U.S. patent application number 17/366239 was filed with the patent office on 2021-11-04 for efficient selectivity of recombinant proteins.
This patent application is currently assigned to REGENERON PHARMACEUTICALS, INC.. The applicant listed for this patent is REGENERON PHARMACEUTICALS, INC.. Invention is credited to Darya Burakov, Gang Chen, Dipali Deshpande, James Fandl.
Application Number | 20210340564 17/366239 |
Document ID | / |
Family ID | 1000005710674 |
Filed Date | 2021-11-04 |
United States Patent
Application |
20210340564 |
Kind Code |
A1 |
Deshpande; Dipali ; et
al. |
November 4, 2021 |
EFFICIENT SELECTIVITY OF RECOMBINANT PROTEINS
Abstract
The invention provides a new expression system comprising a
mammalian selectable marker that promotes desirable
post-translational modifications of glycoproteins. In particular,
the invention includes methods and compositions for optimal
recombinant protein expression in mammalian cells by employing a
selection marker system based on GPT genes of mammalian origin. The
invention includes methods that facilitate selectivity and enhanced
expression copies as well as protein yield of recombinant proteins
in mammalian cells, and methods of using GPT expression
systems.
Inventors: |
Deshpande; Dipali;
(Tarrytown, NY) ; Burakov; Darya; (Tarrytown,
NY) ; Chen; Gang; (Yorktown Heights, NY) ;
Fandl; James; (LaGrangeville, NY) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
REGENERON PHARMACEUTICALS, INC. |
Tarrytown |
NY |
US |
|
|
Assignee: |
REGENERON PHARMACEUTICALS,
INC.
Tarrytown
NY
|
Family ID: |
1000005710674 |
Appl. No.: |
17/366239 |
Filed: |
July 2, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16566253 |
Sep 10, 2019 |
11085053 |
|
|
17366239 |
|
|
|
|
15664444 |
Jul 31, 2017 |
10457959 |
|
|
16566253 |
|
|
|
|
14829834 |
Aug 19, 2015 |
9732357 |
|
|
15664444 |
|
|
|
|
62039416 |
Aug 19, 2014 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12P 21/005 20130101;
C12N 15/85 20130101; C07K 2319/30 20130101 |
International
Class: |
C12N 15/85 20060101
C12N015/85; C12P 21/00 20060101 C12P021/00 |
Claims
1.-29. (canceled)
30. A method of employing tunicamycin (Tn) as a selection marker in
mammalian cell culture, comprising (a) providing a mammalian host
cell population, (b) introducing into the cell population of step
(a) a nucleic acid by transfection to permit integration of the
nucleic acid into a target locus, wherein the nucleic acid
comprises (i) a mammalian tunicamycin (Tn)-resistance gene encoding
a protein having at least 93% identity to the amino acid sequence
of SEQ ID NO: 3, and (ii) a first a gene of interest (GOI), (c)
culturing the cell population of step (b) in the presence of Tn,
and (d) obtaining a cell transfectant that comprises said nucleic
acid integrated in the target locus.
31. The method of claim 30, wherein said integration into the
target locus is mediated by a recombinase that recognizes a
specific site in the target locus.
32. The method of claim 30, wherein said integration into the
target locus is mediated by homologous recombination.
33. The method of claim 30, wherein said homologous recombination
is facilitated by a nuclease that cleaves a sequence within the
target locus.
34. The method of claim 33, wherein said nuclease is selected from
a zinc finger nuclease (ZFN), a transcription activator-like
effector nuclease (TALEN), or an RNA-guided endonuclease.
35. The method of claim 30, wherein said culturing in step (c)
comprises culturing in sequentially increasing concentrations of
Tn.
36. The method of claim 30, wherein said culturing in step (c)
comprises culturing in the presence of Tn at a first concentration,
and wherein the cell transfectant obtained from step (d) is further
cultured in the presence of Tn at a second concentration higher
than the first concentration.
37. The method of claim 30, wherein the Tn-resistance gene encodes
a protein comprising an amino acid sequence selected from the group
consisting of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:
6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 10.
38. The method of claim 37, wherein the Tn-resistance gene
comprises a nucleic acid sequence selected from the group
consisting of SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID
NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO:
17.
39. The method of claim 30, wherein the first GOI encodes a first
protein of interest (POI).
40. The method of claim 39, further comprising expressing said
first POI from said first GOI and isolating said first POI from the
cultured cell transfectant.
41. The method of claim 30, wherein the mammalian host cell is
selected from the group consisting of CHO, COS-7, HEK293, tumor
cell, lymphocyte, retinal cell, and stem cell.
42. The method of claim 30, wherein the mammalian host cell is a
CHO cell.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 16/566,253, filed Sep. 10, 2019, which is a
continuation of U.S. patent application Ser. No. 15/664,444, filed
Jul. 31, 2017, now U.S. Pat. No. 10,457,959, which is a
continuation of U.S. patent application Ser. No. 14/829,834, filed
Aug. 19, 2015, now U.S. Pat. No. 9,732,357, which claims the
benefit under 35 USC 119(e) of U.S. Provisional Application No.
62/039,416, filed Aug. 19, 2014; which application is incorporated
herein by reference in its entirety for all purposes.
BACKGROUND
Sequence Listing
[0002] The Sequence Listing in the ASCII text file, named as
32905Z_8700US02_SubstituteSequenceListing.txt of 76 KB, created on
Jul. 12, 2019, and submitted to the United States Patent and
Trademark Office via EFS-Web, is incorporated herein by
reference.
FIELD OF THE INVENTION
[0003] The invention provides for expression of recombinant
proteins in mammalian cells in a consistent and efficient manner.
In particular, the invention includes methods and compositions for
improved expression of proteins in mammalian cells by employing
mammalian selection markers. The invention includes methods that
facilitate selectivity and enhanced expression copies as well as
protein yield of recombinant proteins in mammalian cells, and
methods of using such expression systems.
DESCRIPTION OF RELATED ART
[0004] The development of cellular expression systems is an
important goal for providing a reliable and efficient source of a
given protein for research and therapeutic use. Recombinant protein
expression in mammalian cells is often preferred for manufacturing
therapeutic proteins due to, for example, the ability of mammalian
expression systems to appropriately post-translationally modify
recombinant proteins.
[0005] Various vectors are available for expression in mammalian
hosts, each containing selection markers that enable ease of
isolation of recombinant protein-expressing cells during cell
culture. Selectable marker genes (SMGs) are utilized in such
systems because they confer a selective advantage for cells
expressing the protein of interest, however SMGs must be optimized
for their phenotypic neutrality, efficiency and versatility, among
other reasons.
[0006] Despite the availability of numerous vectors and expression
systems hosting SMGs, the expression of a recombinant protein
achieved in mammalian systems is often unsatisfactory, whether in
quantity or quality or both. The biological "fingerprint" of a
molecule, for example post-translational modifications like
glycosylation, is of particular importance in defining the
molecule's utility and efficacy in the development of a recombinant
protein therapeutic (Cumming, D. A., 1990, Glycobiology,
1(2):115-130). SMGs that do not negatively impact the biological
properties of an expressed protein of interest are particularly
advantageous.
[0007] Most SMGs are of bacterial origin and impart other
disadvantages for use in mammalian systems due to growing concern
for the risk of horizontal transfer of bacterial antibiotic
resistance genes to environmental bacteria (Breyer, D. et al.,
2014, Critical Reviews in Plant Sciences 33:286-330). Elimination
of use of bacterial antibiotic resistance genes could have positive
effects on consumer acceptance and alleviating such perceived
risks.
[0008] Gene-engineered autologous cells are rapidly becoming a
clinical success (see e.g. Kershaw, M. H. et al., 2013, Nature
Reviews: Cancer 13:525-541). The choice and design of vectors for
genetic modifications in human autologous cell products is
critical, especially since the unwanted introduction of non-human
components to a human autologous cell could have serious
consequences for patient safety (Eaker, et al. 2013, Stem cells
Trans. Med. 2:871-883; first published online in SCTMEXPRESS Oct.
7, 2013). A vector system having only components of mammalian
origin, rather than bacterial, would be advantageous for use in
patient-specific T cells for adoptive immunotherapy.
[0009] Thus it is desirable to introduce mammalian selectivity
genes, especially those that give the transformed cells a
phenotypic or metabolic advantage in expression systems for the
production of mammalian proteins of interest. Moreover, a cell line
that reliably expresses sufficiently high levels of a therapeutic
protein, and appropriately and consistently modifies the
therapeutic protein post-translationally, is highly desirable.
Accordingly, there is a need in the art for improved mammalian
expression systems.
BRIEF SUMMARY
[0010] The use of a mammalian tunicamycin (Tn) resistance gene as a
selectable marker in a mammalian expression system can increase
efficiency and copy number of transfectants. It has been observed
that the use of a Tn resistance gene operably linked to a gene of
interest creates selective pressure on a population of mammalian
cells thereby increasing random integration of the transfectant
(i.e. gene of interest). It is understood that selectable marker
systems may foster selection of desired transfectants, however the
methods of the invention impart an unexpected increase in both
efficiency and random integration of the gene of interest, as well
as reliable biological qualities of the desired protein. The
compositions and methods of the invention thus allow the
advantageous selection of qualitatively favorable
post-translational modifications for expressed proteins.
[0011] In one aspect, the invention provides an isolated cell
comprising a mammalian tunicamycin (Tn)-resistance gene encoding a
protein having at least 93% identity to the amino acid sequence of
SEQ ID NO:3, operably linked to a gene of interest (GOI) and at
least one regulatory element. In a further aspect, the isolated
cell comprises i) a mammalian tunicamycin (Tn)-resistance gene
encoding a protein having at least 93% identity to the amino acid
sequence of SEQ ID NO: 3, operably linked to at least one
regulatory element, and ii) an exogenously added gene of interest
(GOI).
[0012] In another aspect, the invention provides a method of
producing a recombinant protein of interest (POI), wherein the
method comprises: providing a mammalian host cell encoding a
nucleic acid molecule comprising (i) a mammalian tunicamycin
(Tn)-resistance gene and (ii) a gene encoding the POI; culturing
the cell in the presence of a first concentration of Tn; isolating
a cell population expressing at least one copy of the Tn-resistance
gene; culturing the cell population in the presence of increasing
concentrations of Tn, wherein increasing the concentration of Tn
increases production of the POI; and isolating the POI from the
cell culture.
[0013] In yet another aspect, the invention provides a method of
glycosylating a N-glycan protein substrate, wherein the method
comprises: providing a mammalian host cell encoding a nucleic acid
molecule comprising a mammalian tunicamycin (Tn)-resistance gene
operably linked to a gene encoding the protein substrate in need of
glycosylation; culturing the cell in the presence of a first
concentration of Tn; isolating a cell population expressing at
least one copy of the Tn-resistance gene; culturing the cell
population in the presence of increasing concentrations of Tn,
wherein increasing the concentration of Tn increases production of
the POI; and isolating the protein substrate from the cell
culture.
[0014] In some embodiments of the methods, the Tn-resistance gene
is operably linked to the gene encoding the POI, and the gene
encoding the POI is operably linked to at least one regulatory
element.
[0015] In some embodiments, the Tn-resistance gene is exogenously
added to the cell. In other embodiments, the Tn-resistance gene
encodes the protein having at least 93% identity to the amino acid
sequence of SEQ ID NO:3. In other embodiments, the Tn-resistance
gene encodes the protein having at least 94% identity to the amino
acid sequence of SEQ ID NO:3. In some embodiments, the
Tn-resistance gene encodes the protein having at least 93% identity
to the amino acid sequence of SEQ ID NO:4. In still other
embodiments, the Tn-resistance gene encodes the protein having at
least 94% identity to the amino acid sequence of SEQ ID NO:4.
[0016] In some embodiments, the mammalian Tn-resistance gene
comprises a Chinese hamster (Cricetulus griseus) Tn-resistance
gene. In other embodiments, the mammalian Tn-resistance gene
comprises a human Tn-resistance gene.
[0017] The Tn-resistance gene may also comprise the nucleic acid
sequence selected from the group consisting of SEQ ID NO:2, SEQ ID
NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ
ID NO:16 and SEQ ID NO:17.
[0018] In certain embodiments of the aforementioned inventions, the
mammalian Tn-resistance gene comprises a nucleic acid sequence
having at least 92% identity to the nucleic acid sequence of SEQ ID
NO:2. In some embodiments, the mammalian Tn-resistance gene
comprises a nucleic acid sequence having at least 92% identity to
the nucleic acid sequence of SEQ ID NO:12.
[0019] At least one regulatory element operably linked to the
Tn-resistance gene is provided in the isolated cell of the
invention, wherein the regulatory element includes, but is not
limited to a promoter, ribosome-binding site, and enhancer. In
still another embodiment, the GOI is operably linked to a promoter.
In another embodiment, the GOI is operably linked to a
ribosome-binding site, such as an IRES. As such, the cell is a
recombinant cell comprising an expression cassette comprising a
Tn-resistance gene operably linked to at least one regulatory
element. In an embodiment, the expression cassette is exogenously
added by well known methods including those described herein.
[0020] In some embodiments, the isolated cells and methods of the
invention further comprise a second gene of interest (GOI), whereas
the GOI encodes the protein of interest (POI). In one embodiment,
the gene of interest (GOI) is an exogenously added GOI. In another
embodiment, the exogenously-added GOI is a human gene. In yet
another embodiment, the regulatory element is an exogenously added
regulatory element.
[0021] In other embodiments, the first and/or second GOI encodes a
POI including, but not limited to an antibody heavy chain, antibody
light chain, antigen-binding fragment, and/or Fc-fusion
protein.
[0022] In another embodiment, the first GOI and the second GOI are
independently selected from the group consisting of a gene encoding
for an antibody light chain or antigen-specific fragment thereof,
an antibody heavy chain or antigen-specific fragment thereof, an
Fc-fusion protein or a fragment thereof, and a receptor or
ligand-specific fragment thereof. In one embodiment, a recombinase
recognition site is present between the first GOI and the second
GOI. In other embodiments, the invention further provides a
recombinase recognition site 5' to the first GOI and a recombinase
recognition site 3' with respect to the second GOI.
[0023] In still another embodiment, the GOI encodes a glycoprotein
selected from an antibody light chain or antigen-binding fragment
thereof, an antibody heavy chain or antigen-binding fragment
thereof, an Fc-fusion protein or a fragment thereof, a ligand, and
a receptor or ligand-binding fragment thereof.
[0024] The isolated, non-naturally occurring cells of the invention
may be derived from a eukaryotic cell. In one embodiment, the cell
is a mammalian cell. In some embodiments, the isolated cell is an
ex vivo human cell. In other embodiments, the cell is selected from
the group consisting of CHO (e.g. CHO K1, DXB-11 CHO, Veggie-CHO),
COS (e.g. COS-7), lymphocyte, stem cell, retinal cell, Vero, CV1,
kidney (e.g. HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK21), HeLa,
HepG2, W138, MRC 5, Colo25, HB 8065, HL-60, Jurkat, Daudi, A431
(epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT
cell, tumor cell, and a cell line derived from an aforementioned
cell. In certain embodiments, the isolated cell of the invention is
a CHO-K1 cell, a lymphocyte, retinal cell, or stem cell.
[0025] In one embodiment, the first concentration of Tn is 1
.mu.g/mL. In another embodiment, the increasing concentrations of
Tn comprises a second and third concentration of Tn.
[0026] In some embodiments, the second concentration is greater
than the first concentration of Tn, and the third concentration is
greater than the second concentration of Tn. In certain
embodiments, the second concentration of Tn is 2.5 .mu.g/ml, and
the third concentration is 5 .mu.g/mL.
[0027] In still other embodiments, the increasing concentrations of
Tn comprises a second concentration of Tn, wherein the second
concentration of Tn is 2.5 .mu.g/ml or 5 .mu.g/mL.
[0028] Any of the aspects and embodiments of the invention can be
used in conjunction with any other aspect or embodiment of the
invention, unless otherwise specified or apparent from the
context.
[0029] Other objects and advantages will become apparent from a
review of the ensuing detailed description.
BRIEF DESCRIPTION OF THE FIGURES
[0030] FIG. 1 illustrates a schematic diagram of the operative
expression cassette in a cloning vector construct, used for
introduction of the nucleic acid sequence encoding a gene of
interest, for example eGFP, into a cell genome. SV40 Promoter:
Simian virus 40 Promoter; GPT: GlcNAc-1-P transferase (e.g.
CHO-GPT, SEQ ID NO:2; or hGPT, SEQ ID NO:12); IRES: internal
ribosomal entry site; eGFP: enhanced Green Fluorescent Protein;
SV40polyA: Simian virus 40 polyA.
[0031] FIGS. 2A to 2C represent an alignment of mammalian GPT amino
acid sequences, namely human (GPT_HUMAN; UniProtKB Accn. No.
Q9H3H5; SEQ ID NO:4), Rhesus macaque (GPT_MACMU; UniProtKB Accn.
No. F6TXM3; SEQ ID NO:5), chimpanzee (GPT_PANTR; UniProtKB Accn.
No. H2R346; SEQ ID NO:6), dog (GPT_CANFA; UniProtKB Accn. No.
E2RQ47; SEQ ID NO:7), guinea pig (GPT_CAVPO; UniProtKB Accn. No.
E2RQ47; SEQ ID NO:8), rat (GPT_RAT; UniProtKB Accn. No. Q6P4Z8; SEQ
ID NO:9), and mouse (GPT_MOUSE; UniProtKB Accn. No. P42867; SEQ ID
NO:10) compared to Chinese hamster (GPT_CRIGR; UniProtKB Accn. No.
P24140; SEQ ID NO:3) GPT amino acid sequences.
[0032] FIGS. 3A and 3B exemplifies how protein optimization can be
achieved using the methods and compositions of the invention. FIG.
3A depicts the method of selecting a positive cell transfectant
from a first cell pool cultured with 1 .mu.g/mL tunicamycin (Tn).
Subsequently, a second cell culture with an increased concentration
of tunicamycin, e.g. 2.5 .mu.g/mL or 5 .mu.g/mL, to enhance protein
expression. FIG. 3B: depicts a method of selecting a positive cell
transfectant from a first cell pool cultured with 1 .mu.g/mL
tunicamycin (Tn), and then serially increasing concentrations of Tn
in subsequent cell cultures in order to optimize protein
expression.
[0033] FIGS. 4A to 4B show FACS scatterplots representing various
parameters of Hygromycin selectivity. Modified CHO cells comprise a
YFP gene flanked by lox sites. Selection markers (antibiotic
resistance gene and eGFP) flanked by lox sites incorporate at the
YFP site and replace YFP via targeted integration with Cre
recombinase. Random integrants express both YFP and eGFP FIG. 4A:
Cells are transfected with a Cre recombinase vector and hpt
expression vector comprising eGFP; but cultured without hygromycin
in culture. FIG. 4B: Cells are transfected with a Cre recombinase
vector and hpt expression vector comprising eGFP; in the presence
of 400 .mu.g/mL hygromycin.
[0034] FIGS. 5A to 5F show FACS scatterplots representing various
parameters of Tunicamycin (Tn) selectivity. Modified CHO cells
comprise a YFP gene flanked by lox sites. Selection markers
(antibiotic resistance gene and eGFP) flanked by lox sites
incorporate at the YFP site and replace YFP via targeted
integration with Cre recombinase. Random integrants express both
YFP and eGFP FIG. 5A: Cells are transfected with a Cre recombinase
vector and CHO-GPT expression vector comprising eGFP; but without
tunicamycin in culture. FIG. 5B: Cells are transfected with a Cre
recombinase vector and CHO-GPT expression vector comprising eGFP;
in the presence of 1 .mu.g/mL Tn. FIG. 5C: Cells are transfected
with a Cre recombinase vector and CHO-GPT expression vector
comprising eGFP; in the presence of 2.5 .mu.g/mL Tn. FIG. 5D: Cells
are transfected with a Cre recombinase vector and Human GPT
expression vector comprising eGFP; but without tunicamycin in
culture. FIG. 5E: Cells are transfected with a Cre recombinase
vector and Human GPT expression vector comprising eGFP; in the
presence of 1 .mu.g/mL Tn. FIG. 5F: Cells are transfected with a
Cre recombinase vector and Human GPT expression vector comprising
eGFP; in the presence of 2.5 .mu.g/mL Tn.
[0035] FIGS. 6A and 6B show GPT expressing cell pools compared to
non-GPT expressing pools in their relative ability to enhance
expression of an operably linked GOI, such as eGFP. FIG. 6A:
illustrates the relative number of gene copies of CHO-GPT as
measured by PCR for cell pools as follows: Pool-49 cells (no
exogenous GPT added) without Tn selection: Pool-49 cells (no
exogenous GPT) with 5 ug Tn selection; Pool-1 cells naturally
express higher amounts of GPT (data not shown), and are tested
without Tn selection; Pool-78 cells (no exogenous GPT) without Tn
selection; CHO cells expressing exogenously-added hpt and 400
.mu.g/mL Hygromycin selection; CHO cells expressing exogenous GPT
under 1 .mu.g/mL Tn selection conditions; CHO cells expressing
exogenous GPT selected from a 1 .mu.g/mL Tn selection pool further
cultured in 1 .mu.g/mL Tn; CHO cells expressing exogenous GPT
selected from a 1 .mu.g/mL Tn selection pool further cultured in
2.5 .mu.g/mL Tn; CHO cells expressing exogenous GPT selected from a
1 .mu.g/mL Tn selection pool further cultured in 5 .mu.g/mL Tn.
FIG. 6B: illustrates the relative number of gene copies of a gene
of interest, eGFP, as measured by qPCR for the same cell pools (as
FIG. 6A).
[0036] FIGS. 7A to 7D illustrate glycoform characteristics of
Fc-fusion protein 1 (FcFP1) produced from cell culture as follows,
FIG. 7A: CHO cells not expressing GPT using a standard protocol
(Lot B10002M410), compared to FIG. 7B: CHO cells expressing CHO-GPT
and no Tn selection (Lot 110728). FIG. 7C: CHO cells expressing
CHO-GPT and selected with 1 .mu.g/mL Tn (Lot 110728-01), compared
to FIG. 7D: CHO cells expressing CHO-GPT and selected with 5
.mu.g/mL Tn (Lot 110728-02). Each chromatogram indicates fractions
containing sialylated residues as follows: 0SA=zero sialic acid
residues; 1SA=one sialic acid residue; 2SA=two sialic acid
residues; 3SA=three sialic acid residues; 4SA=four sialic acid
residues.
[0037] FIG. 8 illustrates the overlapping glycosylation profile of
Fc-fusion protein 1 (FcFP1) sampled from (A) Lot B10002M410, (B)
Lot 110728, (C) Lot 110728-01, and (D) Lot 110728-02. The
glycoprofiles of each protein produced from the GPT lots are
compatible with the reference standard protein and the major
glycoform species are consistently produced. It is apparent that no
new and unique species of glycoforms were produced in the GPT lots
compared to the reference standard protein.
DETAILED DESCRIPTION
[0038] Before the present methods are described, it is to be
understood that this invention is not limited to particular
methods, and experimental conditions described, as such methods and
conditions may vary. It is also to be understood that the
terminology used herein is for the purpose of describing particular
embodiments only, and is not intended to be limiting, since the
scope of the present invention will be limited only by the appended
claims.
[0039] As used in this specification and the appended claims, the
singular forms "a", "an", and "the" include plural references
unless the context clearly dictates otherwise. Thus for example, a
reference to "a method" includes one or more methods, and/or steps
of the type described herein and/or which will become apparent to
those persons skilled in the art upon reading this disclosure.
[0040] Unless defined otherwise, or otherwise specified, all
technical and scientific terms used herein have the same meaning as
commonly understood by one of ordinary skill in the art to which
this invention belongs.
[0041] Although any methods and materials similar or equivalent to
those described herein can be used in the practice or testing of
the present invention, particular methods and materials are now
described. All publications mentioned herein are incorporated
herein by reference in their entirety.
[0042] A variety of genes well-known in the art may confer a
selectable phenotype on mammalian cells in culture. Commonly,
selectable marker genes express proteins, usually enzymes that
confer resistance to various antibiotics in cell culture. In some
selective conditions, cells that express a fluorescent protein
marker are made visible, and are thus selectable. Examples in the
art include beta-lactamase (bla; beta-lactam antibiotic resistance
gene or ampR; ampicillin resistance gene), bls (blasticidin
resistance acetyl transferase gene), hygromycin phosphotransferase
(hpt; hygromycin resistance gene), and others.
[0043] The methods described herein rely on the use of tunicamycin
and enzymes (markers) that can allow cells resistant to tunicamycin
to grow in cell culture. Tunicamycin (Tn) is mixture of antibiotics
that act as inhibitors of bacterial and eukaryote
N-acetylglucosamine transferases preventing formation of
N-acetylglucosamine lipid intermediates and glycosylation of newly
synthesized glycoproteins. (King, I. A., and Tabiowo, A., 1981,
Effect of tunicamycin on epidermal glycoprotein and
glycosaminoglycan synthesis in vitro. Biochem. J., 198(2):331-338).
Tn is cytotoxic because it specifically inhibits
UDP-N-acetylglucosamine: dolichol phosphate N-acetylglucosamine-1-P
transferase (GPT), an enzyme that catalyzes the initial step of the
biosynthesis of dolichol-linked oligosaccharides. In the presence
of tunicamycin, asparagine-linked glycoproteins made in the
endoplasmic reticulum (ER) are not glycosylated with N-linked
glycans, and therefore may not fold correctly in the ER and thus,
may be targeted for breakdown (Koizumi, et al. 1999, Plant Physiol.
121(2):353-362). Hence, Tn is a notable inducer of the unfolded
protein response (UPR) which leads to apoptosis in bacterial and
eukaryotic cells.
[0044] The gene for uridine diphosphate GPT (also known as
GlcNAc-1-P transferase) was identified as being overexpressed under
certain cellular conditions in order to confer resistance to Tn
(Criscuolo and Krag, 1982, J Biol Chem, 263(36):19796-19803;
Koizumi, et al., 1999, Plant Physiology, Vol. 121, pp. 353-361).
The gene encoding GPT, also described as GenBank Accn. No. M36899
(SEQ ID NO: 2), was isolated from a Tn-resistant Chinese hamster
ovary cell line and encodes a 408 amino acid protein (SEQ ID NO: 3)
(Scocca and Krag, 1990, J Biol Chem 265(33):20621-20626; Lehrman,
M. et al., 1988, J Biol Chem 263(36):19796-803). Hamster GPT was
overexpressed in yeast cells (S. pombe) and conferred Tn resistance
in these cells; also providing a convenient source for the
purification of the GPT enzyme (Scocca J R, et al. 1995,
Glycobiology, 5(1):129-36). Transcript levels of GPT were analyzed
in hybridoma cells (B cells expressing IgG, vs. quiescent B cells)
whereas it was observed that IgG-producing cells did not exhibit
increased levels of GPT transcript or activity, yet a small
increase in GPT was seen in the transition from quiescent to active
B cells. It was concluded that GPT levels may correspond with the
early development of proliferative response to LPS (antigen)
stimulation in B cells (Crick, D. C. et al, 1994, J Biol Chem
269(14):10559-65).
[0045] Furthermore, it was previously unknown whether altering the
expression of GPT, with or without the presence of Tn, in a
cellular expression system will have an effect on the glycosylation
of protein product, and therefore on product quality. It is
understood that optimal and consistent glycosylation is a critical
protein attribute in the production of therapeutic
glycoproteins.
[0046] The present invention provides an improved method for
production of recombinant proteins in mammalian cell systems
utilizing a mammalian Tn-resistance gene, GPT, as a regulatable
selection marker, whereas increased copy number of a gene of
interest operably linked to GPT correlates with increased random
integration of a GPT expression cassette into the cell.
[0047] The art has recognized that the manufacture of therapeutic
proteins, particularly glycoproteins, relies on mammalian-type
expression systems that mimic natural glycosylation of such
proteins. (For review, see Bork, K. et al, 2009, J Pharm Sci.
98(10):3499-3508.) For example, the terminal monosaccharide of
certain glycoproteins such as N-linked complex glycans is typically
occupied by sialic acid. Sialylation may affect the glycoprotein's
pharmacokinetic properties, such as absorption, serum half-life,
and clearance, or other physicochemical or immunogenic properties
of the glycoprotein. Overexpressed recombinant glycoproteins often
have incomplete or inconsistent glycosylation. Reliable methods are
critical for process consistency and quality of therapeutic
glycoproteins produced in mammalian cell lines.
[0048] The present invention also provides an improved method for
the glycosylation of recombinant proteins, i.e. a method for making
glycoproteins, in mammalian cell systems in order to provide
consistent quality yield of the desired proteins.
Definitions
[0049] DNA regions are operably linked when they are functionally
related to each other. For example, a promoter is operably linked
to a coding sequence if the promoter is capable of participating in
the transcription of the sequence; a ribosome-binding site is
operably linked to a coding sequence if it is positioned so as to
permit translation. Generally, operably linked can include, but
does not require, contiguity. In the case of sequences such as
secretory leaders, contiguity and proper placement in a reading
frame are typical features. A production enhancing sequence, such
as a promoter, is operably linked to a gene of interest (GOI) where
it is functionally related to the GOI, for example, where its
presence results in increased expression of the GOI.
[0050] As such, the phrase "operably linked", such as in the
context of DNA expression vector constructs, a control sequence,
e.g., a promoter or operator or marker, is appropriately placed at
a position relative to a coding sequence such that the control
sequence directs or permits the production of a polypeptide/protein
of interest encoded by the coding sequence. For example, where a
selection marker is required for cells to survive in certain
culture conditions, the gene of interest is operably linked to the
selection marker gene because expression will not occur without the
presence of an operable selection marker protein.
[0051] "Promoter" as used herein indicates a DNA sequence
sufficient to direct transcription of a DNA sequence to which it is
operably linked, i.e., linked in such a way as to permit
transcription of the gene of interest and/or selection marker gene
when the appropriate signals are present. The expression of a gene
may be placed under control of any promoter or enhancer element
known in the art.
[0052] An "expression vector" in the context of the present
invention may be any suitable vector, including chromosomal,
non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid
sequence comprising a suitable set of expression control elements).
Examples of such vectors include derivatives of SV40, bacterial
plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived
from combinations of plasmids and phage DNA, and viral nucleic acid
(RNA or DNA) vectors. In one embodiment, an Fc-fusion protein or
polypeptide-encoding nucleic acid molecule is comprised in a naked
DNA or RNA vector, including, for example, a linear expression
element (as described in, for instance, Sykes and Johnston, 1997,
Nat Biotech 12, 355-59), a compacted nucleic acid vector (as
described in for instance U.S. Pat. No. 6,077,835 and/or
WO00/70087), or a plasmid vector such as pBR322, pUC 19/18, or pUC
118/119. Such nucleic acid vectors and the usage thereof are well
known in the art (see, for instance, U.S. Pat. Nos. 5,589,466 and
5,973,972).
[0053] As used herein "operator" indicates a DNA sequence that is
introduced in or near a gene in such a way that the gene may be
regulated by the binding of a repressor protein to the operator
and, as a result, prevent or allow transcription of the GOI, i.e. a
nucleotide encoding a polypeptide or protein of interest.
[0054] Ribosome binding sites include "internal ribosome entry
sites" (IRESs) or may include a 5' cap. Many IRES sequences are
well-known in the art. IRES represents a translation control
sequence, wherein the IRES site is typically located 5' of a gene
of interest and allows translation of the RNA in a cap-independent
manner. Transcribed IRESs may directly bind ribosomal subunits such
that the location of the mRNA's initiator codons is oriented
properly in the ribosome for translation. IRES sequences are
typically located in the 5' UTR of the mRNA (directly upstream of
the initiation codon). IRESs functionally replace the need for
various protein factors that interact with eukaryotic translation
machinery.
[0055] The terms "enhanced" or "improved" when used to describe
protein expression include an increase in the quantity and/or
consistency of quality of the protein (i.e. gene product) produced
by the expression system or methods of the invention. As such, this
includes an enhancement of at least about 1.5-fold to at least
about 3-fold enhancement in expression over what is typically
observed by random integration into a genome, for example, as
compared to a pool of integrants using another selectable marker
construct. As such, fold-expression enhancement observed for
proteins of interest is compared to an expression level of the same
gene, measured under substantially the same conditions, in the
absence of an expression cassette or cell of the invention
comprising a GPT gene, or in the presence of an expression cassette
or cell comprising a different selectable marker. Expression
enhancement may also be measured by the resulting number of random
integration events. Enhanced recombination efficiency includes an
enhancement of the ability of a locus to recombine (for example,
employing recombinase-recognition sites). Enhancement refers to a
measurable efficiency over random recombination, which is typically
0.1%. In certain conditions, enhanced recombination efficiency is
about 10-fold over random, or about 1%. Unless specified, the
claimed invention is not limited to a specific recombination
efficiency. Expression enhancement may also be measured by the
resulting number of gene copies as measured by quantitative
polymerase chain reaction (qPCR), or other well-known
technique.
[0056] Enhanced or improved product also refers to the more
consistent quality, for example, post-translational modifications
observed with the GPT expression system of the invention.
Consistent quality includes having e.g. a desirable glycosylation
profile after replicate production lines. Consistency, with respect
to quality, refers to a degree of uniformity and standardization,
whereas replicate production batches are essentially free from
variation. Calculating a Z-number to measure consistency is taught
herein. Other statistical measures are known in the art for
measuring consistency.
[0057] The phrase "selective pressure" is the force or stimulus
applied to a living organism (e.g. a cell) or system (e.g. as an
expression system) which alters the behavior and survival (such as
ability to survive) of the living organism or system within a given
environment.
[0058] The phrase "gene amplification" means an increase in the
number of identical copies of a gene sequence. Certain cellular
processes are characterized by the production of multiple copies of
a particular gene or genes that amplify the phenotype that the gene
confers on the cell, for example antibiotic resistance.
[0059] Where the phrase "exogenously added gene" or "exogenously
added GOI" is employed with reference to an expression cassette,
the phrase refers to any gene not present within the cell genome as
found in nature, or an additional gene copy integrated into (a
different locus within) the genome. For example, an "exogenously
added gene" within a CHO genome (e.g., an selectable marker gene),
can be a hamster gene not found within the particular CHO locus in
nature (i.e., a hamster gene from another locus in the hamster
genome), a gene from any other species (e.g., a human gene), a
chimeric gene (e.g., human/mouse), or can be a hamster gene not
found within the CHO genome in nature (i.e., a hamster gene having
less than 99.9% identity to the gene from another locus in the
hamster genome), or any other gene not found in nature to exist
within the CHO natural genome.
[0060] Random integration events differ from targeted integration
events, whereas insertion of a gene into the genome of the cell is
not site-specific in random integration events. An example of
targeted integration is homologous recombination. Random
(nonhomologous) integration means that the location (locus) of the
resulting integrant is not known or specified. Random integration
is thought to occur by nonhomologous end joining (NHEJ), however is
not limited to this method.
[0061] Selection efficiency means the percent population of
surviving cells expressing the selectable marker and, if
applicable, the protein of interest under the control of the
selectable marker.
[0062] Percent identity, when describing a Tn-resistance protein,
is meant to include homologous sequences that display the recited
identity along regions of contiguous homology, but the presence of
gaps, deletions, or insertions that have no homolog in the compared
sequence are not taken into account in calculating percent
identity. In explaining the usage of "percent identity" in this
context, the following amino acid sequence comparison will be
referred to:
TABLE-US-00001 GPT_MOUSE (SEQ ID NO: 18) 1
MWAFPELPLPLPLLVNLIGSLLGFVATVTLIPAFRSHFIAARLCGQDLNKLSQQQIPESQ 60
GPT_CRIG (SEQ ID NO: 19) 1
MWAFPELPL--PLLVNLFGSLLGFVATVTLIPAFRSHFIAARLCGQDLNKLSRQQIPESQ 58
[0063] As used herein, a "percent identity" determination between
the "GPT_CRIG" sequence above (for a Chinese hamster GPT) with a
mouse homolog ("GPT_MOUSE") would not include a comparison of
hamster amino acids 10 and 11, since the hamster homolog has no
homologous sequence to compare in an alignment (i.e., the mouse GPT
has an insertion at that point, or the hamster homolog has a gap or
deletion, as the case may be). Thus, in the comparison above, the
percent identity comparison would extend from the "MWA" at the 5'
end to the "ESQ" at the 3' end. In that event, the mouse homolog
differs only in that it has an "R" at hamster GPT position 51.
Since the comparison is over 58 contiguous bases in a 60 base pair
stretch, with only one amino acid difference (which is not a gap,
deletion, or insertion), there is over 98% identity between the two
sequences (hamster and mouse) from hamster GPT position 1 to
hamster GPT position 58 (because "percent identity" does not
include penalties for gaps, deletions, and insertions). Although
the above example is based on an amino acid sequence, it is
understood that nucleic acid sequence percent identity would be
calculated in the same manner.
[0064] The term "cell" includes any cell that is suitable for
expressing a recombinant nucleic acid sequence. Cells include those
of prokaryotes and eukaryotes (single-cell or multiple-cell),
bacterial cells (e.g., strains of E. coli, Bacillus spp.,
Streptomyces spp., etc.), mycobacteria cells, fungal cells, yeast
cells (e.g. S. cerevisiae, S. pombe, P. partoris, P. methanolica,
etc.), plant cells, insect cells (e.g. SF-9, SF-21,
baculovirus-infected insect cells, Trichoplusia ni, etc.),
non-human animal cells, mammalian cells, human cells, or cell
fusions such as, for example, hybridomas or quadromas. In certain
embodiments, the cell is a human, monkey, ape, hamster, rat or
mouse cell. In other embodiments, the cell is eukaryotic and is
selected from the following cells: CHO (e.g. CHO K1, DXB-11 CHO,
Veggie-CHO), COS (e.g. COS-7), retinal cells, Vero, CV1, kidney
(e.g. HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK21), HeLa, HepG2,
W138, MRC 5, Colo25, HB 8065, HL-60, Jurkat, Daudi, A431
(epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT
cell, tumor cell, and a cell line derived from an aforementioned
cell. In some embodiments, the cell comprises one or more viral
genes, e.g. a retinal cell that expresses a viral gene (e.g. a
PER.C6@ cell).
[0065] The phrase "integrated cell density", or "ICD" means the
density of cells in a culture medium taken as an integral over a
period of time, expressed as cell-days per mL. In some embodiments,
the ICD is measured around the twelfth day of cells in culture.
[0066] "Glycosylation" or the phrase "glycosylating a protein"
includes the formation of glycoproteins whereas oligosaccharides
are attached either to the side chain of the asparagine (Asn)
residue (i.e. N-linked) or serine (Ser)/threonine (Thr) residue
(i.e. 0-linked) of a protein. Glycans can be homo- or
heteropolymers of monosaccharide residues, which can be linear or
branched. N-linked glycosylation is known to initiate primarily in
the endoplasmic reticulum, whereas O-linked glycosylation is shown
to initiate in either the ER or Golgi apparatus.
[0067] An "N-glycan protein" or an "N-glycan protein substrate"
includes proteins that contain or can accept N-linked
oligosaccharides. N-glycans can be composed of N-acetyl
galactosamine (GalNAc), mannose (Man), fucose (Fuc), galactose
(Gal), neuraminic acid (NANA), and other monosaccharides, however
N-glycans usually have a common core pentasaccharide structure
including: three mannose and two N-acetylglucosamine (GlcNAc)
sugars. Proteins with the consecutive amino acid sequence (i.e.
sequon) Asn-X-Ser or Asn-X-Thr, where X is any amino acid except
proline, can provide an attachment site for N-glycans.
General Description
[0068] The invention is based at least in part on the discovery
that under certain conditions recombinant proteins may be produced
in a cell wherein the gene encoding the protein is operably linked
to a Tn-resistance gene, GPT, and selection of a protein-producing
cell is formatted to increase random integration events in the cell
genome and thus increase copy number of the gene of interest, and
ultimately protein production.
[0069] The invention is also based at least in part on the finding
that the protein-producing cell may be optimized to express
proteins with consistent and reliable post-translational
modifications. GPT expression cassettes can also be integrated in a
cellular genome, as in expression constructs, such as via
expression vectors, using various gene editing techniques known in
the art. Expression vectors comprising GPT can be integrated into a
genome by random or targeted recombination such as, homologous
recombination or recombination mediated by recombinases that
recognize specific recombination sites (e.g., Cre-lox-mediated
recombination).
[0070] Homologous recombination in eukaryotic cells can be
facilitated by introducing a break in the chromosomal DNA at the
integration site. Model systems have demonstrated that the
frequency of homologous recombination during gene targeting
increases if a double-strand break is introduced within the
chromosomal target sequence. This may be accomplished by targeting
certain nucleases to the specific site of integration. DNA-binding
proteins that recognize DNA sequences at the target locus are known
in the art. Gene targeting vectors are also employed to facilitate
homologous recombination. In the absence of a gene targeting vector
for homology directed repair, the cells frequently close the
double-strand break by non-homologous end-joining (NHEJ) which may
lead to deletion or insertion of multiple nucleotides at the
cleavage site. Gene targeting vector construction and nuclease
selection are within the skill of the artisan to whom this
invention pertains.
[0071] In some examples, zinc finger nucleases (ZFNs), which have a
modular structure and contain individual zinc finger domains,
recognize a particular 3-nucleotide sequence in the target sequence
(e.g. site of targeted integration). Some embodiments can utilize
ZFNs with a combination of individual zinc finger domains targeting
multiple target sequences.
[0072] Transcription activator-like (TAL) effector nucleases
(TALENs) may also be employed for site-specific genome editing. TAL
effector protein DNA-binding domain is typically utilized in
combination with a non-specific cleavage domain of a restriction
nuclease, such as FokI. In some embodiments, a fusion protein
comprising a TAL effector protein DNA-binding domain and a
restriction nuclease cleavage domain is employed to recognize and
cleave DNA at a target sequence within the locus of the invention
(Boch J et al., 2009 Science 326:1509-1512).
[0073] RNA-guided endonucleases (RGENs) are programmable genome
engineering tools that were developed from bacterial adaptive
immune machinery. In this system--the clustered regularly
interspaced short palindromic repeats (CRISPR)/CRISPR-associated
(Cas) immune response--the protein Cas9 forms a sequence-specific
endonuclease when complexed with two RNAs, one of which guides
target selection. RGENs consist of components (Cas9 and tracrRNA)
and a target-specific CRISPR RNA (crRNA). Both the efficiency of
DNA target cleavage and the location of the cleavage sites vary
based on the position of a protospacer adjacent motif (PAM), an
additional requirement for target recognition (Chen, H. et al, J.
Biol. Chem. published online Mar. 14, 2014, as Manuscript
M113.539726).
[0074] Still other methods of homologous recombination are
available to the skilled artisan, such as BuD-derived nucleases
(BuDNs) with precise DNA-binding specificities (Stella, S. et al.
Acta Cryst. 2014, D70, 2042-2052). Precise genome modification
methods are chosen based on the tools available compatible with
unique target sequences within the genome so that disruption of the
cell phenotype is avoided.
[0075] Cells and methods are provided for stably integrating a
nucleic acid sequence (gene of interest) into a mammalian cell,
wherein the nucleic acid sequence is capable of enhanced expression
by virtue of being integrated with a GPT sequence. Compositions and
methods are also provided for using GPT in connection with
expression constructs, for example, expression vectors, and for
adding an exogenous GPT into a mammalian cell of interest. Cells
and methods are provided for use in a consistent yet robust method
of making glycoproteins, particularly therapeutic
glycoproteins.
Construction of a GPT Selection Marker Cassette
[0076] Expression vectors comprising an operative GPT expression
cassette are provided herein. The expression cassette comprises the
necessary regulatory elements to permit and drive transcription and
translation of mammalian GPT and the desired gene product.
[0077] Various combinations of the genes and regulatory sequences
described herein can also be developed. Examples of other
combinations of the appropriate sequences described herein that can
also be developed include sequences that include multiple copies of
the GPT genes disclosed herein, or sequences derived by combining
the disclosed GPT with other nucleotide sequences to achieve
optimal combinations of regulatory elements. Such combinations can
be contiguously linked or arranged to provide optimal spacing of
GPT oriented to the gene of interest and the regulatory
elements.
[0078] Homologous sequences of genes encoding GPT are known to
exist in cells from other mammalian species (such as, for example,
humans; see FIG. 2) as well as in cell lines derived from other
mammalian tissue types, and can be isolated by techniques that are
well-known in the art. An exemplary list of mammalian GPT amino
acid sequences is provided in FIGS. 2A-2C. Changes in nucleotide
sequence, such as codon optimization, can be made to nucleotide
sequences set forth in SEQ ID NOs:2 and 11-17 in order to permit
optimal expression of the corresponding GPT proteins set forth in
SEQ ID NOs:3-10. In addition, changes can be made in the amino acid
sequence set forth in SEQ ID NOs:3-10 by making changes to the
nucleotide sequences encoding GPT. Such techniques including, but
not limited to, site-directed or random mutagenesis techniques are
well known in the art.
[0079] The resulting GPT variants can then be tested for GPT
activity as described herein, e.g. tested for resistance to
tunicamycin. GPT proteins that are at least about 93% identical, or
at least about 95% identical, or at least about 96% identical, or
at least about 97% identical, or at least about 98% identical in
amino acid sequence to SEQ ID NO:3 having GPT activity are
isolatable by routine experimentation, and are expected to exhibit
the same resistance to Tn, selectivity efficiency and
post-translational benefits as for SEQ ID NO:3. Accordingly,
mammalian homologs of GPT and variants of GPT are also encompassed
by embodiments of the invention. FIGS. 2A to 2C show an alignment
of various mammalian GPT amino acid sequences (namely, SEQ ID NOs:
3-10). The mammalian GPT sequences (nucleic acid and amino acid)
are conserved among hamster, human, mouse and rat genomes. Table 1
identifies exemplary mammalian GPT proteins and their degree of
homology.
TABLE-US-00002 TABLE 1A Amino add identity of GPT homologs SEQ ID %
id Animal NO Human % id Mouse % id Rat % id Hamster Hamster 3 93.87
96.08 96.08 - Mouse 10 94.12 - 97.07 96.08 Human 4 - 94.12 93.63
93.87 Rat 9 93.63 97.07 - 96.08
TABLE-US-00003 TABLE 1B Nucleic acid identity of representative GPT
homologs Animal SEQ ID NO % id Hamster Hamster 2 - Mouse 11 92
Human 12 92 Rat 13 94 Macaque 14 92 Chimp 15 92
[0080] Cell populations expressing enhanced levels of a protein of
interest can be developed using the GPT/tunicamycin methods
provided herein. The absolute level of expression will vary with
the specific protein, depending on how efficiently the protein is
processed by the cell.
[0081] Accordingly, the invention also includes a GPT-expressing
nucleotide sequence selected from the group consisting of SEQ ID
NOs:2 and 11-17. The invention also encompasses a GPT-expressing
nucleotide sequence that is at least 92% identical, at least 93%
identical, at least 94% identical, at least 95% identical, at least
96% identical, at least 98% identical, or at least 99% identical to
the nucleotide sequence selected from the group consisting of SEQ
ID NOs:2 and 11-17.
[0082] The invention includes vectors comprising SEQ ID NO:1, SEQ
ID NO:2 or SEQ ID NO:12. Vectors comprising a mammalian GPT gene,
and optional regulatory elements, include vectors for transient or
stable transfection.
[0083] In one embodiment, the GPT gene is employed to enhance the
expression of a GOI, as illustrated in FIG. 1. FIG. 1 shows a GOI
operably linked with an IRES sequence and a GPT selectable marker.
The GPT cassette further includes a promoter sequence, e.g. SV40
promoter, and a polyadenylation (poly(A)) sequence, e.g. SV40
poly(A).
[0084] The expression-enhancing cassette (including GPT and an
upstream promoter) is optimally integrated in a cell genome. Using
the methods of the invention, a GOI is expressed within the GPT
expression cassette under culture conditions based on increasing
concentrations of Tn (FIG. 3A or FIG. 3B). A FACS readout, such as
that shown in FIGS. 5B, 5C, 5E and 5F, exemplifies the distribution
of expression in a stably transfected population of cells, in
particular the dramatic increase in selection efficiency using
mammalian Tn-resistant selection markers, CHO-GPT and hGPT.
Mammalian GPT expression further enhances expression of a gene
product of interest, for example production of a fluorescent
protein, eGFP. Consecutive cultures of increasing concentrations of
Tn result in an enhanced expression of about two-fold in comparison
to the GOI expressed in an expression system using GPT under
culture conditions based on one concentration of Tn, such as that
exemplified in FIG. 6B.
[0085] The invention includes a mammalian cell comprising such a
GPT gene wherein the GPT gene is exogenous and is integrated into
the cell genome by the methods of the invention. Cells comprising
such a GPT gene having at least one exogenously-added gene of
interest (GOI) that is upstream or downstream to the GPT gene.
[0086] In various embodiments, expression of a GOI can be enhanced
by placing the GOI under the control of a mammalian selectable
marker GPT. In other embodiments, the random integration events of
a GOI can be enhanced by placing the GOI under the control of a
mammalian selectable marker GPT and providing cell culture
conditions comprising greater than 0.5 .mu.g/mL Tn concentration.
In some embodiments, the cell culture conditions comprise greater
than 1 .mu.g/mL Tn concentration. A regulatory element may be
operably linked to the GOI where expression of the GOI--at the
selected distance from the GOI and GPT (in the 5' or 3'
direction)--retains the ability to enhance expression of the GOI
over, for example, expression typically observed due to a random
integration event. In various embodiments, enhancement is at least
about 1.5-fold to about 2-fold or more. Enhancement in expression
as compared to a random integration, or random expression, is about
1.5-fold or about 2-fold or more.
[0087] In another embodiment, uniformly glycosylated proteins can
be attained using the methods and compositions of the invention. As
shown in Table 4, GPT/GOI recombinant protein batches treated with
Tn allow replicate batches with equivalent glycosylation profiles.
As such, enhanced protein expression such as consistent
glycosylation profiles can be directly compared by calculating
Z-number as taught herein. The Z-number equation takes into
consideration takes into account the relative number of peaks on a
chromatogram representing sialic acid (SA) moieties, as well as the
relative shape and intensity of each peak. Z-number is based on the
area occupied by each peak and may be used as a measure of
consistency for complex glycoproteins (see e.g. FIGS. 7A-7D, FIG.
8, and Example 3, described herein.
[0088] Protein expression optimization can also be achieved for
each GOI, including, for example, expression cassette orientation
or codon optimization. Protein optimization may also be achieved by
varying the incremental Tn concentration in the cell culture
methods.
[0089] Recombinant expression vectors can comprise synthetic or
cDNA-derived DNA fragments encoding a protein, operably linked to a
suitable transcriptional and/or translational regulatory element
derived from mammalian, viral or insect genes. Such regulatory
elements include transcriptional promoters, enhancers, sequences
encoding suitable mRNA ribosomal binding sites, and sequences that
control the termination of transcription and translation, as
described in detail herein. Mammalian expression vectors can also
comprise nontranscribed elements such as an origin of replication,
other 5' or 3' flanking nontranscribed sequences, and 5' or 3'
nontranslated sequences such as splice donor and acceptor sites.
Additional selectable marker genes (such as fluorescent markers) to
facilitate recognition of transfectants may also be
incorporated.
[0090] In another embodiment, the vector comprises a nucleic acid
molecule (or gene of interest) encoding a protein of interest,
including an expression vector comprising the nucleic acid
molecules (genes) described wherein the nucleic acid molecule
(gene) is operably linked to an expression control sequence.
[0091] A vector comprising a gene of interest (GOI) is provided,
wherein the GOI is operably linked to an expression control
sequence suitable for expression in a mammalian host cell.
[0092] Useful promoters that may be used in the invention include,
but are not limited to, the SV40 early promoter region, the
promoter contained in the 3' long terminal repeat of Rous sarcoma
virus, the regulatory sequences of the metallothionein gene, mouse
or human cytomegalovirus IE promoter (Gossen et al., (1995) Proc.
Nat. Acad. Sci. USA 89:5547-5551), the cauliflower mosaic virus 35S
RNA promoter, and the promoter of the photosynthetic enzyme
ribulose biphosphate carboxylase, promoter elements from yeast or
other fungi such as the Gal 4 promoter, the ADC (alcohol
dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter,
alkaline phosphatase promoter, and the following animal
transcriptional control regions, which exhibit tissue specificity
and have been utilized in transgenic animals: elastase I; insulin;
immunoglobulin; mouse mammary tumor virus; albumin;
.alpha.-fetoprotein; .alpha.1-antitrypsin; .beta.-globin; and
myosin light chain-2.
[0093] Nucleic acid molecules of the invention may also be operably
linked to an effective poly (A) termination sequence, e.g. SV40
poly(A), an origin of replication for plasmid product in E. coli,
and/or a convenient cloning site (e.g., a polylinker). Nucleic
acids may also comprise a regulatable inducible promoter
(inducible, repressable, developmentally regulated) as opposed to a
constitutive promoter such as CMV IE (the skilled artisan will
recognize that such terms are actually descriptors of a degree of
gene expression under certain conditions).
[0094] The invention provides methods for producing a protein of
interest whereas an expression vector is provided comprising a gene
of interest (GOI) is provided. Such expression vectors may be used
for recombinant production of any protein of interest.
Transcriptional and translational control sequences in expression
vectors useful for transfecting vertebrate cells may be provided by
viral sources. For example, commonly used promoters and enhancers
are derived from viruses such as polyoma, adenovirus 2, simian
virus 40 (SV40), and human cytomegalovirus (CMV). Viral genomic
promoters, control and/or signal sequences may be utilized to drive
expression, provided such control sequences are compatible with the
host cell chosen. Non-viral cellular promoters can also be used
(e.g., the .beta.-globin and the EF-1.alpha. promoters), depending
on the cell type in which the recombinant protein is to be
expressed.
[0095] DNA sequences derived from the SV40 viral genome, for
example, the SV40 origin, early and late promoter, enhancer,
splice, and polyadenylation sites may be used to provide other
genetic elements useful for expression of a heterologous DNA
sequence. Early and late promoters are particularly useful because
both are obtained easily from the SV40 virus as a fragment that
also comprises the SV40 viral origin of replication (Fiers et al.,
Nature 273:113, 1978). Smaller or larger SV40 fragments may also be
used. Typically, the approximately 250 bp sequence extending from
the Hind III site toward the BgII site located in the SV40 origin
of replication is included.
[0096] Bicistronic expression vectors used for the expression of
multiple transcripts have been described previously (Kim S. K. and
Wold B. J., Cell 42:129, 1985; Kaufman et al. 1991, supra) and can
be used in combination with a GPT expression system. Other types of
expression vectors will also be useful, for example, those
described in U.S. Pat. No. 4,634,665 (Axel et al.) and U.S. Pat.
No. 4,656,134 (Ringold et al.).
[0097] An integration site, for example, a recombinase recognition
site, can be placed 5' or 3' to the gene sequence encoding the POI.
One example of a suitable integration site is a lox p site. Another
example of a suitable integration site is two recombinase
recognition sites, for example, selected from the group consisting
of a lox p site, lox and a lox 5511 site.
Gene Amplification Cassettes and Expression Vectors Thereof
[0098] Useful regulatory elements, described previously or known in
the art, can also be included in the nucleic acid constructs used
to transfect mammalian cells. FIG. 1 exemplifies an operative
cassette in a GPT vector further comprising a promoter sequence,
IRES sequence, gene of interest, and poly(A) sequence.
[0099] An expression vector in the context of the present invention
may be any suitable vector, including chromosomal, non-chromosomal,
and synthetic nucleic acid vectors (a nucleic acid sequence
comprising a suitable set of expression control elements). Examples
of such vectors include derivatives of SV40, bacterial plasmids,
phage DNA, baculovirus, yeast plasmids, vectors derived from
combinations of plasmids and phage DNA, and viral nucleic acid (RNA
or DNA) vectors. In one embodiment, an antibody-encoding nucleic
acid molecule is comprised in a naked DNA or RNA vector, including,
for example, a linear expression element (as described in, for
instance, Sykes and Johnston, Nat Biotech 12, 355-59 (1997)), a
compacted nucleic acid vector (as described in for instance U.S.
Pat. No. 6,077,835 and/or WO 00/70087), or a plasmid vector such as
pBR322, pUC 19/18, or pUC 118/119. Such nucleic acid vectors and
the usage thereof are well known in the art (see, for instance,
U.S. Pat. Nos. 5,589,466 and 5,973,972).
[0100] An expression vector may alternatively be a vector suitable
for expression in a yeast system. Any vector suitable for
expression in a yeast system may be employed. Suitable vectors
include, for example, vectors comprising constitutive or inducible
promoters such as yeast alpha factor, alcohol oxidase and PGH
(reviewed in: F. Ausubel et al., ed. Current Protocols in Molecular
Biology, Greene Publishing and Wiley InterScience New York (1987),
and Grant et al., Methods in Enzymol 153, 516-544 (1987)).
[0101] In certain embodiments, the vector comprises a nucleic acid
molecule (or gene of interest) encoding a protein of interest,
including an expression vector comprising the nucleic acid
molecules (genes) described wherein the nucleic acid molecule
(gene) is operably linked to an expression control sequence
suitable for expression in the host cell.
[0102] Expression control sequences are engineered to control and
drive the transcription of genes of interest, and subsequent
expression of proteins in various cell systems. Plasmids combine an
expressible gene of interest with expression control sequences
(i.e. expression cassettes) that comprise desirable regulatory
elements such as, for example, promoters, enhancers, selectable
markers, operators, etc. In an expression vector of the invention,
GPT and the proteins of interest, such as antibody-encoding nucleic
acid molecules, may comprise or be associated with any suitable
promoter, enhancer, operator, repressor protein, poly (A)
termination sequences and other expression-facilitating
elements.
[0103] The expression of a gene of interest, such as an
antibody-encoding nucleotide sequence, may be placed under control
of any promoter or enhancer element known in the art. Examples of
such elements include strong expression promoters (e. g., human CMV
IE promoter/enhancer or CMV major IE (CMV-MIE) promoter, as well as
RSV, SV40 late promoter, SL3-3, MMTV, ubiquitin (Ubi), ubiquitin C
(UbC), and HIV LTR promoters).
[0104] In some embodiments, the vector comprises a promoter
selected from the group consisting of SV40, CMV, CMV-IE, CMV-MIE,
RSV, SL3-3, MMTV, Ubi, UbC and HIV LTR.
[0105] Nucleic acid molecules of the invention may also be operably
linked to an effective poly (A) termination sequence, an origin of
replication for plasmid product in E. coli, an antibiotic
resistance gene as selectable marker, and/or a convenient cloning
site (e.g., a polylinker). Nucleic acids may also comprise a
regulatable inducible promoter (inducible, repressable,
developmentally regulated) as opposed to a constitutive promoter
such as CMV IE (the skilled artisan will recognize that such terms
are actually descriptors of a degree of gene expression under
certain conditions).
[0106] Selectable markers are elements well-known in the art. In
some circumstances, additional selectable markers may be employed,
in addition to GPT, wherein such markers make the cells visible.
Positive or negative selection may be used.
[0107] In some embodiments, the vector comprises one or more
selectable marker genes encoding green fluorescent protein (GFP),
enhanced green fluorescent protein (eGFP), cyano fluorescent
protein (CFP), enhanced cyano fluorescent protein (eCFP), yellow
fluorescent protein (YFP) or enhanced yellow fluorescent protein
(eYFP).
[0108] For the purposes of this invention, gene expression in
eukaryotic cells may be tightly regulated using a strong promoter
that is controlled by an operator that is in turn regulated by a
regulatory fusion protein (RFP). The RFP consists essentially of a
transcription blocking domain, and a ligand-binding domain that
regulates its activity. Examples of such expression systems are
described in US20090162901A1, which is herein incorporated by
reference in its entirety.
[0109] A number of operators in prokaryotic cells and bacteriophage
have been well characterized (Neidhardt, ed. Escherichia coli and
Salmonella; Cellular and Molecular Biology 2d. Vol 2 ASM Press,
Washington D.C. 1996). These include, but are not limited to, the
operator region of the LexA gene of E. coli, which binds the LexA
peptide, and the lactose and tryptophan operators, which bind the
repressor proteins encoded by the LacI and trpR genes of E. coli.
These also include the bacteriophage operators from the lambda
P.sub.R and the phage P22 ant/mnt genes which bind the repressor
proteins encoded by lambda cI and P22 arc. In some embodiments,
when the transcription blocking domain of the repressor protein is
a restriction enzyme, such as NotI, the operator is the recognition
sequence for that enzyme. One skilled in the art will recognize
that the operator must be located adjacent to, or 3' to the
promoter such that it is capable of controlling transcription by
the promoter. For example, U.S. Pat. No. 5,972,650, which is
incorporated by reference herein, specifies that tetO sequences be
within a specific distance from the TATA box. In specific
embodiments, the operator is preferably placed immediately
downstream of the promoter. In other embodiments, the operator is
placed within 10 base pairs of the promoter.
[0110] In certain embodiments, the operator is selected from the
group consisting of tet operator (tetO), NotI recognition sequence,
LexA operator, lactose operator, tryptophan operator and Arc
operator (AO). In some embodiments, the repressor protein is
selected from the group consisting of TetR, LexA, LacI, TrpR, Arc,
LambdaC1 and GAL4. In other embodiments, the transcription blocking
domain is derived from a eukaryotic repressor protein, e.g. a
repressor domain derived from GAL4.
[0111] In an exemplary cell expression system, cells are engineered
to express the tetracycline repressor protein (TetR) and a protein
of interest is placed under transcriptional control of a promoter
whose activity is regulated by TetR. Two tandem TetR operators
(tetO) are placed immediately downstream of a CMV-MIE
promoter/enhancer in the vector. Transcription of the gene encoding
the protein of interest directed by the CMV-MIE promoter in such
vector may be blocked by TetR in the absence of tetracycline or
some other suitable inducer (e.g. doxycycline). In the presence of
an inducer, TetR protein is incapable of binding tetO, hence
transcription then translation (expression) of the protein of
interest occurs. (See, e.g., U.S. Pat. No. 7,435,553, which is
herein incorporated by reference in its entirety.)
[0112] Another exemplary cell expression system includes regulatory
fusion proteins such as TetR-ER.sub.LBDT2 fusion protein, in which
the transcription blocking domain of the fusion protein is TetR and
the ligand-binding domain is the estrogen receptor ligand-binding
domain (ER.sub.LBD) with T2 mutations (ER.sub.LBDT2; Feil et al.
(1997) Biochem. Biophys. Res. Commun. 237:752-757). When tetO
sequences were placed downstream and proximal to the strong CMV-MIE
promoter, transcription of the nucleotide sequence of interest from
the CMV-MIE/tetO promoter was blocked in the presence of tamoxifen
and unblocked by removal of tamoxifen. In another example, use of
the fusion protein Arc2-ER.sub.LBDT2, a fusion protein consisting
of a single chain dimer consisting of two Arc proteins connected by
a 15 amino acid linker and the ER.sub.LBDT2 (supra), involves an
Arc operator (AO), more specifically two tandem arc operators
immediately downstream of the CMV-MIE promoter/enhancer. Cell lines
may be regulated by Arc2-ER.sub.LBDT2, wherein cells expressing the
protein of interest are driven by a CMV-MIE/ArcO2 promoter and are
inducible with the removal of tamoxifen. (See, e.g., US
20090162901A1, which is herein incorporated by reference.)
[0113] In some embodiments, a vector of the invention comprises a
CMV-MIE/TetO or CMV-MIE/AO2 hybrid promoter.
[0114] The vectors of the invention may also employ Cre-lox tools
for recombination technology in order to facilitate the replication
of a gene of interest. A Cre-lox strategy requires at least two
components: 1) Cre recombinase, an enzyme that catalyzes
recombination between two loxP sites; and 2) loxP sites (e.g. a
specific 34-base pair bp sequence consisting of an 8-bp core
sequence, where recombination takes place, and two flanking 13-bp
inverted repeats) or mutant lox sites. (See, e.g. Araki et al. PNAS
92:160-4 (1995); Nagy, A. et al. Genesis 26:99-109 (2000); Araki et
al. Nuc Acids Res 30(19):e103 (2002); and US20100291626A1, all of
which are herein incorporated by reference). In another
recombination strategy, yeast-derived FLP recombinase may be
utilized with the consensus sequence FRT (see also, e.g. Dymecki,
S. PNAS 93(12): 6191-6196 (1996)).
[0115] In another aspect, a gene (i.e. a nucleotide sequence
encoding a recombinant polypeptide of the invention) is inserted
upstream or downstream of the GPT gene of the expression cassette,
and is optionally operably linked to a promoter, wherein the
promoter-linked gene is flanked 5' by a first recombinase
recognition site and 3' by a second recombinase recognition site.
Such recombinase recognition sites allow Cre-mediated recombination
in the host cell of the expression system. In some instances, a
second promoter-linked gene is downstream (3') of the first gene
and is flanked 3' by the second recombinase recognition site. In
still other instances, a second promoter-linked gene is flanked 5'
by the second recombinase site, and flanked 3' by a third
recombinase recognition site. In some embodiments, the recombinase
recognition sites are selected from a loxP site, a lox511 site, a
lox2272 site, and a FRT site. In other embodiments, the recombinase
recognition sites are different. In a further embodiment, the host
cell comprises a gene capable of expressing a Cre recombinase.
[0116] In one embodiment, the vector comprises a first gene
encoding a light chain of an antibody or a heavy chain of an
antibody of the invention, and a second gene encoding a light chain
of an antibody or a heavy chain of an antibody of the
invention.
[0117] In some embodiments, the vector further comprises an
X-box-binding-protein 1 (mXBP1) gene capable of further enhancing
protein production/protein secretion through control of the
expression of genes involved in protein folding in the endoplasmic
reticulum (ER). (See, e.g. Ron D, and Walter P. Nat Rev Mol Cell
Biol. 8:519-529 (2007)).
[0118] Any cell is suitable for expressing a recombinant nucleic
acid sequence of the invention. Cells used in the invention include
mammalian cells such as non-human animal cells, human cells, or
cell fusions such as, for example, hybridomas or quadromas. In
certain embodiments, the cell is a human, monkey, hamster, rat or
mouse cell. In other embodiments, the cell is eukaryotic and is
selected from the following cells: CHO (e.g. CHO K1, DXB-11 CHO,
Veggie-CHO), COS (e.g. COS-7), retinal cells, Vero, CV1, kidney
(e.g. HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK21), HeLa, HepG2,
W138, MRC 5, Colo25, HB 8065, HL-60, Jurkat, Daudi, A431
(epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT
cell, tumor cell, and a cell line derived from an aforementioned
cell. In some embodiments, the cell comprises one or more viral
genes, e.g. a retinal cell that expresses a viral gene (e.g. a
PER.C6.RTM. cell).
[0119] In an even further aspect, the invention relates to a
recombinant mammalian host cell, such as a transfectoma, which
produces an immunoglobulin, such as an antibody or a bispecific
molecule. Examples of such host cells include engineered mammalian
cells such as CHO or HEK cells. For example, in one embodiment, the
present invention provides a cell comprising a nucleic acid stably
integrated into the cellular genome that comprises a sequence
coding for expression of an antibody comprising a recombinant
polypeptide of the present invention. In another embodiment, the
present invention provides a cell comprising a non-integrated
(i.e., episomal) nucleic acid, such as a plasmid, cosmid, phagemid,
or linear expression element, which comprises a sequence coding for
expression of an antibody comprising the recombinant polypeptide of
the invention. In other embodiments, the present invention provides
a cell line produced by stably transfecting a host cell with a
plasmid comprising an expression vector of the invention.
[0120] Thus, in one aspect, the invention provides a cell
containing (a) a recombinant polynucleotide that encodes an
exogenously-added mammalian GPT gene and (b) a polynucleotide that
encodes a multi-subunit protein. In some embodiments, the
exogenously-added GPT gene is 90% identical to the nucleic acid
sequence of SEQ ID NO: 2, non-limiting examples of which are
provided in SEQ ID NOs:11-17, and the multi-subunit protein is an
antibody. In other embodiments, the cell also contains an
exogenously-added GPT gene, and regulatory elements. In one
embodiment, the cell is a mammalian cell, such as a CHO cell used
in the manufacture of biopharmaceuticals.
[0121] In another aspect, the invention provides a cell line
derived from the cell described in the previous aspect. By "derived
from", what is meant is a population of cells clonally descended
from an individual cell and having some select qualities, such as
the ability to produce active protein at a given titer, or the
ability to proliferate to a particular density. In some
embodiments, the cell line, which is derived from a cell harboring
the recombinant polynucleotide encoding a mammalian GPT gene and a
polynucleotide encoding a multi-subunit protein, is capable of
producing the multi-subunit protein at a titer of at least 3 grams
per liter of media (g/L), at least 5 g/L, or at least 8 g/L. In
some embodiments, the cell line can attain an integrated cell
density (ICD) that is at least 30% greater, at least 50% greater,
at least 60% greater, or at least 90% greater than the integrated
cell density attainable by a cell line derived from what is
essentially the same cell but without the recombinant
polynucleotide encoding GPT.
[0122] A method for amplifying the GOI is provided. The exemplified
methods apply increasing concentrations of tunicamycin to a
eukaryotic GPT expression system, thus amplifying the gene copy of
a GOI operably linked to an exogenously-added mammalian GPT
gene.
Proteins of Interest
[0123] A nucleic acid sequence encoding a protein of interest can
be conveniently integrated into a cell comprising an Tn resistance
marker gene and an IRES, and optionally flanked by recombinase
recognition sites. Any protein of interest suitable for expression
in mammalian cells can be used, however glycoproteins will
especially benefit from the methods of the invention. For example,
the protein of interest can be an antibody or antigen-binding
fragment thereof, a bispecific antibody or fragment thereof, a
chimeric antibody or fragment thereof, an ScFv or fragment thereof,
an Fc-tagged protein (e.g. Trap protein) or fragment thereof, a
growth factor or a fragment thereof, a cytokine or a fragment
thereof, or an extracellular domain of a cell surface receptor or
fragment thereof.
[0124] Glycoproteins with asparagine-linked (N-linked) glycans are
ubiquitous in eukaryotic cells. Biosynthesis of these glycans and
their transfer to polypeptides takes place in the endoplasmic
reticulum (ER). N-glycan structures are further modified by a
number of glycosidases and glycosyl-transferases in the ER and the
Golgi complex. Protein production using the invention is directed
at consistency of the native N-glycan structure in order to
eliminate immunogenic epitopes ("glycotopes").
[0125] Using the methods of the invention, recombinant protein lots
display favorable characteristics. HPLC (with fluorescent
detection) of replicate protein production batches demonstrated
that the glycoproteins had uniform expression and glycosylation
patterns, as exemplified in FIGS. 7A-8 herein. A method of
glycosylating a N-glycan protein substrate is provided, whereas a
mammalian host cell encoding a nucleic acid molecule comprising a
mammalian tunicamycin (Tn)-resistance gene operably linked to a
gene encoding the protein substrate in need of glycosylation is
provided; the cell is cultured in the presence of a first
concentration of Tn; a cell population expressing at least one copy
of the Tn-resistance gene is isolated; the cell population is
cultured in the presence of increasing concentrations of Tn; and
the N-glycan protein substrate is isolated from the cell culture.
The N-glycan content of the protein substrate may be evaluated for
the presence of monosaccharides and oligosaccharides by any method
known in the art.
[0126] Detailed structural analysis of glycan-linked proteins may
be correlated to functional features of the protein. Such analysis
characterizing protein glycosylation typically involves several
steps: i) an enzymatic or chemical release of the attached glycans;
ii) derivatization of the released glycans via reductive amination
with aromatic or aliphatic amines or permethylation; iii) analysis
of the glycans. Many variations of analyzing glycosylation patterns
in known to the skilled person. Glycoproteins may carry several
types of glycoforms occupying various sites in specific quantities,
and therefore their complexity may make it difficult to reproduce
in certain production methods. Consistency of type and quantity of
glycoform is measurable and represents a desirable outcome for
therapeutic protein production.
Host Cells and Transfection
[0127] The mammalian host cells used in the methods of the
invention are eukaryotic host cells, usually mammalian cells,
including, e.g. CHO cells and mouse cells. In one embodiment, the
invention provides a cell comprising a nucleic acid sequence that
encodes a Tn resistance marker protein derived from Cricetulus
griseus (Chinese hamster) (as set forth in SEQ ID NO:3), or a
homolog or variant thereof. In some embodiments, the cell comprises
multiple gene copies of the Tn resistance marker gene. In other
embodiments, the invention provides a nucleic acid sequence that
encodes a Tn resistance marker protein derived from human (SEQ ID
NO:4), Rhesus monkey (SEQ ID NO:5), chimpanzee (SEQ ID NO:6), dog
(SEQ ID NO:7), guinea pig (SEQ ID NO:8), rat (SEQ ID NO:9) or mouse
(SEQ ID NO:10).
[0128] The invention includes a mammalian host cell transfected
with an expression vector of the invention. Transfected host cells
include cells that have been transfected with expression vectors
that comprise a sequence encoding a protein or polypeptide of
interest. Expressed proteins will typically be secreted into the
culture medium, depending on the nucleic acid sequence selected,
but may be retained in the cell or deposited in the cell membrane.
Various mammalian cell culture systems can be employed to express
recombinant proteins. Examples of suitable mammalian host cell
lines include the COS-7 lines of monkey kidney cells, described by
Gluzman (1981) Cell 23:175, and other cell lines capable of
expressing an appropriate vector including, for example, CV-1/EBNA
(ATCC CRL 10478), L cells, C127, 3T3, CHO, HeLa and BHK cell lines.
Other cell lines developed for specific selection or amplification
schemes will also be useful with the methods and compositions
provided herein. In one embodiment of the invention, the cell is a
CHO cell line designated K1 (i.e. a CHO K1 cell). In order to
achieve the goal of high volume production of recombinant proteins,
the host cell line should be pre-adapted to bioreactor medium in
the appropriate case.
[0129] Several transfection protocols are known in the art, and are
reviewed in Kaufman (1988) Meth. Enzymology 185:537. The
transfection protocol chosen will depend on the host cell type and
the nature of the GOI, and can be chosen based upon routine
experimentation. The basic requirements of any such protocol are
first to introduce DNA encoding the protein of interest into a
suitable host cell, and then to identify and isolate host cells
which have incorporated the heterologous DNA in a relatively
stable, expressible manner.
[0130] Certain reagents useful for introducing heterologous DNA
into a mammalian cell include Lipofectin.TM. Reagent and
Lipofectamine.TM.Reagent (Gibco BRL, Gaithersburg, Md.). Both of
these reagents are commercially available reagents used to form
lipid-nucleic acid complexes (or liposomes) which, when applied to
cultured cells, facilitate uptake of the nucleic acid into the
cells.
[0131] The transfection protocol chosen and the elements selected
for use therein will depend on the type of host cell used. Those of
skill in the art are aware of numerous different protocols and host
cells, and can select an appropriate system for expression of a
desired protein, based on the requirements of the cell culture
system used. In a further aspect, the invention relates to an
expression vector encoding a polypeptide, including but not limited
to, an antibody, bispecific antibody, chimeric antibody, ScFv,
antigen-binding protein, or Fc fusion protein. Such expression
vectors may be used for recombinant production of polypeptides
using the methods and compositions of the invention.
[0132] Other features of the invention will become apparent in the
course of the following descriptions of exemplary embodiments which
are given for illustration of the invention and are not intended to
be limiting thereof.
EXAMPLES
[0133] The following examples are put forth so as to provide those
of ordinary skill in the art how to make and use the methods and
compositions described herein, and are not intended to limit the
scope of what the inventors regard as their invention. Efforts have
been made to ensure accuracy with respect to numbers used (e.g.,
amount, temperature, etc.) but some experimental error and
deviation should be accounted for. Unless indicated otherwise,
parts are parts by weight, molecular weight is average molecular
weight, temperature is in degrees Centigrade, and pressure is at or
near atmospheric.
Example 1. Selection Efficiency of Transfectant Cells Expressing
GPT
[0134] Modified CHO K1 cells were transfected with a plasmid vector
containing CHO-GPT (SEQ ID NO: 2), human GPT (SEQ ID NO:12) or a
plasmid vector containing a hygromycin phosphotransferase (Hpt,
Hygromycin resistant gene); e.g. the selectable marker gene
(CHO-GPT or hpt) was transcriptionally linked to a downstream eGFP
gene via an IRES sequence, in their respective vectors. For
example, each plasmid was constructed to contain the following gene
sequences, in 5' to 3' direction: a Lox site, a SV40 late promoter,
either CHO-GPT (or Hpt), IRES, enhanced green fluorescent protein
(eGFP), and a second Lox site. Purified recombinant plasmids were
transfected together with a plasmid that expresses Cre recombinase,
into a modified CHO host cell line containing: from 5' to 3', a lox
site, YFP, and a second lox site, at a transcriptionally active
locus. Consequently, the host CHO cell can be isolated by flow
cytometry as a green-positive or a yellow-negative cell. When the
recombinant plasmid expressing eGFP (transcriptionally regulated by
the GPT or hpt genes) was transfected together with a plasmid
expressing the Cre recombinase, recombination mediated by the Cre
recombinase results in the site-specific integration of the
GPT/eGFP cassette at the chromosomal locus containing the lox sites
and replacement of the YFP gene occurs (i.e. a green-positive
cell). Should the eGFP integrate randomly, both green-positive and
yellow positive cells will result.
[0135] Cell populations were either incubated with 0, 1 .mu.g/ml,
2.5 .mu.g/ml or 5 .mu.g/ml tunicamycin (Tn) or 400 .mu.g hygromycin
(Hyg), as outlined in Table 2. Observed recombinant populations
(ORPs) were measured by fluorescent-activated cell sorting (FACS)
analysis. Cells were sorted to quantitate each population of cells,
and selection efficiency was calculated for cells expressing only
GFP and not YFP (FIG. 4 or 5).
[0136] Selection efficiency (percent population of surviving cells
expressing GFP) was compared between cell pools resistant to either
Tn or Hyg (Table 2).
TABLE-US-00004 TABLE 2 Selection Efficiency Selection agent
Selection efficiency Hpt or GPT Cre (ug/ml Hyg or Tn) % (Total
GFP+) Hpt + - 1.35 Hpt + + (400 Hyg) 98.8 choGPT + - 0.89 choGPT +
+ (1 Tn) 86.9 choGPT + + (2.5 Tn) 96.1 hGPT + - 2.6 hGPT + + (1 Tn)
97 hGPT + + (2.5 Tn) 96.7
[0137] It was observed that tunicamycin selection is as efficient
as hygromycin selection. Both CHO-GPT and human GPT were efficient
at selection of integrants in the presence of 1 ug/ml or 2.5 ug/ml
Tunicamycin.
Example 2. Amplification of the Gene Product
[0138] Incremental selection was done by applying increasing
concentrations of tunicamycin to the GPT expression system. CHO K1
cells were transfected with a plasmid vector containing the CHO-GPT
gene (SEQ ID NO: 2) as above. The plasmid contains in 5' to 3'
direction, a first Lox site, a SV40 late promoter, the CHO-GPT
gene, an IRES, eGFP, and a second Lox site. The CRE-lox sites
direct integration of the gene of interest into the genome
resulting in a stable transfectant pool of cells with at least one
GPT insertion per cell. (More integrants may occur due to random
integration, as seen above). CHO cells were initially cultured in
the presence of 1 .mu.g/ml tunicamycin (Tn). Transfectants were
then selected from the stable pool (named Cell Pool 2) and
subsequently expanded in the presence of 1 .mu.g/ml, 2.5 .mu.g/ml
or 5 .mu.g/ml Tn. Selection rounds were conducted to identify cell
populations capable of enhanced expression (multiple copies) of
eGFP. The random integration events increased greatly, in the
presence of 2.5 .mu.g/ml or 5 .mu.g/ml Tn.
[0139] Copy number of gene product, either CHO GPT, eGFP or mGapdh
(normalized control), was measured using standard qPCR methods.
Copy number of eGFP in the cells from the 1 .mu.g/ml Tn-resistant
pool incubated further with 2.5 ug/ml Tn was at least 2 times the
copy number of eGFP from the 1 .mu.g/ml Tn-resistant pool incubated
further with 1 .mu.g/ml Tn. The gene copy number increased further
when a 1 .mu.g/ml Tn-treated pool was incubated further with 5
.mu.g/ml Tn. The increase in gene copy number for eGFP correlates
with the increased gene copy of CHO-GPT. (See FIGS. 6A and 6B.)
[0140] To determine whether increase in gene copy number translates
to increased protein expression, the mean fluorescent intensity
(MFI) was measured by FACS for the same cell pools expressing GPT
and eGFP that were treated with multiple rounds of Tn selection,
namely 1, 2.5 or 5 .mu.g Tn (see e.g. samples 7, 8, and 9 in FIG.
6B). The comparison of eGFP expression for these cell pools is
represented in Table 3.
[0141] The cell pool expressing GPT that was subjected to a second
round of selection with 5 .mu.g Tn resulted in just greater than
2.5 times the productive output compared to 1 .mu.g Tn treatment,
and 1.5 times the productive output compared to 2.5 .mu.g Tn
treatment, with respect to eGFP production (Table 3).
TABLE-US-00005 TABLE 3 eGFP protein production GPT 1 ug pool +
Second Tn (.mu.g) Treatment MFI 1 .mu.g 1098 2.5 .mu.g 1867 5 .mu.g
2854
[0142] Without being bound by any one theory, incremental increases
in the concentration of Tn amplified the selective pressure to the
cells in a controlled manner, thus increasing the productive
output.
[0143] Tn-resistant expression vectors were also employed in
further experiments, described below, to test the effects of Tn
selection on glycosylation patterns.
Example 3. Expression and Glycosylation Profile of an Exemplary
Dimeric Protein
[0144] CHO cells expressing a "Trap" protein (Fc fusion protein-1,
hereinafter referred to as FcFP1) were transfected with a
GPT-containing expression vector. The plasmid has, in 5' to 3'
direction, a Lox site, a SV40 late promoter, a Tn-resistant gene
(CHO-GPT), an IRES eGFP, SV40 polyA and a second Lox site. 1
.mu.g/mL Tn or 5 .mu.g/mL Tn was used for selection of the GPT
selectable marker. The selected pools cells were expanded in
suspension cultures in serum-free production medium. GPT
transfection was confirmed by expression of eGFP by FACS analysis.
Pellets collected from selected pools were sent for copy number
analysis for GPT expression and a 12 day productivity assay was set
up to determine the expression level of FcFP1 in pools selected
with different concentrations of Tunicamycin.
[0145] FcFP1 was selected for its complex glycosylation pattern,
having an abundance of glycosylation sites. To determine
glycosylation profiles, cells expressing FcF1 protein were expanded
in cell culture under standard protocol (no Tn) or conditions of Tn
treatment as represented in Table 4, then protein was isolated and
purified.
TABLE-US-00006 TABLE 4 FcFP1 protein production Protein Lot #
Treatment FcFP1 110728 None Trap FcFP1 110728-1 1 .mu.g/ml Tn Trap
FcFP1 110728-2 5 .mu.g/ml Tn Trap
[0146] Detailed glycan analysis was performed using chromatography
based on well-known methods for HPLC and fluorescent anthranilic
acid (AA) tags (Anumula, and Dhume, Glycobiology, 8(7):685-694,
1998), for each lot of glycoprotein to determine whether Tn had a
negative impact on glycosylation profiles. The production lots were
also compared to a reference standard which represents a
therapeutically acceptable batch of protein. Representative glycan
analysis is shown in FIGS. 7A-7D. Each lot, compared to the
reference lot, consistently produces the same number of peaks,
relative shape and relative intensity. An overlap of each
chromatogram (FIG. 8) indicates that no unique or unusual peaks are
uncovered.
[0147] Oligosaccharide profiling was done by well-known HPLC
methods against the reference standard lot for the FcFP1 protein.
Levels of sialylation were measured for the FcFP1 trap protein lots
and the Z-number was calculated for each lot (3 replicates).
Z-number represents the measure of variation between lots. The
Z-number takes into account the relative number of peaks, as well
as the relative shape and intensity of each peak. For example, the
area of each 0SA, 1SA, 2SA, 3SA and 4SA peak in FIGS. 7A-7D is
quantitated as in Table 5.
TABLE-US-00007 TABLE 5 Quantitative Oligosaccharide Analysis OS
PROFILE Protein Lot Replicate OSA 1SA 2SA 3SA 4SA (Z-number)
Reference 1 6506.43 13388.34 11268.60 5176.21 1728.15 1.53
B100002M410 2 5869.80 11932.32 10159.21 4196.10 1550.09 1.51 3
6870.18 14536.84 12090.21 5200.58 1707.74 1.51 Avg 6415.47 13285.83
11172.65 4857.63 1661.99 1.52 .+-. 0.01 FcFP1 Trap 1 6159.09
9394.92 7368.03 3074.66 675.48 1.34 110728 2 7530.49 12117.03
9589.08 2951.63 810.09 1.36 3 5508.95 8580.56 6902.59 3794.81
630.79 1.34 Avg 6399.51 10030.84 7953.23 3074.66 705.45 1.35 .+-.
0.01 FcFP1 trap 1 5330.22 8149.81 6039.33 2490.06 641.37 1.35
110728-1 2 5034.39 9009.42 7059.61 2698.05 812.21 1.40 3 6222.44
10235.08 8428.04 3276.75 848.83 1.39 Avg 5529.02 9131.44 7342.33
2821.62 767.47 1.38 .+-. 0.03 FcFP1 trap 1 6300.77 10001.93 8109.12
3000.96 790.99 1.36 110728-2 2 5999.09 9952.47 7968.58 2885.50
717.70 1.36 3 4322.29 6176.33 5187.48 1742.26 458.52 1.32 Avg
5540.72 8710.24 7088.39 2542.91 655.74 1.35 .+-. 0.02 OS =
oligosaccharide; 0SA = zero sialic acid residues; 1SA = one sialic
acid residue; 2SA = two sialic acid residues; 3SA = three sialic
acid residues; 4SA = four sialic acid residues
Z .times. .times. number = ( Area .times. .times. 1 .times. SA + 2
* .times. Area .times. .times. 2 .times. SA + 3 * .times. Area
.times. .times. 3 .times. SA + 4 * .times. Area .times. .times. 4
.times. SA ) ( Area .times. .times. 0 .times. SA + Area .times.
.times. 1 .times. SA + Area .times. .times. 2 .times. SA + Area
.times. .times. 3 .times. SA + Area .times. .times. 4 .times. SA )
##EQU00001##
[0148] The Z-number calculated for each lot is within an acceptable
range compared to the reference lot, therefore each protein lot is
understood to achieve the same material as the therapeutic
molecule. Since the presence of Tn is known to have a negative
effect on glycosylation of N-linked glycoproteins, it was
unexpected that protein production would be reliable and
consistent, as well as productive, given the conditions of
increased selection pressure by Tn.
[0149] The present invention may be embodied in other specific
embodiments without departing from the spirit or essence thereof.
Sequence CWU 1
1
1916964DNAArtificial SequenceSynthetic 1aagcttatac tcgagctcta
gattgggaac ccgggtctct cgaattcgag atctagttta 60aacacgcggc cgctaatcag
ccataccaca tttgtagagg ttttacttgc tttaaaaaac 120ctcccacacc
tccccctgaa cctgaaacat aaaatgaatg caattgttgt tgttaacttg
180tttattgcag cttataatgg ttacaaataa agcaatagca tcacaaattt
cacaaataaa 240gcattttttt cactgcattc tagttgtggt ttgtccaaac
tcatcaatgt atcttatcat 300gtctaccggt ataacttcgt ataatgtata
ctatacgaag ttagccggta gggcccctct 360cttcatgtga gcaaaaggcc
agcaaaaggc caggaaccgt aaaaaggccg cgttgctggc 420gtttttccat
aggctccgcc cccctgacga gcatcacaaa aatcgacgct caagtcagag
480gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa
gctccctcgt 540gcgctctcct gttccgaccc tgccgcttac cggatacctg
tccgcctttc tcccttcggg 600aagcgtggcg ctttctcata gctcacgctg
taggtatctc agttcggtgt aggtcgttcg 660ctccaagctg ggctgtgtgc
acgaaccccc cgttcagccc gaccgctgcg ccttatccgg 720taactatcgt
cttgagtcca acccggtaag acacgactta tcgccactgg cagcagccac
780tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct
tgaagtggtg 840gcctaactac ggctacacta gaagaacagt atttggtatc
tgcgctctgc tgaagccagt 900taccttcgga aaaagagttg gtagctcttg
atccggcaaa caaaccaccg ctggtagcgg 960tggttttttt gtttgcaagc
agcagattac gcgcagaaaa aaaggatctc aagaagatcc 1020tttgatcttt
tctacggggt ctgacgctca gtggaacgaa aactcacgtt aagggatttt
1080ggtcatgggc gcgcctcata ctcctgcagg catgagatta tcaaaaagga
tcttcaccta 1140gatcctttta aattaaaaat gaagttttaa atcaatctaa
agtatatatg agtaaacttg 1200gtctgacagt taccaatgct taatcagtga
ggcacctatc tcagcgatct gtctatttcg 1260ttcatccata gttgcctgac
tccccgtcgt gtagataact acgatacggg agggcttacc 1320atctggcccc
agtgctgcaa tgataccgcg agacccacgc tcaccggctc cagatttatc
1380agcaataaac cagccagccg gaagggccga gcgcagaagt ggtcctgcaa
ctttatccgc 1440ctccatccag tctattaatt gttgccggga agctagagta
agtagttcgc cagttaatag 1500tttgcgcaac gttgttgcca ttgctacagg
catcgtggtg tcacgctcgt cgtttggtat 1560ggcttcattc agctccggtt
cccaacgatc aaggcgagtt acatgatccc ccatgttgtg 1620caaaaaagcg
gttagctcct tcggtcctcc gatcgttgtc agaagtaagt tggccgcagt
1680gttatcactc atggttatgg cagcactgca taattctctt actgtcatgc
catccgtaag 1740atgcttttct gtgactggtg agtactcaac caagtcattc
tgagaatagt gtatgcggcg 1800accgagttgc tcttgcccgg cgtcaatacg
ggataatact gcgccacata gcagaacttt 1860aaaagtgctc atcattggaa
aacgtttttc ggggcgaaaa ctctcaagga tcttaccgct 1920gttgagatcc
agttcgatgt aacccactcg tgcacccaac tgatcttcag catcttttac
1980tttcaccagc gtttctgggt gagcaaaaac aggaaggcaa aatgccgcaa
aaaagggaat 2040aagggcgaca cggaaatgtt gaatactcat actcttcctt
tttcaatatt attgaagcat 2100ttatcagggt tattgtctca tgagcggata
catatttgaa tgtatttaga aaaataaaca 2160aataggggtt ccgcgcacat
ttccccgaaa agtgccacct gacgtcaggt acacaacttc 2220gtatagcata
cattatacga agttatggta ccaagcctag gcctccaaaa aagcctcctc
2280actacttctg gaatagctca gaggcagagg cggcctcggc ctctgcataa
ataaaaaaaa 2340ttagtcagcc atggggcgga gaatgggcgg aactgggcgg
agttaggggc gggatgggcg 2400gagttagggg cgggactatg gttgctgact
aattgagatg catgctttgc atacttctgc 2460ctgctgggga gcctggggac
tttccacacc tggttgctga ctaattgaga tgcatgcttt 2520gcatacttct
gcctgctggg gagcctgggg actttccaca ccggatccac catgtgggcc
2580ttcccggagt tgccgctgcc gctgctggtg aatttgttcg gctcgctgct
gggatttgtg 2640gctactgtga ccctcatccc tgccttccgt agccacttta
tcgccgcgcg cctctgtggc 2700caggacctca acaagctcag ccggcagcag
atcccagaat cccagggagt gatctgcggt 2760gctgttttcc ttatcatcct
cttctgcttc atccctttcc ccttcctgaa ctgctttgtg 2820gaggagcagt
gtaaggcatt cccccaccat gaatttgtgg ccctgatagg tgccctcctt
2880gccatctgct gcatgatctt cctgggcttc gctgatgatg tactcaatct
gcgctggcgc 2940cataagctgc tgctgcccac agctgcctct ctacctctcc
tcatggttta cttcactaac 3000tttggcaata caaccattgt ggtacccaag
cccttccgct ggattcttgg cctgcatttg 3060gacttgggaa tcctatacta
tgtctacatg ggactgcttg cggtgttctg taccaatgcc 3120atcaacatcc
tagcaggaat taatggccta gaggctggtc agtcactagt catctctgct
3180tctatcattg tcttcaacct ggtagagctg gaaggtgatt atcgggatga
tcatgtcttt 3240tccctctact tcatgatacc attttttttt accaccttgg
gattgctata ccataactgg 3300tacccatcac aggtgtttgt gggagatacc
ttctgttatt ttgctggcat gacctttgcc 3360gtggtgggaa tcttgggaca
cttcagcaag accatgctac tcttctttat tccacaagtg 3420ttcaatttcc
tctactcgct gcctcagctc cttcacgcca tcccctgccc tcgacaccgc
3480atacccagac tcaatccgaa gacgggcaaa ctggagatga gctattccaa
gttcaagacc 3540aagaacctct ctttcttggg cacctttatt ttaaaggtag
cagagcgcct ccagctagtg 3600acagttcacc gaggcgagag tgaggatggt
gccttcactg aatgtaacaa catgaccctc 3660atcaacttgc tactcaaaat
ctttgggccc atacatgaga gaaacctcac actgctcctg 3720ctgcttttgc
agatcctgag cagcgctgtc accttctcca ttcgatacca gcttgtccga
3780ctcttctatg atgtctgaac gcgtcccccc tctccctccc ccccccctaa
cgttactggc 3840cgaagccgct tggaataagg ccggtgtgcg tttgtctata
tgttattttc caccatattg 3900ccgtcttttg gcaatgtgag ggcccggaaa
cctggccctg tcttcttgac gagcattcct 3960aggggtcttt cccctctcgc
caaaggaatg caaggtctgt tgaatgtcgt gaaggaagca 4020gttcctctgg
aagcttcttg aagacaaaca acgtctgtag cgaccctttg caggcagcgg
4080aaccccccac ctggcgacag gtgcctctgc ggccaaaagc cacgtgtata
agatacacct 4140gcaaaggcgg cacaacccca gtgccacgtt gtgagttgga
tagttgtgga aagagtcaaa 4200tggctctcct caagcgtatt caacaagggg
ctgaaggatg cccagaaggt accccattgt 4260atgggatctg atctggggcc
tcggtgcaca tgctttacat gtgtttagtc gaggttaaaa 4320aacgtctagg
ccccccgaac cacggggacg tggttttcct ttgaaaaaca cgattgctcg
4380aatcaccatg gtgagcaagg gcgaggagct gttcaccggg gtggtgccca
tcctggtcga 4440gctggacggc gacgtaaacg gccacaagtt cagcgtgtcc
ggcgagggcg agggcgatgc 4500cacctacggc aagctgaccc tgaagttcat
ctgcaccacc ggcaagctgc ccgtgccctg 4560gcccaccctc gtgaccaccc
tgacctacgg cgtgcagtgc ttcagccgct accccgacca 4620catgaagcag
cacgacttct tcaagtccgc catgcccgaa ggctacgtcc aggagcgcac
4680catcttcttc aaggacgacg gcaactacaa gacccgcgcc gaggtgaagt
tcgagggcga 4740caccctggtg aaccgcatcg agctgaaggg catcgacttc
aaggaggacg gcaacatcct 4800ggggcacaag ctggagtaca actacaacag
ccacaacgtc tacatcatgg ccgacaagca 4860gaagaacggc atcaaggtga
acttcaagat ccgccacaac atcgaggacg gcagcgtgca 4920gctcgccgac
cactaccagc agaacacccc catcggcgac ggccccgtgc tgctgcccga
4980caaccactac ctgagcaccc agtccgccct gagcaaagac cccaacgaga
agcgcgatca 5040catggtcctg ctggagttcg tgaccgccgc cgggatcact
ctcggcatgg acgagctgta 5100caagtaatcg gccgctaatc agccatacca
catttgtaga ggttttactt gctttaaaaa 5160acctcccaca cctccccctg
aacctgaaac ataaaatgaa tgcaattgtt gttgttaact 5220tgtttattgc
agcttataat ggttacaaat aaagcaatag catcacaaat ttcacaaata
5280aagcattttt ttcactgcat tctagttgtg gtttgtccaa actcatcaat
gtatcttatc 5340atgtcggcgc gttgacattg attattgact agttattaat
agtaatcaat tacggggtca 5400ttagttcata gcccatatat ggagttccgc
gttacataac ttacggtaaa tggcccgcct 5460ggctgaccgc ccaacgaccc
ccgcccattg acgtcaataa tgacgtatgt tcccatagta 5520acgccaatag
ggactttcca ttgacgtcaa tgggtggagt atttacggta aactgcccac
5580ttggcagtac atcaagtgta tcatatgcca agtacgcccc ctattgacgt
caatgacggt 5640aaatggcccg cctggcatta tgcccagtac atgaccttat
gggactttcc tacttggcag 5700tacatctacg tattagtcat cgctattacc
atggtgatgc ggttttggca gtacatcaat 5760gggcgtggat agcggtttga
ctcacgggga tttccaagtc tccaccccat tgacgtcaat 5820gggagtttgt
tttggcacca aaatcaacgg gactttccaa aatgtcgtaa caactccgcc
5880ccattgacgc aaatgggcgg taggcgtgta cggtgggagg tctatataag
cagagctctc 5940cctatcagtg atagagatct ccctatcagt gatagagatc
gtcgacgttt agtgaaccgt 6000cagatcgcct ggagacgcca tccacgctgt
tttgacctcc atagaagaca ccgggaccga 6060tccagcctcc gcggccggga
acggtgcatt ggaacgcgga ttccccgtgc caagagtgac 6120gtaagtaccg
cctatagagt ctataggccc acccccttgg cttcttatgc atgctatact
6180gtttttggct tggggtctat acacccccgc ttcctcatgt tataggtgat
ggtatagctt 6240agcctatagg tgtgggttat tgaccattat tgaccactcc
cctattggtg acgatacttt 6300ccattactaa tccataacat ggctctttgc
cacaactctc tttattggct atatgccaat 6360acactgtcct tcagagactg
acacggactc tgtattttta caggatgggg tctcatttat 6420tatttacaaa
ttcacatata caacaccacc gtccccagtg cccgcagttt ttattaaaca
6480taacgtggga tctccacgcg aatctcgggt acgtgttccg gacatgggct
cttctccggt 6540agcggcggag cttctacatc cgagccctgc tcccatgcct
ccagcgactc atggtcgctc 6600ggcagctcct tgctcctaac agtggaggcc
agacttaggc acagcacgat gcccaccacc 6660accagtgtgc cgcacaaggc
cgtggcggta gggtatgtgt ctgaaaatga gctcggggag 6720cgggcttgca
ccgctgacgc atttggaaga cttaaggcag cggcagaaga agatgcaggc
6780agctgagttg ttgtgttctg ataagagtca gaggtaactc ccgttgcggt
gctgttaacg 6840gtggagggca gtgtagtctg agcagtactc gttgctgccg
cgcgcgccac cagacataat 6900agctgacaga ctaacagact gttcctttcc
atgggtcttt tctgcagtca ccgtccttga 6960cacg 696421231DNACricetulus
griseus 2caccatgtgg gccttcccgg agttgccgct gccgctgctg gtgaatttgt
tcggctcgct 60gctgggattt gtggctactg tgaccctcat ccctgccttc cgtagccact
ttatcgccgc 120gcgcctctgt ggccaggacc tcaacaagct cagccggcag
cagatcccag aatcccaggg 180agtgatctgc ggtgctgttt tccttatcat
cctcttctgc ttcatccctt tccccttcct 240gaactgcttt gtggaggagc
agtgtaaggc attcccccac catgaatttg tggccctgat 300aggtgccctc
cttgccatct gctgcatgat cttcctgggc ttcgctgatg atgtactcaa
360tctgcgctgg cgccataagc tgctgctgcc cacagctgcc tctctacctc
tcctcatggt 420ttacttcact aactttggca atacaaccat tgtggtaccc
aagcccttcc gctggattct 480tggcctgcat ttggacttgg gaatcctata
ctatgtctac atgggactgc ttgcggtgtt 540ctgtaccaat gccatcaaca
tcctagcagg aattaatggc ctagaggctg gtcagtcact 600agtcatctct
gcttctatca ttgtcttcaa cctggtagag ctggaaggtg attatcggga
660tgatcatgtc ttttccctct acttcatgat accatttttt tttaccacct
tgggattgct 720ataccataac tggtacccat cacaggtgtt tgtgggagat
accttctgtt attttgctgg 780catgaccttt gccgtggtgg gaatcttggg
acacttcagc aagaccatgc tactcttctt 840tattccacaa gtgttcaatt
tcctctactc gctgcctcag ctccttcacg ccatcccctg 900ccctcgacac
cgcataccca gactcaatcc gaagacgggc aaactggaga tgagctattc
960caagttcaag accaagaacc tctctttctt gggcaccttt attttaaagg
tagcagagcg 1020cctccagcta gtgacagttc accgaggcga gagtgaggat
ggtgccttca ctgaatgtaa 1080caacatgacc ctcatcaact tgctactcaa
aatctttggg cccatacatg agagaaacct 1140cacactgctc ctgctgcttt
tgcagatcct gagcagcgct gtcaccttct ccattcgata 1200ccagcttgtc
cgactcttct atgatgtctg a 12313408PRTCricetulus griseus 3Met Trp Ala
Phe Pro Glu Leu Pro Leu Pro Leu Leu Val Asn Leu Phe1 5 10 15Gly Ser
Leu Leu Gly Phe Val Ala Thr Val Thr Leu Ile Pro Ala Phe 20 25 30Arg
Ser His Phe Ile Ala Ala Arg Leu Cys Gly Gln Asp Leu Asn Lys 35 40
45Leu Ser Arg Gln Gln Ile Pro Glu Ser Gln Gly Val Ile Cys Gly Ala
50 55 60Val Phe Leu Ile Ile Leu Phe Cys Phe Ile Pro Phe Pro Phe Leu
Asn65 70 75 80Cys Phe Val Glu Glu Gln Cys Lys Ala Phe Pro His His
Glu Phe Val 85 90 95Ala Leu Ile Gly Ala Leu Leu Ala Ile Cys Cys Met
Ile Phe Leu Gly 100 105 110Phe Ala Asp Asp Val Leu Asn Leu Arg Trp
Arg His Lys Leu Leu Leu 115 120 125Pro Thr Ala Ala Ser Leu Pro Leu
Leu Met Val Tyr Phe Thr Asn Phe 130 135 140Gly Asn Thr Thr Ile Val
Val Pro Lys Pro Phe Arg Trp Ile Leu Gly145 150 155 160Leu His Leu
Asp Leu Gly Ile Leu Tyr Tyr Val Tyr Met Gly Leu Leu 165 170 175Ala
Val Phe Cys Thr Asn Ala Ile Asn Ile Leu Ala Gly Ile Asn Gly 180 185
190Leu Glu Ala Gly Gln Ser Leu Val Ile Ser Ala Ser Ile Ile Val Phe
195 200 205Asn Leu Val Glu Leu Glu Gly Asp Tyr Arg Asp Asp His Val
Phe Ser 210 215 220Leu Tyr Phe Met Ile Pro Phe Phe Phe Thr Thr Leu
Gly Leu Leu Tyr225 230 235 240His Asn Trp Tyr Pro Ser Gln Val Phe
Val Gly Asp Thr Phe Cys Tyr 245 250 255Phe Ala Gly Met Thr Phe Ala
Val Val Gly Ile Leu Gly His Phe Ser 260 265 270Lys Thr Met Leu Leu
Phe Phe Ile Pro Gln Val Phe Asn Phe Leu Tyr 275 280 285Ser Leu Pro
Gln Leu Leu His Ala Ile Pro Cys Pro Arg His Arg Ile 290 295 300Pro
Arg Leu Asn Pro Lys Thr Gly Lys Leu Glu Met Ser Tyr Ser Lys305 310
315 320Phe Lys Thr Lys Asn Leu Ser Phe Leu Gly Thr Phe Ile Leu Lys
Val 325 330 335Ala Glu Arg Leu Gln Leu Val Thr Val His Arg Gly Glu
Ser Glu Asp 340 345 350Gly Ala Phe Thr Glu Cys Asn Asn Met Thr Leu
Ile Asn Leu Leu Leu 355 360 365Lys Ile Phe Gly Pro Ile His Glu Arg
Asn Leu Thr Leu Leu Leu Leu 370 375 380Leu Leu Gln Ile Leu Ser Ser
Ala Val Thr Phe Ser Ile Arg Tyr Gln385 390 395 400Leu Val Arg Leu
Phe Tyr Asp Val 4054408PRTHomo sapiens 4Met Trp Ala Phe Ser Glu Leu
Pro Met Pro Leu Leu Ile Asn Leu Ile1 5 10 15Val Ser Leu Leu Gly Phe
Val Ala Thr Val Thr Leu Ile Pro Ala Phe 20 25 30Arg Gly His Phe Ile
Ala Ala Arg Leu Cys Gly Gln Asp Leu Asn Lys 35 40 45Thr Ser Arg Gln
Gln Ile Pro Glu Ser Gln Gly Val Ile Ser Gly Ala 50 55 60Val Phe Leu
Ile Ile Leu Phe Cys Phe Ile Pro Phe Pro Phe Leu Asn65 70 75 80Cys
Phe Val Lys Glu Gln Cys Lys Ala Phe Pro His His Glu Phe Val 85 90
95Ala Leu Ile Gly Ala Leu Leu Ala Ile Cys Cys Met Ile Phe Leu Gly
100 105 110Phe Ala Asp Asp Val Leu Asn Leu Arg Trp Arg His Lys Leu
Leu Leu 115 120 125Pro Thr Ala Ala Ser Leu Pro Leu Leu Met Val Tyr
Phe Thr Asn Phe 130 135 140Gly Asn Thr Thr Ile Val Val Pro Lys Pro
Phe Arg Pro Ile Leu Gly145 150 155 160Leu His Leu Asp Leu Gly Ile
Leu Tyr Tyr Val Tyr Met Gly Leu Leu 165 170 175Ala Val Phe Cys Thr
Asn Ala Ile Asn Ile Leu Ala Gly Ile Asn Gly 180 185 190Leu Glu Ala
Gly Gln Ser Leu Val Ile Ser Ala Ser Ile Ile Val Phe 195 200 205Asn
Leu Val Glu Leu Glu Gly Asp Cys Arg Asp Asp His Val Phe Ser 210 215
220Leu Tyr Phe Met Ile Pro Phe Phe Phe Thr Thr Leu Gly Leu Leu
Tyr225 230 235 240His Asn Trp Tyr Pro Ser Arg Val Phe Val Gly Asp
Thr Phe Cys Tyr 245 250 255Phe Ala Gly Met Thr Phe Ala Val Val Gly
Ile Leu Gly His Phe Ser 260 265 270Lys Thr Met Leu Leu Phe Phe Met
Pro Gln Val Phe Asn Phe Leu Tyr 275 280 285Ser Leu Pro Gln Leu Leu
His Ile Ile Pro Cys Pro Arg His Arg Ile 290 295 300Pro Arg Leu Asn
Ile Lys Thr Gly Lys Leu Glu Met Ser Tyr Ser Lys305 310 315 320Phe
Lys Thr Lys Ser Leu Ser Phe Leu Gly Thr Phe Ile Leu Lys Val 325 330
335Ala Glu Ser Leu Gln Leu Val Thr Val His Gln Ser Glu Thr Glu Asp
340 345 350Gly Glu Phe Thr Glu Cys Asn Asn Met Thr Leu Ile Asn Leu
Leu Leu 355 360 365Lys Val Leu Gly Pro Ile His Glu Arg Asn Leu Thr
Leu Leu Leu Leu 370 375 380Leu Leu Gln Ile Leu Gly Ser Ala Ile Thr
Phe Ser Ile Arg Tyr Gln385 390 395 400Leu Val Arg Leu Phe Tyr Asp
Val 4055408PRTMacaca mulatta 5Met Trp Ala Phe Ser Glu Leu Pro Met
Pro Leu Leu Val Asn Leu Ile1 5 10 15Val Ser Leu Leu Gly Phe Val Ala
Thr Val Thr Leu Ile Pro Ala Phe 20 25 30Arg Gly His Phe Ile Ala Ala
Arg Leu Cys Gly Gln Asp Leu Asn Lys 35 40 45Thr Ser Arg Gln Gln Ile
Pro Glu Ser Gln Gly Val Ile Ser Gly Ala 50 55 60Val Phe Leu Ile Ile
Leu Phe Cys Phe Ile Pro Phe Pro Phe Leu Asn65 70 75 80Cys Phe Val
Lys Glu Gln Cys Lys Ala Phe Pro His His Glu Phe Val 85 90 95Ala Leu
Ile Gly Ala Leu Leu Ala Ile Cys Cys Met Ile Phe Leu Gly 100 105
110Phe Ala Asp Asp Val Leu Asn Leu Arg Trp Arg His Lys Leu Leu Leu
115 120 125Pro Thr Ala Ala Ser Leu Pro Leu Leu Met Val Tyr Phe Thr
Asn Phe 130 135 140Gly Asn Thr Thr Ile Val Val Pro Lys Pro Phe Arg
Pro Ile Leu Gly145 150 155 160Leu His Leu Asp Leu Gly Ile Leu Tyr
Tyr Val Tyr Met Gly Leu Leu 165 170 175Ala Val Phe Cys Thr Asn Ala
Ile Asn Ile Leu Ala Gly Ile Asn Gly 180 185 190Leu Glu Ala Gly Gln
Ser Leu Val Ile Ser Ala Ser Ile Ile Val Phe 195 200 205Asn Leu Val
Glu Leu Glu Gly Asp Cys Arg Asp Asp His Val Phe Ser 210 215 220Leu
Tyr Phe Met Ile Pro Phe Phe Phe Thr Thr Leu Gly Leu Leu Tyr225 230
235 240His Asn Trp Tyr Pro Ser Arg Val Phe Val Gly Asp Thr Phe Cys
Tyr 245 250 255Phe Ala Gly Met Thr Phe Ala Val Val Gly Ile Leu Gly
His Phe Ser 260 265 270Lys Thr Met Leu Leu Phe Phe Met Pro Gln Val
Phe Asn Phe Leu Tyr
275 280 285Ser Leu Pro Gln Leu Leu His Ile Ile Pro Cys Pro Arg His
Arg Ile 290 295 300Pro Arg Leu Asn Ile Lys Thr Gly Lys Leu Glu Met
Ser Tyr Ser Lys305 310 315 320Phe Lys Thr Lys Ser Leu Ser Phe Leu
Gly Thr Phe Ile Leu Lys Val 325 330 335Ala Glu Ser Leu Arg Leu Val
Thr Ile His Gln Ser Asp Thr Glu Asp 340 345 350Gly Glu Phe Thr Glu
Cys Asn Asn Met Thr Leu Ile Asn Leu Leu Leu 355 360 365Lys Ile Phe
Gly Pro Ile His Glu Arg Asn Leu Thr Leu Leu Leu Leu 370 375 380Leu
Leu Gln Ile Leu Gly Ser Ala Phe Thr Phe Ser Ile Arg Tyr Gln385 390
395 400Leu Val Arg Leu Phe Tyr Asp Val 4056408PRTPan troglodytes
6Met Trp Ala Phe Ser Glu Leu Pro Met Pro Leu Leu Ile Asn Leu Ile1 5
10 15Val Ser Leu Leu Gly Phe Val Ala Thr Val Thr Leu Ile Pro Ala
Phe 20 25 30Arg Gly His Phe Ile Ala Ala Arg Leu Cys Gly Gln Asp Leu
Asn Lys 35 40 45Thr Ser Arg Gln Gln Ile Pro Glu Ser Gln Gly Val Ile
Ser Gly Ala 50 55 60Val Phe Leu Ile Ile Leu Phe Cys Phe Ile Pro Phe
Pro Phe Leu Asn65 70 75 80Cys Phe Val Lys Glu Gln Cys Lys Ala Phe
Pro His His Glu Phe Val 85 90 95Ala Leu Ile Gly Ala Leu Leu Ala Ile
Cys Cys Met Ile Phe Leu Gly 100 105 110Phe Ala Asp Asp Val Leu Asn
Leu Arg Trp Arg His Lys Leu Leu Leu 115 120 125Pro Thr Ala Ala Ser
Leu Pro Leu Leu Met Val Tyr Phe Thr Asn Phe 130 135 140Gly Asn Thr
Thr Ile Val Val Pro Lys Pro Phe Arg Pro Ile Leu Gly145 150 155
160Leu His Leu Asp Leu Gly Ile Leu Tyr Tyr Val Tyr Met Gly Leu Leu
165 170 175Ala Val Phe Cys Thr Asn Ala Ile Asn Ile Leu Ala Gly Ile
Asn Gly 180 185 190Leu Glu Ala Gly Gln Ser Leu Val Ile Ser Ala Ser
Ile Ile Val Phe 195 200 205Asn Leu Val Glu Leu Glu Gly Asp Cys Arg
Asp Asp His Val Phe Ser 210 215 220Leu Tyr Phe Met Ile Pro Phe Phe
Phe Thr Thr Leu Gly Leu Leu Tyr225 230 235 240His Asn Trp Tyr Pro
Ser Arg Val Phe Val Gly Asp Thr Phe Cys Tyr 245 250 255Phe Ala Gly
Met Thr Phe Ala Val Val Gly Ile Leu Gly His Phe Ser 260 265 270Lys
Thr Met Leu Leu Phe Phe Met Pro Gln Val Phe Asn Phe Leu Tyr 275 280
285Ser Leu Pro Gln Leu Leu His Ile Ile Pro Cys Pro Arg His Arg Ile
290 295 300Pro Arg Leu Asn Ile Lys Thr Gly Lys Leu Glu Met Ser Tyr
Ser Lys305 310 315 320Phe Lys Thr Lys Ser Leu Ser Phe Leu Gly Thr
Phe Ile Leu Lys Val 325 330 335Ala Glu Ser Leu Gln Leu Val Thr Val
His Gln Ser Glu Thr Glu Asp 340 345 350Gly Glu Phe Thr Glu Cys Asn
Asn Met Thr Leu Ile Asn Leu Leu Leu 355 360 365Lys Ile Leu Gly Pro
Ile His Glu Arg Asn Leu Thr Leu Leu Leu Leu 370 375 380Leu Leu Gln
Ile Leu Gly Ser Ala Ile Thr Phe Ser Ile Arg Tyr Gln385 390 395
400Leu Val Arg Leu Phe Tyr Asp Val 4057408PRTCanis familiaris 7Met
Trp Ala Phe Pro Glu Leu Pro Met Pro Leu Leu Val Asn Leu Val1 5 10
15Gly Ser Leu Leu Gly Phe Val Ala Thr Val Thr Leu Ile Pro Ala Phe
20 25 30Arg Gly His Phe Ile Ala Ala His Leu Cys Gly Gln Asp Leu Asn
Lys 35 40 45Thr Gly Arg Gln Gln Ile Pro Glu Ser Gln Gly Val Ile Ser
Gly Ala 50 55 60Val Phe Leu Ile Ile Leu Phe Cys Phe Ile Pro Phe Pro
Phe Leu Asn65 70 75 80Cys Phe Met Glu Glu Gln Cys Lys Ala Phe Pro
His His Glu Phe Val 85 90 95Ala Leu Ile Gly Ala Leu Leu Ala Ile Cys
Cys Met Ile Phe Leu Gly 100 105 110Phe Ala Asp Asp Val Leu Asn Leu
Arg Trp Arg His Lys Leu Leu Leu 115 120 125Pro Thr Ala Ala Ser Leu
Pro Leu Leu Met Val Tyr Phe Thr Asn Phe 130 135 140Gly Asn Thr Thr
Ile Val Val Pro Lys Pro Phe Arg Pro Ile Leu Gly145 150 155 160Leu
His Leu Asp Leu Gly Ile Leu Tyr Tyr Val Tyr Met Gly Leu Leu 165 170
175Ala Val Phe Cys Thr Asn Ala Ile Asn Ile Leu Ala Gly Ile Asn Gly
180 185 190Leu Glu Ala Gly Gln Ser Leu Val Ile Ser Ala Ser Ile Ile
Val Phe 195 200 205Asn Leu Val Glu Leu Glu Gly Asp Tyr Arg Asp Asp
His Val Phe Ser 210 215 220Leu Tyr Phe Met Ile Pro Phe Phe Phe Thr
Thr Leu Gly Leu Leu Tyr225 230 235 240His Asn Trp Tyr Pro Ser Gln
Val Phe Val Gly Asp Thr Phe Cys Tyr 245 250 255Phe Ala Gly Met Thr
Phe Ala Val Val Gly Ile Leu Gly His Phe Ser 260 265 270Lys Thr Met
Leu Leu Phe Phe Met Pro Gln Val Phe Asn Phe Leu Tyr 275 280 285Ser
Leu Pro Gln Leu Leu His Ile Ile Pro Cys Pro Arg His Arg Ile 290 295
300Pro Arg Leu Asn Thr Lys Thr Gly Lys Leu Glu Met Ser Tyr Ser
Lys305 310 315 320Phe Lys Thr Lys Ser Leu Ser Phe Leu Gly Asn Phe
Ile Leu Lys Val 325 330 335Ala Ala Ser Leu Gln Leu Val Thr Val His
Gln Ser Glu Asn Glu Asp 340 345 350Gly Ala Phe Thr Glu Cys Asn Asn
Met Thr Leu Leu Asn Leu Leu Leu 355 360 365Lys Val Leu Gly Pro Met
His Glu Arg Asn Leu Thr Leu Leu Leu Leu 370 375 380Leu Leu Gln Ile
Leu Gly Ser Ala Val Thr Phe Ser Ile Arg Tyr Gln385 390 395 400Leu
Val Arg Leu Phe Tyr Asp Val 4058408PRTCavia porcellus 8Met Trp Ala
Phe Ser Glu Val Pro Ile Pro Leu Leu Val Asn Leu Ile1 5 10 15Gly Ser
Leu Leu Gly Phe Val Ala Thr Leu Thr Leu Ile Pro Ala Phe 20 25 30Arg
Gly His Phe Ile Ala Ala Arg Leu Cys Gly Gln Asp Leu Asn Lys 35 40
45Thr Asn Arg Gln Gln Ile Pro Glu Ser Gln Gly Val Ile Ser Gly Ala
50 55 60Val Phe Leu Ile Ile Leu Phe Cys Phe Ile Pro Phe Pro Phe Leu
Asn65 70 75 80Cys Phe Val Lys Glu Gln Cys Lys Ala Phe Pro His His
Glu Phe Val 85 90 95Ala Leu Ile Gly Ala Leu Leu Ala Ile Cys Cys Met
Ile Phe Leu Gly 100 105 110Phe Ala Asp Asp Val Leu Asn Leu Arg Trp
Arg His Lys Leu Leu Leu 115 120 125Pro Thr Ala Ala Ser Leu Pro Leu
Leu Met Val Tyr Phe Thr Asn Phe 130 135 140Gly Asn Thr Thr Ile Val
Val Pro Lys Pro Phe Arg Pro Val Leu Gly145 150 155 160Leu His Leu
Asp Leu Gly Ile Leu Tyr Tyr Val Tyr Met Gly Leu Leu 165 170 175Ala
Val Phe Cys Thr Asn Ala Ile Asn Ile Leu Ala Gly Ile Asn Gly 180 185
190Leu Glu Ala Gly Gln Ser Leu Val Ile Ser Ala Ser Ile Ile Val Phe
195 200 205Asn Leu Val Glu Leu Gln Gly Asp Tyr Arg Asp Asp His Val
Phe Ser 210 215 220Leu Tyr Phe Met Ile Pro Phe Phe Phe Thr Thr Leu
Gly Leu Leu Tyr225 230 235 240His Asn Trp Tyr Pro Ser Gln Val Phe
Val Gly Asp Thr Phe Cys Tyr 245 250 255Phe Ala Gly Met Thr Phe Ala
Val Val Gly Ile Leu Gly His Phe Ser 260 265 270Lys Thr Met Leu Leu
Phe Phe Met Pro Gln Val Phe Asn Phe Leu Tyr 275 280 285Ser Leu Pro
Gln Leu Leu His Ile Ile Pro Cys Pro Arg His Arg Ile 290 295 300Pro
Arg Leu Asn Thr Lys Thr Gly Lys Leu Glu Met Ser Tyr Ser Lys305 310
315 320Phe Lys Thr Asn Ser Leu Ser Phe Leu Gly Thr Phe Ile Leu Lys
Val 325 330 335Ala Glu Arg Leu Gln Leu Val Thr Val His Arg Ser Glu
Gly Glu Asp 340 345 350Gly Ala Phe Thr Glu Cys Asn Asn Met Thr Leu
Ile Asn Leu Leu Leu 355 360 365Lys Ile Phe Gly Pro Ile His Glu Arg
Asn Leu Thr Leu Leu Leu Leu 370 375 380Leu Leu Gln Ile Val Gly Ser
Ala Val Thr Phe Ser Ile Arg Tyr Gln385 390 395 400Leu Val Arg Leu
Phe Tyr Asp Val 4059410PRTRattus norvegicus 9Met Trp Ala Phe Pro
Glu Leu Pro Leu Pro Leu Pro Leu Leu Val Asn1 5 10 15Leu Ile Gly Ser
Leu Leu Gly Phe Val Ala Thr Val Thr Leu Ile Pro 20 25 30Ala Phe Arg
Ser His Phe Ile Ala Ala Arg Leu Cys Gly Gln Asp Leu 35 40 45Asn Lys
Leu Ser Arg Gln Gln Ile Pro Glu Ser Gln Gly Val Ile Ser 50 55 60Gly
Ala Val Phe Leu Ile Ile Leu Phe Cys Phe Ile Pro Phe Pro Phe65 70 75
80Leu Asn Cys Phe Val Glu Glu Gln Cys Lys Ala Phe Pro His His Glu
85 90 95Phe Val Ala Leu Ile Gly Ala Leu Leu Ala Ile Cys Cys Met Ile
Phe 100 105 110Leu Gly Phe Ala Asp Asp Val Leu Asn Leu Arg Trp Arg
His Lys Leu 115 120 125Leu Leu Pro Thr Ala Ala Ser Leu Pro Leu Leu
Met Val Tyr Phe Thr 130 135 140Asn Phe Gly Asn Thr Thr Ile Val Val
Pro Lys Pro Phe Arg Trp Ile145 150 155 160Leu Gly Leu His Leu Asp
Leu Gly Ile Leu Tyr Tyr Val Tyr Met Gly 165 170 175Leu Leu Ala Val
Phe Cys Thr Asn Ala Ile Asn Ile Leu Ala Gly Ile 180 185 190Asn Gly
Leu Glu Ala Gly Gln Ser Leu Val Ile Ser Ala Ser Ile Ile 195 200
205Val Phe Asn Leu Val Glu Leu Glu Gly Asp Tyr Arg Asp Asp His Val
210 215 220Phe Ser Leu Tyr Phe Met Met Pro Phe Phe Phe Thr Thr Leu
Gly Leu225 230 235 240Leu Tyr His Asn Trp Tyr Pro Ser Gln Val Phe
Val Gly Asp Thr Phe 245 250 255Cys Tyr Phe Ala Gly Met Thr Phe Ala
Val Val Gly Ile Leu Gly His 260 265 270Phe Ser Lys Thr Met Leu Leu
Phe Phe Met Pro Gln Val Phe Asn Phe 275 280 285Leu Tyr Ser Leu Pro
Gln Leu Phe Gln Ile Ile Pro Cys Pro Arg His 290 295 300Arg Met Pro
Arg Leu Asn Thr Lys Thr Gly Lys Leu Glu Met Ser Tyr305 310 315
320Ser Lys Phe Lys Thr Lys Ser Leu Ser Phe Leu Gly Thr Phe Ile Leu
325 330 335Lys Val Ala Glu Ser Leu Arg Leu Val Thr Val His Arg Gly
Glu Ser 340 345 350Glu Asp Gly Ala Phe Thr Glu Cys Asn Asn Met Thr
Leu Ile Asn Leu 355 360 365Leu Leu Lys Val Phe Gly Pro Thr His Glu
Arg Asn Leu Thr Leu Phe 370 375 380Leu Leu Leu Leu Gln Val Leu Ser
Ser Ala Val Thr Phe Ser Ile Arg385 390 395 400Tyr Gln Leu Val Arg
Leu Phe Tyr Asp Val 405 41010410PRTMus musculus 10Met Trp Ala Phe
Pro Glu Leu Pro Leu Pro Leu Pro Leu Leu Val Asn1 5 10 15Leu Ile Gly
Ser Leu Leu Gly Phe Val Ala Thr Val Thr Leu Ile Pro 20 25 30Ala Phe
Arg Ser His Phe Ile Ala Ala Arg Leu Cys Gly Gln Asp Leu 35 40 45Asn
Lys Leu Ser Gln Gln Gln Ile Pro Glu Ser Gln Gly Val Ile Ser 50 55
60Gly Ala Val Phe Leu Ile Ile Leu Phe Cys Phe Ile Pro Phe Pro Phe65
70 75 80Leu Asn Cys Phe Val Glu Glu Gln Cys Lys Ala Phe Pro His His
Glu 85 90 95Phe Val Ala Leu Ile Gly Ala Leu Leu Ala Ile Cys Cys Met
Ile Phe 100 105 110Leu Gly Phe Ala Asp Asp Val Leu Asn Leu Arg Trp
Arg His Lys Leu 115 120 125Leu Leu Pro Thr Ala Ala Ser Leu Pro Leu
Leu Met Val Tyr Phe Thr 130 135 140Asn Phe Gly Asn Thr Thr Ile Val
Val Pro Lys Pro Phe Arg Trp Ile145 150 155 160Leu Gly Leu His Leu
Asp Leu Gly Ile Leu Tyr Tyr Val Tyr Met Gly 165 170 175Leu Leu Ala
Val Phe Cys Thr Asn Ala Ile Asn Ile Leu Ala Gly Ile 180 185 190Asn
Gly Leu Glu Ala Gly Gln Ser Leu Val Ile Ser Ala Ser Ile Ile 195 200
205Val Phe Asn Leu Val Glu Leu Glu Gly Asp Tyr Arg Asp Asp His Ile
210 215 220Phe Ser Leu Tyr Phe Met Ile Pro Phe Phe Phe Thr Thr Leu
Gly Leu225 230 235 240Leu Tyr His Asn Trp Tyr Pro Ser Arg Val Phe
Val Gly Asp Thr Phe 245 250 255Cys Tyr Phe Ala Gly Met Thr Phe Ala
Val Val Gly Ile Leu Gly His 260 265 270Phe Ser Lys Thr Met Leu Leu
Phe Phe Met Pro Gln Val Phe Asn Phe 275 280 285Leu Tyr Ser Leu Pro
Gln Leu Phe His Ile Ile Pro Cys Pro Arg His 290 295 300Arg Met Pro
Arg Leu Asn Ala Lys Thr Gly Lys Leu Glu Met Ser Tyr305 310 315
320Ser Lys Phe Lys Thr Lys Asn Leu Ser Phe Leu Gly Thr Phe Ile Leu
325 330 335Lys Val Ala Glu Asn Leu Arg Leu Val Thr Val His Gln Gly
Glu Ser 340 345 350Glu Asp Gly Ala Phe Thr Glu Cys Asn Asn Met Thr
Leu Ile Asn Leu 355 360 365Leu Leu Lys Val Phe Gly Pro Ile His Glu
Arg Asn Leu Thr Leu Leu 370 375 380Leu Leu Leu Leu Gln Val Leu Ser
Ser Ala Ala Thr Phe Ser Ile Arg385 390 395 400Tyr Gln Leu Val Arg
Leu Phe Tyr Asp Val 405 410111920DNAMus musculus 11gttgcttcct
aagagcttct tgctggtcag gagggagggt caggtcctag cgtcctagct 60gggttttgtt
cccgctggcg ccggaatcct ctgcgggttg ggagccgcac tgccggctgc
120cgaggccacg ggattgttcc tggcttacca gttagctgag taggcggcgg
ggcggcggcc 180accggagggt caccatgtgg gccttcccgg agttgcccct
gccgctgccg ctgctggtga 240atttgatcgg ctcgctgttg ggattcgtgg
ctacagtcac cctcatccct gccttccgta 300gccactttat cgccgcgcgc
ctctgtggcc aggacctcaa caagctcagc cagcagcaga 360tcccagagtc
ccagggagtg atcagcggtg ctgttttcct tatcatcctc ttctgcttca
420tccctttccc cttcctgaac tgcttcgtgg aggagcagtg taaggcattc
ccccaccatg 480aatttgtggc cctaataggt gccctccttg ccatctgctg
catgatcttc ctggggtttg 540ctgatgatgt cctcaatctc cgctggcgcc
acaagctgct gctgcccaca gctgcctcac 600tacctctcct catggtctac
ttcacaaact ttggcaatac aaccatcgtg gtgcccaagc 660ccttccgctg
gattctgggc ctgcatttgg acttggggat cctgtactac gtctacatgg
720ggctgcttgc agtgttctgt accaatgcca tcaacatcct ggcgggcatt
aatggcctag 780aggccggtca gtcactagtc atctctgctt ctatcattgt
cttcaacctg gtggaactgg 840aaggtgatta tcgagatgat catatctttt
ccctttactt catgatacca tttttcttta 900ccaccttggg actgctttac
cacaactggt acccgtcccg cgtgtttgtg ggagacacct 960tctgttactt
tgcgggcatg acttttgccg tggtggggat cttgggacac ttcagcaaga
1020ccatgctgct cttctttatg ccacaagtat tcaatttcct ctactcactg
cctcagctct 1080tccatatcat cccctgccct cgacaccgga tgcccagact
caacgcaaag acaggcaaac 1140tggaaatgag ctattccaag ttcaagacca
agaacctctc tttcctgggc acctttattt 1200taaaggtagc agagaacctc
cggttagtga cagttcacca aggtgagagt gaggacggtg 1260ccttcactga
gtgtaacaac atgaccctca tcaacttgct acttaaagtc tttgggccta
1320tacatgagag aaacctcacc ctgctcctgc tgctcctgca ggtcctaagc
agcgccgcca 1380ccttctccat tcgttaccaa ctcgtccgac tcttctatga
tgtctgagct ccctgacagc 1440tgccctttac ctcacagtct ccattggacc
tcagccagga ccagcctctg tctggtccga 1500gatgaccctc tggtccaggc
ctcgctgaca cttttgttct cagcttctgc catctgtgac 1560tactgatatc
ctggatggac accttgctgg acttgaagtc cgctagttgg actttgccta
1620gggctttcat cttgccttgc cctccctttc tgtcccatct gcagcctcac
caggtgggct 1680tgtagcctct attatgcaaa tattcgtagc tcagctttca
gagcgctaac tctaaaggaa 1740ttcacctgag ccttgagaga gaacctgggc
tagggctaga gttagggcta catactccaa 1800ggtgacctca catttgacta
tcaaatgaag tgttgtgatt gggaagcgta gaggcagggc 1860catgtgctca
gaacggtgac aataaaggac tgccttttac ttgttaaaaa aaaaaaaaaa
1920122150DNAHomo sapiens 12aagtatccgt tcttggctgc ctttctttaa
ttgcgtttcc agtactctct cggtgattct 60actcttgaac ataggatgaa atttggaatc
acacttctct tccacttcca tccccaccct 120ctaatgccca tattaaaaat
ggcggccgcc gccttccgca gtaatggttg ttcagcgaac 180aagatccggg
cggaaacagt agataggcgg gtgcagcggg gcagaacata ggttgcctta
240gagaggttcc ccggtgtccc gacggcggct caagtcagag ttgctgggtt
ttgctcagat 300tggtgtggga agagcctgcc tgtggggagc ggccactcca
tactgctgag gcctcaggac 360tgctgctcag cttgcccgtt acctgaagag
gcggcggagc cgggcccctg accggtcacc 420atgtgggcct tctcggaatt
gcccatgccg ctgctgatca atttgatcgt ctcgctgctg 480ggatttgtgg
ccacagtcac cctcatcccg gccttccggg gccacttcat tgctgcgcgc
540ctctgtggtc aggacctcaa caaaaccagc cgacagcaga tcccagaatc
ccagggagtg 600atcagcggtg ctgttttcct tatcatcctc ttctgcttca
tccctttccc cttcctgaac 660tgctttgtga aggagcagtg taaggcattc
ccccaccatg aatttgtggc cctgataggt 720gccctccttg ccatctgctg
catgatcttc ctgggctttg cggatgatgt actgaatctg 780cgctggcgcc
ataagctgct gctacctaca gctgcctcac tacctctcct catggtctat
840ttcaccaact ttggcaacac gaccattgtg gtgcccaagc ccttccgccc
gatacttggc 900ctgcatctgg acttgggaat cctgtactat gtctacatgg
ggctgctggc agtgttctgt 960accaatgcca tcaatatcct agcaggaatt
aacggcctag aggctggcca gtcactagtc 1020atttctgctt ccatcattgt
cttcaacctg gtagagttgg aaggtgattg tcgggatgat 1080catgtctttt
ccctctactt catgataccc ttttttttca ccactttggg attgctctac
1140cacaactggt acccatcacg ggtgtttgtg ggagatacct tctgttactt
tgctggcatg 1200acctttgccg tggtgggcat cttgggacac ttcagcaaga
ccatgctact attcttcatg 1260ccccaggtgt tcaacttcct ctactcactg
cctcagctcc tgcatatcat cccctgccct 1320cgccaccgca tacccagact
caatatcaag acaggcaaac tggagatgag ctattccaag 1380ttcaagacca
agagcctctc tttcttgggc acctttattt taaaggtggc agagagcctc
1440cagctggtga cagtacacca gagtgagact gaagatggtg aattcactga
atgtaacaac 1500atgaccctca tcaacttgct acttaaagtc cttgggccca
tacatgagag aaacctcaca 1560ttgctcctgc tgctgctgca gatcctgggc
agtgccatca ccttctccat tcgatatcag 1620ctcgttcgac tcttctatga
tgtctgagtc ccttgatcat tgtcctttac ctcacagtct 1680ctaggattcc
tgactcaggc tgacctctct ctctggtccc agactgcctc cttgcccagg
1740cctctctcac tcttcatact cctccagatt ttgttctcag cattttcctt
tctctgtgat 1800cattggcatc ctgggcgttt cttgccctct gctgactact
gattggattt tacctatggc 1860tttctgcaac ttgctactct ctccctctcc
atcccatctt tgcagcctca tagggtggga 1920tacagcagct ttttttgcag
ttatccacac tcacatttca gagtcctgac tctcaaggaa 1980ccactggttt
ttgggataga acttgggcca gggctaggaa cacaggctcc acggtgacat
2040gtcatttgat tgtaaattaa gtgttctgat tagtaagaac taagcagggg
gccacatgct 2100ctcaatggag acaataaagt gttgtctttt tcttattgtt
taaaaaaaaa 2150131840DNARattus norvegicus 13gggggctggc gccggaatcc
tctgagtgta gggagctgca ctgctggctg ccgaggcctc 60tggtttgttc ctggcttacc
aagttagctg agtaggcggc ggagcggcgg cccccggagg 120gtcactatgt
gggccttccc ggagttacct ctgccgctgc cgctgttggt gaatttgatc
180ggatcgctgt tgggatttgt ggctaccgtc accctcatcc ctgccttccg
tagccacttt 240atcgccgcgc gtctctgtgg ccaggacctc aacaagctca
gccggcagca gatcccagag 300tcccagggag tgatcagcgg tgctgttttc
cttatcatcc tcttctgctt catccctttc 360cctttcctga actgctttgt
ggaggagcag tgtaaggcat tcccccacca tgaatttgtg 420gccctgatag
gtgccctcct tgctatctgc tgcatgatct tcctgggttt tgctgatgac
480gtactcaatc tgcgatggcg tcataagctg ctgctcccca cagctgcctc
actacctctc 540ctcatggtct acttcactaa ctttggcaat acaaccattg
tggtgccgaa gcccttccgc 600tggattcttg gcctgcattt ggatttgggc
atcctgtact atgtctacat gggactgctt 660gcagtgttct gtaccaatgc
catcaacatc ctagcgggaa ttaatggcct agaggctggt 720caatcactag
tcatctctgc ttctattatt gtcttcaacc tggtggagct ggaaggtgat
780tatcgggacg atcatgtctt ttccctctac ttcatgatgc catttttttt
taccaccttg 840ggattgctgt accataactg gtacccgtct caggtgtttg
tgggagacac cttctgttat 900tttgctggca tgacctttgc cgtggtggga
atcttgggac acttcagcaa gaccatgctg 960ctcttcttta tgccacaagt
attcaatttc ctctactcac tgcctcagct ctttcagatc 1020atcccctgcc
ctcgacaccg tatgcccaga ctcaatacga agacaggcaa actggagatg
1080agctattcca agttcaagac caagagcctc tctttcttgg gcacgtttat
tttaaaggta 1140gcagagagcc tccggctggt gacagttcac cgaggggaga
gtgaggatgg tgccttcact 1200gagtgtaaca acatgaccct catcaacttg
ctacttaaag tctttgggcc tacacatgag 1260agaaacctca cactgttcct
gctgctcctg caggttctga gcagcgctgt caccttctcc 1320attcgttacc
agctcgtccg actcttctat gatgtctgag ctccctgacg actgcccttt
1380accacacagt ctccattgga cctcagccag gacccacctc tgtccgctcc
gaccgccttc 1440tggtccaggc tcagcttctg ccgtcatctg tgactactga
catcctggat ggactcctta 1500gtggacttga cgtccactag ttggacttgc
ctatgctttc ttgagtttgc tactccctcc 1560ctttctgcag cctcaccagg
tgggcctgta gcatctttta tgcaaatatt catggctcaa 1620ctttcagaac
cctaactcta aaggaatccc ctgggccttg agagagaacc tgggctaggg
1680ctagagttag ggcaacatac tccaaggtaa cctcacatct gactatcaaa
ttaagtgttc 1740tgattaggaa gagcagaggc agggccatgt gctcagaatg
gtgacaataa aggattgcct 1800tttacttgcc aaaaaaaaaa aaaaaaaaaa
aaaaaaaaaa 1840145424DNAMacaca mulatta 14tattaaaaat ggcggctgcc
gccctccgca gtaatagttg ttcagcgaat aaaatccggg 60cggaaacagt aggtaggctg
gttcagtggg ggcagaacct aggttgcctt agagaggttc 120ttcgaggtcc
cgagggcggc tcaagtcaga gttgttggat tctgctcaga ttggtgtggg
180aagagcctgc ctgtggggag cggccactcc atactgctga ggcctcagga
ctgctgctca 240gcttgccagt tacctgaaga ggcggcggag ccgggcccct
gaccggtcac catgtgggcc 300ttctcggaat tgcccatgcc gctgctggtc
aatttgatcg tctcgctgct gggatttgtg 360gccacagtca ccctcatccc
agccttccgg ggccacttca ttgctgcgcg cctctgtggt 420caggacctca
acaaaaccag ccgacaacag atgtgagcag cggcacacgg ttccgggcag
480ggggcaaggg ctaaggaagg agtggctagg gcaggggcgg ggaccggggt
gtttgaccac 540acgtgaaaac tcagaactaa cccaggcagc ctggaactcg
gagaggtgat gagcagaact 600tattcgcatt ggggaaagga tgggtaggga
accttgggta tatcagggac tctagcagtg 660gtgctttcct ccctccgccc
ccctcaccac ttcccaaaat aaaaaaccag gaatgagaag 720accgctttgg
gttattgtaa cacctgcact agtgagtgac cacaccccct ttcctctttc
780ccctcgcccc cttgctgctg ggccacagcc cagaatccca gggagtgatc
agcggtgctg 840ttttccttat catcctcttc tgcttcatcc ctttcccctt
cctgaactgc tttgtgaagg 900agcagtgtaa ggcattcccc caccatgaag
taagtgggtt cgtgggggtt gttgcctgtg 960gctgggacct gggaggtacc
tgagagaatt ggtgttattt gggcttgtgg ggaggggcta 1020agaaatgata
agaaaagaca agaattctta aaaggtgaaa tgggagcagg cttgagtcat
1080ggacctgccc tagcctcccc cagtttgtgg ccctgatagg tgccctcctt
gccatctgct 1140gcatgatctt cctgggcttt gcggatgatg tactgaatct
gcgctggcgc cataagctgc 1200tgctacccac agctgcctca ctacctctcc
tcatggtcta tttcaccaac tttggcaaca 1260cgaccattgt ggtgccgaag
cccttccgcc cgattcttgg cctgcatctg gacttgggta 1320ggtagtcctg
ccactgctac tcctatggca cctacttcag ggcacccttc ctggtgcttc
1380acattctcct tcaagtgttc cttttctgtc tctgtgtctt cccagatcct
ttctggtagc 1440ccttcatcct atcctctgtc ctcaccactt ttctaaatcc
tcctccccta ggtggcacta 1500cttttcctac catctctccc ttcaggaatc
ctgtactatg tctacatggg gctgctggca 1560gtgttctgta ccaatgccat
caatatccta gcaggaatta atggcctaga ggctggccag 1620tcactagtaa
tttctgcttc catcattgtc ttcaacctgg tagagttgga aggtaggtgg
1680gattgggggt ggggagagag aagtctgaat gttaaaggtg tggcctgata
tatgactttg 1740ggaaattcag ggaaaaaaag caatatgcgt agtaattata
gaagataagg gaggctactt 1800actttgcaaa taatgcagat ttattgaaag
tgagaaagaa aaatagcagc cgtgtcattt 1860atagctggat tggcactaac
agctaggcca tgatcttctc ccattgaata taaacaattt 1920cacagaacct
caacgttaca cagggtcatt ctgtgaccat gatggaggaa gaccaaaact
1980cgacccctcc ctctataatc ctgtttgagc acagataaaa ccacaaaaac
actgagcaac 2040ccacaaaatg gccaagatcc tctctctctg ttaacgtgag
ccatgagcga ctgctgcggc 2100tttccaataa caactcagtt cctaccacct
tttattttgt tttttgagac agggtctccc 2160tctgtcaccc aggctggaga
gcagtggcac gatcttagct cactgcatcc tctgactcaa 2220acgatcctcc
tgccccagac tcccaggtag ctggggctac aggcatgcgc caccacacct
2280ggcaaatttt tgtatttttt gtagagacag ggtttcacca cgttgcctag
gctggtcttg 2340aactcctggg ccgaagtgat ttgtcagcct tggcctccca
aagtgctggg attacactct 2400tgagccactg tggccagcca gttcctacca
cttcttagat aaacattaaa atgcttgatc 2460agagaattat tgttgttttc
ttttcttttt cttttttttt tttttttgag acggagtttc 2520actcttgccc
aggctggagt gcaatggtgc gatctcggct cactgcaacc tccacctccc
2580aggttcaggc gattctcctg cctcagcctc cctagtagct gggattacag
gcatgtgcca 2640tcacgcccag ctagttttgt atttttagta gagatgggat
ttctccatgt tggtcaagct 2700ggtctcaaac tccagacctc aggtgatccg
cccacctcgg cctcccaaag tgctgggatt 2760acaggtgtga gccaccgcac
ccggccatga attacacctg ctttctaaca gcacccaatc 2820cagagcaaaa
ctcttacttt cttttaccct ctcccaaaat acccaaaact gcaagcccct
2880cctaacactc tcttactgag acattccgtg gttcccaatg gtgtgtggtt
tctgaagtct 2940ccctttttac aacaagtcat taaacctagc ttcgaactat
agatgtgttt ctagtggtct 3000ttggctgatg gacatcaaca aatgtttatt
aaagctaagt actttttaaa catgatcgta 3060tttaaatctt gtaatggttt
tatgtggcac atgttataat cagccctgtt ttacagatga 3120gtaaacagat
ttagagaagt taaatgtgtc atgatcaaga tcaaggtcac aaagctaaga
3180agtaaagttg gtgtccaaac tgacatcaga atgggctaaa ccaaatttaa
gacagtaact 3240agtttggaag gctgcatgaa agaggtggaa tattgggaat
tgccttgggt gacataaaag 3300gggtattgag ttcttgaaag tgacttgggt
gaggtggatg atacagctgt aaacagaact 3360tagacaaaaa taggaccatg
gtatgcagaa gaagtgggta ttaattttcc cttctttctt 3420ccttgcttcc
aaaggtgatt gtcgggatga tcatgtcttt tccctctact tcatgatacc
3480cttttttttc accactttgg gattgctgta ccacaactgg taagtaggcc
tatggataag 3540gggaaaaggg gaaaactacc cgaacacatg gcaaagatgg
cccttatcat aacccacctt 3600gtggtggaga ggttaaacct gtgcatacct
ccatggaatt ttctgtgtct tcagttggtc 3660gtattctgaa atttctccct
acccaacagt atttggggat gagtgcgtgg aggtcccagg 3720aatagatgaa
ttcagggcct tggatcctgc agagttgctg cacaactgga gtctcctcta
3780agtcagaact agggtcaggg ctagtacagt gcccataggg tgtgatgtga
gagaaaggat 3840tggtaatgcc tcttgccact ggctcggatc ctctccccca
cacaggtacc catcacgggt 3900gtttgtggga gacaccttct gttactttgc
tggcatgacc tttgccgtgg tgggcatctt 3960gggacacttc agcaagacca
tgctactatt cttcatgccc caggtgttca acttcctcta 4020ctcactgcct
cagctcctgc atatcatccc ctgccctcgc caccgcatac ccaggtagcc
4080gctttggggc ttgaaatgga catcatagcc ttttcacttg ggatatctaa
tgccagcctt 4140tacattgctg tgcaaaggga gtgggcccaa agaagggcta
tttccatgtg agtaaccctt 4200tataacttcc aaagcacatt tatttgcatc
atctgatact cacagtggtt ctgataacag 4260caagcagcag agccagaaat
agatctcagg ttgactccac attcaatgct cttcctattg 4320attagccaca
gggaggaggg ttcaaatagt ggcccagtca catgaagctg tcttcccccc
4380gcagactcaa tatcaagaca ggcaaactgg agatgagcta ttccaagttc
aagaccaaga 4440gcctctcttt cttgggcacc tttattttaa aggtaacagg
gtaacaagga ggtaaggccc 4500taggctgcca tcctgacctt gaggaatggg
gaacctaggc ctacatcaga tccaagggga 4560acttggaagc attaaataga
tccacattcc taaagcatag gtattagctg aggttctctt 4620cacctctggt
ccctccaggt ggcagagagc ctccggctgg tgacaataca ccaaagtgat
4680actgaggatg gtgaattcac tgaatgtaac aacatgaccc tcatcaactt
gctacttaaa 4740atctttgggc ccatacatga gagaaacctc acattgctcc
tgctgctgct gcaggtgagg 4800atggggattg ggtttatacc tccttgtctc
cctttctccg tgattcttat tccagtccat 4860ttctccttgc agatcctggg
cagtgccttc accttctcca ttcgatatca gctcgttcga 4920ctcttctatg
atgtctgagt cccttgatca ttgtccttta cctcacagtc tctaggattc
4980ctgactcagg ctgacctctc tctggtccca gactgcctcc ttgcccaggc
ctctctcact 5040cttcatactc ttccagattt tgttctcagc attttctttt
ccctgtgatc actggcatcc 5100tgggcgtttc ttgcccccta ctgtctactg
attggatttt acttatgact ttctgcaact 5160tgctactctc cctctccatc
ctgtctttgc agcctcacag ggtgggatac agaagttttt 5220tttttgcagt
tatccacagt cacatttcag agtcctgact ctcaaggaac tactggtttt
5280tgggatagaa cttgggccag ggctagggac acaggctcca cagtgacctg
ttatttgatt 5340gtaaattaag tgttctgatt agtaagaagt aagcaggggg
ccacatgctc tcaatggaga 5400caataaagtg ttgtctattt ctta
5424155894DNAPan troglodytesmisc_feature(3408)..(3408)n is a, c, g,
or t 15aaaccgtagc tgcgtttccg ggaactgagt tgtgtttacc ttggcttccg
actatgttgg 60caacaggttt cctgcaagaa actggcgcgt ctccacaccc tcgtccctcc
tccccacccc 120ctgcctttca atagccatct tcctggagcc ggaggcatcc
cagattaagg gagaggtacg 180ggccctttaa gcttgaccta tggaggcgga
cggagctaaa actgacgtgg aaccggaatg 240tgagcggtgt cagacacgtg
gtacaaggag gcattcatct tggaaccggg caattggcat 300ttccgctctg
ggtagtacat ctttaacata atgttaggga agtatccgtt cttggctgcc
360tttctttaat tgcgtttcca gtactctctc ggtgattcta ctcttgaaca
taggatgaaa 420tttggaatca cacttctctt gcacttccat ccccaccctc
taatgcccat attaaaaatg 480gcggccgccg ccttccgcag taatggttgt
tcagcgaaca agatccgggc ggaaacagta 540gataggcggg tgcagcgggg
cagaacatag gttgccttag agaggttctc cggtgtctcg 600agggcggctc
aagttagagt tgttgggttt tgctcagatt ggtgtgggaa gagcctgcct
660gtggggagcg gccactccat actgctgagg cctcaggact gctgctcagc
ttgcccgtta 720cctgaagagg cggcggagcc gggcccctga ccggtcacca
tgtgggcctt ctcggaattg 780cccatgccgc tgctgatcaa tttgatcgtc
tcgctgctgg gatttgtggc cacagtcacc 840ctcatcccgg ccttccgggg
ccacttcatt gctgcgcgcc tctgtggtca ggacctcaac 900aaaaccagcc
gacagcagat gtgagcagcg gcacacgggt ctgggcaggg ggcaagggct
960aaggaaggag tggctagggc aggggcgggg accggggtgc ttgaccacac
gtgaagactc 1020agaactaacc caggcagcct ggaactcgga gaggtgatga
gcagaactta ctcgcattgg 1080ggaaaggatg ggtagggacc cttgggtata
tctgggactc tggcagtggt gctttcctcc 1140ctccgccccc ctcaccactt
accagaataa aaaaccggga atgagaagac cactttgggt 1200tattgtaaca
cctgcactag tgagtgacca cgcccccttt gctcttcccc ctcgccccct
1260tgctgctggg ccacagccca gaatcccagg gagtgatcag cggtgctgtt
ttccttatca 1320tcctcttctg cttcatccct ttccccttcc tgaactgctt
tgtgaaggag cagtgtaagg 1380cattccccca ccatgaagta agtgggttcg
tgggggtgat tgcctgtggc tgggacctgg 1440gaggtacctg agagaattgg
ggttatttgg gcttgtgggg aggggctaag aaattatcag 1500aaaagacagg
aattcttaaa aggtggaatg ggagcaggct tgagtcatgg acctgcccga
1560gcccccccca gtttgtggcc ctgataggtg ccctccttgc catctgctgc
atgatcttcc 1620tgggctttgc ggatgatgta ctgaatctgc gctggcgcca
taaactgctg ctacctacag 1680ctgcctcact acctctcctc atggtctatt
tcaccaactt tggcaacacg accattgtgg 1740tgcccaagcc cttccgcccg
atacttggcc tgcatctgga cttgggtagg tagtcctacc 1800actgctgccc
ctatggcacc tacttcaggg aacccttcct ggtgctccac attctcctcc
1860aagtgttcct tttctgtctc tgtgtcttcc cagatccttt ctggtagccc
ttcatcctat 1920cgtccgtcct caccactttt ctaaaaattc ttaaatcctc
ctcccctagg tggcactact 1980tcttttccta ccatttctcc ccgcaggaat
cctgtactat gtctacatgg ggctgctggc 2040agtgttctgt accaatgcca
tcaatatcct agcaggaatt aacggcctag aggctggcca 2100gtcactagtc
atttctgctt ccatcattgt cttcaacctg gtagagttgg aaggtaggtg
2160ggattggggg tggggagaga gaagtctgag cattaaaggt gtggcctgat
atatgacttt 2220gggaaattca gggaaaaaaa gcaatatgtg tagtaattat
agaagataag ggaagctact 2280tactttgcaa ataacaatgc agatttatta
aaagtgagaa agaaaaatag cagccctgtc 2340atttatagct ggattggcac
taatagctag gccatgatct tctcccattg aatataaaca 2400gtttcacaga
accccaacgt tacacagggt cattctgtga ccatgatgga gcaagactaa
2460aactagaccc ctccctctgt aatcatgttt gagcacaggc aaaaccacaa
gaacactgag 2520caacccacaa aatggccaag atcccctctc tcggctaaca
tgagcgactg ctgctgctct 2580ccaataacaa ctcagttcct accacttctt
tttttttttt ttgagacagg gtctccctct 2640gtcatgcagg ctggagagca
gtggcgcaat cttagctcac tgcatcctct gactcaaacg 2700atcctcctgc
cccagcctcc caagtagctg gggctacagg catgtgccac cacacctggc
2760aaatttttgt attttttgta gagacagggt ttcaccatgt tccctaggct
ggtcttgaac 2820tcctggactc aagtgatctg ccaggcctcc caaagtgctg
ggattcactc ttgagccact 2880gtgcccagcc agttcctacc atttcttaaa
taaacattaa aatgcttgat catagaatta 2940ctcttgcttt cttttctttt
cttttctttt ttttttgaga cggagttttg ttcttgccca 3000ggccggagta
caatggtgcg atctcggctc accgcaacct ccgcctccca ggttcaagcg
3060attctcctgc ctcagcctcc ctagtagctg ggattacagg cacgtgccac
cacgcccagc 3120taattttgta tttctagtag agacggggtt tctccatgtt
ggtcaggctg gtctcgaact 3180cctgacctca ggtgatctgc ctgcttcagc
ctcccaaagt gctgggatta caggcgtgag 3240tcaccgcacc cggccatgaa
ttactcctgc tttctaacag cacccagtcc agagcaaaac 3300tactttcttt
caccctctcc caaaataccc aaaacaaacg ctactacaag cccctcctaa
3360caccctctta ctgagacatt ccgtggttcc caatggtgtg tggtttcnga
agtctccctt 3420tttacaacaa gtcattaaac ctagctttga gctatagatg
tgtttctgat ggtcttggct 3480gatgaacatc aacaagtgtt tattaaagct
aagtactttt taaacactat cttatttaaa 3540tcttgtaatg gttttatgtg
gcagatgtta taatcagccc tgttttacag atgagaaaac 3600aggcttagag
aagtcaaatg tgtcatgatc aagatgaagg tcacaaagct aagaagtaaa
3660gttggtatcc aaacttacat cagaatgggc taaaccaaat ttaagatagt
aactagtttg 3720gaaggctgca cgaaagaggt ggaatattgg gaattgcctt
gggtgacata aaaggagtat 3780tgagttctta aaagtgactt gggtgaggtg
gatgataaca gctgtaaaca gaacttagac 3840aaaaatagga ccaaggtttg
cagaggaagt gggtattaac ttttccttct ttcttccttg 3900cttccaaagg
tgattgtcgg gatgatcatg tcttttccct ctacttcatg ataccctttt
3960ttttcaccac tttgggattg ctctaccaca actggtaagt aggcctgtgg
ataaggggac 4020aactacctga acacatggca aagatggccc ttatcataac
ccaccttgtg gtggtgaagc 4080taaacctgcg catacctcta tggagttttc
tgcgtcttca gttggtagta ttctgaaatt 4140tctctctacc cagtagtagt
tagggatgag tgcgtggagg ccccaggaat agttgaattc 4200agggccttgg
atcctgcaga gttgctgcac aactggagtc tcctctgagt cagaactagg
4260gtcagggcta gtccagtgcc catagggtgt gatgtgagag aagggattgg
taatgcctct 4320tgccactggc tcggatcctc ttcccccaca caggtaccca
tcacgggtgt ttgtgggaga 4380taccttctgt tactttgctg gcatgacctt
tgccgtggtg ggcatcttgg gacacttcag 4440caagaccatg ctactattct
tcatgcccca ggtgttcaac ttcctctact cactgcctca 4500gctcctgcat
atcatcccct gccctcgcca ccgcataccc aggtagccgc tttggggctt
4560gaaatggaca tcatagcctt ttcacttggg atatctaatg ccagcctata
catttgctgt 4620gcaaagggag tgggcccaaa gaagggctat ttccatgtga
gtagcccttt ataacttaca 4680aagcacattt atttgcataa tctgctacag
tggttctgat aacagtaagc agcagagcca 4740gaaatagatc tcaggttgac
tccacattca atgctcttcc tattagccac agggaggagg 4800gttcaaatag
tggcccagtc acatgaagct atcttccccc cgcagactca atatcaagac
4860aggcaaactg gagatgagct attccaagtt caagaccaag agcctctctt
tcttgggcac 4920ctttatttta aaggtaacag ggtaacaagg aggtaaggcc
ctaggctgcc atcctgacct 4980tgaggaatgg ggaacctagt cctacatcag
atccaagggg aacttgaaag cattaaatag 5040atccacattc ctaaagcata
ggtattagct gaggttctct tcacctctgg tccctccagg 5100tggcagagag
cctccagctg gtgacagtac accagagtga gactgaagat ggtgaattca
5160ctgaatgtaa caacatgacc ctcatcaact tgctacttaa aatccttggg
cccatacatg 5220agagaaacct cacattgctc ctgctgctgc tgcaggtgag
gatgggaatc gagtttatac
5280ctccgtgtct ccctttctgc gtgattctta ctccagtcca tttctccttg
cagatcctgg 5340gcagtgccat caccttctcc attcgatatc agctcgttcg
actcttctat gatgtctgag 5400tcccttgatc attgtccttt acctcacagt
ctctaggatt cctgactcag gctgacctct 5460ctctctggtc ccagactgcc
tccttgccca ggcctctctc actcttcata ctcctccaga 5520ttttgttctc
agcattttcc tttctctgtg atcattggca tcctgggcgt ttcttgccct
5580ctactgacta ctgattggat tttacctatg gctttctgcg acttgctact
ctctccctct 5640ccatcccatc tttgcagcct catagggtgg gatacagcag
ctttttttgc agttatccac 5700actcacattt cagagtcctg actctcaagg
aaccactggt ttttgggata gaacttgggc 5760cagggctagg aacacaggct
ccacggtgac atgtcatttg attgtaaatt aagtgttctg 5820attagtaaga
actaagcagg gggccacatg ctctcaatgg agacaataaa gtgttgtctt
5880tttcttattg ttta 5894164557DNACanis familiaris 16gtgaggaggc
aagtgcggcg ggggacagcc gagggtgcgc gctggaggct cgcgggagtc 60ctgggggcgc
ctcaattcag agttgggttt tgctcaggcc gctgtgggag gatccagcct
120gtgccgagcg gctgctcctc cccgcggggg gctccgggct accgcccagc
tcgcccatta 180gccgaggcgg cggcagagcg gggcccctgg ctggtcatca
tgtgggcctt cccggagttg 240ccgatgccgc tgctggtgaa tttggtcggc
tcgctgctgg gatttgtggc cacggtcacc 300ctcatccccg ccttccgtgg
ccacttcatc gccgcgcacc tctgtggcca ggacctcaac 360aaaaccggcc
ggcagcagat gtgagcggtg gcacccgggt ccggggaggg ggccggcagg
420gcaagggcgg gacctggggt gcctgacccc gcggacacgc agcgctaacc
ccgcagacag 480ctgcgggctc tgggagacga agggcagcgc tggccaactc
tgggaaggga tgttgcagta 540caggggaccc tcgggtgtat cagggactcc
agcgctggtg cccttccacc ccccttcccc 600gtagatcgct gtaatgcttg
ctctagtgag tgaccacgcc ccctctcctc tcccccgccc 660cctccctttg
ctgctgggcc acagcccaga gtcccaggga gtgatcagcg gtgctgtttt
720ccttatcatc ctcttctgct tcatcccttt ccccttcctg aactgtttta
tggaggagca 780gtgtaaagcc ttcccccatc acgaagtaag tgggtgagtt
gggggcggtt gcttggggct 840ggggcctggg agctacctgg gagagttgtg
gttattaggg tttgggtgga ggggctgagg 900aaggagcgaa gagacgggtg
tttttgcaag atgatgtggg cataggcttg agcggtgacc 960tgcccgagcc
tcccccagtt cgtggccctg ataggtgcgc tccttgccat ctgctgcatg
1020attttcctgg gctttgcgga cgatgtactg aatctgcgct ggcgccacaa
gctgctgctg 1080cctacagctg cctcgctacc tcttcttatg gtctatttca
ccaactttgg caacacgacc 1140attgtggtgc ccaagccttt ccggccgatt
cttggcctgc atctggactt gggtgagtag 1200ccctgtgact gacgtccctg
tggcccttac tttggggcac ccttaccctg ggagataatc 1260tagcagagca
tcattcctgg tgctccagat cctcttccaa gtgtccccat cttgttcctg
1320tgtcttctca gatccgttct gttggtcctt cgtccaatcc tctgtcctca
ccacttttct 1380cagaagaata ttcttaagtc ctcatttcta tggatggcac
acttcttact ctcttcttcc 1440cccagggatc ctgtattatg tttacatggg
gctgctggca gtgttctgta ccaatgccat 1500caatatccta gcaggaatta
atggcctaga ggcaggccag tcgctagtta tttctgcttc 1560catcatcgtc
ttcaatctgg tggagctgga aggtaggtga gagtgggagt ctgagtatta
1620aggaaactgc ctgatacctg gctttgggga attcaggaaa aaataaaagc
aatatattaa 1680gattaaatgt aaagaaaaac agctctgtca ttgacagctg
aattggcact aataggtagg 1740ccatggtctt ctgctgaaca taaacaattt
cacagaactt cacaatcaga cgaggtcact 1800ctatgtccat gatagagtaa
agcaaaccca gattcctcca taaacatgtc tgagtatagc 1860cagaactgca
ttttgtgcat cccacaaaaa tgactaggat ctccctcttc tggctaaggt
1920gagcaattgc ttccttctga taacttggtt ctacttagag aaaactaaga
tgctcataga 1980attacttcca ctgacagcac ccagtcttgg gcaaaacttt
gcctccttcc tttctccccc 2040aaattactca aaacaatcct ataacacatc
ttcctaatac ttccctactg aggcatcccc 2100tggttaccta tggtgcgtgg
tctacagtgt ctctcttgtt acacgtcagt aaacccagct 2160ttgactgcag
gtgtgtttct ggtggtcttt ggctgatgga tatcagtgct tattaaaaca
2220aaatactctt aaagcattta aactttgtaa tgtggcaagt gttctcatga
accatatttt 2280acagttgagg aaacagaggg cgagagaatt taagtgtgtc
atgatcaagg tcacacagtt 2340agaaagtaaa gctagtattc aaacctgggc
tgaatgatct aaaccaaatt gaagacagca 2400acttgtatta ggaagggttc
atgaatgagg tggaatatta ggaattgcct gagtgacaca 2460aaagaagtag
tgagttctgg aatgggactt ggaagaggtg gaaagtacag ctggggacag
2520aacttgagac agaaatagga cccagttatg cagggggaag taccttatca
actcatcctt 2580ctttcttttt cttcttcccc tgcttccaaa ggtgattatc
gggatgatca cgtcttttcc 2640ctctacttta tgataccctt ttttttcacc
accttgggat tgctctacca taactggtaa 2700gtgggccatg tgaacatgta
gcaagtatgg tcctgttggt cctgacccaa ctcctgttgg 2760agaggctaag
cctgcgcaca cctgtattga gtgttttctg gatgcctagt tggtaatatt
2820cttcaattac tctctaccca gttgcagtta gagacaagtg ctgtggagcc
cccaagaaga 2880gatgaattca gggctttggg ttctggaggc ttgttggaag
atctggagtt tcctccgggc 2940caggactaga gtcagggcta gtccagggtt
cagggcgtgt aatatgagag aaaagactga 3000tagtgcctcc tgccactggc
tcagatcctc tcccccacac aggtacccat cacaggtgtt 3060tgtgggagat
accttctgtt actttgctgg catgaccttt gccgtggtgg gcatcttggg
3120acacttcagc aagaccatgc tactcttctt catgccccag gtgttcaact
tcctctactc 3180actgcctcag ctcctgcata tcataccctg ccctcgccac
cgcattccca ggtagccact 3240ttggggctta aaagggacat cttagctttt
tcacttggga tgcataaagc cagccttctg 3300catctgctgt gtaaggggaa
tgggcccaaa ggagggctct ttccgtgcaa ttagccctta 3360taaatgacag
agcacattca cccacataat ctgatcagct ctgatcacac agtggtaagc
3420agagccggaa acagatcttc aggttgtctg attccacttt cggtactctt
cctattaatt 3480gaccgcagtg tggagagttc ttggagtagt ggcccagtca
cataaagctc tcttccccct 3540gcagactcaa taccaagaca ggcaaactgg
agatgagcta ttccaagttc aagaccaaga 3600gcctctcttt cttgggcaac
tttattctaa aggtaacagg gtaacgaggt aaggctctag 3660gccaccatcc
ggaattcagg gcctggggac cctcggcttg catcagatcc aaggggagcc
3720tggaagcatg aagcagatcc cccattgctg aagcagagtt gaagttctct
ccacctctgg 3780cccctccagg tagcagcgag cctgcagcta gtgacagtgc
accagagtga gaatgaggat 3840ggtgccttca cggagtgtaa caacatgacg
ctcctcaact tgctccttaa ggttctcggg 3900cccatgcatg agagaaacct
gactctgctc ctgctgctgc tccaggtgtg gtcagggaag 3960ggctttgctg
gctctggtct ccctttctcc atggctctga ctctggtgtg tttctttctc
4020ctcacagatc cttggcagtg ctgtcacctt ctccatccgg taccagcttg
tccggctctt 4080ctacgatgtc tgagtccccc aatccttgcc cttcactgca
tagtctgcag ggttcctgac 4140tcaggcctgc ctctttctgg gccaggcacg
cttccgggcc caggcctctc tcacctctta 4200cttttctcca gattttgtac
ttagcgattc cgttccgctg tgatcgacat cctgggcctg 4260tcttgccctg
tactgactgt tgattggact ttgcctgtgg ctttcttcaa cttgctgctc
4320tccctctcta tcccatccct gcggcctccc aaagtgggat actgtgcttt
ttatgcagtt 4380atccaccact cggactctcg aggaatatgt tgggcctggg
gatagaaccc tggctgggga 4440gagggacaca ggctcgaaga tcacttgatt
atttgaccat aaattaagta ttctgattcg 4500taagagcaga ttggggggcc
aggtgctccc agtggtgaca ataaagtgtt gtctttt 4557175374DNACricetulus
griseus 17caaggcagag cctaggttgc tttataaaac ctcttgggga agcccgaggg
cggttcaaat 60taagagttgt tgggttttgc cccgcctcgc atgtgaggag cggacactgc
tcacggctga 120gacctcgggg ctgcttccca ccagttagct gagaaggctg
cggagctgga acctctggcc 180actcgccatg tgggccttct ctgaggtacc
gattccgctg ctggtgaatt tgatcggctc 240gctgctggga tttgtggcca
cgctcaccct catcccggcc tttcgtggcc actttatcgc 300tgcgcgcctc
tgtggccagg acctcaacaa aaccaaccgg cagcagatgt gagcagtggc
360acacgggtgt cccgggcagg ggccaggggt gggcaaggca caggcgagct
ctgaggtgct 420taaatgtgcg tacgaaccaa atctaactgg agttgtccgg
gaccctggga ctcgatggcc 480agaagtggtt agcactgggg aatgctaagg
aaggggaccc ttgagtgaga acatccagcg 540gcgcctgcct ccccccgccc
cccactgccc tcccgctcca ctgctccccc gcctcactcc 600tgggaagatc
ttttgggtca catggttttt gcactaacca cgcccatttc ttcttccttc
660tccaccccct tgctgcgggg ccacagccca gaatcccagg gagtgatcag
cggtgccgtt 720ttccttatca tcctgttctg cttcatcccc ttccccttct
tgaactgctt tgtgaaggag 780cagtgtaagg ctttccccca ccatgaagta
agtgggttcg tgggggcggt tgcctggggc 840ctgggaggtt cccgagagag
ttggggttgt gtggatttga ggaggaggga ctgaggacct 900agtggaaaag
acagaaattt ttgaaagctt gaatggcagt aggcttgagt catgacctgc
960ccgagcctcc cccagtttgt ggccctcata ggtgcccttc ttgccatctg
ctgcatgatt 1020ttcttgggct tcgcggacga tgtcctgaat ctacgctggc
gccataagct gctgctgccc 1080acagctgcat cactacctct tcttatggtc
tattttacca actttggcaa cacaaccatt 1140gtggtaccca agcccttccg
cccagttctt ggcttgcatc tggatttggg tgagtatccc 1200tgctgctaca
gcccctgtgg cacttatttc aagtcaccct ccccccaaag gtgcccagca
1260gagcaccctt cttgatgttc cacactcccc tgtttttgtt ccgtccctgt
gaatgctcag 1320gttctctctt gtgccctgtc attgtgtgtt ctgttttcag
aataccgtta gatcctttcc 1380tagctgtcac tgctttttat actatgtctt
gcagggatcc tgtactatgt ctacatgggg 1440ctcctggcag tgttctgtac
caatgccatc aatatcctag caggaattaa cggcctagag 1500gccggccagt
cattggtcat ctctgcttcc atcattgtct tcaacctggt ggagctgcaa
1560ggttggtggg aagagagaga tctcagtgtt cagagaattg cctgatatat
agctttgaga 1620aaaggggggc ttatagaaga tagggaaagc tatttacttt
gcaaataaca atgaagagtt 1680acttgagtag gaggaagaaa aatagcagtc
tgtcatttat agctggattg gcatgagtag 1740ctagaccatg actgtttcct
attggacata aatagtttca tagaacccca gcatgagaga 1800ggggcgccct
gaccgtggtg aaacaagaca gaaaccagac ttctcccact gtaatcatgt
1860ctgaacaccg acaaaagcac aggaacaaag tcagcccaaa catcccttct
tgtctaatgt 1920gagagggtat agcttctttg cagtaacaac tcagttcctg
ctacttctta agttgttcag 1980tcagaaaatt acttctgctt tctgacatca
ggcagtccag agcacaactt ttccttgcag 2040cctccccaga accacttaaa
gtgaatccta ttgtaagtcc cttctaacaa cctttagagt 2100acctgcccag
catgaggcct tgggtacagt ccccagtatc tctgtttgca tgcatgtaca
2160catacccaca tgcacacact gaacttactt attgaaggta agcaatattt
atttgcattt 2220tttgtgtgtg tgacaaaatt tcactatgta attcagaata
gccttgaatt cactatgtag 2280cctaggccgt cctcgaactt acagtgataa
tcctgcctca gcttcctaag tgctaagatt 2340caaggtatgc actaccaggc
cagctaagaa agcaattttt aaactaggta tggtggcaca 2400catcactaat
tctaacactc tgggagactt gggcaggaag atcatgagtt tgagctcagc
2460ctgggcactt ggtaagtctc tgtttctaga aataaaacat ggagtggtga
tacacacctg 2520taatcccagc attcatgagg ctggggcagg aggatcacca
caaggtcaag acctgcctgg 2580gttacataag caagttcaag gccagcgtga
actacgtagt gagaccctgc ctcaaacaaa 2640caaataaata aataaacatg
atcctgagtt tggttcccag tactcccccc aataaatgaa 2700atgaaatgaa
agagctgggg aggcagctta gtgctaaggt ccaggacccc atgtgaaggc
2760agctgcgtgt atgtgttatc agccctgttt catacactag ataataaaac
tggttttcaa 2820acttaagtca gcatgtctgg acaaagtgaa gactttaact
tgtttttgac ggtttcatga 2880cagtagtgag ctattgggaa ctgcctgggt
accatcaaag gaataatgag gggctgggga 2940tttagctcag cggcataagc
gcctgccttg caagcaggca gtcatgagtt tgatccccgg 3000taccgataaa
aaggaaaaag acaaaaaaaa aaggaataat gagtttttga aggtggctcg
3060ggtgagggga ggtggcaaca gagacaggga tgcgacagac aaaatgaaga
gcaggggaca 3120taggggagat gggtgttcac ttttccttct ttgtcctttg
tttcccaagg tgattaccgg 3180gatgatcatg tcttttccct ctacttcatg
ataccgtttt ttttcaccac cttgggattg 3240ctgtatcata actggtaagg
aggctgtggc tcagggaaaa ggaaaacaac taactggtca 3300ttggacaaag
atggtcctga tcttaaccca gctcctgaaa gacaggctga acttgcgcat
3360acttttgctc agtgttttct gggtattcag ttggtggatt gcctcccccc
gccccgtttt 3420ttttttgaga cacctgtggc ctctcgagtg ctaggccagt
gctttactac tgagtcttgc 3480cctctagtat tctcaggttt gttcttttct
cagcagttgg agacaagtgc tatggagccc 3540caggaataat tatggggact
tgcgttctgc agacttgcta gaccctcctg tccgaactag 3600gatcagggga
gcatgtgtgg tggctcacac ctgtaatccc agcactcagg agactgaggc
3660aggaggatta ccatgagatc gagggcaccc tcagctcaca tagtgacttt
gaggccagcc 3720tggactacat agcgagactc ttgtctccaa aagaaaaaaa
aagaaagaat aaaagaacag 3780gggtctgagt tcgtccagta cctagcctgt
gtgatgtgag agaaaagact gtgatgcctc 3840ttggcactgg cttggatcct
ttcccccaca caggtaccca tctcaggtgt ttgtgggaga 3900caccttctgt
tactttgctg gcatgacctt tgccgtggta ggcatcttgg gacacttcag
3960caagaccatg ctgctcttct tcatgccaca ggtgttcaac ttcctctact
cgctgcctca 4020gctcctgcat atcatcccct gtcctcgcca ccgtataccc
aggtagctgt ttgggggctg 4080gaaagccttt ctactgggat gtctaacacc
aggctctaca tttgctgtgc aaagaatgtg 4140ggcccatagg aaggctaact
tttttcatgt aggtggccct ttaagtttac acagcacgtt 4200tacttccata
atctcattta atactcacag tagttctgat catagagtag taagcagcag
4260agccagaaat agatctcact ccatgatcag tgtttttctt agtcattaac
ggaagaaagt 4320tttttgagta gtgacccagt cacacgaagc tgtctttccc
ctacagactc aataccaaga 4380caggcaaact ggagatgagc tattccaagt
tcaagaccaa cagcctttct ttcttgggca 4440cctttatttt aaaggtaaca
aggtaacgag gaggtaaggc cccaggccac catcctgaac 4500ttgggacatg
ggggacccag gcctacatta gatctagagg gagcttggaa gcattaagca
4560gagccctgtt cctgacatac aggtattggc tgaagttttt ctgtctgtct
ctggtctctc 4620taggtagcag agagactcca gctagtgaca gtgcaccgga
gtgagggtga ggacggggcc 4680ttcactgagt gtaacaacat gaccctcatc
aacttgctgc ttaaaatctt tgggcccata 4740catgagagga acctcacatt
gctcttgctg ctgctacagg tgagcctggg gtgagtttgt 4800gcctcctcat
gtccttttct ctatggttct tattctagtc catttctcct tgcagatcgt
4860gggcagtgct gtcaccttct ccattcgata ccagcttgtc cgactcttct
atgacgtttg 4920agttcctgaa gattgccctc tgccacactg tctccagggg
tcctgctcag gccagccagt 4980ctggttctgt gggcctctcc caatcttcag
tctccttcag atttattccc agcatttttc 5040ataacctatg attatcaaca
tcctgagcca tttttgccct ccagcaacta ctaactggac 5100tttgcctatg
gcctccttca acttgccact ctccctaccc atcacagcca gaggcttgat
5160gtagcagctt ttatgcagat atccacaact cagctttcag agtcctcact
ctcaaagaac 5220atgctgggcc ttgagataga acctgagcta gggctaggga
cactggtgca agggtgattt 5280gatatttgat tataaattaa gtgttctgat
tagtaagaca gaaggggagc ctggtgctcc 5340caacggtgac aataaagtgt
tacctttttc ttgt 53741860PRTMus musculus 18Met Trp Ala Phe Pro Glu
Leu Pro Leu Pro Leu Pro Leu Leu Val Asn1 5 10 15Leu Ile Gly Ser Leu
Leu Gly Phe Val Ala Thr Val Thr Leu Ile Pro 20 25 30Ala Phe Arg Ser
His Phe Ile Ala Ala Arg Leu Cys Gly Gln Asp Leu 35 40 45Asn Lys Leu
Ser Gln Gln Gln Ile Pro Glu Ser Gln 50 55 601958PRTCricetulus
griseus 19Met Trp Ala Phe Pro Glu Leu Pro Leu Pro Leu Leu Val Asn
Leu Phe1 5 10 15Gly Ser Leu Leu Gly Phe Val Ala Thr Val Thr Leu Ile
Pro Ala Phe 20 25 30Arg Ser His Phe Ile Ala Ala Arg Leu Cys Gly Gln
Asp Leu Asn Lys 35 40 45Leu Ser Arg Gln Gln Ile Pro Glu Ser Gln 50
55
* * * * *