a
conservative substitution, for example as shown in Table 2
above.
[0139] The TrkB binding agonist may comprise any one or a
combination of the following CDRs: CDRH1 of SEQ ID NO: 12; CDRH2 of
SEQ ID NO: 13; CDRH3 of SEQ ID NO: 14; CDRL1 of SEQ ID NO: 9; CDRL2
of SEQ ID NO: 10; and/or CDRL3 of SEQ ID NO: 11. For example, the
TrkB binding agonist may comprise 1, 2, 3, 4, 5, or 6 CDRs selected
from CDRH1 of SEQ ID NO: 12; CDRH2 of SEQ ID NO: 13; CDRH3 of SEQ
ID NO: 14; CDRL1 of SEQ ID NO: 9; CDRL2 of SEQ ID NO: 10; and/or
CDRL3 of SEQ ID NO: 11. The TrkB binding agonist may comprise CDRH1
of SEQ ID NO: 12; CDRH2 of SEQ ID NO: 13; CDRH3 of SEQ ID NO: 14;
CDRL1 of SEQ ID NO: 9; CDRL2 of SEQ ID NO: 10; and CDRL3 of SEQ ID
NO: 11.
[0140] The TrkB binding agonist may comprise: a humanised VH
region, or a humanised Heavy Chain (HC) sequence; and/or a
humanised VL region, or a humanised Light Chain (LC) sequence.
[0141] The TrkB binding agonist may comprise: a VH region as set
forth in SEQ ID NO: 40 or a variant thereof, which variant has up
to 10 amino acid modifications; and/or a VL region as set forth in
SEQ ID NO: 41 or a variant thereof, which variant has up to 10
amino acid modifications. The TrkB binding agonist may comprise: a
VH region as set forth in SEQ ID NO: 40 or a variant thereof, which
variant has up to 10 amino acid modifications; and a VL region as
set forth in SEQ ID NO: 41 or a variant thereof, which variant has
up to 10 amino acid modifications. In one embodiment, the variant
VH region has 1, 2 3, 4, 5, 6, 7, 8, 9 or 10 amino acid
modifications. In one embodiment, the variant VL region has 1, 2 3,
4, 5, 6, 7, 8, 9 or 10 amino acid modifications.
[0142] The TrkB binding agonist may comprise: a HC as set forth in
SEQ ID NO: 42 or a variant thereof, which variant has up to 10
amino acid modifications; and/or a LC region as set forth in SEQ ID
NO: 43 or a variant thereof, which variant has up to 10 amino acid
modifications. The TrkB binding agonist may comprise: a HC as set
forth in SEQ ID NO: 42 or a variant thereof, which variant has up
to 10 amino acid modifications; and a LC region as set forth in SEQ
ID NO: 43 or a variant thereof, which variant has up to 10 amino
acid modifications. In one embodiment, the variant HC has 1, 2 3,
4, 5, 6, 7, 8, 9 or 10 amino acid modifications. In one embodiment,
the variant LC has 1, 2 3, 4, 5, 6, 7, 8, 9 or 10 amino acid
modifications.
[0143] The modifications to the VH, VL, HC and LC may be
independently a substitution, addition or deletion such that any
particular variant sequence may contain substitutions, additions
and deletions. Typically, the variation is a substitution,
particularly a conservative substitution, for example as shown in
Table 2 above.
[0144] The TrkB binding agonist may comprise a VH region comprising
a sequence at least 80% identical to the sequence of SEQ ID NO: 46
and/or a VL region comprising a sequence at least 80% identical to
the sequence of SEQ ID NO: 47. In one embodiment, the VH region
comprises a sequence at least 85% identical, at least 90%
identical, at least 95% identical, at least 97% identical, at least
98% identical, or at least 99% identical to the sequence of SEQ ID
NO: 46. In one embodiment, the VL region comprises a sequence at
least 85% identical, at least 90% identical, at least 95%
identical, at least 97% identical, at least 98% identical, or at
least 99% identical to the sequence of SEQ ID NO: 47. The TrkB
binding agonist may comprise a VH region of SEQ ID NO: 46; and/or a
VL region of SEQ ID NO: 47. The TrkB binding agonist may comprise a
VH region of SEQ ID NO: 46; and a VL region of SEQ ID NO: 47.
[0145] The TrkB binding agonist may comprise: a Heavy Chain (HC)
sequence at least 80% identical to SEQ ID NO: 48; and/or a Light
Chain (LC) sequence at least 80% identical to SEQ ID NO: 49. In one
embodiment, the HC comprises a sequence at least 85%, at least 90%,
at least 95% identical, at least 97% identical, at least 98%
identical, or at least 99% identical to the sequence of SEQ ID NO:
48. In one embodiment, the LC comprises a sequence at least 85%, at
least 90% identical, at least 95% identical, at least 97%
identical, at least 98% identical, or at least 99% identical to the
sequence of SEQ ID NO: 49. The TrkB binding agonist may comprise a
Heavy Chain (HC) sequence of SEQ ID NO: 48; and/or a Light Chain
(LC) sequence of SEQ ID NO: 49. The TrkB binding agonist may
comprise a Heavy Chain (HC) sequence of SEQ ID NO: 48; and a Light
Chain (LC) sequence of SEQ ID NO: 49.
[0146] In the embodiments relating to 3A3, "percent identity" is
calculated as set out above. Again, the % identity may be
determined across the entire length of the query sequence,
including the CDRs. Alternatively, the % identity may exclude the
CDRs, for example the CDRs are 100% identical to the subject
sequence and the % identity variation is in the remaining portion
of the query sequence (i.e. SEQ ID NOs: 46, 47, 48 or 49), so that
the CDR sequence is fixed/intact. Alternatively, the CDR sequences
are as set forth in any of the foregoing embodiments relating to
3A3 and % identity variation is calculated over the remaining
portion of the query sequence. The variant sequence substantially
retains the biological characteristics of the unmodified TrkB
binding agonist.
[0147] The HC and LC domains of the 8E5 TrkB binding agonist are
set out in SEQ ID NO: 31 and SEQ ID NO: 32 respectively.
[0148] The TrkB binding agonist may comprise any one or a
combination of CDRs selected from CDRH1, CDRH2, CDRH3 from SEQ ID
NO: 31, and/or CDRL1, CDRL2, CDRL3 from SEQ ID NO:32; or a CDR
variant, wherein the variant has 1, 2, or 3 amino acid
modifications in each CDR. For example, the TrkB binding agonist
may comprise 1, 2, 3, 4, 5, or 6 CDRs selected from CDRH1, CDRH2,
CDRH3 from SEQ ID NO: 31, and/or CDRL1, CDRL2, CDRL3 from SEQ ID
NO:32; or a CDR variant, wherein the variant has 1, 2, or 3 amino
acid modifications in each CDR. In certain embodiments, particular
CDRs are as present in SEQ ID NO: 31 or SEQ ID NO: 32 whilst other
CDRs are variants of those present in SEQ ID NO: 31 or SEQ ID NO:
32. In one embodiment, the invention provides a TrkB binding
agonist comprising one of more of the following CDRs:
(a) CDRL1 as present in SEQ ID NO: 32 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; (b) CDRL2 as
present in SEQ ID NO: 32 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications; (c) CDRL3 as present in SEQ ID NO:
32 or a variant thereof, which variant has 1, 2 or 3 amino acid
modifications; (d) CDRH1 as present in SEQ ID NO: 31 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications; (e)
CDRH2 as present in SEQ ID NO: 31 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; and (f) CDRH3 as
present in SEQ ID NO: 31 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications.
[0149] In one embodiment, the TrkB binding agonist comprises at
least two CDRs, at least three CDRs, at least four CDRs or at least
five CDRs or all six CDRs selected from the group:
(a) CDRL1 as present in SEQ ID NO: 32 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; (b) CDRL2 as
present in SEQ ID NO: 32 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications; (c) CDRL3 as present in SEQ ID NO:
32 or a variant thereof, which variant has 1, 2 or 3 amino acid
modifications; (d) CDRH1 as present in SEQ ID NO: 31 or a variant
thereof, which variant has 1, 2 or 3 amino acid modifications; (e)
CDRH2 as present in SEQ ID NO: 31 or a variant thereof, which
variant has 1, 2 or 3 amino acid modifications; and (f) CDRH3 as
present in SEQ ID NO: 31 or a variant thereof, which variant has 1,
2 or 3 amino acid modifications.
[0150] In embodiments relating to 8E5, certain CDRs may be a
variant sequences with up to 3 amino acid modifications. Each
modification may be independently a substitution, addition or
deletion. For example, a variant sequence may have one addition,
one deletion and one substitution. In one embodiment, each variant
CDR may have 1 amino acid modification. In another embodiment, each
variant sequence has up to 2 amino acid modifications. In one
embodiment, the modification is a substitution, particularly a
conservative substitution, for example as shown in Table 2
above.
[0151] The TrkB binding agonist may comprise any one or a
combination of the following CDRs: CDRH1 of SEQ ID NO: 18; CDRH2 of
SEQ ID NO: 19; CDRH3 of SEQ ID NO: 20; CDRL1 of SEQ ID NO: 15;
CDRL2 of SEQ ID NO: 16; and/or CDRL3 of SEQ ID NO: 17. For example,
the TrkB binding agonist may comprise 1, 2, 3, 4, 5, or 6 CDRs
selected from CDRH1 of SEQ ID NO: 18; CDRH2 of SEQ ID NO: 19; CDRH3
of SEQ ID NO: 20; CDRL1 of SEQ ID NO: 15; CDRL2 of SEQ ID NO: 16;
and/or CDRL3 of SEQ ID NO: 17. The TrkB binding agonist may
comprise CDRH1 of SEQ ID NO: 18; CDRH2 of SEQ ID NO: 19; CDRH3 of
SEQ ID NO: 20; CDRL1 of SEQ ID NO: 15; CDRL2 of SEQ ID NO: 16; and
CDRL3 of SEQ ID NO: 17.
[0152] The TrkB binding agonist may comprise: a humanised VH
region, or a humanised Heavy Chain (HC) sequence; and/or a
humanised VL region, or a humanised Light Chain (LC) sequence.
[0153] The TrkB binding agonist may comprise: a Heavy Chain (HC)
sequence at least 80% identical to SEQ ID NO: 31; and/or a Light
Chain (LC) sequence at least 80% identical to SEQ ID NO: 32. In one
embodiment, the HC comprises a sequence at least 85%, at least 90%,
at least 95% identical, at least 97% identical, at least 98%
identical, or at least 99% identical to the sequence of SEQ ID NO:
48. In one embodiment, the LC comprises a sequence at least 85%, at
least 90% identical, at least 95% identical, at least 97%
identical, at least 98% identical, or at least 99% identical to the
sequence of SEQ ID NO: 49. The TrkB binding agonist may comprise a
Heavy Chain (HC) sequence of SEQ ID NO: 31; and/or a Light Chain
(LC) sequence of SEQ ID NO: 32. The TrkB binding agonist may
comprise a Heavy Chain (HC) sequence of SEQ ID NO: 31; and a Light
Chain (LC) sequence of SEQ ID NO: 32.
[0154] In the embodiments relating to 8E5, "percent identity" is
calculated as set out above. Again, the % identity may be
determined across the entire length of the query sequence,
including the CDRs. Alternatively, the % identity may exclude the
CDRs, for example the CDRs are 100% identical to the subject
sequence and the % identity variation is in the remaining portion
of the query sequence (i.e. SEQ ID NOs: 31 and 32), so that the CDR
sequence is fixed/intact. Alternatively, the CDR sequences are as
set forth in any of the foregoing embodiments relating to 8E5 and %
identity variation is calculated over the remaining portion of the
query sequence. The variant sequence substantially retains the
biological characteristics of the unmodified TrkB binding
agonist.
[0155] The TrkB binding agonist may be produced by any of a number
of conventional techniques. For example, the TrkB binding agonist
may purified from cells that naturally express them (e.g., an
antibody can be purified from a hybridoma that produces it), or
produced by a recombinant expression system. Generally, host cells
are transformed with a recombinant expression vector encoding the
desired TrkB binding agonist.
[0156] One or more nucleic acid sequences encoding the TrkB binding
agonist are also described. For embodiments relating to 1G11, a
single nucleic acid sequence may comprise SEQ ID NO: 44 encoding
the heavy chain; and/or SEQ ID NO: 45 encoding the light chain, or
SEQ ID NO: 44. Alternatively, the invention provides a nucleic acid
comprising SEQ ID NO: 44 encoding the heavy chain; and/or a
separate nucleic acid comprising SEQ ID NO: 45 encoding the light
chain. In one embodiment, a single nucleic acid sequence may
comprise SEQ ID NO: 50 encoding the heavy chain; and/or SEQ ID NO:
51 encoding the light chain. In an alternative embodiment, the
invention provides a nucleic acid comprising SEQ ID NO: 50 encoding
the heavy chain; and/or a separate nucleic acid comprising SEQ ID
NO: 51 encoding the light chain.
[0157] An expression vector comprising the nucleic acid sequence
which encodes the TrkB binding agonist is also described. A
recombinant host cell comprising the nucleic acid sequence, or the
expression vector is also described. The host cell may be an
isolated host cell. The host cell is usually not part of a
multicellular organism (e.g., plant or animal). The host cell may
be a non-human host cell. A wide range of host cells can be
employed, including Prokaryotes (including Gram negative or Gram
positive bacteria, for example Escherichia coli, Bacilli sp.,
Pseudomonas sp., Corynebacterium sp.), Eukaryotes including yeast
(for example Saccharomyces cerevisiae, Pichia pastoris), fungi (for
example, Aspergillus sp.), or higher Eukaryotes including insect
cells and cell lines of mammalian origin (for example, CHO, Perc6,
HEK293, HeLa, NS0). Suitable host cells include mammalian cells
such as CHO (e.g. CHOK1 and CHO-DG44). Appropriate cloning and
expression vectors for use with bacterial, fungal, yeast, and
mammalian cellular hosts and methods of cloning are known in the
art.
[0158] A method for the production of the TrkB binding agonist is
described, which method comprises culturing the host cell under
conditions suitable for expression of the nucleic acid sequence or
vector. In one embodiment, the TrkB binding agonist is purified
(e.g. by conventional protein purification procedures). A TrkB
binding agonist that is produced by this method is also described.
The invention thus provides a population of substantially
homogeneous TrkB binding agonist, substantially free of
contaminating materials.
[0159] Upon expression and production of the TrkB binding agonist,
post-translational modifications may occur. This may include the
cleavage of certain leader sequences, the addition of various sugar
moieties in various glycosylation patterns, deamidation (for
example at an asparagine or glutamine residue), oxidation (for
example at a methionine, tryptophan or free cysteine residue),
disulfide bond scrambling, isomerisation (for example at an
aspartic acid residue), C-terminal lysine clipping (for example
from one or both heavy chains), and N-terminal glutamine
cyclisation (for example in the heavy and/or light chain). The TrkB
agonists may have have been subjected to, or have undergone, one or
more post-translational modifications. The modification may occur
in a CDR, the variable framework region, or the constant region.
The modification may result in a change in charge of the
molecule.
[0160] Deamidation is an enzymatic reaction primarily converting
asparagine (N) to iso-aspartic acid (iso-aspartate) and aspartic
acid (aspartate) (D) at approximately 3:1 ratio. This deamidation
reaction is therefore related to isomerization of aspartate (D) to
iso-aspartate. The deamidation of asparagine and the isomerisation
of aspartate, both involve the intermediate succinimide. To a much
lesser degree, deamidation can occur with glutamine residues in a
similar manner. Deamidation can occur in a CDR, in a Fab (non-CDR
region), or in the Fc region.
[0161] Oxidation can occur during production and storage (i.e. in
the presence of oxidizing conditions) and results in a covalent
modification of a protein, induced either directly by reactive
oxygen species or indirectly by reaction with secondary by-products
of oxidative stress. Oxidation happens primarily with methionine
residues, but may occur at tryptophan and free cysteine residues.
Oxidation can occur in a CDR, in a Fab (non-CDR) region, or in the
Fc region.
[0162] Disulfide bond scrambling can occur during production and
basic storage conditions. Under certain circumstances, disulfide
bonds can break or form incorrectly, resulting in unpaired cysteine
residues (--SH). These free (unpaired) sulfhydryls (--SH) can
promote shuffling.
[0163] N-terminal glutamine (Q) and glutamate (glutamic acid) (E)
in the heavy chain and/or light chain is likely to form
pyroglutamate (pGlu) via cyclization. Most pGlu formation happens
in the production bioreactor, but it can be formed
non-enzymatically, depending on pH and temperature of processing
and storage conditions. Cyclization of N-terminal Q or E is
commonly observed in natural human antibodies.
[0164] C-terminal lysine clipping is an enzymatic reaction
catalyzed by carboxypeptidases, and is commonly observed in
recombinant and natural human antibodies. Variants of this process
include removal of lysine from one or both heavy chains due to
cellular enzymes from the recombinant host cell. Administration of
the TrkB binding agonist to the human subject/patient is likely to
result in the removal of any remaining C-terminal lysines within
the human body.
[0165] In the present invention, the post-translational
modifications and changes in primary amino acid sequence described
above, do not typically result in significant changes in antigen
binding affinity, biological activity, PK/PD, aggregation,
immunogenicity, or binding to the Fc receptor.
[0166] The TrkB binding agonist may be incorporated into
pharmaceutical compositions for use in the treatment of the human
diseases. In one embodiment, the pharmaceutical composition
comprises a TrkB binding agonist optionally in combination with one
or more pharmaceutically acceptable carriers and/or excipients
and/or diluents. An example of a pharmaceutical composition may
comprise one or a combination of buffer(s), salt(s), amino acid(s),
polyol(s), sugar(s), surfactant(s), detergent(s), antioxidant(s),
and/or chelator(s).
[0167] Pharmaceutical compositions may be administered as a bolus
or intermittently (for example by injection or by use of sustained
release formulations) or by continuous infusion. Routes of
administration include, but are not limited to, intravenous,
intrathecal, intraperitoneal, intradermal, subcutaneous, topical,
transtympanic, intracochlear, intraocular, intravitreally,
intramuscular and intraportal. Pharmaceutical compositions may be
suitable for topical administration (which includes, but is not
limited to, epicutaneous, inhaled, intranasal or ocular
administration) or enteral administration (which includes, but is
not limited to, oral or rectal administration). For example, the
composition is suitable for intravenous or intrathecal
administration. In another embodiment, the composition is suitable
for intravitreal administration.
[0168] Pharmaceutical compositions may comprise between 1 mg to 10
g of TrkB binding agonist, for example between 5 mg and 1 g of
antigen binding protein. Alternatively, the composition may
comprise between 5 mg and 500 mg, for example between 5 mg and 50
mg.
[0169] Effective doses and treatment regimes for administering the
TrkB binding agonist may be dependent on factors such as the age,
weight and health status of the patient and disease to be treated.
Pharmaceutical formulations may be immediate release formulations
and sustained release formulations. Sustained release formulations
are particularly desirable for transtympanic and intracochlea
delivery.
[0170] The pharmaceutical composition may comprise a kit of parts
of the TrkB binding agonist together with other medicaments,
optionally with instructions for use. For convenience, the kit may
comprise the reagents in predetermined amounts with instructions
for use.
[0171] The terms "individual", "subject" and "patient" are used
herein interchangeably. In one embodiment, the subject is a mammal,
such as a primate, for example a cynomolgus, marmoset or monkey. In
another embodiment, the subject is a human.
[0172] The TrkB binding agonist may also be used in therapy, for
example in methods of treatment or prevention. Treatment and
encompasses alleviation or reduction or cure of at least one aspect
or symptom or biological manifestations of a disorder.
[0173] For example, treatment includes: (1) amelioration of one or
more of the biological manifestations of the disorder (2)
interference with (a) one or more points in the biological cascade
that leads to or is responsible for the disorder or (b) one or more
of the biological manifestations of the disorder, (3) alleviation
of one or more of the symptoms or effects associated with the
disorder, (4) slowing the progression of the disorder or one or
more of the biological manifestations of the disorder, and/or (5)
diminish the likelihood of severity of a disorder or biological
manifestations of the disorder.
[0174] Prevention includes the prophylactic administration of a
drug to diminish the likelihood of the onset of or to delay the
onset of a disorder or biological manifestation thereof, for
example by interference with one or more points in the biological
cascade that leads to or is responsible for the disorder.
[0175] The TrkB binding agonist is used in an effective amount for
the methods described. A therapeutically effective amount of the
TrkB binding agonist is an amount effective to ameliorate or reduce
one or more symptoms of, or to prevent or cure, the disorder.
[0176] The TrkB agonist can be used to enhance: cell survival,
and/or neuronal repair, and/or neuronal plasticity, both centrally
at the CNS and peripherally at the PNS.
[0177] The TrkB agonist can be used to treat or prevent a
neurological disorder or other disorder where restoring or
enhancing the BDNF-TrkB pathway by activating TrkB can be
beneficial. Considering the mechanisms of action of the BDNF-TrkB
pathway and that TrkB is widely expressed in the CNS and PNS, the
TrkB binding agonist can provide therapy to subjects with
neurological disorders, neurodegenerative disorders, developmental
disorders and other disorders. These are disorders where TrkB
agonism is expected to be beneficial.
[0178] For example, the TrkB binding agonist may agonise TrkB
cellular signalling at the NeuroMuscular Junction (NMJ) and enhance
NMJ development, stability and maintenance. The TrkB binding
agonist may agonise TrkB cellular signalling in skeletal muscle and
regulate proliferation and differentiation of skeletal muscle
progenitor cells. This may be beneficial, for example, following
muscle injury and degeneration. The TrkB binding agonist may
agonise TrkB cellular signalling in Schwann cells and enhance axon
regeneration and growth. This may be beneficial, for example,
following nerve injury and degeneration.
[0179] Disorders include diseases, conditions, syndromes, symptoms
and signs. Neurological disorders include neurological diseases,
conditions, syndromes, symptoms and signs. A neurological disorder
can include those where there is a disruption in the structure or
function of component(s) of the central and peripheral nervous
system, including the brain, spinal cord, cranial nerves,
peripheral nerves, nerve roots, autonomic nervous system,
neuromuscular junction, and/or muscles. Neurological disorders can
be phenotypically heterogeneous, and often have an unknown
etiology. Several mechanisms and pathways have been implicated in
neurological disorders such as neurological diseases. In these
diseases, specific symptoms and structure/function relationships
have led to an understanding of the underlying etiology.
[0180] The disorder can also be one where restoring or enhancing
the BDNF-TrkB pathway by activating TrkB can be beneficial. For
example, in those disorders involving degeneration or dysfunction
of cells expressing TrkB.
[0181] The TrkB binding agonist may be used in a method of
treatment or prevention of the disorders described herein. More
specifically, the TrkB binding agonist may be used in a method of
treatment of the disorders described herein. The disorders comprise
neurodegenerative diseases, optic neuropathies and retinal
degenerative conditions, hearing loss disorders, psychiatric
disorders, neurodevelopmental disorders, disorders of body weight
regulation, muscular disorders and other CNS disorders.
[0182] Neurodegenerative diseases include: Amyotrophic Lateral
Sclerosis (ALS), Huntington's Disease (HD), Alzheimer's Disease
(AD), Motor Neuron Disease (including progressive muscular
atrophy), Parkinson's disease, prion diseases including
Creutzfeldt-Jakob disease (OD), Lewy body disease, Spinal muscular
atrophy, Multiple system atrophy, Dementia (including
fronto-temporal dementia) and tauopathies. More particular
neurodegenerative disorders include ALS, Huntington's Disease and
Motor Neuron Disease.
[0183] In one example, treatment of ALS includes promoting motor
neuron survival and function. The TrkB binding agonist may have a
neuroprotective and/or neuro-repair effect.
[0184] In one example, treatment in reference to dementia or
Alzheimer's disease means: to slow the progression of cognitive
function decline. The TrkB binding agonist may enhance cell
survival, promote neurite outgrowth, and/or regulating synapse
plasticity. The TrkB binding agonist may prevent or delay neuronal
dysfunction in Alzheimer's disease and other dementias.
[0185] In one example, treatment in reference to Huntington's
disease means to slow disease progression, including but not
limited to slowing progression of cognitive function decline. The
TrkB binding agonist may enhance cell survival, promote neurite
outgrowth, and/or regulating synapse plasticity. The TrkB binding
agonist may prevent or delay neuronal dysfunction in Huntington's
disease.
[0186] Optic neuropathies include, for example conditions impacting
retinal ganglion cells (RGC) and/or the optic nerve. Particular
optic neuropathies include: glaucoma (for example open angle
glaucoma, wide angle glaucoma, angle closure glaucoma (acute and
chronic), normal tension glaucoma), anterior ischaemic optic
neuropathy (AION) (for example, non-arteritic ischeamic optic
neuropathy (NAION)), posterior ischemic optic neuropathy, radiation
optic neuropathy, compressive optic neuropathy (for example,
papilledema), infiltrative optic neuropathy, traumatic optic
neuropathy, mitochondrial optic neuropathy, toxic optic
neuropathies, hereditary optic neuropathies (for example, autosomal
dominant optic atrophy (ADOA; optic atrophy type Kjer), Leber
hereditary optic neuropathy, Rosenberg Chutorian syndrome, Wolfram
syndrome, optic nerve hypoplasia), optic neuritis (for example,
neuromyelitis optica, papillitis). Retinal degenerative disorders
would include hereditary dystrophies (e.g. retinitis pigmentosa) or
acquired conditions including age-related macular degeneration (wet
and dry). In one embodiment, optic neuropathies include for example
conditions impacting retinal ganglion cells (RGC) and/or the optic
nerve. Particular optic neuropathies include: glaucoma (for example
open angle glaucoma, wide angle glaucoma, primary angle closure
glaucoma, normal tension glaucoma), anterior ischaemic optic
neuropathy (AION), non-anterior ischeamic optic neuropathy (NAION),
traumatic optic neuropathies and Leber hereditary optic neuropathy.
Retinal degenerative disorders would include hereditary or acquired
conditions including age-related macular degeneration (wet and
dry).
[0187] Hearing loss disorders include sensorineural hearing loss
(SNHL) (bilateral, unilateral and unspecified) and composite
hearing loss (in which there are sensorineural and conductive loss
elements; bilateral, unilateral and unspecified). Sensorineural
hearing loss includes sensory (cochlear related) or a neural (8th
nerve related) hearing loss. Sensorineural hearing loss may result
from end organ lesions. End organ lesions associated with
sensorineural hearing loss include: acoustic trauma (due to a noise
greater than, for example 85 decibels (db)), viral endolymphatic
labyrinthitis, Meniere's disease, cerebellopontine angle tumors of
the 8th nerve, bacterial or viral infection of the 8th nerve
ganglia, (e.g. with herpes zoster oticus), purulent labyrinthitis
arising from acute otitis media, purulent meningitis, chronic
otitis media, sudden deafness including that of viral origin, e.g.,
viral endolymphatic labyrinthitis caused by viruses including
mumps, measles, influenza, chickenpox, mononucleosis and
adenoviruses) and transient ischaemic deafness, fractures of the
temporal bone extending into the middle ear and rupturing the
tympanic membrane and possibly the ossicular chain, fractures
affecting the cochlea, and acoustic neurinoma, which are tumors
generally of Schwann cell origin that arise from either the
auditory or vestibular divisions of the 8th nerve. The end organ
lesion hearing loss can be congenital, such as that caused by
rubella, anoxia during birth, bleeding into the inner ear due to
trauma during delivery, ototoxic drugs administered to the mother,
erythroblastosis fetalis, and hereditary conditions including
Waardenburg's syndrome and Hurler's syndrome. Sensorineural hearing
loss may alternatively be age-related, for example, presbycusis
(including presbyacusia), which is a sensorineural hearing loss
occurring as a normal part of aging. Sensorineural hearing loss may
ototoxic hearing loss (hearing loss resulting from an ototoxic drug
(e.g. certain antiobiotics, certain chemotherapeutics, certain
salicylate compounds--particularly aspirin--certain
diuretics--common loop diuretics- and certain quinines) that
affects the auditory portion of the inner ear, particularly the
organ of Corti). Sudden sensorineural hearing loss, hidden hearing
loss (thought to result from synapse and auditory fibre loss in the
inner ear) and tinnitus (possibly resulting from damage to the
Organ of Corti) are also included.
[0188] Psychiatric disorders include: anxiety, mood disorder,
depression (including major depressive disorder), panic disorder,
post-traumatic stress disorder (PTSD), attention deficit
hyperactive disorder (ADHD), bipolar disorder and
Schizophrenia.
[0189] Neurodevelopmental disorders include: Angelman syndrome,
Prader-Willi syndrome Autistic disorder and Rett syndrome.
[0190] Energy balance depends on the regulation of two central
circuits that control feeding behaviour: the central nervous system
(CNS) must coordinate and integrate appetite, food-seeking
behaviour, and thermoregulation; and signals relating to satiety
(e.g., from the gut) and overall energy balance must be transduced
in the periphery and feedback to the CNS. Therefore disorders of
bodyweight regulation include: anorexia nervosa, cachexia, unwanted
weight loss (including unwanted weight loss that is related to
and/or caused by cancer treatment), sarcopenia, obesity and
opioid-induced emesis.
[0191] Muscular disorders include sarcopenia.
[0192] Other CNS disorders include: diabetic neuropathy, epilepsy,
multiple sclerosis, migraine, nerve injury (including traumatic
brain injury (TBI), spinal cord injury and peripheral nerve
injury), peripheral neuropathies, neuromuscular diseases (including
myasthenia gravis and myasthenic syndromes), sleep disorders and
Stroke. In one example, peripheral neuropathy includes Chemotherapy
induced peripheral neuropathy (CIPN). CIPN is a major dose-limiting
side effect of many anticancer drugs.
[0193] The TrkB binding agonist can be used as a treatment for
neurological disorders and other disorders that will significantly
slow/stop/delay progression of the disorder, enhance daily life
function, and increase life span of the subject.
[0194] In one embodiment, the TrkB binding agonist is used for the
treatment of any one of the following disorders: Amyotrophic
Lateral Sclerosis (ALS), Huntington's Disease (HD), Stroke, Spinal
Cord Injury, Alzheimer's Disease (AD), motor neuron disorders,
traumatic brain injury (TBI), dementias, tauopathies, peripheral
neuropathy, nerve injury, peripheral nerve injury, Parkinson's
disease, prion diseases including Creutzfeldt-Jakob disease (CJD),
psychiatric disorders, Schizophrenia, multiple sclerosis, Rett
syndrome, Lewy body disease, Multiple system atrophy, myasthenia
gravis, diabetic neuropathy, retinal degeneration, glaucoma,
hearing loss, bodyweight regulation, anorexia nervosa, cachexia,
neuromuscular disease, mood and depressive disorders,
post-traumatic stress disorder, attention deficit hyperactive
disorder (ADHD), bipolar disorder, anxiety, Autistic disorder,
pain, disorders involving bodyweight regulation, anorexia nervosa,
cachexia, unwanted weight loss, and opioid-induced emesis.
[0195] When used for the treatment or prevention of the disorders
described above, the TrkB binding agonist may be administered
together with one or more active agents, for example active agents
approved for use in the treatment or prevention of the particular
disorder and more particularly agents considered to form the
current standard of care. Where combination therapy is envisaged,
the active agents may be administered simultaneously, separately or
sequentially in one or more pharmaceutical compositions.
[0196] In embodiments in which the TrkB binding agonist of the
invention is used for the treatment of Alzheimer's disease, it may
be used in combination with cholinesterase inhibitors and/or
memantine.
[0197] In embodiments in which the TrkB binding agonist of the
invention is used for the treatment of ALS, it may be used in
combination with riluzole.
[0198] In embodiments in which the TrkB binding agonist of the
invention is used for the treatment of glaucoma, it may be used in
combination with one or more of: prostaglandin analogues, beta
blockers, alpha agonists and carbonic anhydrase inhibitors. In
another embodiment in which the TrkB binding agonist of the
invention is used for the treatment of glaucoma, it may be used in
combination with selective laser trabeculoplasty (SLT) and argon
laser trabeculoplasty (ALT).
[0199] In one embodiment, the TrkB binding agonist of the invention
may used in combination with cochlear implant as a co-therapy to
treat sensorineural hearing loss. In another embodiment, the TrkB
binding agonist of the invention, this may used in combination with
steroids to treat sensorineural hearing loss. In another
embodiment, the TrkB binding agonist of the invention, this may
used in combination with gene therapy, for example ATOH1 gene
therapy, to treat sensorineural hearing loss.
[0200] In one particular embodiment, the TrkB binding agonist
administered in combination with an ototoxic agent. The skilled
person will appreciate that may prevent hearing impairment
resulting from the ototoxic agent and may further permit higher
doses of the ototoxic agent to be administered to the patient.
[0201] The present invention also has the following
embodiments:
Embodiment 1. A TrkB binding agonist, wherein the agonist
potentiates BDNF-induced agonism of TrkB. Embodiment 2. The TrkB
binding agonist of embodiment 1, wherein the agonist does not
compete with BDNF for binding to TrkB. Embodiment 3. The TrkB
binding agonist of embodiment 1 or 2, wherein the potentiating
effect of BDNF-induced agonism of TrkB is measured by increased
activation of TrkB in the presence of a saturating concentration of
BDNF in the presence of the TrkB binding agonist, compared with the
absence of the TrkB binding agonist. Embodiment 4. The TrkB binding
agonist of embodiment 3, wherein increased activation of TrkB is
measured by increased levels of phosphorylation of TrkB. Embodiment
5. The TrkB binding agonist of embodiment 4, wherein the
phosphorylation of TrkB in the presence of a saturating
concentration of BDNF is 100% in the absence of the TrkB binding
agonist, compared with at least 110% in the presence of the TrkB
binding agonist. Embodiment 6. The TrkB binding agonist of
embodiment 4 or 5, wherein the phosphorylation of TrkB in the
presence of a saturating concentration of BDNF is 100% in the
absence of the TrkB binding agonist, compared with at least 115%,
at least 120%, at least 125%, at least 130%, at least 135%, at
least 140%, at least 145%, or at least 150% in the presence of the
TrkB binding agonist. Embodiment 7. A TrkB binding agonist that
does not compete with BDNF for binding to TrkB, and binds to an
epitope comprised within beta sheets A and G, and the region
between beta sheets A and A', of the D5 domain of TrkB. Embodiment
8. The TrkB binding agonist according to embodiment 7, wherein the
epitope comprises residues T288, F291, K372, and E293. Embodiment
9. A TrkB binding agonist that does not compete with BDNF for
binding to TrkB, and binds to an epitope comprised within the
juxta-membrane region (W381-H430) of TrkB. Embodiment 10. The TrkB
binding agonist according to embodiment 9, wherein the epitope
comprises residues E398, Y397, D399, and Y400. Embodiment 11. A
TrkB binding agonist that does not compete with BDNF for binding to
TrkB, and competes for binding to TrkB with a reference antibody
having: (a) a heavy chain sequence of SEQ ID NO: 27 and a light
chain sequence of SEQ ID NO: 28; or (b) a heavy chain sequence of
SEQ ID NO: 29 and a light chain sequence of SEQ ID NO: 30; or (c) a
heavy chain sequence of SEQ ID NO: 31 and a light chain sequence of
SEQ ID NO: 32. Embodiment 12. The TrkB binding agonist of any one
of embodiments 7 to 11, wherein the TrkB binding agonist
potentiates the BDNF induced agonism of TrkB. Embodiment 13. A TrkB
binding agonist, wherein the agonist activates TrkB in the absence
of BDNF, and maintains TrkB levels on the cell surface. Embodiment
14. The TrkB binding agonist according to any one of the preceding
embodiments wherein the TrkB binding agonist does not bind to the
ligand binding domain of TrkB. Embodiment 15. A TrkB binding
agonist comprising: (a) (i) any one or a combination of CDRs
selected from CDRH1, CDRH2, CDRH3 from SEQ ID NO: 27, and/or CDRL1,
CDRL2, CDRL3 from SEQ ID NO:28; or
[0202] (ii) a CDR variant of (i), wherein the variant has 1, 2, or
3 amino acid modifications in each CDR; or
(b) a VH region comprising a sequence at least 80% identical to the
sequence of SEQ ID NO: 40 and/or a VL region comprising a sequence
at least 80% identical to the sequence of SEQ ID NO: 41. Embodiment
16. A TrkB binding agonist comprising any one or a combination of
the following CDRs:
(a) CDRH1 of SEQ ID NO: 6;
(b) CDRH2 of SEQ ID NO: 7;
(c) CDRH3 of SEQ ID NO: 8;
(d) CDRL1 of SEQ ID NO: 3;
[0203] (e) CDRL2 of SEQ ID NO: 4; and/or
(f) CDRL3 of SEQ ID NO: 5.
[0204] Embodiment 17. The TrkB binding agonist according to
embodiment 15 or 16, wherein the binding agonist comprises CDRL1,
CDRL3, and CDRH3. Embodiment 18. The TrkB binding agonist according
to embodiment 17, wherein the binding agonist additionally
comprises CDRH2. Embodiment 19. The TrkB binding agonist according
to any one of embodiments 15 to 18, wherein the binding agonist
comprises: (a) a humanised VH region, or a humanised Heavy Chain
(HC) sequence; and/or (b) a humanised VL region, or a humanised
Light Chain (LC) sequence. Embodiment 20. The TrkB binding agonist
according to any one of embodiments 15 to 19, wherein VH position
47 is Cys, Ser, Gly, Ala, Val, Thr or Asn. Embodiment 21. A TrkB
binding agonist comprising: (a) a VH region of SEQ ID NO: 40;
and/or (b) a VL region of SEQ ID NO: 41. Embodiment 22. The TrkB
binding agonist according to any one of embodiments 15 to 21,
wherein the binding agonist comprises: (a) a Heavy Chain (HC)
sequence at least 80% identical to SEQ ID NO: 42; and/or (b) a
Light Chain (LC) sequence at least 80% identical to SEQ ID NO: 43.
Embodiment 23. A TrkB binding agonist comprising: (a) a Heavy Chain
(HC) sequence of SEQ ID NO: 42; and/or (b) a Light Chain (LC)
sequence of SEQ ID NO: 43. Embodiment 24. The TrkB binding agonist
according to any one of embodiments 15 to 23 that agonises human
TrkB receptor, does not compete with BDNF, and potentiates the
BDNF-induced agonism of TrkB. Embodiment 25. The TrkB binding
agonist according to any one of the preceding embodiments, wherein
the Fc region is disabled. Embodiment 26. The TrkB binding agonist
according to any one of the preceding embodiments, wherein the
binding agonist comprises a synthetic sequence, a humanised
sequence, or a chimeric sequence. Embodiment 27. A nucleic acid
sequence which encodes the TrkB binding agonist as defined in any
one of the preceding embodiments. Embodiment 28. The nucleic acid
sequence according to embodiment 27, wherein the sequence comprises
SEQ ID NO: 44 encoding the heavy chain; and/or SEQ ID NO: 45
encoding the light chain. Embodiment 29. An expression vector
comprising the nucleic acid sequence as defined in embodiment 27 or
28. Embodiment 30. A recombinant host cell comprising the nucleic
acid sequence as defined in embodiment 27 or 28, or the expression
vector as defined in embodiment 29. Embodiment 31. A method for the
production of the TrkB binding agonist as defined in any one of
embodiments 1 to 26, which method comprises culturing the host cell
as defined in claim 30 under conditions suitable for expression of
said nucleic acid sequence or vector, whereby the TrkB binding
agonist is expressed and purified. Embodiment 32. A TrkB binding
agonist produced by the method of embodiment 31. Embodiment 33. A
pharmaceutical composition comprising the TrkB binding agonist as
defined in any one of embodiments 1 to 26 or embodiment 32, and one
or a combination of pharmaceutically acceptable carriers,
excipients or diluents. Embodiment 34. A TrkB binding agonist as
defined in any one of embodiments 1 to 26 or embodiment 32, or a
pharmaceutical composition as defined in embodiment 33 for use in
therapy. Embodiment 35. A TrkB binding agonist as defined in any
one of embodiments 1 to 26 or embodiment 32, or a pharmaceutical
composition as defined in embodiment 33 for use in the treatment of
a neurological disorder. Embodiment 36. A TrkB binding agonist as
defined in any one of embodiments 1 to 26 or embodiment 32, or a
pharmaceutical composition as defined in embodiment 33, for use in
the treatment of a neurological disorder or other disorder where
restoring or enhancing the BDNF-TrkB pathway by activating TrkB can
be beneficial. Embodiment 37. A TrkB binding agonist for use
according to embodiment 35 or 36, wherein the disorder is: a
neurodegenerative disease, an optic neuropathy, a retinal
degenerative condition, a disorder involving hearing loss, a
psychiatric disorder, a neurodevelopmental disorder, a disorder of
body weight regulation, a muscular disorder and another CNS
disorder. Embodiment 38. A TrkB binding agonist for use according
to embodiment 37, wherein the disorder is: Amyotrophic Lateral
Sclerosis (ALS), Huntington's Disease (HD), Alzheimer's Disease
(AD), Motor Neuron Disease, Parkinson's disease, prion diseases,
Lewy body disease, Spinal muscular atrophy, Multiple system
atrophy, Dementia and tauopathies, glaucomaanterior ischaemic optic
neuropathy (AION), non-anterior ischeamic optic neuropathy (NAION),
traumatic optic neuropathies, Leber hereditary optic neuropathy,
age-related macular degeneration, neural deafness, cochlear
deafness, tinnitus, sensorineural hearing loss, composite hearing
loss, anxiety, mood disorder, depression, panic disorder,
post-traumatic stress disorder (PTSD), attention deficit
hyperactive disorder (ADHD), bipolar disorder, Schizophrenia,
Angelman syndrome, Prader-Willi syndrome, Autistic disorder, Rett
syndrome, anorexia nervosa, cachexia, unwanted weight loss,
sarcopenia, obesity, opioid-induced emesis, sarcopenia, diabetic
neuropathy, epilepsy, multiple sclerosis, migraine, nerve injury,
peripheral neuropathy, neuromuscular disease, sleep disorder and
Stroke. Embodiment 39. The TrkB binding agonist of any one of
embodiments 34, 35, 36, 37 or 38, wherein treatment comprises
enhancement of: cell survival, and/or neuronal repair, and/or
neuronal plasticity. Embodiment 40. A potentiator of BDNF-induced
agonism of TrkB, for use in therapy.
EXAMPLES
1. TrkB Agonists
[0205] Mouse monoclonal antibodies against the TrkB receptor were
generated by immunization of Balb/c mice with recombinant human
TrkB extracellular domain (hereafter referred to as TrkB-ECD, SEQ
ID NO:1, D1-D2-D3-D4-D5-3M, C32-H430, 399 amino acids) generated
using HEK293-6E cell line expression and purification. The TrkB-ECD
used for immunization was FLAG tagged via a GSA linker, and had a
His tag (5 His residues) at the C-terminus (FLAG
tag-GSA-C32-H430-His5). Screening of the hybridoma fusion clones
(.about.3000 wells) was conducted by selecting clones that showed a
correlation between (i) direct antigen ELISA (i.e. binding to
TrkB-ECD), and (ii) TrkB activation-dependent NFAT promoter driven
reporter assay (i.e. agonists of TrkB). This selection criteria led
to the identification of multiple hybridoma clones expressing the
murine agonist antibodies 1G11, 3A3 (same antibody sequence as
3B3), 8E5, 5D11 (same as 3E10), 5C7 (same antibody sequence as
5E6), 3A4, and 2A1.
1.1 Affinity
[0206] 1G11 demonstrated binding to human TrkB-ECD with an affinity
of .about.42 nM (k.sub.on=5.66.times.10.sup.4/Ms,
k.sub.off=0.00239/s) as determined by surface plasmon resonance.
The affinity of 1G11 is shown in Table 3, together with the
affinities of other agonist antibodies identified.
1.2 Receptor Selectivity
[0207] Evaluation of 1G11 selectivity against the Trk family of
receptors using a Trk activation dependent NFAT promoter driven
reporter assay in CHO-K1 cells expressing either TrkA or TrkB or
TrkC revealed that 1G11 selectively induced reporter gene
expression in cells expressing TrkB receptors, but not in TrkA or
TrkC receptor expressing cells at the concentrations tested
(0.00006-125 nM). As a control, the cognate ligands (NGF for TrkA,
BDNF for TrkB and NT-3 for TrkC) induced comparable levels of
reporter gene expression in corresponding Trk receptor expressing
cells. 1G11 was also tested for its ability to bind the
pan-neurotrophin receptor, p75NTR. The cell based binding assay
showed no detectable binding of 1G11 to p75.sup.NTR receptor. The
receptor selectivity of the TrkB agonists is summarised in Table
3.
1.3 Cross Species Reactivity
[0208] 1G11 binds to and activates rodent (murine, rat),
cynomolgus, and human TrkB receptors. 2A1 and 5D11 also activate
rat, mouse and human TrkB receptors. Interestingly, 3A3 and 8E5
only activate the human TrkB receptors but not the rodent TrkB
receptors. The species cross-reactivity was tested using either
recombinantly expressed TrkB receptors in heterologous cell line or
primary cells derived from corresponding species or human iPSC
derived cells. The species selectivity of the TrkB agonists is
summarised in Table 3.
1.4 Activation of TrkB
[0209] CHO-K1 stably expressing human full-length TrkB receptor
(SEQ ID NO:2) when treated with 1G11 led to TrkB activation as
measured by the phosphorylated levels of TrkB (pTrkB, Y515) with an
average EC.sub.50 of 3.1.+-.2.1 nM (mean.+-.S.D., n=8). The TrkB
activation effect of the TrkB agonists is summarised in Table 3.
1G11 by itself activates the TrkB receptor to about 30-40% of the
cognate ligand BDNF (as well as NT-4) maximal response.
[0210] 1G11 induced sustained activation of TrkB and its downstream
signalling pathways in rat cortical neurons (up to 24 hours)
indicating that 1G11 when exposed to TrkB can maintain the receptor
in the activated state for a prolonged period of time, compared
with BDNF (see FIG. 1A). Mechanistically, 1G11 induced TrkB
activation is different from BDNF. Activated tyrosine kinase
receptors typically undergo endocytosis followed by degradation
resulting in down regulation of the cell surface receptors thereby
becoming non-responsive to the ligand temporarily to maintain
cellular homeostasis. Interestingly, 1G11 did not alter the surface
levels of TrkB in rat cortical neurons up to 4 hrs, however levels
increased at 24 hours compared to untreated controls despite
reduction in total cellular levels of TrkB receptors as measured by
cell surface biotinylation (see FIG. 1B).
1.5 BDNF Competition
[0211] 1G11's activation effect on TrkB receptor was determined by
TrkB phosphorylation both in the presence and absence of BDNF. The
competitive effect of the TrkB agonists in the presence of BDNF was
defined as reduced TrkB phosphorylation. Evaluation of the effect
of different concentrations of 1G11 on TrkB phosphorylation in the
presence of saturating BDNF concentration (10 nM, EC100) in the CHO
cells overexpressing full-length TrkB receptor revealed that 1G11
does not compete with BDNF for TrkB. The only TrkB agonist
identified that did compete with BDNF was 5D11, which reduced
BDNF-induced TrkB phosphorylation by .about.50%. The BDNF
competition results of the TrkB agonists are summarised in Table
3.
1.6 TrkB Agonist Competition Assays
[0212] To analyse the epitope binding properties of the TrkB
agonist mAbs, competition assays were set up to determine which
TrkB agonists competed with each other, to enable grouping together
of those which bound to similar or overlapping epitope(s) on TrkB.
TrkB-ECD was immobilized on a chip surface and a single TrkB
agonist mAb was injected into flow cells for binding to TrkB. The
second TrkB agonist mAb was then injected and its binding capacity
to TrkB-ECD in presence of the 1.sup.st TrkB agonist mAb was
assessed. Competition was categorised as: "no" with less than 20%
binding of the 2.sup.nd TrkB agonist; "partial" with 20-60% binding
of the 2.sup.nd TrkB agonist; and "yes" with more than 60% binding
of the 2.sup.nd TrkB agonist. Thus "no" binding of the second TrkB
agonist was concluded as no competition, and thus the two TrkB
agonists binding to non-overlapping epitopes, or alternately
binding of the 1.sup.st TrkB agonist alters the TrkB-ECD
conformation in such a way that the 2.sup.nd TrkB agonist was
unable to bind. "Partial" and "yes" was concluded as competition of
the two TrkB agonists for binding to a similar or overlapping
epitope(s) on TrkB.
[0213] The TrkB agonist competition results are summarised in Table
3 (competition with 1G11, or 3A3, or 8E5). Table 2 shows that 1G11,
3A3, and 8E5 can be grouped together as TrkB agonists that compete
with each other for binding to a similar or overlapping epitope(s)
on TrkB.
1.7 BDNF Potentiation
[0214] The potentiation effect of 1G11 on BDNF-induced agonism of
TrkB was assessed by measuring TrkB phosphorylation levels (pTrkB,
Y515) in the presence of BDNF. Evaluation of the effect of
different concentrations of 1G11 on TrkB in the presence of
saturating BDNF concentration (10 nM, EC100) in CHO cells
overexpressing full-length TrkB receptor (SEQ ID NO:2) resulted in
enhancement in the steady state levels of TrkB activation 30
minutes following treatment, as reflected in maximal response
(BDNF--100%; BDNF+1G11-.about.100%445%), as shown in FIG. 2.
[0215] Evaluation of other TrkB agonists in the presence of
saturating BDNF concentration revealed that 3A3 and 8E5 also
"potentiated" TrkB receptor activation (.about.100-165%, and
.about.100-120%, respectively), as shown in FIG. 2. These results
are summarised in Table 3.
[0216] Interestingly, clones 5C7, 5E6, 3A4 and 2A1 neither competed
nor potentiated BDNF mediated TrkB receptor activation indicating
that (a) not all agonist antibodies will harbour the potentiating
property, and (b) not all ligand non-competitive antibodies will be
potentiators.
[0217] FIG. 2 shows representative data for the TrkB
antibodies--potentiators and non-competitors (3A3, 1G11, 8E5),
competitors (5D11), non-competitors (2A1, 3A4, 5C7). 100% activity
represents TrkB activation at saturating concentration of BDNF i.e.
10 nM EC100. BDNF levels have been reported to be decreased in most
neurological and pathophysiological diseases and the
phenotypes/deficits have been attributed to this reduction. Under
BDNF deficient pathophysiological conditions, where TrkB receptor
levels remain unaltered, a physiological cellular/system response
could still be elicited if the administered therapeutic TrkB
agonist could: (i) activate TrkB receptors (e.g. 1G11, 3A3, 8E5,
5D11, 5C7, 5E6, 3A4 and 2A1), (ii) not compete with the reduced
levels of BDNF (e.g. 1G11, 3A3, 8E5, 5C7, 5E6, 3A4 and 2A1), (iii)
potentiate the cellular signalling induced by the reduced
physiological levels of BDNF (e.g. 1G11, 3A3, 8E5), and (iv)
without altering the cell surface levels of TrkB (e.g. 1G11), which
otherwise may potentially result in temporary desensitization to
the TrkB agonist. This data is also summarised in Table 3.
1.8 NT-4 Potentiation
[0218] Similarly, 1G11 failed to compete with NT-4 and displayed
the "potentiation" effect on NT-4-induced agonism of TrkB in the
presence of saturating levels of NT-4 (NT-4-100%;
NT-4+1G11-.about.130%; Table 3). It is therefore expected that 3A3
and 8E5 will also have a potentiating effect on NT-4 induced
agonism of TrkB.
1.9 Cell Survival and Repair
[0219] 1G11 promoted the survival of and induced neurite outgrowth
in the rat PC12 neuroblastoma cell line stably expressing human
full length TrkB receptor in a concentration-dependent manner with
an average EC.sub.50 of 0.025.+-.0.01 nM and 0.19.+-.0.06 nM
respectively. 1G11 activated endogenously expressed TrkB receptors
in rat brain and spinal cord derived neurons, mouse brain derived
neurons, and recombinantly expressed cynomolgus TrkB in CHO
cells.
[0220] Similarly 8E5 and 3A3 enhanced cell survival with an EC50 of
0.09.+-.0.06 nM (mean.+-.SD) and 0.006.+-.0.001 nM (mean.+-.SD),
respectively.
[0221] While 8E5 induced neurite outgrowth in a
concentration-dependent manner with an EC50 of 1.58.+-.0.34 nM
(mean.+-.SD), 3A3 consistently displayed a biphasic neurite
outgrowth response with increasing antibody concentrations making
it challenging to derive accurate EC50.
TABLE-US-00003 TABLE 3 3A3 5D11 5C7 1G11 (=3B3) 8E5 (=3E10) (=5E6)
3A4 2A1 Affinity ~42 nM (k.sub.on = ~07.5 nM ~9.8 nM ~3.3 nM ~68 nM
KD (nM) 5.66 .times. (k.sub.on = 1.2 .times. (k.sub.on = 6.9
.times. (k.sub.on = 4.41 .times. (k.sub.on = 6.1 .times.
10.sup.4/Ms, k.sub.off = 10.sup.5/Ms, 10.sup.4/Ms, 10.sup.4/Ms,
10.sup.3/Ms, 0.00239/s) k.sub.off = 8.97 .times. k.sub.off =
k.sub.off = 1.45 .times. k.sub.off = 4.17 .times. 10.sup.-4/s 6.76
.times. 10.sup.-4/s) 10.sup.-4/s 10.sup.-4/s Receptor TrkB TrkB
TrkB TrkB TrkB TrkB TrkB selectivity (negative for (negative
(negative (negative (negative (negative (negative TrkA and for TrkA
for TrkA) for TrkA for TrkA for TrkA for TrkA TrkC) and TrkC) TrkC:
ND and TrkC) and TrkC) and TrkC) and TrkC) Species Murine, rat,
Human, Human, Murine, rat, human selectivity cynomolgus, not active
not active rat, human in rat in rat cynomolgus, human Activation
EC.sub.50 of 3.1 .+-. EC.sub.50 of EC.sub.50 of EC.sub.50 of 1-2
EC.sub.50 of of TrkB 2.1 nM 0.2-0.6 nM ~15 nM nM ~5-6 nM (pTrkB)
Competition No No No Yes No No No with BDNF Competition No ND ND ND
ND ND ND with NT-4 Competition -- Partial 20- Yes No >20% ND
with 1G11 60% >60% (1G11 1.sup.st, (1G11 1.sup.st, (1G11
1.sup.st, 5C7 2.sup.nd)) 3A3 2.sup.nd) 8E5 2.sup.nd) No >20%
(5C7 1.sup.st, 1G11 2.sup.nd) Competition Yes >60% -- Yes No
>20% ND with 3A3 (3A3 1.sup.st, >60% (3A3 1.sup.st, 1G11
2.sup.nd) (3A3 1.sup.st, 5C7 2.sup.nd)) 8E5 2.sup.nd) No >20%
(3A3 1.sup.st, 1G11 2.sup.nd) Competition Yes >60% Partial 20-
-- No >20% ND with 8E5 (8E5 1.sup.st, 60% (8E5 (8E5 1.sup.st,
1G11 2.sup.nd) 1.sup.st, 3A3 5C7 2.sup.nd) 2.sup.nd) No >20%
(5C7 1.sup.st, 8E5 2.sup.nd) Potentiation Yes Yes Yes No No No No
of BDNF- ~130% ~160% ~120% induced agonism of TrkB Potentiation Yes
ND ND ND ND ND ND of NT-4- 130% induced agonism of TrkB Increased
Yes, ~4 fold ND ND ND ND ND No surface to BDNF levels of control
TrkB Activation Yes, ND ND Yes, ND ND Yes, of p-Akt, increased
increased increased p-Erk p-Akt, p-Erk p-Akt and p-Akt and and/or
p- and p-Creb p-Erk p-Erk Creb ND: not determined
2. Sequencing of 1G11, 3A3, and 5D11
[0222] The TrkB agonists were sequenced by conventional techniques.
The CDRs were determined by Kabat and are presented for 1G11, 3A3,
8E5, and 5D11 in Table 4 (note that the CDR regions for 1G11
determined by different numbering conventions are presented in
Table 1). The full length murine sequences (heavy chain and light
chain) for each of 1G11 (SEQ ID NO: 27 and 28), 3A3 (SEQ ID NO: 29
and 30), 8E5 (SEQ ID NO: 31 and 32), and 5D11 (SEQ ID NO: 33 and
34) are also referenced in Table 4.
TABLE-US-00004 TABLE 4 Heavy Light chain chain SEQ SEQ SEQ ID ID ID
Kabat CDRs NO: NO: NO: 1G11 27 28 CDRL1 RASQRISNNLH 3 CDRL2 YVSQSIS
4 CDRL3 QQSNSWPLT 5 CDRH1 SYYIN 6 CDRH2 RIAPGNTYYNEIFKG 7 CDRH3
RGYEGALDY 8 3A3 (3B3) 29 30 CDRL1 KSSQSLLYSGNQKNYLA 9 CDRL2 WASTRES
10 CDRL3 QQYYSYPYT 11 CDRH1 SYWMH 12 CDRH2 YINPSTGYTDYNQKFKD 13
CDRH3 SRAARY 14 8E5 31 32 CDRL1 RASSSVSSSYLH 15 CDRL2 STSNLAS 16
CDRL3 QQYSGYPLT 17 CDRH1 TYGMS 18 CDRH2 TVSTGGTYTYYPDSVKG 19 CDRH3
GGYSFAY 20 5D11 (3E10) 33 34 CDRL1 RASQSVSTSFYSYMH 21 CDRL2 YASNLQS
22 CDRL3 QHSWEIPWT 23 CDRH1 NYLIE 24 CDRH2 VINPGSGGTNYNDKFKG 25
CDRH3 GGNDYGDY 26
2. Epitope
[0223] The TrkB primary amino acid sequence is highly conserved
across mouse, rat, cynomolgus and human (95% across the full-length
sequence), and particularly conserved in the extracellular domain
where all the TrkB agonists identified in Example 1 bind. To
determine binding epitopes on TrkB, epitope mapping studies were
performed by domain deletion and alanine scanning mutagenesis
(using surface plasmon resonance), as well as X-ray crystallography
studies, using TrkB ECD (SEQ ID NO:1). The TrkB ECD includes 5
domains (D1-D3: C32-C194; D4: G195-V283; D5: H284-G380) and a short
juxtamembrane JM region (W381-H430). The TrkB-ECD used for epitope
mapping studies was FLAG tagged via a GSA linker, and had a His tag
(5 His residues) at the C-terminus (FLAG
tag-GSA-C32-H430-His5).
[0224] Deletion domain variants were generated: the D1-D3 domain
variant includes C32-L196 (SEQ ID NO:35); the D4-D5-JM domain
variant includes P197-H430 (SEQ ID NO:36), and the D5-JM domain
variant includes H284-H430 (SEQ ID NO:37).
[0225] For alanine scanning mutatgenesis studies (2.2, 2.3 and
2.5), single point mutants were made in TrkB-ECD (SEQ ID NO: 1) as
listed: N193A; S198A; N200A; L206A; E210A; K212A; 5213A; T215A;
S217A; D223A; N227A; Y229A; D231A; N234A; V236A; H239A; 5244A;
T246A; 5249A; R251A; Q263A; L271A; Q276A; T288A; F291A; E293A;
T296A; D298A; H299A; K308A; K312A; F318A; N325A; K328A; K333A;
H335A; H343A; N350A; M354A; K364A E366A E371A K372A Q373A H377A
M379A W381A D385A N389A D394A E398A T402A; D406A; T410A; N415A;
T420A; D424A; R428A; F285A; T290A; S294A; H300A; 5327A; Y329A;
C331A; Q347A; D349A; T352A; D370A; D386A; N391A; Y392A; V395A;
I396A; Y397A; D399A; Y400A; N405A; D358A; or S375A.
2.1 Binding between TrkB and BDNF
[0226] It is known that the D5 domain of TrkB (residues 286-384)
can replace full length TrkB for binding to the ligand (BDNF/NT-4).
There are two contact regions within the ligand binding site of
TrkB: the "conserved patch" and the "specificity patch". The
contact residues of TrkB D5 in the conserved patch are from the
loops between AB, C'D and EF beta sheets, and the C-terminus of the
D5 domain. The conserved patch of TrkB binds to the stalk of the
ligand (BDNF/NT-4). The contact residues of TrkB D5 in the
specificity patch are from the external face of the ABED beta
sheet. The specificity patch of TrkB binds to the N-terminus of the
ligand (BDNF/NT-4) which is disordered in the unliganded form and
becomes ordered upon binding to TrkB. The structural interactions
between the BDNF/NT-4 homodimer and two TrkB D5 domains are
summarised in FIG. 3.
2.2 Epitope of 1G11
[0227] Initial surface plasmon resonance binding analysis of 1G11
with different TrkB domain deletion variants revealed that 1G11
binds to TrkB-ECD (C32-H430), the D4-D5 domain variant (P197-H430),
and the D5 domain variant (H284-H430), but not to the D1-D3 domain
variant (C32-L196).
[0228] Surface plasmon resonance binding analysis of 1G11 with
.about.80 single point alanine mutants in TrkB-ECD, mostly in the
D4-D5-JM domain, identified 8 amino acids as critical residues for
binding, although to varying extents showing the most important
first: F291, E293>K372, E210, T288, D370>F285, T290. All the
residues are from the D5 domain of TrkB, except for E210 which is
in the D4 domain.
[0229] The co-crystal structure of 1G11 chimeric Fab1 [variable
region from 1G11 fused with constant region from human IgG1] (SEQ
ID NOs: 38 and 39) complexed with the D5-JM domain of TrkB (SEQ ID
NO: 37) at 2.3 .ANG. resolution revealed 14 residues on the D5-JM
domain of TrkB that closely approach IG11 (using a distance cut-off
of 4.5 .ANG.). The 14 residues identified included those that were
also identified by alanine scanning analysis (T288, F291, K372,
E293); as well as other amino acid residues that are in close
proximity (1289, T290, L292, S294, K308, D358, E371, Q373, I374,
S375) only identified by X-ray crystallography. Using a distance
cut-off of 3.5 .ANG. at 2.3 .ANG. resolution, identified 7 residues
(290, 293, 294, 372, 373, 374, 375).
[0230] The interactions involved in the epitope were defined using
CCG (Chemical Computing Group) MOE v2015.1001 (Molecular Operating
Environment). Protein residues within 7 .ANG. of the 1G11 chimeric
Fab1 on the D5-JM domain of TrkB were selected, and then the
"Ligand Interaction" tool with the default parameters was used to
identify water molecules or residues from the interacting molecule
that were deemed to be interacting with these residues. Note that
due to this tool being designed for defining small molecule ligand
interactions, rather than protein residues, the "Ligand
interactions" of each selected residue were calculated
individually. The interactions defined by MOE were edited in Excel
to delete any intrachain interactions, and to delete all water
interactions apart from those that formed a bridge between the two
chains. The remaining interacting residues are as follows:
Direct interaction with 1G11 chimeric Fab1 residues
[0231] Thr290, Glu293, Ser294, Asp358, Ser375
Direct interaction with 1G11 chimeric Fab1 residues, and indirect
interaction via water
[0232] Lys372, GIn373
Indirect interaction via water only
[0233] Glu341
[0234] The analysis of the co-crystal structure and alanine scan
mutagenesis complement and corroborate with each other, and
identify residues in the D5-JM domain of TrkB that either interacts
with the TrkB agonist or indirectly influence binding through
structural interactions.
[0235] Using the alanine scanning data and the X-ray data, it
appears that K372 and E293 as a minimum, are part of the TrkB
epitope to which 1G11 binds. This data is summarised in Table
5.
[0236] E293 is located between D5 beta sheets A and A'; and K372 is
located in D5 beta sheet G. Residues T288 and T291 (identified by
alanine scanning and proximity analysis) are located in D5 beta
sheet A.
[0237] The residues identified by alanine scanning are shown in
FIG. 4A, and the residues identified by co-crystal X-ray
crystallography proximity analysis are shown in FIG. 4B. In FIGS.
4A and 4B, the D5 TrkB domain from the co-crystal structure of 1G11
Fab bound to TrkB D5 was superimposed with the same TrkB domain
from the published co-crystal structure of human TrkB domain D5
bound to NT-4 homodimer to orientate the binding of TrkB to ligand
with respect to the 1G11 Fab. The BDNF chain from the human
BDNF/NT-4 heterodimer was subsequently superimposed to show the
potential binding site of TrkB on BDNF. The C-terminus of TrkB D5
from the published co-crystal structure of human TrkB domain D5
bound to NT-4 homodimer was extended using beta-strand geometry to
join the juxtamembrane (JM) region and up to the transmembrane
region to demonstrate the potential length of this missing region,
due to lack of published/available crystal structure data. The
structure was displayed using a ribbon cartoon format and atoms
were displayed on the structures for residues that were indicated
as potential TrkB epitopes.
[0238] It can be seen from FIGS. 4A and 4B, that the epitope of
1G11 is located on TrkB D5 domain proximal to the BDNF/NT4
"conserved patch" ligand binding site (loops between AB, C'D and EF
beta sheets, and the C-terminus of the D5 domain), and close to the
BDNF/NT4 "specificity patch" ligand binding site (external face of
the ABED beta sheet). More particularly, the 1G11 epitope on TrkB
domain 5 appears to be along D5 beta sheet A, the region between D5
beta sheets A and A', and D5 beta sheet G, close to the external
face of the ABED beta sheet of the specificity patch. The fact that
1G11 epitope on TrkB does not overlap directly with the BDNF/NT4
ligand binding site, presumably allows for 1G11 to bind to TrkB,
and for TrkB to also bind to BDNF/NT-4, to form a ternary complex
"TrkB agonist+TrkB+ligand".
[0239] Further analysis of the superimposition of the 1G11, TrkB,
BDNF/NT-4 components shows that the N-terminus of NT-4/BDNF
potentially protrudes into a space between TrkB and the Heavy Chain
of the 1G11 Fab (see FIG. 5). The addition of molecular surfaces to
the superimposition shows that the V.sub.K CDRs L1 and L3, and
CDRH3, interact closely with TrkB, and there is a cleft between
TrkB and CDRs H1 and H2 which could be envisaged to potentially
accommodate the N-terminus of BDNF (see FIG. 6). Binding of 1G11 to
TrkB in the presence of BDNF thus may also include binding to the
N-terminus of BDNF, and this binding possibly stabilises the
ternary complex leading to potentiation of the BDNF functional
response. 1G11 thus may, in addition to TrkB, also be able to
interact with the N-terminus of the ligand (BDNF/NT-4).
Alternatively, 1G11 may stabilise the interaction between TrkB and
the ligand, by binding not at the ligand binding site, but close to
it.
[0240] The residues involved in the paratope were identified by
analysis of the co-crystal structure by proximity analysis (using a
distance cut-off of 4.5 .ANG.) and by defining residues interacting
with the epitope using CCG (Chemical Computing Group) MOE
v2015.1001 (Molecular Operating Environment). The main binding
residues in the paratope are within CDRs L1 (bold residues
represent those approaching the epitope within 4.5 .ANG.,
underlined residues represent those that interact directly or
indirectly (via water) with the epitope: RASQRISNNLH/SEQ ID NO:3),
L3 (bold residues represent those approaching the epitope within
4.5 .ANG., underlined residues represent those that interact
directly or indirectly (via water) with the epitope: QQSNSWPLT/SEQ
ID NO:5) and H3 (bold residues represent those approaching the
epitope within 4.5 .ANG., underlined residues represent those that
interact directly or indirectly (via water) with the epitope:
RGYEGALDY/SEQ ID NO:8). There are only two residues in CDRH2
approaching the epitope within 4.5 .ANG. and only one direct
interaction (bold residues represent those approaching the epitope
within 4.5 .ANG., underlined residues represent those that interact
directly or indirectly (via water) with the epitope:
RIAPGNTYYNEIFKG/SEQ ID NO:7). There is only and a single residue in
CDRH1 that approaches or (indirectly) contacts the epitope (bold
residues represent those approaching the epitope within 4.5 .ANG.,
underlined residues represent those that interact directly or
indirectly (via water) with the epitope: SYYIN/SEQ ID NO:6) and a
single residue in CDRL2 that approaches the epitope (bold residues
represent those approaching the epitope within 4.5 .ANG.,
underlined residues represent those that interact directly or
indirectly (via water) with the epitope: YVSQSIS/SEQ ID NO:4).
Therefore, from a ranking point of view, CDRs L1, L3 and H3 are
most important for binding, followed by CDRH2, then CDRL2 and
CDRH1.
2.3 Epitope of 3A3
[0241] Surface plasmon resonance binding analysis of 3A3 with
.about.80 single point alanine mutants in TrkB-ECD, mostly in the
D4-D5-JM domain, identified 9 amino acids as critical residues for
binding, although to varying extents (E398, Y397, D399,
Y400>D394, I396>V395, N389, T402). This data is summarized in
Table 5. These residues are all in the JM region, which is
C-terminal to the D5 domain of TrkB and N-terminal to the
transmembrane region (see FIG. 7--JM residues were extended using
beta-strand geometry). This juxta-membrane (JM) region is, in the
absence of any crystal structure, assumed to be a long flexible
linker region. It is thought that the JM region may also be
important for binding to the ligand.
[0242] Although the TrkB epitope to which 3A3 binds appears to be
distinct to the epitope for 1G11, it is important to note that 3A3
competes with 1G11 (and 8E5) for binding to TrkB, and therefore the
epitopes may be overlapping in some way (see Example 1.6 above) or
binding to JM or D5 domain may result in a conformational change
that alter the binding epitope for the other antibody. It is
possible that the long flexible linker of the juxta-membrane (JM)
region may actually be in close proximity to the D5 beta sheets A,
B and G.
[0243] 3A3 also shows potentiation of BDNF induced agonism of TrkB
(see Example 1.7 above). There is thus a possibility that when 3A3
binds to TrkB, it too may have some additional interactions with
BDNF/NT-4 (for example via the N-terminus of the ligand), and/or
similarly stabilises the complex of receptor plus ligand.
[0244] Interestingly, the study revealed that residues D394, I396,
and Y400 in the juxta-membrane region confer human TrkB receptor
specificity because these residues are different in rat TrkB (Glu,
Leu, Trp respectively), and 3A3 does not activate rat TrkB.
2.4 Epitope of 8E5
[0245] No alanine scan mutagenesis or crystallography studies have
been carried out to determine the binding epitope for 8E5. However,
it is important to note that 8E5 competes with 1G11 (and 3A3) for
binding to TrkB, and therefore the epitopes may be overlapping in
some way (see Example 1.6 above), or binding to JM or D5 domain may
result in a conformational change that alters the binding epitope
for the other antibody. 8E5 also shows potentiation of BDNF induced
agonism of TrkB (see Example 1.7 above). The fact that 8E5 is human
TrkB specific, similar to 3A3, implies that the epitope is likely
to be in the JM region, similar to 3A3, where the sequence is
diverse between rodent and human (see Table 5).
2.5 Epitope of 5D11
[0246] Surface plasmon resonance binding analysis of 5D11 with
.about.80 single point alanine mutants in TrkB-ECD, mostly in the
D4-D5-JM domain, identified 6 amino acids as critical residues for
binding, although to varying extents (N350>H299, D349>H300,
K328, K333). This data is summarised in Table 5. FIG. 8 shows that
the epitope for 5D11 is at the ligand binding site (the loops
between AB, C'D and EF beta sheets of the D5 domain; and the D beta
sheet). This is entirely in agreement with the fact that 5D11
competes with BDNF as measured in TrkB phosphorylation assay.
TABLE-US-00005 TABLE 5 Epitope summary Residues identified by X-ray
crystallography proximity analysis and (a) BDNF Residues identified
interaction competition by alanine analysis (bold: (b) BDNF Agonist
scanning same as alanine interaction/ Ab mutagenesis scanning) TrkB
epitope stabilisation 1G11 F291, E293 > T288, F291, D5 beta
sheet A, (a) No K372, E210, T288, K372, E293, region between beta
(b) Possibly via N- D370 > F285, T290 I289, T290, sheets A and
A', D5 terminus of BDNF L292, S294, beta sheet G; E371, Q373, Not
ligand binding site I374, S375, K308, D358, E341 3A3 E398, Y397,
D399, ND Juxta-membrane a) No Y400 > D394, region; (b) Possibly
via N- I396 > V395, Not ligand binding site terminus of BDNF
N389, T402 8E5 ND ND Presume juxta- a) No membrane region; (b)
Possibly via N- Not ligand binding site terminus of BDNF 5D11 N350
> H299, D5, ligand binding site (a) Yes D349 > H300, (b) No
K328, K333 ND: not determined
2.6 Potentiating Antibodies
[0247] Based on the results from Examples 1 and 2, there are (i)
TrkB agonists which bind to TrkB epitopes that are in close
proximity to the BDNF binding site of TrkB, in particular close to
the specificity patch that binds to the N-terminus of the ligand,
and allow for binding to TrkB which is either enhanced or
stabilised in the presence of BDNF/NT-4: these are TrkB-BDNF
potentiators; (ii) TrkB agonists that bind within or in close
proximity to the ligand binding site, and destabilise the
interactions between receptor and ligand: these are BDNF
competitors; and (iii) TrkB agonists that bind to epitopes away
from the BDNF binding site that are simple agonists with no
potentiating function.
[0248] 1G11, 3A3 and 8E5 are exemplars of potentiators which are
non-competitive with BDNF and which appear to bind to two epitopes
(8E5 epitope not yet determined). It is possible that binding to
these epitopes stabilises the TrkB receptor in an active
conformation in the presence of BDNF, and also (a) increase the
available cell surface levels of TrkB to be activated by the
antibody; and/or (b) inhibit activated TrkB receptor endocytosis
and degradation.
[0249] SEC-MALS was conducted to evaluate the formation of binary
complexes of a soluble truncated form of the ECD of TrkB
(TrkB_H284-H430 ECD-6H) with 3A3 or 1G11 or BNDF. The presence of
binary complexes could be detected in all cases. SEC-MALS was also
used to evaluate whether a ternary complex was formed between this
construct of TrkB with BDNF and 3A3, and/or between TrkB, BDNF and
1G11. The TrkB, BDNF and 3A3 experiment provided no clear evidence
of the presence of a ternary complex. No binary or ternary
complexes could be detected in this experiment, suggesting
complicated solution behaviour and the possibility of formation of
higher order species not visible by SEC-MALS. The data from the
TrkB, BDNF and 1G11 experiment also suggested formation of higher
than simple binary complexes. In this instance some of these larger
than simple binary species could be detected. However, the
constituents of these higher molecular weight species could not be
accurately determined. Thus it remains possible that potentiation
by both antibodies may result from the formation of a ternary
complex.
2.6 Hydrogen Deuterium Exchange
[0250] HDX-MS was used to monitor the exchange rates of his tagged
D5-JM TrkB in the presence or absence of a number of other
potential protein partners. The following protein solutions were
prepared by diluting the individual components into a
non-deuterated H.sub.2O buffer of 50 mM Na phosphate, 150 mM NaCl
pH 7.0: [0251] TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His (20
.mu.M) [0252] TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His (20
.mu.M); 1G11 mAb (40 .mu.M; to ensure all TrkB is present in a
binary complex) [0253] TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
(20 .mu.M); 3A3 mAb (40 .mu.M; to ensure all TrkB is present in a
binary complex) [0254] TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
(20 .mu.M); BDNF (40 .mu.M; to ensure all TrkB is present in a
binary complex) [0255] TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
(20 .mu.M); 1G11 mAb (20 .mu.M); BDNF (20 .mu.M) [0256]
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His (20 .mu.M); 3A3 mAb
(20 .mu.M); BDNF (20 .mu.M)
[0257] The HDX labelling reaction was carried out using a standard
HDX method with a 20 fold dilution from non-deuterated into
deuterated buffer (50 mM Na phosphate, 100 mM NaCl in D20, pH 6.6)
at ambient temperature. Exchange samples (1-3 replicates) were
taken at 4 time points: 0 seconds (i.e. on dilution into
non-deuterated buffer), 15 seconds; 60 seconds and 300 seconds. The
samples were quenched with a pre-chilled low pH and denaturing
quench buffer (400 mM sodium phosphate, 8 M guanidine HCl, 500 mM
(tris(2-carboxyethyl)phosphine), pH 2.2) at 4.degree. C.
[0258] The denatured quenched samples were injected onto an
immobilised pepsin digestion column (Waters Enzymate BEH, 2.1
mm.times.30 mm, Part no: 186007233) with a 240 second digestion
time, a column flow rate of 100 .mu.l/min and digest buffer of 0.2%
aqueous formic acid at 15.degree. C. The released peptides were
analysed by a UPLC-MS at 0.degree. C. on a Acquity UPLC system
using a 1.0.times.100 mm UPLC BEH C18 column (Part no 186002346)
with typically a 15 minute run time and mobile phase A:
H.sub.2O/formic acid (99.8:0.2 v/v) and mobile phase B: ACN/formic
acid (99.8:0.2 v/v) at a flow rate of 40 .mu.l/min.
[0259] Peptides produced by proteolysis of the non-deuterated
proteins were identified using a ProteinLynxGlobal SERVER
(http://www.waters.com/waters/en_GB/ProteinLynx-Global-SERVER
%28PLGS%29/nay.htm?cid=513821&locale=en_GB), or a Mascot search
engine, against a database containing only the protein sequences of
interest. The deuterium incorporation for each time point and state
was calculated using DynamX Analysis Software v 3.0 (or HD
Examiner) by comparing the undeuterated peptide list imported from
PLGS to the data acquired for the deuterated samples.sup.1.
[0260] Deuteration data for each peptide were manually assessed and
charge states or peptides giving poor quality data were removed
from the analysis.
Results
[0261] TrkB in the presence of 1G11 showed significant changes in
the profile of deuterium exchange rates observed for TrkB peptides.
The fractional deuteration update difference plot (FIG. 9), shows
strongest deuteration protection for the TrkB peptide region
284-291. This remains strongly protected over all time points
investigated suggesting this region is likely to be important for
the interaction of TrkB with 1G11. More subtle exchange protection
was seen throughout the central region of TrkB approximately
316-380 suggesting additional residues here may play a role in the
interaction.
[0262] TrkB in the presence of 3A3 showed significant changes in
the profile of deuterium exchange rates observed for TrkB peptides
but only at the earliest exchange time points of 15 and 60s. The
fractional deuteration update difference plot (FIG. 10), shows
strongest deuteration protection for TrkB peptides containing the
region 385-398. However this protection is lost at an exchange time
point of 300s. Together with the very rapid deuteration of this
region for TrkB, this data suggests that this region may be
solvent-exposed and is rapidly deuterated; protection from
deuteration through interaction with 3A3 is incomplete and while
the rate is slowed, even this slower rate allows saturating
deuteration to be reached within 300s.
[0263] TrkB alone; TrkB-3A3 mAb; TrkB-1G11 mAb in the presence of
BDNF. Addition of BDNF, either to TrkB alone or to TrkB-mAb
complexes, did not give robust changes in TrkB deuteration so it
was not possible to show either the presence or absence of
TrkB-mAb-BDNF ternary complexes.
3. Humanised 1G11, 3A3, 5D11
3.1 Humanisation
[0264] 1G11, 3A3 and 5D11 were humanised. The sequences are as
follows: Humanised 1G11 variable heavy (VH) region--SEQ ID NO: 40;
variable light (VL) region--SEQ ID NO: 41; heavy chain (HC)--SEQ ID
NO: 42; light chain (LC)--SEQ ID NO: 43; DNA encoding the HC--SEQ
ID NO: 44; DNA encoding the LC--SEQ ID NO: 45.
[0265] Humanised 3A3 variable heavy (VH) region--SEQ ID NO: 46;
variable light (VL) region--SEQ ID NO: 47; heavy chain (HC)--SEQ ID
NO: 48; light chain (LC)--SEQ ID NO: 49; DNA encoding the HC--SEQ
ID NO: 50; DNA encoding the LC--SEQ ID NO: 51.
[0266] Humanised 5D11 variable heavy (VH) region--SEQ ID NO: 52;
variable light (VL) region--SEQ ID NO: 53; heavy chain (HC)--SEQ ID
NO: 54; light chain (LC)--SEQ ID NO: 55; DNA encoding the HC--SEQ
ID NO: 56; DNA encoding the LC--SEQ ID NO: 57.
[0267] The murine CDRs of the heavy and light chains were grafted
onto suitable human framework sequences using standard procedures
in the art: search of the CDR-masked variable (V) region sequences
on the human V gene germline databases, V and J gene template
sequences selected based on sequence similarity. Potential
back-mutations were identified based on the comparison between
human and mouse.
[0268] Murine CDRs of the heavy chain of 1G11 were grafted onto the
IGHV1_69 heavy chain framework and three humanised heavy chain
variants were generated: one which was a straight graft of the CDRs
(H0), a second variant which incorporated a back mutation at kabat
position 47 (W47C) (H4) and a third variant which incorporated a
serine residue at position 47 (W475) (H7).
[0269] Murine CDRs of the light chain of 1G11 were grafted onto the
IGKV3_11 human framework (Lo1); and onto the IGKV3D-15 human
framework with a single back-mutation of tyrosine at Kabat position
49 to lysine (Y49K) (Ln1).
[0270] The humanised variants of 1G11 were generated and tested for
binding to TrkB-ECD and in various functional assays. The Ln1
variants showed no significant difference in binding compared to
the Lo1 variants.
[0271] However, the variants with the human framework residue
tryptophan at Kabat position 47 (W47) of the heavy chain, just
before CDRH2, had significant loss of binding to TrkB. Tryptophan
at Kabat position 47 of the heavy chain is 100% conserved in human
antibodies and is at the heavy chain-light chain interface. When
W47C/S back-mutations were introduced, binding to TrkB was
restored. Cysteine and serine are similar sized amino acids, and
both mutants retained binding and functional properties of the
humanised 1G11 similar to that of the murine parental 1G11. It is
therefore expected that other similar sized amino acids at position
47 of the heavy chain would also retain binding and function. For
example, other possible substitutions include Gly, Ala, Val, Thr or
Asn. It is also expected that if tryptophan was maintained at
position 47 of the heavy chain, there could be other framework
changes that would restore the heavy chain-light chain interface
structure and therefore restore binding to TrkB.
[0272] Humanised 1G11 is a straight graft of the 1G11 CDRs onto
human frameworks with incorporation of a serine mutation in the
variable heavy chain at Kabat position 47 (H7, Lo1). Humanised 1G11
contains a human IgG1 Fc region modified with mutations L235A and
G237A (EU numbering). This modification of the IgG1 Fc region
diminishes mAb binding to Fc.gamma. receptors and C1q, therefore
reducing the potential of the mAb to induce depletion of TrkB
positive cells by antibody-dependent cytotoxicity (ADCC) or
complement dependent cytotoxicity (CDC). This is commonly described
as Fc-disablement.
[0273] Humanised 1G11 was assessed for its ability to bind to C1q
and various human and cynomolgus monkey Fc receptors (FcRn,
Fc.gamma.R I, Fc.gamma.R IIaH, Fc.gamma.R IIaR, Fc.gamma.R 11b,
Fc.gamma.R IIIaV and Fc.gamma.R IIIaF) by surface plasmon
resonance. The results demonstrated that, as anticipated,
introduction of the Fc disabling L235A and G237A mutations in the
heavy chain did not affect the binding of humanised 1G11 to FcRn,
but did diminish binding to C1q, Fc.gamma.R I, Fc.gamma.R IIaH,
Fc.gamma.R IIaR, Fc.gamma.R IIb, Fc.gamma.R IIIaV and Fc.gamma.R
IIIaF.
[0274] It should be noted that humanised 1G11 is Fc-disabled
whereas the murine 1G11 is not. Fc effector function is not
critical to the biological function of this TrkB agonist.
3.2 Humanised Antibody Properties
[0275] Humanised 1G11 was compared to the murine 1G11 in a number
of assays including surface plasmon resonance to measure binding
affinity of the antibodies to TrkB, as well as in TrkB
phosphorylation assays. In these assays humanised 1G11 was
comparable to 1G11 confirming that humanisation was successful.
Humanised 1G11 bound to recombinant human and cynomolgus TrkB-ECD
with an affinity of .about.55 nM and .about.60 nM, respectively, in
a 1:1 binding mode as measured by surface plasmon resonance.
Humanised 1G11 activated human TrkB receptor in CHO-K1 cells stably
overexpressing the human full length TrkB receptor, with the EC50
of 0.65.+-.0.14 nM (Mean.+-.SD, n=3) determined by measuring the
levels of phosphorylated TrkB. Humanised 1G11 selectively activated
the human TrkB receptor, but not the human TrkA or TrkC receptors;
and also cross-reacts with and activates rodent (murine, rat),
cynomolgus and human TrkB receptors.
[0276] Humanised 1G11 did not compete with BDNF; and it activated
human TrkB in CHO-K1 cells with an EC.sub.50 of 0.65.+-.0.14 nM
(Mean.+-.SD, n=3); retained the property of potentiation
(.about.120% vs BDNF) i.e. enhancing the levels of TrkB activation
in the presence of saturating concentrations of BDNF.
[0277] In vitro, humanised 1G11 enhanced TrkB mediated cell
survival in the rat PC12 neuroblastoma cells stably expressing
human full length TrkB receptor in a concentration-dependent manner
with an average EC.sub.50 of 0.007.+-.0.003 nM (mean.+-.S.D.;
1G11=0.025.+-.0.01 nM). In the same rat PC12 neuroblastoma cells
stably expressing human full length TrkB receptor humanised 1G11
enhanced TrkB mediated neurite outgrowth in a
concentration-dependent manner with an average EC.sub.50 of
0.07.+-.0.02 nM (mean.+-.S.D.; 1G11=0.19.+-.0.06 nM).
4. In Vivo Effects
SRA Rat Model of Neuronal Survival
[0278] The in vivo effect of 1G11 on neuronal survival was
evaluated in a rat model of avulsion (unilateral) induced spinal
motor neuron degeneration. Briefly, the ventral root from the
lumbar segment 4 (L4) was avulsed in young adult sprague-dawley
rats by surgery and allowed to recover for 1 week before
intervention with 1G11 either intravenously (as single bolus) or
intrathecally (continuous). For continuous intrathecal infusion, a
catheter was inserted into the subarachnoid cavity through the
intervertebral hole between L4-L5 with the other end connected to
alzet 2002 miniosmotic pump which was implanted subcutaneously at
the back of the neck. Until antibody intervention, vehicle
formulation was loaded to the pump and delivered at the rate of
0.5.mu.l/hr.
[0279] Continuous intrathecal infusion of 2 different doses of 1G11
(60 .mu.g or 240 .mu.g/day) or BDNF (positive control; 12
.mu.g/day), but not vehicle formulation (negative control) in the
rat SRA model for 2 weeks enhanced the survival of ChAT expressing
neurons (stained with anti-ChAT antibody) to a similar extent (i.e.
compared to the contralateral side) with no distinct dose-dependent
response compared to vehicle treated group. Intravenous
administration of 1G11 (0.03, 0.1, 0.3, 1, 3, 30 mg/kg) or BDNF
(positive control; 12 .mu.g/day) 1 week post-nerve root avulsion,
but not isotype control (IgG1, 3 mg/kg) or vehicle formulation
(negative control), showed an exposure-dependent enhancement of
spinal neuron survival as visualised by ChAT staining. 1G11 was
able to rescue ChAT neurons to different extent at 1, 3, and 30
mg/kg with negligible effect at 0.3 mg/kg.
[0280] In summary, 1G11, when administered either as a single bolus
intravenous tail vein injection or by continuous intrathecal
infusion, 7 days post-injury in the unilaterally (L4 ventral root)
avulsed rats, enhanced the survival of spinal cord ChAT
neurons.
Gait function (hSOD1.sup.G93A mice)
[0281] In addition to the effect of 1G11 on neuronal survival (as
described above), the functional effect of 1G11 was investigated in
the congenic B6Cg-Tg(hSOD1.sup.G93A)1Gur/J transgenic mice. The
hSOD1 Tg mice display impairment in various gait parameters as the
disease develop and progress. 1G11 (0.3 mg/kg), but not the vehicle
formulation (negative control), when administered through tail vein
bolus injection every 2 weeks for 28 days (twice during the
intervention period) in a cohort of females (.about.3.5 months old)
significantly improved the gait features in hSOD1 mice compared to
hSOD1-vehicle control to different extent: run speed, cadence
(steps/second), stride time, and stance time almost comparable to
that in wild type littermates; relatively moderate effect on stride
length; and much reduced effect on swing speed. These results
indicate that 1G11 when administered intravenously could ameliorate
gait deficits in hSOD1.sup.G93A transgenic mice.
[0282] To further evaluate the effect of 1G11 on gait and
neurological score, mice (males and females, approximately 3.5
months old, at least 16 mice of each gender per group at the
beginning of the study) were dosed in accordance with table 6. The
experiment was performed in a randomized, placebo and isotype
controlled, and double blinded manner.
TABLE-US-00006 TABLE 6 Administra- Dosing Cohort Animals
Therapeutic tion Route Regimen A Wild type Vehicle iv, bolus, 4
doses, 14 days tail vein between doses B hSOD1- Mouse 1gG1 iv,
bolus, 4 doses, 14 days G93A isotype control tail vein between
doses (1 mg/kg in vehicle) C hSOD1- 1G11 (0.3 mg/kg iv, bolus, 4
doses, 14 days G93A in vehicle) tail vein between doses D hSOD1-
1G11 (1 mg/kg iv, bolus, 4 doses, 14 days G93A in vehicle) tail
vein between doses E hSOD1- Vehicle G93A iv, bolus, 4 doses, 14
days tail vein between doses Vehicle = 20 mM Phosphate Buffer, 130
mM NaCl pH 6.0, and 0.005% Polysorbate 20 iv = intravenous, ip =
intraperitoneal
[0283] Animals were subjected to gait analysis using the rodent
CatWalk System at 8 time points: Day 97 (baseline), Day 99
(1.sup.st post 1.sup.st dose), Day 111 (13 d post 1.sup.st dose),
Day 113 (1 d post 2.sup.nd dose), Day 125 (13 d post 2.sup.nd
dose), Day 139 (13 d post 3rd dose), Day 146 (7 d post 4th dose)
and on Day 153 (13 d post 4th dose). Six kinds of gait parameters
(run speed, stride length, stance time, stride time, cadence and
swing speed) were selected for the analysis. Results showed that
1G11 significantly improved the gait features in hSOD1-G93A mice
compared to IgG1 isotype control for both genders, especially at
Day 125 and Day 139. On average, there was a better improvement in
gait features in high dose group, compared to low dose group.
[0284] Neurological score was monitored for all hSOD1-G93A animals
throughout the whole study time period. Log-Rank tests showed that
relative to IgG1 isotype control, both 1 mg/kg and 0.3 mg/kg 1G11
delayed the median time to death noticeably for female mice. For
male mice, 0.3 mg/kg of hSOD1-1G11 group delayed the median time to
death noticeably while 1 mg/kg of hSOD1-1G11 groups did not show
much improvement relative to the IgG1 isotype control. Wilcoxon
tests showed for female mice, 1 mg/kg 1G11, but not 0.3 mg/kg 1G11,
delayed the median time to tremor onset noticeably, relative to the
IgG1 isotype control. Both 1 mg/kg and 0.3 mg/kg 1G11 delayed the
median time to tremor onset marginally in male mice relative to the
IgG1 isotype control.
[0285] In summary, these results indicate that 1G11 when
administered intravenously could ameliorate gait deficits in both
genders of hSOD1-G93A transgenic mice, delay tremor onset in both
genders and improve overall `survival` only in females of
hSOD1-G93A transgenic mice.
Motor Neuron Survival (hSOD1.sup.G93A Mice)
[0286] To evaluate the effect of 1G11 on spinal cord ChAT positive
neurons, male mice (approximately 50 days old, 12 mice per group at
the beginning of the study) were dosed in accordance with table 7.
The experiment was performed in a randomized, placebo & isotype
controlled, and double blinded manner.
TABLE-US-00007 TABLE 7 Administra- Dosing Cohort Animals
Therapeutic tion Route Regimen A Wild type Vehicle iv, bolus, 3
doses, 14 days tail vein between doses B hSOD1- Mouse 1gG1 iv,
bolus, 3 doses, 14 days G93A isotype control tail vein between
doses (1 mg/kg in vehicle) C hSOD1- 1G11 (0.3 mg/kg iv, bolus, 3
doses, 14 days G93A in vehicle) tail vein between doses D hSOD1-
1G11 (1 mg/kg iv, bolus, 3 doses, 14 days G93A in vehicle) tail
vein between doses E hSOD1- Vehicle iv, bolus, 3 doses, 14 days
G93A tail vein between doses Vehicle = 20 mM Phosphate Buffer, 130
mM NaCl pH 6.0, and 0.005% Polysorbate 20 iv = intravenous, ip =
intraperitoneal
[0287] At the end of the dosing period, mice were deeply
anesthetized with isoflurane. Mice were transcardially perfused
with ice cold 0.9% saline (120 mL) to drain the blood followed by
60 mL of 4% Paraformaldehyde (PFA). The spinal cord was collected
and post-fixed for 24 hours in 4% PFA at 4.degree. C.
Immunohistochemistry (IHC) of Choline acetyltransferase (ChAT) was
performed on an IHC autostainer (Ventana Discovery Ultra, Roche,
USA). Whole slide images were captured by ScanScope XT (Leica
Biosystems, USA).
[0288] ChAT positive cells in L3-L5 of lumbar spinal cord were
quantified and analyzed. In order to count the neurons accurately,
hematoxylin channel was separated from DAB (ImageScope, version 11,
Leica Biosystem) and then DAB only images (10.times.) covering
whole ventral spinal cord was taken for cell quantification. ChAT
positive MN neurons were manually counted by an independent
observer in a blinded manner. To eliminate bias and ensure
consistency, image quantification was randomly checked for quality
by another independent investigator.
[0289] Lumbar spinal cord (L3-L5) analysis by ChAT immunostaining
showed a highly significant reduction of ChAT positive motor
neurons in vehicle treated hSOD1-G93A transgenic mice compared to
vehicle treated wild type mice (35% reduction, p<0.0001). These
data indicate obvious degeneration of motor neurons in the spinal
cord of hSOD1-G93A mice, compared with wild type mice. Mouse IgG1
(172.6.+-.31.10) and 1G11 treatment groups did not demonstrate
statistical significance over vehicle, (0.3 mg/kg: 169.1.+-.17.25;
1 mg/kg:160.1.+-.28.12).
TABLE-US-00008 Sequence listing TrkB-ECD SEQ ID NO: 1
CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKF-
V
AHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNE
SSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLR
ITNISSDDSGKQISCVAENLVGEDQDSVNLIVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAIL
NESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPD
VIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREH TrkB full length sequence SEQ
ID NO: 2
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEI
FIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELIL
VGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCS
VAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTIT
FLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLI
AKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSV
YAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMT
KIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDN
ARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQS
QMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMP
PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQR
EPHMRKNIKGIHTLLQNLAKASPVYLDILG 1G11 and humanised 1G11 CDR L1
(Kabat, Chothia, AbM) SEQ ID NO: 3 RASQRISNNLH 1G11 and humanised
1G11 CDR L2 (Kabat, Chothia, AbM) SEQ ID NO: 4 YVSQSIS 1G11 and
humanised 1G11 CDR L3 (Kabat, Chothia, AbM) SEQ ID NO: 5 QQSNSWPLT
1G11 and humanised 1G11 CDR H1 (Kabat) SEQ ID NO: 6 SYYIN 1G11 and
humanised 1G11 CDR H2 (Kabat) SEQ ID NO: 7 RIAPGNTYYNEIFKG 1G11 and
humanised 1G11 CDR H3 (Kabat, Chothia, AbM) SEQ ID NO: 8 RGYEGALDY
3A3 CDR L1 (Kabat) SEQ ID NO: 9 KSSQSLLYSGNQKNYLA 3A3 CDR L2
(Kabat) SEQ ID NO: 10 WASTRES 3A3 CDR L3 (Kabat) SEQ ID NO: 11
QQYYSYPYT 3A3 CDR H1 (Kabat) SEQ ID NO: 12 SYWMH 3A3 CDR H2 (Kabat)
SEQ ID NO: 13 YINPSTGYTDYNQKFKD 3A3 CDR H3 (Kabat) SEQ ID NO: 14
SRAARY 8E5 CDR L1 (Kabat) SEQ ID NO: 15 RASSSVSSSYLH 8E5 CDR L2
(Kabat) SEQ ID NO: 16 STSNLAS 8E5 CDR L3 (Kabat) SEQ ID NO: 17
QQYSGYPLT 8E5 CDR H1 (Kabat) SEQ ID NO: 18 TYGMS 8E5 CDR H2 (Kabat)
SEQ ID NO: 19 TVSTGGTYTYYPDSVKG 8E5 CDR H3 (Kabat) SEQ ID NO: 20
GGYSFAY 5D11 CDR L1 (Kabat) SEQ ID NO: 21 RASQSVSTSFYSYMH 5D11 CDR
L2 (Kabat) SEQ ID NO: 22 YASNLQS 5D11 CDR L3 (Kabat) SEQ ID NO: 23
QHSWEIPWT 5D11 CDR H1 (Kabat) SEQ ID NO: 24 NYLIE 5D11 CDR H2
(Kabat) SEQ ID NO: 25 VINPGSGGTNYNDKFKG 5D11 CDR H3 (Kabat) SEQ ID
NO: 26 GGNDYGDY 1G11 HC SEQ ID NO: 27
QVQLQQSGDDLVKPGASVKLSCKASGYTFTSYYINWIKQRPGQGLECIGRIAPGNTYYNEIFKGKAILTVDTS
SSTAYIQLSSLSSEDSGVYFCARRGYEGALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLV
KGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
CGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFN
STFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMIT
DFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKS
LSHSPGK 1G11 LC SEQ ID NO: 28
DIVLTQSPATLSVTPGDSVSLSCRASQRISNNLHWYQQKSHESPRLLIKYVSQSISGIPSRFSGSGSGTDFTL
SINSVETEDFGMYFCQQSNSWPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
3A3 HC SEQ ID NO: 29
QVQLQQSGAELAKPGASVKMSCKASGYTFSSYWMHWVKQRPGQGLEWIGYINPSTGYTDYNQKFKDKAT
LTADKSSNTAYMQLSSLTSDDSAVYYCARSRAARYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTL
GCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
VPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPRE
EQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLT
CMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNH
HTEKSLSHSPGK 3A3 LC SEQ ID NO: 30
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSGNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGS
GSGTDFTLTISSVKAEDLAVYYCQQYYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNN
FYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF
NRNEC 8E5 HC SEQ ID NO: 31
EVQLVESGGDLVKPGGSLKLSCAASGFTFSTYGMSWVRQTPDKGLEWVATVSTGGTYTYYPDSVKGRFTIS
RDNAKNTLYLQMSSLKSEDTAMYYCARGGYSFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLG
CLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTINDKKIV
PRDCGCKPCTCTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREE
QFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTC
MITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHH
TEKSLSHSPGK 8E5 LC SEQ ID NO: 32
ENVLTQSPAIMSASPGEKVTMTCRASSSVSSSYLHWYQQKSGVSPKLWIYSTSNLASGVPARFSGSGSGTSY
SLTISSVEAEDAATYYCQQYSGYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
5D11 HC SEQ ID NO: 33
QVHLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWIKQRPGQGLEWIGVINPGSGGTNYNDKFKGKAILTA
DKSSTTAYMQLSSLTSDDSAVYFCARGGNDYGDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTL
GCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
VPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPRE
EQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLT
CMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNH
HTEKSLSHSPGK 5D11 LC SEQ ID NO: 34
DIVLTQSPASLAVSLGQRATISCRASQSVSTSFYSYMHWYQQKPGQPPKVFIKYASNLQSGVPARFSGSGSG
TDFTLNIHPVEEDDTATYYCQHSWEIPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP
KDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
EC D1-D3 domain deletion variant C32-L196 SEQ ID NO: 35
CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKF-
V
AHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNE
SSKNIPLANLQIPNCGL D4-D5-JM domain deletion variant P197-H430 SEQ ID
NO: 36
PSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVA
ENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHT
EYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDT
TNRSNEIPSTDVTDKTGREH D5 domain deletion variant H284-H430 SEQ ID
NO: 37
HFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMN
NGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKT
GREH 1G11 chimeric Fab1 [variable region (VH) from 1G11 fused with
constant region (CH1) from human IgG1] SEQ ID NO: 38
QVQLQQSGDDLVKPGASVKLSCKASGYTFTSYYINWIKQRPGQGLECIGRIAPGNTYYNEIFKGKAILIVDTS
SSTAYIQLSSLSSEDSGVYFCARRGYEGALDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
CDK 1G11 chimeric Fab1 [variable region (VL) from 1G11 fused with
constant region (CL1) from human IgG1] SEQ ID NO: 39
DIVLTQSPATLSVTPGDSVSLSCRASQRISNNLHWYQQKSHESPRLLIKYVSQSISGIPSRFSGSGSGTDFTL
SINSVETEDFGMYFCQQSNSWPLTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
humanised 1G11 VH SEQ ID NO: 40
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYINWVRQAPGQGLESMGRIAPGNTYYNEIFKGRVTITADK
STSTAYMELSSLRSEDTAVYYCARRGYEGALDYWGQGTLVTVSS humanised 1G11 VL SEQ
ID NO: 41
EIVLTQSPATLSLSPGERATLSCRASQRISNNLHWYQQKPGQAPRLLIKYVSQSISGIPARFSGSGSGTDFTL
TISSLEPEDFAVYYCQQSNSWPLTFGQGTKLEIK humanised 1G11 HC SEQ ID NO: 42
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYINWVRQAPGQGLESMGRIAPGNTYYNEIFKGRVTITADK
STSTAYMELSSLRSEDTAVYYCARRGYEGALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
KSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT
KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK humanised 1G11 LC SEQ ID NO: 43
EIVLTQSPATLSLSPGERATLSCRASQRISNNLHWYQQKPGQAPRLLIKYVSQSISGIPARFSGSGSGTDFTL
TISSLEPEDFAVYYCQQSNSWPLTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
DNA encoding humanised 1G11 HC SEQ ID NO: 44
CAGGTGCAGCTCGTGCAGAGCGGCGCCGAAGTCAAAAAGCCCGGCAGCAGCGTGAAGGTGAGCTGCAA
GGCCAGCGGCTACACCTTCACCTCCTACTACATCAACTGGGTGAGGCAGGCTCCCGGACAGGGCCTGGA
GAGCATGGGCAGGATCGCCCCCGGCAACACCTACTACAACGAGATCTTCAAGGGCAGGGTGACCATCAC
TGCCGACAAGAGCACCAGCACCGCCTACATGGAACTGTCTAGCCTGAGGAGCGAGGACACCGCCGTGTA
CTACTGCGCCAGAAGGGGCTACGAGGGCGCCCTGGACTATTGGGGCCAGGGCACACTAGTGACCGTGTC
CAGCGCCAGCACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGGCAC
AGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAACCGGTGACCGTGTCCTGGAACAGCGGAGC
CCTGACCAGCGGCGTGCACACCTTCCCCGCCGTGCTGCAGAGCAGCGGCCTGTACAGCCTGAGCAGCGT
GGTGACCGTGCCCAGCAGCAGCCTGGGCACCCAGACCTACATCTGTAACGTGAACCACAAGCCCAGCAA
CACCAAGGTGGACAAGAAGGTGGAGCCCAAGAGCTGTGACAAGACCCACACCTGCCCCCCCTGCCCTGC
CCCCGAGCTGGCCGGAGCCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAG
CAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTG
GTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTA
CCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGT
GTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCC
CCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGT
GAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAA
GACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAG
CAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCA
GAAGAGCCTGAGCCTGTCCCCTGGCAAG DNA encoding humanised 1G11 LC SEQ ID
NO: 45
GAGATCGTGCTGACCCAGAGCCCCGCCACTCTGAGCCTGAGCCCAGGCGAAAGGGCAACCCTGAGCTGC
AGGGCCTCCCAGAGGATCAGCAACAACCTGCACTGGTACCAGCAGAAGCCCGGCCAGGCCCCCAGGCTG
CTGATCAAATACGTGAGCCAGAGCATCAGCGGCATCCCCGCCAGGTTTAGCGGAAGCGGCAGCGGCACC
GACTTCACCCTGACCATTAGCAGCCTGGAGCCCGAGGACTTCGCCGTCTACTACTGCCAGCAGTCTAACA
GCTGGCCCCTGACCTTCGGCCAGGGCACCAAGCTCGAGATCAAGCGTACGGTGGCCGCCCCCAGCGTGT
TCATCTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGTGTCTGCTGAACAACT
TCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGAGCGGCAACAGCCAGGAGA
GCGTGACCGAGCAGGACAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACCCTGAGCAAGGCCG
ACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGA
GCTTCAACCGGGGCGAGTGC humanised 3A3 VH SEQ ID NO: 46
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWMHWVRQAPGQGLEWMGYINPSTGYTDYNQKFKDRVT
ITADKSTSTAYMELSSLRSEDTAVYYCARSRAARYWGQGTLVTVSS humanised 3A3 VL SEQ
ID NO: 47
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSGNQKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGS
GSGTDFTLTISSLQAEDVAVYYCQQYYSYPYTFGQGTKLEIK humanised 3A3 HC SEQ ID
NO: 48
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWMHWVRQAPGQGLEWMGYINPSTGYTDYNQKFKDRVT
ITADKSTSTAYMELSSLRSEDTAVYYCARSRAARYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
EPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPGK humanised 3A3 LC SEQ ID NO: 49
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSGNQKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGS
GSGTDFTLTISSLQAEDVAVYYCQQYYSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNN
FYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGEC DNA encoding humanised 3A3 HC SEQ ID NO: 50
CAGGTCCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAACCCGGCAGCTCCGTGAAGGTGAGCTGCAA
GGCCAGCGGCTACACCTTCTCCAGCTACTGGATGCACTGGGTGAGGCAGGCCCCCGGACAGGGCCTGGA
GTGGATGGGCTACATCAACCCCAGCACCGGCTACACCGACTACAACCAGAAGTTCAAGGACAGGGTGAC
CATCACCGCCGACAAGAGCACCAGCACCGCCTACATGGAACTGAGCAGCCTGAGGAGCGAGGACACCGC
CGTGTACTATTGCGCCAGGAGCAGGGCTGCCAGGTACTGGGGCCAGGGCACACTAGTGACCGTGTCCAG
CGCCAGCACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGGCACAGC
CGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAACCGGTGACCGTGTCCTGGAACAGCGGAGCCCT
GACCAGCGGCGTGCACACCTTCCCCGCCGTGCTGCAGAGCAGCGGCCTGTACAGCCTGAGCAGCGTGGT
GACCGTGCCCAGCAGCAGCCTGGGCACCCAGACCTACATCTGTAACGTGAACCACAAGCCCAGCAACACC
AAGGTGGACAAGAAGGTGGAGCCCAAGAGCTGTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCC
GAGCTGGCCGGAGCCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATCAGCAGA
ACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTAC
GTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTACCGG
GTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAGGTGTCC
AACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAG
GTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAG
GGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACC
ACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGA
TGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAG
AGCCTGAGCCTGTCCCCTGGCAAG DNA encoding humanised 3A3 LC SEQ ID NO:
51
GACATCGTGATGACCCAGAGCCCCGACTCTCTGGCCGTGAGCCTGGGCGAAAGGGCCACCATCAACTGC
AAGAGCAGCCAGAGCCTCCTGTACAGCGGCAACCAGAAGAACTACCTGGCCTGGTATCAGCAGAAGCCC
GGCCAGCCCCCCAAACTGCTGATCTACTGGGCTAGCACAAGGGAGAGCGGCGTGCCTGATAGGTTCAGC
GGAAGCGGCAGCGGCACCGACTTCACCCTGACCATTAGCAGCCTGCAGGCCGAGGACGTGGCCGTCTAC
TACTGCCAGCAGTACTACTCCTACCCCTACACCTTCGGCCAGGGCACCAAGCTGGAGATCAAGCGTACGG
TGGCCGCCCCCAGCGTGTTCATCTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGG
TGTGTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGA
GCGGCAACAGCCAGGAGAGCGTGACCGAGCAGGACAGCAAGGACTCCACCTACAGCCTGAGCAGCACCC
TGACCCTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGCCTGT
CCAGCCCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC humanised 5D11 VH SEQ ID NO:
52
QVQLVQSGAEVKKPGSSVKVSCKASGYAFTNYLIEWVRQAPGQGLEWMGVINPGSGGTNYNDKFKGRVTI
TADKSTSTAYMELSSLRSEDTAVYYCARGGNDYGDYWGQGTLVTVSS humanised 5D11 VL
SEQ ID NO: 53
DIVMTQSPDSLAVSLGERATINCRASQSVSTSFYSYMHWYQQKPGQPPKVLIKYASNLQSGVPDRFSGSGS
GTDFTLTISSLQAEDVAVYYCQHSWEIPWTFGQGTKLEIK humanised 5D11 HC SEQ ID
NO: 54
QVQLVQSGAEVKKPGSSVKVSCKASGYAFTNYLIEWVRQAPGQGLEWMGVINPGSGGTNYNDKFKGRVTI
TADKSTSTAYMELSSLRSEDTAVYYCARGGNDYGDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA
LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
KVEPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK humanised 5D11 LC SEQ ID NO: 55
DIVMTQSPDSLAVSLGERATINCRASQSVSTSFYSYMHWYQQKPGQPPKVLIKYASNLQSGVPDRFSGSGS
GTDFTLTISSLQAEDVAVYYCQHSWEIPWTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY
PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GEC DNA encoding humanised 5D11 HC SEQ ID NO: 56
CAGGTGCAGCTGGTGCAGAGCGGCGCCGAAGTCAAGAAGCCCGGCAGCTCCGTGAAGGTGAGCTGCAA
AGCCAGCGGCTACGCCTTCACCAACTACCTGATCGAGTGGGTGAGGCAGGCTCCCGGCCAGGGCCTGGA
GTGGATGGGAGTGATCAATCCCGGCAGCGGCGGCACCAACTACAACGACAAGTTCAAGGGCAGGGTGAC
CATCACCGCCGACAAGAGCACCAGCACCGCCTACATGGAACTGAGCAGCCTCAGGAGCGAGGACACTGC
CGTGTACTATTGCGCCAGGGGCGGGAACGATTACGGCGACTACTGGGGCCAGGGCACACTAGTGACCGT
GTCCAGCGCCAGCACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGAGCACCAGCGGCGG
CACAGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAACCGGTGACCGTGTCCTGGAACAGCGG
AGCCCTGACCAGCGGCGTGCACACCTTCCCCGCCGTGCTGCAGAGCAGCGGCCTGTACAGCCTGAGCAG
CGTGGTGACCGTGCCCAGCAGCAGCCTGGGCACCCAGACCTACATCTGTAACGTGAACCACAAGCCCAG
CAACACCAAGGTGGACAAGAAGGTGGAGCCCAAGAGCTGTGACAAGACCCACACCTGCCCCCCCTGCCC
TGCCCCCGAGCTGGCCGGAGCCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACCCTGATGATC
AGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGAGCCACGAGGACCCTGAGGTGAAGTTCAAC
TGGTACGTGGACGGCGTGGAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACC
TACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAGGAGTACAAGTGTAAG
GTGTCCAACAAGGCCCTGCCTGCCCCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAG
CCCCAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCTGCCTG
GTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTAC
AAGACCACCCCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAG
AGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAATCACTACACC
CAGAAGAGCCTGAGCCTGTCCCCTGGCAAG DNA encoding humanised 5D11 LC SEQ
ID NO: 57
GACATCGTGATGACCCAGAGCCCCGATAGCCTGGCCGTGAGCCTGGGCGAGAGGGCCACCATTAACTGC
AGGGCCAGCCAGAGCGTGAGCACCAGCTTCTACTCCTACATGCACTGGTACCAGCAGAAACCCGGCCAG
CCCCCCAAGGTGCTGATCAAATACGCCAGCAACCTCCAGAGCGGCGTGCCCGACAGGTTCAGCGGCTCA
GGCTCCGGCACCGACTTCACACTGACCATCAGCAGCCTGCAGGCAGAGGACGTGGCCGTCTACTACTGC
CAGCACAGCTGGGAGATCCCCTGGACCTTCGGCCAGGGAACCAAGCTGGAGATCAAGCGTACGGTGGCC
GCCCCCAGCGTGTTCATCTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTGTGT
CTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGAGCGGC
AACAGCCAGGAGAGCGTGACCGAGCAGGACAGCAAGGACTCCACCTACAGCCTGAGCAGCACCCTGACC
CTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCTGTGAGGTGACCCACCAGGGCCTGTCCAGC
CCCGTGACCAAGAGCTTCAACCGGGGCGAGTGC 1G11 and humanised 1G11 CDRH1
(Chothia) SEQ ID NO: 58 GYTFTSY 1G11 and humanised 1G11 CDRH2
(Chothia) SEQ ID NO: 59 APGN 1G11 and humanised 1G11 CDRH1 (AbM)
SEQ ID NO: 60 GYTFTSYYIN 1G11 and humanised 1G11 CDRH2 (AbM) SEQ ID
NO: 61 RIAPGNTY 1G11 and humanised 1G11 CDRH1 (Contact) SEQ ID NO:
62 TSYYIN 1G11 CDRH2 (Contact) SEQ ID NO: 63 CIGRIAPGNTY humanised
1G11 CDRH2 (Contact) SEQ ID NO: 64 SMGRIAPGNTY 1G11 and humanised
1G11 CDRH3 (Contact) SEQ ID NO: 65 ARRGYEGALD 1G11 and humanised
1G11 CDRL1 (Contact) SEQ ID NO: 66 SNNLHWY 1G11 and humanised 1G11
CDRL2 (Contact) SEQ ID NO: 67 LLIKYVSQSI 1G11 and humanised 1G11
CDRL3 (Contact) SEQ ID NO: 68 QQSNSWPL SEQ ID NO: 69
DGANPNYPDVIYEDYGTAAN SEQ ID NO: 70 NPNYPDVIYEDYGT SEQ ID NO: 71
HFAPTITFLESP TRKB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide
from 283-291 SEQ ID NO: 72 GHFAPTITF
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 284-291
SEQ ID NO: 73 HFAPTITF TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 292-316 SEQ ID NO: 74 LESPTSDHHWCIPFTVKGNPKPALQ
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 316-324
SEQ ID NO: 75 QWFYNGAIL
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 317-324
SEQ ID NO: 76 WFYNGAIL TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 318-324 SEQ ID NO: 77 FYNGAIL
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 347-361
SEQ ID NO: 78 QLDNPTHMNNGDYTL
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 349-358
SEQ ID NO: 79 DNPTHMNNGD
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 351-368
SEQ ID NO: 80 PTHMNNGDYTLIAKNEYG
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 363-378
SEQ ID NO: 81 AKNEYGKDEKQISAHF
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 377-395
SEQ ID NO: 82 HFMGWPGIDDGANPNYPDV
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 379-385
SEQ ID NO: 83 MGWPGID TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 379-395 SEQ ID NO: 84 MGWPGIDDGANPNYPDV
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 379-396
SEQ ID NO: 85 MGWPGIDDGANPNYPDVI
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 379-397
SEQ ID NO: 86 MGWPGIDDGANPNYPDVIY
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 379-398
SEQ ID NO: 87 MGWPGIDDGANPNYPDVIYE
TrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His peptide from 418-435
SEQ ID NO: 88 PSTDVTDKTGREHHHHHH
Sequence CWU 1
1
881399PRTArtificialHuman TrkB-Extracellular Domain 1Cys Pro Thr Ser
Cys Lys Cys Ser Ala Ser Arg Ile Trp Cys Ser Asp1 5 10 15Pro Ser Pro
Gly Ile Val Ala Phe Pro Arg Leu Glu Pro Asn Ser Val 20 25 30Asp Pro
Glu Asn Ile Thr Glu Ile Phe Ile Ala Asn Gln Lys Arg Leu 35 40 45Glu
Ile Ile Asn Glu Asp Asp Val Glu Ala Tyr Val Gly Leu Arg Asn 50 55
60Leu Thr Ile Val Asp Ser Gly Leu Lys Phe Val Ala His Lys Ala Phe65
70 75 80Leu Lys Asn Ser Asn Leu Gln His Ile Asn Phe Thr Arg Asn Lys
Leu 85 90 95Thr Ser Leu Ser Arg Lys His Phe Arg His Leu Asp Leu Ser
Glu Leu 100 105 110Ile Leu Val Gly Asn Pro Phe Thr Cys Ser Cys Asp
Ile Met Trp Ile 115 120 125Lys Thr Leu Gln Glu Ala Lys Ser Ser Pro
Asp Thr Gln Asp Leu Tyr 130 135 140Cys Leu Asn Glu Ser Ser Lys Asn
Ile Pro Leu Ala Asn Leu Gln Ile145 150 155 160Pro Asn Cys Gly Leu
Pro Ser Ala Asn Leu Ala Ala Pro Asn Leu Thr 165 170 175Val Glu Glu
Gly Lys Ser Ile Thr Leu Ser Cys Ser Val Ala Gly Asp 180 185 190Pro
Val Pro Asn Met Tyr Trp Asp Val Gly Asn Leu Val Ser Lys His 195 200
205Met Asn Glu Thr Ser His Thr Gln Gly Ser Leu Arg Ile Thr Asn Ile
210 215 220Ser Ser Asp Asp Ser Gly Lys Gln Ile Ser Cys Val Ala Glu
Asn Leu225 230 235 240Val Gly Glu Asp Gln Asp Ser Val Asn Leu Thr
Val His Phe Ala Pro 245 250 255Thr Ile Thr Phe Leu Glu Ser Pro Thr
Ser Asp His His Trp Cys Ile 260 265 270Pro Phe Thr Val Lys Gly Asn
Pro Lys Pro Ala Leu Gln Trp Phe Tyr 275 280 285Asn Gly Ala Ile Leu
Asn Glu Ser Lys Tyr Ile Cys Thr Lys Ile His 290 295 300Val Thr Asn
His Thr Glu Tyr His Gly Cys Leu Gln Leu Asp Asn Pro305 310 315
320Thr His Met Asn Asn Gly Asp Tyr Thr Leu Ile Ala Lys Asn Glu Tyr
325 330 335Gly Lys Asp Glu Lys Gln Ile Ser Ala His Phe Met Gly Trp
Pro Gly 340 345 350Ile Asp Asp Gly Ala Asn Pro Asn Tyr Pro Asp Val
Ile Tyr Glu Asp 355 360 365Tyr Gly Thr Ala Ala Asn Asp Ile Gly Asp
Thr Thr Asn Arg Ser Asn 370 375 380Glu Ile Pro Ser Thr Asp Val Thr
Asp Lys Thr Gly Arg Glu His385 390 3952822PRTHuman 2Met Ser Ser Trp
Ile Arg Trp His Gly Pro Ala Met Ala Arg Leu Trp1 5 10 15Gly Phe Cys
Trp Leu Val Val Gly Phe Trp Arg Ala Ala Phe Ala Cys 20 25 30Pro Thr
Ser Cys Lys Cys Ser Ala Ser Arg Ile Trp Cys Ser Asp Pro 35 40 45Ser
Pro Gly Ile Val Ala Phe Pro Arg Leu Glu Pro Asn Ser Val Asp 50 55
60Pro Glu Asn Ile Thr Glu Ile Phe Ile Ala Asn Gln Lys Arg Leu Glu65
70 75 80Ile Ile Asn Glu Asp Asp Val Glu Ala Tyr Val Gly Leu Arg Asn
Leu 85 90 95Thr Ile Val Asp Ser Gly Leu Lys Phe Val Ala His Lys Ala
Phe Leu 100 105 110Lys Asn Ser Asn Leu Gln His Ile Asn Phe Thr Arg
Asn Lys Leu Thr 115 120 125Ser Leu Ser Arg Lys His Phe Arg His Leu
Asp Leu Ser Glu Leu Ile 130 135 140Leu Val Gly Asn Pro Phe Thr Cys
Ser Cys Asp Ile Met Trp Ile Lys145 150 155 160Thr Leu Gln Glu Ala
Lys Ser Ser Pro Asp Thr Gln Asp Leu Tyr Cys 165 170 175Leu Asn Glu
Ser Ser Lys Asn Ile Pro Leu Ala Asn Leu Gln Ile Pro 180 185 190Asn
Cys Gly Leu Pro Ser Ala Asn Leu Ala Ala Pro Asn Leu Thr Val 195 200
205Glu Glu Gly Lys Ser Ile Thr Leu Ser Cys Ser Val Ala Gly Asp Pro
210 215 220Val Pro Asn Met Tyr Trp Asp Val Gly Asn Leu Val Ser Lys
His Met225 230 235 240Asn Glu Thr Ser His Thr Gln Gly Ser Leu Arg
Ile Thr Asn Ile Ser 245 250 255Ser Asp Asp Ser Gly Lys Gln Ile Ser
Cys Val Ala Glu Asn Leu Val 260 265 270Gly Glu Asp Gln Asp Ser Val
Asn Leu Thr Val His Phe Ala Pro Thr 275 280 285Ile Thr Phe Leu Glu
Ser Pro Thr Ser Asp His His Trp Cys Ile Pro 290 295 300Phe Thr Val
Lys Gly Asn Pro Lys Pro Ala Leu Gln Trp Phe Tyr Asn305 310 315
320Gly Ala Ile Leu Asn Glu Ser Lys Tyr Ile Cys Thr Lys Ile His Val
325 330 335Thr Asn His Thr Glu Tyr His Gly Cys Leu Gln Leu Asp Asn
Pro Thr 340 345 350His Met Asn Asn Gly Asp Tyr Thr Leu Ile Ala Lys
Asn Glu Tyr Gly 355 360 365Lys Asp Glu Lys Gln Ile Ser Ala His Phe
Met Gly Trp Pro Gly Ile 370 375 380Asp Asp Gly Ala Asn Pro Asn Tyr
Pro Asp Val Ile Tyr Glu Asp Tyr385 390 395 400Gly Thr Ala Ala Asn
Asp Ile Gly Asp Thr Thr Asn Arg Ser Asn Glu 405 410 415Ile Pro Ser
Thr Asp Val Thr Asp Lys Thr Gly Arg Glu His Leu Ser 420 425 430Val
Tyr Ala Val Val Val Ile Ala Ser Val Val Gly Phe Cys Leu Leu 435 440
445Val Met Leu Phe Leu Leu Lys Leu Ala Arg His Ser Lys Phe Gly Met
450 455 460Lys Gly Pro Ala Ser Val Ile Ser Asn Asp Asp Asp Ser Ala
Ser Pro465 470 475 480Leu His His Ile Ser Asn Gly Ser Asn Thr Pro
Ser Ser Ser Glu Gly 485 490 495Gly Pro Asp Ala Val Ile Ile Gly Met
Thr Lys Ile Pro Val Ile Glu 500 505 510Asn Pro Gln Tyr Phe Gly Ile
Thr Asn Ser Gln Leu Lys Pro Asp Thr 515 520 525Phe Val Gln His Ile
Lys Arg His Asn Ile Val Leu Lys Arg Glu Leu 530 535 540Gly Glu Gly
Ala Phe Gly Lys Val Phe Leu Ala Glu Cys Tyr Asn Leu545 550 555
560Cys Pro Glu Gln Asp Lys Ile Leu Val Ala Val Lys Thr Leu Lys Asp
565 570 575Ala Ser Asp Asn Ala Arg Lys Asp Phe His Arg Glu Ala Glu
Leu Leu 580 585 590Thr Asn Leu Gln His Glu His Ile Val Lys Phe Tyr
Gly Val Cys Val 595 600 605Glu Gly Asp Pro Leu Ile Met Val Phe Glu
Tyr Met Lys His Gly Asp 610 615 620Leu Asn Lys Phe Leu Arg Ala His
Gly Pro Asp Ala Val Leu Met Ala625 630 635 640Glu Gly Asn Pro Pro
Thr Glu Leu Thr Gln Ser Gln Met Leu His Ile 645 650 655Ala Gln Gln
Ile Ala Ala Gly Met Val Tyr Leu Ala Ser Gln His Phe 660 665 670Val
His Arg Asp Leu Ala Thr Arg Asn Cys Leu Val Gly Glu Asn Leu 675 680
685Leu Val Lys Ile Gly Asp Phe Gly Met Ser Arg Asp Val Tyr Ser Thr
690 695 700Asp Tyr Tyr Arg Val Gly Gly His Thr Met Leu Pro Ile Arg
Trp Met705 710 715 720Pro Pro Glu Ser Ile Met Tyr Arg Lys Phe Thr
Thr Glu Ser Asp Val 725 730 735Trp Ser Leu Gly Val Val Leu Trp Glu
Ile Phe Thr Tyr Gly Lys Gln 740 745 750Pro Trp Tyr Gln Leu Ser Asn
Asn Glu Val Ile Glu Cys Ile Thr Gln 755 760 765Gly Arg Val Leu Gln
Arg Pro Arg Thr Cys Pro Gln Glu Val Tyr Glu 770 775 780Leu Met Leu
Gly Cys Trp Gln Arg Glu Pro His Met Arg Lys Asn Ile785 790 795
800Lys Gly Ile His Thr Leu Leu Gln Asn Leu Ala Lys Ala Ser Pro Val
805 810 815Tyr Leu Asp Ile Leu Gly 820311PRTArtificial1G11 and
humanised 1G11 CDR L2 (Kabat, Chothia, AbM) 3Arg Ala Ser Gln Arg
Ile Ser Asn Asn Leu His1 5 1047PRTArtificial1G11 and humanised 1G11
CDR L2 (Kabat, Chothia, AbM) 4Tyr Val Ser Gln Ser Ile Ser1
559PRTArtificial1G11 and humanised 1G11 CDR L3 (Kabat, Chothia,
AbM) 5Gln Gln Ser Asn Ser Trp Pro Leu Thr1 565PRTArtificial1G11 and
humanised 1G11 CDR H1 (Kabat) 6Ser Tyr Tyr Ile Asn1
5715PRTArtificial1G11 and humanised 1G11 CDR H2 (Kabat) 7Arg Ile
Ala Pro Gly Asn Thr Tyr Tyr Asn Glu Ile Phe Lys Gly1 5 10
1589PRTArtificial1G11 and humanised 1G11 CDR H3 (Kabat, Chothia,
AbM) 8Arg Gly Tyr Glu Gly Ala Leu Asp Tyr1 5917PRTArtificial3A3 CDR
L1 (Kabat) 9Lys Ser Ser Gln Ser Leu Leu Tyr Ser Gly Asn Gln Lys Asn
Tyr Leu1 5 10 15Ala107PRTArtificial3A3 CDR L2 (Kabat) 10Trp Ala Ser
Thr Arg Glu Ser1 5119PRTArtificial3A3 CDR L3 (Kabat) 11Gln Gln Tyr
Tyr Ser Tyr Pro Tyr Thr1 5125PRTArtificial3A3 CDR H1 (Kabat) 12Ser
Tyr Trp Met His1 51317PRTArtificial3A3 CDR H2 (Kabat) 13Tyr Ile Asn
Pro Ser Thr Gly Tyr Thr Asp Tyr Asn Gln Lys Phe Lys1 5 10
15Asp146PRTArtificial3A3 CDR H3 (Kabat) 14Ser Arg Ala Ala Arg Tyr1
51512PRTArtificial8E5 CDR L1 (Kabat) 15Arg Ala Ser Ser Ser Val Ser
Ser Ser Tyr Leu His1 5 10167PRTArtificial8E5 CDR L2 (Kabat) 16Ser
Thr Ser Asn Leu Ala Ser1 5179PRTArtificial8E5 CDR L3 (Kabat) 17Gln
Gln Tyr Ser Gly Tyr Pro Leu Thr1 5185PRTArtificial8E5 CDR H1
(Kabat) 18Thr Tyr Gly Met Ser1 51917PRTArtificial8E5 CDR H2 (Kabat)
19Thr Val Ser Thr Gly Gly Thr Tyr Thr Tyr Tyr Pro Asp Ser Val Lys1
5 10 15Gly207PRTArtificial8E5 CDR H3 (Kabat) 20Gly Gly Tyr Ser Phe
Ala Tyr1 52115PRTArtificial5D11 CDR L1 (Kabat) 21Arg Ala Ser Gln
Ser Val Ser Thr Ser Phe Tyr Ser Tyr Met His1 5 10
15227PRTArtificial5D11 CDR L2 (Kabat) 22Tyr Ala Ser Asn Leu Gln
Ser1 5239PRTArtificial5D11 CDR L3 (Kabat) 23Gln His Ser Trp Glu Ile
Pro Trp Thr1 5245PRTArtificial5D11 CDR H1 (Kabat) 24Asn Tyr Leu Ile
Glu1 52517PRTArtificial5D11 CDR H2 (Kabat) 25Val Ile Asn Pro Gly
Ser Gly Gly Thr Asn Tyr Asn Asp Lys Phe Lys1 5 10
15Gly268PRTArtificial5D11 CDR H3 (Kabat) 26Gly Gly Asn Asp Tyr Gly
Asp Tyr1 527440PRTMouse 27Gln Val Gln Leu Gln Gln Ser Gly Asp Asp
Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Tyr Ile Asn Trp Ile Lys Gln Arg
Pro Gly Gln Gly Leu Glu Cys Ile 35 40 45Gly Arg Ile Ala Pro Gly Asn
Thr Tyr Tyr Asn Glu Ile Phe Lys Gly 50 55 60Lys Ala Ile Leu Thr Val
Asp Thr Ser Ser Ser Thr Ala Tyr Ile Gln65 70 75 80Leu Ser Ser Leu
Ser Ser Glu Asp Ser Gly Val Tyr Phe Cys Ala Arg 85 90 95Arg Gly Tyr
Glu Gly Ala Leu Asp Tyr Trp Gly Gln Gly Thr Ser Val 100 105 110Thr
Val Ser Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu Ala 115 120
125Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu Gly Cys Leu
130 135 140Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn
Ser Gly145 150 155 160Ser Leu Ser Ser Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Asp 165 170 175Leu Tyr Thr Leu Ser Ser Ser Val Thr
Val Pro Ser Ser Thr Trp Pro 180 185 190Ser Glu Thr Val Thr Cys Asn
Val Ala His Pro Ala Ser Ser Thr Lys 195 200 205Val Asp Lys Lys Ile
Val Pro Arg Asp Cys Gly Cys Lys Pro Cys Ile 210 215 220Cys Thr Val
Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro Lys Pro225 230 235
240Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys Val Val
245 250 255Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp
Phe Val 260 265 270Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro
Arg Glu Glu Gln 275 280 285Phe Asn Ser Thr Phe Arg Ser Val Ser Glu
Leu Pro Ile Met His Gln 290 295 300Asp Trp Leu Asn Gly Lys Glu Phe
Lys Cys Arg Val Asn Ser Ala Ala305 310 315 320Phe Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys Thr Lys Gly Arg Pro 325 330 335Lys Ala Pro
Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln Met Ala 340 345 350Lys
Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe Phe Pro Glu 355 360
365Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu Asn Tyr
370 375 380Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe
Val Tyr385 390 395 400Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu
Ala Gly Asn Thr Phe 405 410 415Thr Cys Ser Val Leu His Glu Gly Leu
His Asn His His Thr Glu Lys 420 425 430Ser Leu Ser His Ser Pro Gly
Lys 435 44028214PRTMouse 28Asp Ile Val Leu Thr Gln Ser Pro Ala Thr
Leu Ser Val Thr Pro Gly1 5 10 15Asp Ser Val Ser Leu Ser Cys Arg Ala
Ser Gln Arg Ile Ser Asn Asn 20 25 30Leu His Trp Tyr Gln Gln Lys Ser
His Glu Ser Pro Arg Leu Leu Ile 35 40 45Lys Tyr Val Ser Gln Ser Ile
Ser Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Ser Ile Asn Ser Val Glu Thr65 70 75 80Glu Asp Phe Gly
Met Tyr Phe Cys Gln Gln Ser Asn Ser Trp Pro Leu 85 90 95Thr Phe Gly
Ala Gly Thr Lys Leu Glu Leu Lys Arg Ala Asp Ala Ala 100 105 110Pro
Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly 115 120
125Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile
130 135 140Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly
Val Leu145 150 155 160Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser
Thr Tyr Ser Met Ser 165 170 175Ser Thr Leu Thr Leu Thr Lys Asp Glu
Tyr Glu Arg His Asn Ser Tyr 180 185 190Thr Cys Glu Ala Thr His Lys
Thr Ser Thr Ser Pro Ile Val Lys Ser 195 200 205Phe Asn Arg Asn Glu
Cys 21029439PRTmouse 29Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu
Ala Lys Pro Gly Ala1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Ser Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Arg Pro
Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asn Pro Ser Thr Gly
Tyr Thr Asp Tyr Asn Gln Lys Phe 50 55 60Lys Asp Lys Ala Thr Leu Thr
Ala Asp Lys Ser Ser Asn Thr Ala Tyr65 70 75 80Met Gln Leu Ser Ser
Leu Thr Ser Asp Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Arg
Ala Ala Arg Tyr Trp Gly Gln Gly Thr Thr Leu Thr 100 105 110Val Ser
Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu Ala Pro 115 120
125Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu Gly Cys Leu Val
130 135 140Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn Ser
Gly Ser145 150 155 160Leu Ser Ser Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Asp Leu 165 170 175Tyr Thr Leu Ser Ser Ser Val Thr Val
Pro Ser Ser Thr Trp Pro Ser 180 185 190Glu Thr Val Thr Cys Asn Val
Ala His Pro Ala Ser Ser Thr Lys Val 195 200 205Asp Lys Lys Ile Val
Pro Arg Asp Cys Gly Cys Lys
Pro Cys Ile Cys 210 215 220Thr Val Pro Glu Val Ser Ser Val Phe Ile
Phe Pro Pro Lys Pro Lys225 230 235 240Asp Val Leu Thr Ile Thr Leu
Thr Pro Lys Val Thr Cys Val Val Val 245 250 255Asp Ile Ser Lys Asp
Asp Pro Glu Val Gln Phe Ser Trp Phe Val Asp 260 265 270Asp Val Glu
Val His Thr Ala Gln Thr Gln Pro Arg Glu Glu Gln Phe 275 280 285Asn
Ser Thr Phe Arg Ser Val Ser Glu Leu Pro Ile Met His Gln Asp 290 295
300Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn Ser Ala Ala
Phe305 310 315 320Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys
Gly Arg Pro Lys 325 330 335Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro
Lys Glu Gln Met Ala Lys 340 345 350Asp Lys Val Ser Leu Thr Cys Met
Ile Thr Asp Phe Phe Pro Glu Asp 355 360 365Ile Thr Val Glu Trp Gln
Trp Asn Gly Gln Pro Ala Glu Asn Tyr Lys 370 375 380Asn Thr Gln Pro
Ile Met Asp Thr Asp Gly Ser Tyr Phe Val Tyr Ser385 390 395 400Lys
Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly Asn Thr Phe Thr 405 410
415Cys Ser Val Leu His Glu Gly Leu His Asn His His Thr Glu Lys Ser
420 425 430Leu Ser His Ser Pro Gly Lys 43530220PRTMouse 30Asp Ile
Val Met Ser Gln Ser Pro Ser Ser Leu Ala Val Ser Val Gly1 5 10 15Glu
Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser Leu Leu Tyr Ser 20 25
30Gly Asn Gln Lys Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln
35 40 45Ser Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser Gly
Val 50 55 60Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr
Leu Thr65 70 75 80Ile Ser Ser Val Lys Ala Glu Asp Leu Ala Val Tyr
Tyr Cys Gln Gln 85 90 95Tyr Tyr Ser Tyr Pro Tyr Thr Phe Gly Gly Gly
Thr Lys Leu Glu Ile 100 105 110Lys Arg Ala Asp Ala Ala Pro Thr Val
Ser Ile Phe Pro Pro Ser Ser 115 120 125Glu Gln Leu Thr Ser Gly Gly
Ala Ser Val Val Cys Phe Leu Asn Asn 130 135 140Phe Tyr Pro Lys Asp
Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu145 150 155 160Arg Gln
Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp 165 170
175Ser Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr
180 185 190Glu Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr
Ser Thr 195 200 205Ser Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys
210 215 22031440PRTMouse 31Glu Val Gln Leu Val Glu Ser Gly Gly Asp
Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Thr Tyr 20 25 30Gly Met Ser Trp Val Arg Gln Thr
Pro Asp Lys Gly Leu Glu Trp Val 35 40 45Ala Thr Val Ser Thr Gly Gly
Thr Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser
Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Gly
Gly Tyr Ser Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110Thr
Val Ser Ala Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu Ala 115 120
125Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu Gly Cys Leu
130 135 140Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn
Ser Gly145 150 155 160Ser Leu Ser Ser Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Asp 165 170 175Leu Tyr Thr Leu Ser Ser Ser Val Thr
Val Pro Ser Ser Thr Trp Pro 180 185 190Ser Glu Thr Val Thr Cys Asn
Val Ala His Pro Ala Ser Ser Thr Lys 195 200 205Val Asp Lys Lys Ile
Val Pro Arg Asp Cys Gly Cys Lys Pro Cys Ile 210 215 220Cys Thr Val
Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro Lys Pro225 230 235
240Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys Val Val
245 250 255Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp
Phe Val 260 265 270Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro
Arg Glu Glu Gln 275 280 285Phe Asn Ser Thr Phe Arg Ser Val Ser Glu
Leu Pro Ile Met His Gln 290 295 300Asp Trp Leu Asn Gly Lys Glu Phe
Lys Cys Arg Val Asn Ser Ala Ala305 310 315 320Phe Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys Thr Lys Gly Arg Pro 325 330 335Lys Ala Pro
Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln Met Ala 340 345 350Lys
Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe Phe Pro Glu 355 360
365Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu Asn Tyr
370 375 380Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe
Val Tyr385 390 395 400Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu
Ala Gly Asn Thr Phe 405 410 415Thr Cys Ser Val Leu His Glu Gly Leu
His Asn His His Thr Glu Lys 420 425 430Ser Leu Ser His Ser Pro Gly
Lys 435 44032215PRTMouse 32Glu Asn Val Leu Thr Gln Ser Pro Ala Ile
Met Ser Ala Ser Pro Gly1 5 10 15Glu Lys Val Thr Met Thr Cys Arg Ala
Ser Ser Ser Val Ser Ser Ser 20 25 30Tyr Leu His Trp Tyr Gln Gln Lys
Ser Gly Val Ser Pro Lys Leu Trp 35 40 45Ile Tyr Ser Thr Ser Asn Leu
Ala Ser Gly Val Pro Ala Arg Phe Ser 50 55 60Gly Ser Gly Ser Gly Thr
Ser Tyr Ser Leu Thr Ile Ser Ser Val Glu65 70 75 80Ala Glu Asp Ala
Ala Thr Tyr Tyr Cys Gln Gln Tyr Ser Gly Tyr Pro 85 90 95Leu Thr Phe
Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg Ala Asp Ala 100 105 110Ala
Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser 115 120
125Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp
130 135 140Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn
Gly Val145 150 155 160Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp
Ser Thr Tyr Ser Met 165 170 175Ser Ser Thr Leu Thr Leu Thr Lys Asp
Glu Tyr Glu Arg His Asn Ser 180 185 190Tyr Thr Cys Glu Ala Thr His
Lys Thr Ser Thr Ser Pro Ile Val Lys 195 200 205Ser Phe Asn Arg Asn
Glu Cys 210 21533441PRTMouse 33Gln Val His Leu Gln Gln Ser Gly Ala
Glu Leu Val Arg Pro Gly Thr1 5 10 15Ser Val Lys Val Ser Cys Lys Ala
Ser Gly Tyr Ala Phe Thr Asn Tyr 20 25 30Leu Ile Glu Trp Ile Lys Gln
Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Val Ile Asn Pro Gly
Ser Gly Gly Thr Asn Tyr Asn Asp Lys Phe 50 55 60Lys Gly Lys Ala Ile
Leu Thr Ala Asp Lys Ser Ser Thr Thr Ala Tyr65 70 75 80Met Gln Leu
Ser Ser Leu Thr Ser Asp Asp Ser Ala Val Tyr Phe Cys 85 90 95Ala Arg
Gly Gly Asn Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr Ser 100 105
110Val Thr Val Ser Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu
115 120 125Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu
Gly Cys 130 135 140Leu Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Val
Thr Trp Asn Ser145 150 155 160Gly Ser Leu Ser Ser Gly Val His Thr
Phe Pro Ala Val Leu Gln Ser 165 170 175Asp Leu Tyr Thr Leu Ser Ser
Ser Val Thr Val Pro Ser Ser Thr Trp 180 185 190Pro Ser Glu Thr Val
Thr Cys Asn Val Ala His Pro Ala Ser Ser Thr 195 200 205Lys Val Asp
Lys Lys Ile Val Pro Arg Asp Cys Gly Cys Lys Pro Cys 210 215 220Ile
Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro Lys225 230
235 240Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys
Val 245 250 255Val Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe
Ser Trp Phe 260 265 270Val Asp Asp Val Glu Val His Thr Ala Gln Thr
Gln Pro Arg Glu Glu 275 280 285Gln Phe Asn Ser Thr Phe Arg Ser Val
Ser Glu Leu Pro Ile Met His 290 295 300Gln Asp Trp Leu Asn Gly Lys
Glu Phe Lys Cys Arg Val Asn Ser Ala305 310 315 320Ala Phe Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Arg 325 330 335Pro Lys
Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln Met 340 345
350Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe Phe Pro
355 360 365Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala
Glu Asn 370 375 380Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly
Ser Tyr Phe Val385 390 395 400Tyr Ser Lys Leu Asn Val Gln Lys Ser
Asn Trp Glu Ala Gly Asn Thr 405 410 415Phe Thr Cys Ser Val Leu His
Glu Gly Leu His Asn His His Thr Glu 420 425 430Lys Ser Leu Ser His
Ser Pro Gly Lys 435 44034218PRTMouse 34Asp Ile Val Leu Thr Gln Ser
Pro Ala Ser Leu Ala Val Ser Leu Gly1 5 10 15Gln Arg Ala Thr Ile Ser
Cys Arg Ala Ser Gln Ser Val Ser Thr Ser 20 25 30Phe Tyr Ser Tyr Met
His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45Lys Val Phe Ile
Lys Tyr Ala Ser Asn Leu Gln Ser Gly Val Pro Ala 50 55 60Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His65 70 75 80Pro
Val Glu Glu Asp Asp Thr Ala Thr Tyr Tyr Cys Gln His Ser Trp 85 90
95Glu Ile Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg
100 105 110Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser
Glu Gln 115 120 125Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu
Asn Asn Phe Tyr 130 135 140Pro Lys Asp Ile Asn Val Lys Trp Lys Ile
Asp Gly Ser Glu Arg Gln145 150 155 160Asn Gly Val Leu Asn Ser Trp
Thr Asp Gln Asp Ser Lys Asp Ser Thr 165 170 175Tyr Ser Met Ser Ser
Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg 180 185 190His Asn Ser
Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro 195 200 205Ile
Val Lys Ser Phe Asn Arg Asn Glu Cys 210 21535165PRTArtificialHuman
TrkB D1-D3 domain deletion variant C32-L196 35Cys Pro Thr Ser Cys
Lys Cys Ser Ala Ser Arg Ile Trp Cys Ser Asp1 5 10 15Pro Ser Pro Gly
Ile Val Ala Phe Pro Arg Leu Glu Pro Asn Ser Val 20 25 30Asp Pro Glu
Asn Ile Thr Glu Ile Phe Ile Ala Asn Gln Lys Arg Leu 35 40 45Glu Ile
Ile Asn Glu Asp Asp Val Glu Ala Tyr Val Gly Leu Arg Asn 50 55 60Leu
Thr Ile Val Asp Ser Gly Leu Lys Phe Val Ala His Lys Ala Phe65 70 75
80Leu Lys Asn Ser Asn Leu Gln His Ile Asn Phe Thr Arg Asn Lys Leu
85 90 95Thr Ser Leu Ser Arg Lys His Phe Arg His Leu Asp Leu Ser Glu
Leu 100 105 110Ile Leu Val Gly Asn Pro Phe Thr Cys Ser Cys Asp Ile
Met Trp Ile 115 120 125Lys Thr Leu Gln Glu Ala Lys Ser Ser Pro Asp
Thr Gln Asp Leu Tyr 130 135 140Cys Leu Asn Glu Ser Ser Lys Asn Ile
Pro Leu Ala Asn Leu Gln Ile145 150 155 160Pro Asn Cys Gly Leu
16536234PRTArtificialHuman TrkB D4-D5-JM domain deletion variant
P197-H430 36Pro Ser Ala Asn Leu Ala Ala Pro Asn Leu Thr Val Glu Glu
Gly Lys1 5 10 15Ser Ile Thr Leu Ser Cys Ser Val Ala Gly Asp Pro Val
Pro Asn Met 20 25 30Tyr Trp Asp Val Gly Asn Leu Val Ser Lys His Met
Asn Glu Thr Ser 35 40 45His Thr Gln Gly Ser Leu Arg Ile Thr Asn Ile
Ser Ser Asp Asp Ser 50 55 60Gly Lys Gln Ile Ser Cys Val Ala Glu Asn
Leu Val Gly Glu Asp Gln65 70 75 80Asp Ser Val Asn Leu Thr Val His
Phe Ala Pro Thr Ile Thr Phe Leu 85 90 95Glu Ser Pro Thr Ser Asp His
His Trp Cys Ile Pro Phe Thr Val Lys 100 105 110Gly Asn Pro Lys Pro
Ala Leu Gln Trp Phe Tyr Asn Gly Ala Ile Leu 115 120 125Asn Glu Ser
Lys Tyr Ile Cys Thr Lys Ile His Val Thr Asn His Thr 130 135 140Glu
Tyr His Gly Cys Leu Gln Leu Asp Asn Pro Thr His Met Asn Asn145 150
155 160Gly Asp Tyr Thr Leu Ile Ala Lys Asn Glu Tyr Gly Lys Asp Glu
Lys 165 170 175Gln Ile Ser Ala His Phe Met Gly Trp Pro Gly Ile Asp
Asp Gly Ala 180 185 190Asn Pro Asn Tyr Pro Asp Val Ile Tyr Glu Asp
Tyr Gly Thr Ala Ala 195 200 205Asn Asp Ile Gly Asp Thr Thr Asn Arg
Ser Asn Glu Ile Pro Ser Thr 210 215 220Asp Val Thr Asp Lys Thr Gly
Arg Glu His225 23037147PRTArtificialHuman TrkB D5 domain deletion
variant H284-H430 37His Phe Ala Pro Thr Ile Thr Phe Leu Glu Ser Pro
Thr Ser Asp His1 5 10 15His Trp Cys Ile Pro Phe Thr Val Lys Gly Asn
Pro Lys Pro Ala Leu 20 25 30Gln Trp Phe Tyr Asn Gly Ala Ile Leu Asn
Glu Ser Lys Tyr Ile Cys 35 40 45Thr Lys Ile His Val Thr Asn His Thr
Glu Tyr His Gly Cys Leu Gln 50 55 60Leu Asp Asn Pro Thr His Met Asn
Asn Gly Asp Tyr Thr Leu Ile Ala65 70 75 80Lys Asn Glu Tyr Gly Lys
Asp Glu Lys Gln Ile Ser Ala His Phe Met 85 90 95Gly Trp Pro Gly Ile
Asp Asp Gly Ala Asn Pro Asn Tyr Pro Asp Val 100 105 110Ile Tyr Glu
Asp Tyr Gly Thr Ala Ala Asn Asp Ile Gly Asp Thr Thr 115 120 125Asn
Arg Ser Asn Glu Ile Pro Ser Thr Asp Val Thr Asp Lys Thr Gly 130 135
140Arg Glu His14538221PRTArtificial1G11 chimeric Fab1 [variable
region (VH) from 1G11 fused with constant region (CH1) from human
IgG1] 38Gln Val Gln Leu Gln Gln Ser Gly Asp Asp Leu Val Lys Pro Gly
Ala1 5 10 15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr
Ser Tyr 20 25 30Tyr Ile Asn Trp Ile Lys Gln Arg Pro Gly Gln Gly Leu
Glu Cys Ile 35 40 45Gly Arg Ile Ala Pro Gly Asn Thr Tyr Tyr Asn Glu
Ile Phe Lys Gly 50 55 60Lys Ala Ile Leu Thr Val Asp Thr Ser Ser Ser
Thr Ala Tyr Ile Gln65 70 75 80Leu Ser Ser Leu Ser Ser Glu Asp Ser
Gly Val Tyr Phe Cys Ala Arg 85 90 95Arg Gly Tyr Glu Gly Ala Leu Asp
Tyr Trp Gly Gln Gly Thr Ser Val 100 105 110Thr Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro Leu Ala
115 120 125Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly
Cys Leu 130 135 140Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser
Trp Asn Ser Gly145 150 155 160Ala Leu Thr Ser Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser 165 170 175Gly Leu Tyr Ser Leu Ser Ser
Val Val Thr Val Pro Ser Ser Ser Leu 180 185 190Gly Thr Gln Thr Tyr
Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr 195 200 205Lys Val Asp
Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215
22039214PRTArtificial1G11 chimeric Fab1 [variable region (VL) from
1G11 fused with constant region (CL1) from human IgG1] 39Asp Ile
Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Val Thr Pro Gly1 5 10 15Asp
Ser Val Ser Leu Ser Cys Arg Ala Ser Gln Arg Ile Ser Asn Asn 20 25
30Leu His Trp Tyr Gln Gln Lys Ser His Glu Ser Pro Arg Leu Leu Ile
35 40 45Lys Tyr Val Ser Gln Ser Ile Ser Gly Ile Pro Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile Asn Ser Val
Glu Thr65 70 75 80Glu Asp Phe Gly Met Tyr Phe Cys Gln Gln Ser Asn
Ser Trp Pro Leu 85 90 95Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170
175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr
180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr
Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
21040116PRTArtificialHumanised 1G11 VH 40Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Tyr Ile Asn Trp
Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Ser Met 35 40 45Gly Arg Ile
Ala Pro Gly Asn Thr Tyr Tyr Asn Glu Ile Phe Lys Gly 50 55 60Arg Val
Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr Met Glu65 70 75
80Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg
85 90 95Arg Gly Tyr Glu Gly Ala Leu Asp Tyr Trp Gly Gln Gly Thr Leu
Val 100 105 110Thr Val Ser Ser 11541107PRTArtificialHumanised 1G11
VL 41Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro
Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Arg Ile Ser
Asn Asn 20 25 30Leu His Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg
Leu Leu Ile 35 40 45Lys Tyr Val Ser Gln Ser Ile Ser Gly Ile Pro Ala
Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
Ser Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala Val Tyr Tyr Cys Gln
Gln Ser Asn Ser Trp Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Leu
Glu Ile Lys 100 10542446PRTArtificialHumanised 1G11 Heavy chain
42Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser
Tyr 20 25 30Tyr Ile Asn Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Ser Met 35 40 45Gly Arg Ile Ala Pro Gly Asn Thr Tyr Tyr Asn Glu Ile
Phe Lys Gly 50 55 60Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr
Ala Tyr Met Glu65 70 75 80Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys Ala Arg 85 90 95Arg Gly Tyr Glu Gly Ala Leu Asp Tyr
Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala 115 120 125Pro Ser Ser Lys Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu 130 135 140Val Lys Asp
Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly145 150 155
160Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser
165 170 175Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu 180 185 190Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser Asn Thr 195 200 205Lys Val Asp Lys Lys Val Glu Pro Lys Ser
Cys Asp Lys Thr His Thr 210 215 220Cys Pro Pro Cys Pro Ala Pro Glu
Leu Ala Gly Ala Pro Ser Val Phe225 230 235 240Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro 245 250 255Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val 260 265 270Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 275 280
285Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
290 295 300Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys305 310 315 320Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser 325 330 335Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro 340 345 350Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val 355 360 365Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly 370 375 380Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp385 390 395
400Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
405 410 415Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu His 420 425 430Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 435 440 44543214PRTArtificialHumanised 1G11 Light chain
43Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly1
5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Arg Ile Ser Asn
Asn 20 25 30Leu His Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu
Leu Ile 35 40 45Lys Tyr Val Ser Gln Ser Ile Ser Gly Ile Pro Ala Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln
Ser Asn Ser Trp Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu
Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro
Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val
Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys
Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
210441338DNAArtificialDNA encoding humanised 1G11 Heavy chain
44caggtgcagc tcgtgcagag cggcgccgaa gtcaaaaagc ccggcagcag cgtgaaggtg
60agctgcaagg ccagcggcta caccttcacc tcctactaca tcaactgggt gaggcaggct
120cccggacagg gcctggagag catgggcagg atcgcccccg gcaacaccta
ctacaacgag 180atcttcaagg gcagggtgac catcactgcc gacaagagca
ccagcaccgc ctacatggaa 240ctgtctagcc tgaggagcga ggacaccgcc
gtgtactact gcgccagaag gggctacgag 300ggcgccctgg actattgggg
ccagggcaca ctagtgaccg tgtccagcgc cagcaccaag 360ggccccagcg
tgttccccct ggcccccagc agcaagagca ccagcggcgg cacagccgcc
420ctgggctgcc tggtgaagga ctacttcccc gaaccggtga ccgtgtcctg
gaacagcgga 480gccctgacca gcggcgtgca caccttcccc gccgtgctgc
agagcagcgg cctgtacagc 540ctgagcagcg tggtgaccgt gcccagcagc
agcctgggca cccagaccta catctgtaac 600gtgaaccaca agcccagcaa
caccaaggtg gacaagaagg tggagcccaa gagctgtgac 660aagacccaca
cctgcccccc ctgccctgcc cccgagctgg ccggagcccc cagcgtgttc
720ctgttccccc ccaagcctaa ggacaccctg atgatcagca gaacccccga
ggtgacctgt 780gtggtggtgg atgtgagcca cgaggaccct gaggtgaagt
tcaactggta cgtggacggc 840gtggaggtgc acaatgccaa gaccaagccc
agggaggagc agtacaacag cacctaccgg 900gtggtgtccg tgctgaccgt
gctgcaccag gattggctga acggcaagga gtacaagtgt 960aaggtgtcca
acaaggccct gcctgcccct atcgagaaaa ccatcagcaa ggccaagggc
1020cagcccagag agccccaggt gtacaccctg ccccctagca gagatgagct
gaccaagaac 1080caggtgtccc tgacctgcct ggtgaagggc ttctacccca
gcgacatcgc cgtggagtgg 1140gagagcaacg gccagcccga gaacaactac
aagaccaccc cccctgtgct ggacagcgat 1200ggcagcttct tcctgtacag
caagctgacc gtggacaaga gcagatggca gcagggcaac 1260gtgttcagct
gctccgtgat gcacgaggcc ctgcacaatc actacaccca gaagagcctg
1320agcctgtccc ctggcaag 133845642DNAArtificialDNA encoding
humanised 1G11 Light chain 45gagatcgtgc tgacccagag ccccgccact
ctgagcctga gcccaggcga aagggcaacc 60ctgagctgca gggcctccca gaggatcagc
aacaacctgc actggtacca gcagaagccc 120ggccaggccc ccaggctgct
gatcaaatac gtgagccaga gcatcagcgg catccccgcc 180aggtttagcg
gaagcggcag cggcaccgac ttcaccctga ccattagcag cctggagccc
240gaggacttcg ccgtctacta ctgccagcag tctaacagct ggcccctgac
cttcggccag 300ggcaccaagc tcgagatcaa gcgtacggtg gccgccccca
gcgtgttcat cttccccccc 360agcgatgagc agctgaagag cggcaccgcc
agcgtggtgt gtctgctgaa caacttctac 420ccccgggagg ccaaggtgca
gtggaaggtg gacaatgccc tgcagagcgg caacagccag 480gagagcgtga
ccgagcagga cagcaaggac tccacctaca gcctgagcag caccctgacc
540ctgagcaagg ccgactacga gaagcacaag gtgtacgcct gtgaggtgac
ccaccagggc 600ctgtccagcc ccgtgaccaa gagcttcaac cggggcgagt gc
64246115PRTArtificialHumanised 3A3 VH 46Gln Val Gln Leu Val Gln Ser
Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15Ser Val Lys Val Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Ser Ser Tyr 20 25 30Trp Met His Trp Val
Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Tyr Ile Asn
Pro Ser Thr Gly Tyr Thr Asp Tyr Asn Gln Lys Phe 50 55 60Lys Asp Arg
Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70 75 80Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95Ala Arg Ser Arg Ala Ala Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr
100 105 110Val Ser Ser 11547113PRTArtificialHumanised 3A3 VL 47Asp
Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly1 5 10
15Glu Arg Ala Thr Ile Asn Cys Lys Ser Ser Gln Ser Leu Leu Tyr Ser
20 25 30Gly Asn Gln Lys Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
Gln 35 40 45Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser
Gly Val 50 55 60Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr65 70 75 80Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val
Tyr Tyr Cys Gln Gln 85 90 95Tyr Tyr Ser Tyr Pro Tyr Thr Phe Gly Gln
Gly Thr Lys Leu Glu Ile 100 105 110Lys48445PRTArtificialHumanised
3A3 HC 48Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ser1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe
Ser Ser Tyr 20 25 30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly
Leu Glu Trp Met 35 40 45Gly Tyr Ile Asn Pro Ser Thr Gly Tyr Thr Asp
Tyr Asn Gln Lys Phe 50 55 60Lys Asp Arg Val Thr Ile Thr Ala Asp Lys
Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Arg Ala Ala Arg
Tyr Trp Gly Gln Gly Thr Leu Val Thr 100 105 110Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro 115 120 125Ser Ser Lys
Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val 130 135 140Lys
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala145 150
155 160Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser
Gly 165 170 175Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly 180 185 190Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser Asn Thr Lys 195 200 205Val Asp Lys Lys Val Glu Pro Lys Ser
Cys Asp Lys Thr His Thr Cys 210 215 220Pro Pro Cys Pro Ala Pro Glu
Leu Ala Gly Ala Pro Ser Val Phe Leu225 230 235 240Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 245 250 255Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 260 265
270Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
275 280 285Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
Val Leu 290 295 300Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys305 310 315 320Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys 325 330 335Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser 340 345 350Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 355 360 365Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 370 375 380Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly385 390
395 400Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln 405 410 415Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu His Asn 420 425 430His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 435 440 44549220PRTArtificialHumanised 3A3 LC 49Asp Ile Val
Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly1 5 10 15Glu Arg
Ala Thr Ile Asn Cys Lys Ser Ser Gln Ser Leu Leu Tyr Ser 20 25 30Gly
Asn Gln Lys Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln 35 40
45Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser Gly Val
50 55 60Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
Thr65 70 75 80Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr
Cys Gln Gln 85 90 95Tyr Tyr Ser Tyr Pro Tyr Thr Phe Gly Gln Gly Thr
Lys Leu Glu Ile 100 105 110Lys Arg Thr Val Ala Ala Pro Ser Val Phe
Ile Phe Pro Pro Ser Asp 115 120 125Glu Gln Leu Lys Ser Gly Thr Ala
Ser Val Val Cys Leu Leu Asn Asn 130 135 140Phe Tyr Pro Arg Glu Ala
Lys Val Gln Trp Lys Val Asp Asn Ala Leu145 150 155 160Gln Ser Gly
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp 165 170 175Ser
Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr 180 185
190Glu
Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser 195 200
205Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215
220501335DNAArtificialDNA encoding humanised 3A3 HC 50caggtccagc
tggtgcagag cggcgccgag gtgaagaaac ccggcagctc cgtgaaggtg 60agctgcaagg
ccagcggcta caccttctcc agctactgga tgcactgggt gaggcaggcc
120cccggacagg gcctggagtg gatgggctac atcaacccca gcaccggcta
caccgactac 180aaccagaagt tcaaggacag ggtgaccatc accgccgaca
agagcaccag caccgcctac 240atggaactga gcagcctgag gagcgaggac
accgccgtgt actattgcgc caggagcagg 300gctgccaggt actggggcca
gggcacacta gtgaccgtgt ccagcgccag caccaagggc 360cccagcgtgt
tccccctggc ccccagcagc aagagcacca gcggcggcac agccgccctg
420ggctgcctgg tgaaggacta cttccccgaa ccggtgaccg tgtcctggaa
cagcggagcc 480ctgaccagcg gcgtgcacac cttccccgcc gtgctgcaga
gcagcggcct gtacagcctg 540agcagcgtgg tgaccgtgcc cagcagcagc
ctgggcaccc agacctacat ctgtaacgtg 600aaccacaagc ccagcaacac
caaggtggac aagaaggtgg agcccaagag ctgtgacaag 660acccacacct
gccccccctg ccctgccccc gagctggccg gagcccccag cgtgttcctg
720ttccccccca agcctaagga caccctgatg atcagcagaa cccccgaggt
gacctgtgtg 780gtggtggatg tgagccacga ggaccctgag gtgaagttca
actggtacgt ggacggcgtg 840gaggtgcaca atgccaagac caagcccagg
gaggagcagt acaacagcac ctaccgggtg 900gtgtccgtgc tgaccgtgct
gcaccaggat tggctgaacg gcaaggagta caagtgtaag 960gtgtccaaca
aggccctgcc tgcccctatc gagaaaacca tcagcaaggc caagggccag
1020cccagagagc cccaggtgta caccctgccc cctagcagag atgagctgac
caagaaccag 1080gtgtccctga cctgcctggt gaagggcttc taccccagcg
acatcgccgt ggagtgggag 1140agcaacggcc agcccgagaa caactacaag
accacccccc ctgtgctgga cagcgatggc 1200agcttcttcc tgtacagcaa
gctgaccgtg gacaagagca gatggcagca gggcaacgtg 1260ttcagctgct
ccgtgatgca cgaggccctg cacaatcact acacccagaa gagcctgagc
1320ctgtcccctg gcaag 133551660DNAArtificialDNA encoding humanised
3A3 LC 51gacatcgtga tgacccagag ccccgactct ctggccgtga gcctgggcga
aagggccacc 60atcaactgca agagcagcca gagcctcctg tacagcggca accagaagaa
ctacctggcc 120tggtatcagc agaagcccgg ccagcccccc aaactgctga
tctactgggc tagcacaagg 180gagagcggcg tgcctgatag gttcagcgga
agcggcagcg gcaccgactt caccctgacc 240attagcagcc tgcaggccga
ggacgtggcc gtctactact gccagcagta ctactcctac 300ccctacacct
tcggccaggg caccaagctg gagatcaagc gtacggtggc cgcccccagc
360gtgttcatct tcccccccag cgatgagcag ctgaagagcg gcaccgccag
cgtggtgtgt 420ctgctgaaca acttctaccc ccgggaggcc aaggtgcagt
ggaaggtgga caatgccctg 480cagagcggca acagccagga gagcgtgacc
gagcaggaca gcaaggactc cacctacagc 540ctgagcagca ccctgaccct
gagcaaggcc gactacgaga agcacaaggt gtacgcctgt 600gaggtgaccc
accagggcct gtccagcccc gtgaccaaga gcttcaaccg gggcgagtgc
66052117PRTArtificialHumanised 5D11 VH 52Gln Val Gln Leu Val Gln
Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Tyr Ala Phe Thr Asn Tyr 20 25 30Leu Ile Glu Trp
Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Val Ile
Asn Pro Gly Ser Gly Gly Thr Asn Tyr Asn Asp Lys Phe 50 55 60Lys Gly
Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Gly Gly Asn Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr
Leu 100 105 110Val Thr Val Ser Ser 11553111PRTArtificialHumanised
5D11 VL 53Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser
Leu Gly1 5 10 15Glu Arg Ala Thr Ile Asn Cys Arg Ala Ser Gln Ser Val
Ser Thr Ser 20 25 30Phe Tyr Ser Tyr Met His Trp Tyr Gln Gln Lys Pro
Gly Gln Pro Pro 35 40 45Lys Val Leu Ile Lys Tyr Ala Ser Asn Leu Gln
Ser Gly Val Pro Asp 50 55 60Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser65 70 75 80Ser Leu Gln Ala Glu Asp Val Ala
Val Tyr Tyr Cys Gln His Ser Trp 85 90 95Glu Ile Pro Trp Thr Phe Gly
Gln Gly Thr Lys Leu Glu Ile Lys 100 105
11054447PRTArtificialHumanised 5D11 Heavy chain 54Gln Val Gln Leu
Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Ala Phe Thr Asn Tyr 20 25 30Leu Ile
Glu Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly
Val Ile Asn Pro Gly Ser Gly Gly Thr Asn Tyr Asn Asp Lys Phe 50 55
60Lys Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Gly Gly Asn Asp Tyr Gly Asp Tyr Trp Gly Gln Gly
Thr Leu 100 105 110Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe Pro Leu 115 120 125Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly
Thr Ala Ala Leu Gly Cys 130 135 140Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser145 150 155 160Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro Ala Val Leu Gln Ser 165 170 175Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser 180 185 190Leu
Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn 195 200
205Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His
210 215 220Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Ala Gly Ala Pro
Ser Val225 230 235 240Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr 245 250 255Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro Glu 260 265 270Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys 275 280 285Thr Lys Pro Arg Glu
Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 290 295 300Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys305 310 315
320Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
325 330 335Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro 340 345 350Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu 355 360 365Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn 370 375 380Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser385 390 395 400Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 405 410 415Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420 425 430His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440
44555218PRTArtificialHumanised 5D11 Light Chain 55Asp Ile Val Met
Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly1 5 10 15Glu Arg Ala
Thr Ile Asn Cys Arg Ala Ser Gln Ser Val Ser Thr Ser 20 25 30Phe Tyr
Ser Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45Lys
Val Leu Ile Lys Tyr Ala Ser Asn Leu Gln Ser Gly Val Pro Asp 50 55
60Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser65
70 75 80Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln His Ser
Trp 85 90 95Glu Ile Pro Trp Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile
Lys Arg 100 105 110Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro
Ser Asp Glu Gln 115 120 125Leu Lys Ser Gly Thr Ala Ser Val Val Cys
Leu Leu Asn Asn Phe Tyr 130 135 140Pro Arg Glu Ala Lys Val Gln Trp
Lys Val Asp Asn Ala Leu Gln Ser145 150 155 160Gly Asn Ser Gln Glu
Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 165 170 175Tyr Ser Leu
Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 180 185 190His
Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro 195 200
205Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210
215561341DNAArtificialDNA encoding humanised 5D11 Heavy chain
56caggtgcagc tggtgcagag cggcgccgaa gtcaagaagc ccggcagctc cgtgaaggtg
60agctgcaaag ccagcggcta cgccttcacc aactacctga tcgagtgggt gaggcaggct
120cccggccagg gcctggagtg gatgggagtg atcaatcccg gcagcggcgg
caccaactac 180aacgacaagt tcaagggcag ggtgaccatc accgccgaca
agagcaccag caccgcctac 240atggaactga gcagcctcag gagcgaggac
actgccgtgt actattgcgc caggggcggg 300aacgattacg gcgactactg
gggccagggc acactagtga ccgtgtccag cgccagcacc 360aagggcccca
gcgtgttccc cctggccccc agcagcaaga gcaccagcgg cggcacagcc
420gccctgggct gcctggtgaa ggactacttc cccgaaccgg tgaccgtgtc
ctggaacagc 480ggagccctga ccagcggcgt gcacaccttc cccgccgtgc
tgcagagcag cggcctgtac 540agcctgagca gcgtggtgac cgtgcccagc
agcagcctgg gcacccagac ctacatctgt 600aacgtgaacc acaagcccag
caacaccaag gtggacaaga aggtggagcc caagagctgt 660gacaagaccc
acacctgccc cccctgccct gcccccgagc tggccggagc ccccagcgtg
720ttcctgttcc cccccaagcc taaggacacc ctgatgatca gcagaacccc
cgaggtgacc 780tgtgtggtgg tggatgtgag ccacgaggac cctgaggtga
agttcaactg gtacgtggac 840ggcgtggagg tgcacaatgc caagaccaag
cccagggagg agcagtacaa cagcacctac 900cgggtggtgt ccgtgctgac
cgtgctgcac caggattggc tgaacggcaa ggagtacaag 960tgtaaggtgt
ccaacaaggc cctgcctgcc cctatcgaga aaaccatcag caaggccaag
1020ggccagccca gagagcccca ggtgtacacc ctgcccccta gcagagatga
gctgaccaag 1080aaccaggtgt ccctgacctg cctggtgaag ggcttctacc
ccagcgacat cgccgtggag 1140tgggagagca acggccagcc cgagaacaac
tacaagacca ccccccctgt gctggacagc 1200gatggcagct tcttcctgta
cagcaagctg accgtggaca agagcagatg gcagcagggc 1260aacgtgttca
gctgctccgt gatgcacgag gccctgcaca atcactacac ccagaagagc
1320ctgagcctgt cccctggcaa g 134157654DNAArtificialDNA encoding
humanised 5D11 Light chain 57gacatcgtga tgacccagag ccccgatagc
ctggccgtga gcctgggcga gagggccacc 60attaactgca gggccagcca gagcgtgagc
accagcttct actcctacat gcactggtac 120cagcagaaac ccggccagcc
ccccaaggtg ctgatcaaat acgccagcaa cctccagagc 180ggcgtgcccg
acaggttcag cggctcaggc tccggcaccg acttcacact gaccatcagc
240agcctgcagg cagaggacgt ggccgtctac tactgccagc acagctggga
gatcccctgg 300accttcggcc agggaaccaa gctggagatc aagcgtacgg
tggccgcccc cagcgtgttc 360atcttccccc ccagcgatga gcagctgaag
agcggcaccg ccagcgtggt gtgtctgctg 420aacaacttct acccccggga
ggccaaggtg cagtggaagg tggacaatgc cctgcagagc 480ggcaacagcc
aggagagcgt gaccgagcag gacagcaagg actccaccta cagcctgagc
540agcaccctga ccctgagcaa ggccgactac gagaagcaca aggtgtacgc
ctgtgaggtg 600acccaccagg gcctgtccag ccccgtgacc aagagcttca
accggggcga gtgc 654587PRTArtificial1G11 and humanised 1G11 CDRH1
(Chothia) 58Gly Tyr Thr Phe Thr Ser Tyr1 5594PRTArtificial1G11 and
humanised 1G11 CDRH2 (Chothia) 59Ala Pro Gly
Asn16010PRTArtificial1G11 and humanised 1G11 CDRH1 (AbM) 60Gly Tyr
Thr Phe Thr Ser Tyr Tyr Ile Asn1 5 10618PRTArtificial1G11 and
humanised 1G11 CDRH2 (AbM) 61Arg Ile Ala Pro Gly Asn Thr Tyr1
5626PRTArtificial1G11 and humanised 1G11 CDRH1 (Contact) 62Thr Ser
Tyr Tyr Ile Asn1 56311PRTArtificial1G11 CDRH2 (Contact) 63Cys Ile
Gly Arg Ile Ala Pro Gly Asn Thr Tyr1 5 106411PRTArtificialhumanised
1G11 CDRH2 (Contact) 64Ser Met Gly Arg Ile Ala Pro Gly Asn Thr Tyr1
5 106510PRTArtificial1G11 and humanised 1G11 CDRH3 65Ala Arg Arg
Gly Tyr Glu Gly Ala Leu Asp1 5 10667PRTArtificial1G11 and humanised
1G11 CDRL1 (Contact) 66Ser Asn Asn Leu His Trp Tyr1
56710PRTArtificial1G11 and humanised 1G11 CDRL2 (Contact) 67Leu Leu
Ile Lys Tyr Val Ser Gln Ser Ile1 5 10688PRTArtificial1G11 and
humanised 1G11 CDRL3 (Contact) 68Gln Gln Ser Asn Ser Trp Pro Leu1
56920PRTArtificialPeptide derived from human TrkB 69Asp Gly Ala Asn
Pro Asn Tyr Pro Asp Val Ile Tyr Glu Asp Tyr Gly1 5 10 15Thr Ala Ala
Asn 207014PRTArtificialPeptide derived from human TrkB 70Asn Pro
Asn Tyr Pro Asp Val Ile Tyr Glu Asp Tyr Gly Thr1 5
107112PRTArtificialPeptide derived from human TrkB 71His Phe Ala
Pro Thr Ile Thr Phe Leu Glu Ser Pro1 5
10729PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 283-291 72Gly His Phe Ala Pro Thr Ile Thr Phe1
5738PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 284-291 73His Phe Ala Pro Thr Ile Thr Phe1
57425PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 292-316 74Leu Glu Ser Pro Thr Ser Asp His His Trp Cys
Ile Pro Phe Thr Val1 5 10 15Lys Gly Asn Pro Lys Pro Ala Leu Gln 20
25759PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 316-324 75Gln Trp Phe Tyr Asn Gly Ala Ile Leu1
5768PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 317-324 76Trp Phe Tyr Asn Gly Ala Ile Leu1
5777PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 318-324 77Phe Tyr Asn Gly Ala Ile Leu1
57815PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 347-361 78Gln Leu Asp Asn Pro Thr His Met Asn Asn Gly
Asp Tyr Thr Leu1 5 10
157910PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 349-358 79Asp Asn Pro Thr His Met Asn Asn Gly Asp1 5
108018PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 351-368 80Pro Thr His Met Asn Asn Gly Asp Tyr Thr Leu
Ile Ala Lys Asn Glu1 5 10 15Tyr
Gly8116PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 363-378 81Ala Lys Asn Glu Tyr Gly Lys Asp Glu Lys Gln
Ile Ser Ala His Phe1 5 10
158219PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 377-395 82His Phe Met Gly Trp Pro Gly Ile Asp Asp Gly
Ala Asn Pro Asn Tyr1 5 10 15Pro Asp
Val837PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 379-385 83Met Gly Trp Pro Gly Ile Asp1
58417PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 379-395 84Met Gly Trp Pro Gly Ile Asp Asp Gly Ala Asn
Pro Asn Tyr Pro Asp1 5 10
15Val8518PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 379-396 85Met Gly Trp Pro Gly Ile Asp Asp Gly Ala Asn
Pro Asn Tyr Pro Asp1 5 10 15Val
Ile8619PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 379-397 86Met Gly Trp Pro Gly Ile Asp Asp Gly Ala Asn
Pro Asn Tyr Pro Asp1 5 10 15Val Ile
Tyr8720PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5Hi- s
peptide from 379-398 87Met Gly Trp Pro Gly Ile Asp Asp Gly Ala Asn
Pro Asn Tyr Pro Asp1 5 10 15Val Ile Tyr Glu
208818PRTArtificialTrkB_MPLLLLLPLLWAGALAG_H284-H430(D5-JM)-5His
peptide from 418-435 88Pro Ser Thr Asp Val Thr Asp Lys Thr Gly Arg
Glu His His His His1 5 10 15His His
* * * * *
References