U.S. patent application number 17/319250 was filed with the patent office on 2021-11-04 for flagellin compositions and uses.
The applicant listed for this patent is Genome Protection, Inc.. Invention is credited to Vadim METT.
Application Number | 20210340190 17/319250 |
Document ID | / |
Family ID | 1000005712222 |
Filed Date | 2021-11-04 |
United States Patent
Application |
20210340190 |
Kind Code |
A1 |
METT; Vadim |
November 4, 2021 |
FLAGELLIN COMPOSITIONS AND USES
Abstract
The present invention relates to compositions comprising
improved flagellin derived constructs and methods of using the same
in the treatment of various diseases.
Inventors: |
METT; Vadim; (Buffalo,
NY) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Genome Protection, Inc. |
Buffalo |
NY |
US |
|
|
Family ID: |
1000005712222 |
Appl. No.: |
17/319250 |
Filed: |
May 13, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16802859 |
Feb 27, 2020 |
11034733 |
|
|
17319250 |
|
|
|
|
16226909 |
Dec 20, 2018 |
10669316 |
|
|
16802859 |
|
|
|
|
15329870 |
Oct 9, 2017 |
10202426 |
|
|
PCT/US2015/042684 |
Jul 29, 2015 |
|
|
|
16226909 |
|
|
|
|
62117366 |
Feb 17, 2015 |
|
|
|
62110744 |
Feb 2, 2015 |
|
|
|
62031116 |
Jul 30, 2014 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/55594
20130101; A61K 39/02 20130101; A61K 38/164 20130101; A61K
2039/55516 20130101; A61K 39/0013 20130101; C07K 2319/21 20130101;
Y02A 50/30 20180101; A61K 39/39 20130101; C07K 14/195 20130101;
A61K 2039/57 20130101; A61K 2039/55583 20130101; C07K 2319/00
20130101; A61K 2039/55505 20130101; A61K 2039/575 20130101; A61K
45/06 20130101 |
International
Class: |
C07K 14/195 20060101
C07K014/195; A61K 38/16 20060101 A61K038/16; A61K 39/39 20060101
A61K039/39; A61K 39/00 20060101 A61K039/00; A61K 39/02 20060101
A61K039/02; A61K 45/06 20060101 A61K045/06 |
Claims
1-60. (canceled)
61. A composition comprising a polypeptide having an amino acid
sequence that is about 95% identical to SEQ ID NO: 137.
62. The composition of claim 61, the composition comprising a
polypeptide having an amino acid sequence that is about 98%
sequence identical to SEQ ID NO: 137.
63. The composition of claim 61, the composition comprising a
polypeptide having an amino acid sequence that is about 99%
sequence identical to SEQ ID NO: 137.
64. The composition of claim 61, the composition comprising a
polypeptide having an amino acid sequence that is SEQ ID NO:
137.
65. A pharmaceutical composition, the pharmaceutical composition
comprising a polypeptide having the amino acid sequence of SEQ ID
NO: 137, and a pharmaceutically acceptable carrier.
66. The composition of claim 61, wherein the composition has
reduced antigenicity and immunogenicity as compared to the
polypeptide SEQ ID NO: 2.
67. The composition of claim 61, wherein the composition
demonstrates improved pharmacokinetics as compared to the
polypeptide SEQ ID NO: 2.
68. The composition of claim 61, wherein the composition activates
TLR5 signaling at a level the same as, or similar to, that of the
polypeptide SEQ ID NO: 2.
69. The composition of claim 61, wherein the polypeptide further
comprises a N-terminal tag.
70. The composition of claim 61, wherein the polypeptide further
comprises a C-terminal tag.
71. The composition of claim 61, wherein the composition induces
NF-.kappa.B mediated expression of one or more of the cytokines
selected from IL-6, IL-12, keratinocyte chemoattractant (KC),
IL-10, G-CSF, MCP-1, TNF-.alpha., MIG, and MIP-2.
72. A pharmaceutical composition comprising the composition of
claim 61 and a pharmaceutically acceptable carrier.
73. A method of stimulating TLR5 signaling comprising administering
to a subject in need thereof a composition comprising a polypeptide
having an amino acid sequence that is about 95% sequence identical
to SEQ ID NO: 137.
74. The method of claim 73, wherein the subject suffers from
radiation-induced cellular damage.
75. The method of claim 73, wherein the subject has been subjected
to a lethal dose of radiation.
76. The method of claim 73, wherein the subject is undergoing
radiation treatment.
77. The method of claim 73, wherein the composition has reduced
antigenicity and immunogenicity as compared to the polypeptide SEQ
ID NO: 2.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation application of U.S.
patent application Ser. No. 16/802,859 (now U.S. Pat. No.
11,034,733), filed on Feb. 27, 2020, which is a continuation
application of U.S. patent application Ser. No. 16/226,909 (now
U.S. Pat. No. 10,669,316), filed on Dec. 20, 2018, which is a
continuation application of U.S. patent application Ser. No.
15/329,870 (now U.S. Pat. No. 10,202,426), filed on Oct. 9, 2017,
which is a 371 national stage entry of International Application
No. PCT/US2015/042684, filed on Jul. 29, 2015, which claims the
benefit of U.S. Provisional Patent Application Nos. 62/031,116,
filed Jul. 30, 2014; 62/110,744, filed Feb. 2, 2015; and
62/117,366, filed Feb. 17, 2015 the entire contents of which are
herein incorporated by reference.
FIELD OF THE INVENTION
[0002] This invention relates to methods and compositions that are
useful for the treatment, prevention, and/or diagnosis, of various
diseases, including cancer and radiation-related ailments.
DESCRIPTION OF THE TEXT FILE SUBMITTED ELECTRONICALLY
[0003] The contents of the text file submitted electronically
herewith are incorporated herein by reference in their entirety: A
computer readable format copy of the Sequence Listing (filename:
CLE-016PC-SequenceListing.txt; date recorded: Jul. 28, 2015; file
size: 245 KB).
BACKGROUND
[0004] Toll-like receptors (TLRs) are type I membrane glycoproteins
that are key receptors in innate immunity. The 10 TLRs known in
humans recognize different microbial antigens, and when activated
by ligand binding, mediate rapid production of cytokines and
chemokines. In addition to their role in host defense, TLRs play a
role in cancer progression and development and cell protection.
[0005] TLR5 binds flagellin, a globular protein that arranges
itself in a hollow cylinder to form the filament in bacterial
flagella. Binding of flagellin to TLR5 initiates a cascade of
pro-inflammatory molecules, notably NF-.kappa.B and its targets.
TLR5 agonists derived from flagellin have been developed as
therapies various diseases. However, these molecules may suffer
from specific limitations, including for example, unsatisfactory
binding and signaling. Additionally, many possible hosts already
produce anti-flagellin antibodies that also target the TLR5 agonist
derivatives, thereby clearing the therapeutics from the body and
limiting their efficacy. Moreover, as intrinsically immunogenic
bacterial proteins flagellin derivatives may possess
disadvantageous antigenicity and immunogenicity, and therefore
warrant improvement.
SUMMARY OF THE INVENTION
[0006] Accordingly, the present invention provides
flagellin-related compositions and methods that overcome
limitations observed among this group of biologies.
[0007] The present invention is based, in part, of the discovery
that minimized constructs of flagellin-related compositions can
exhibit reduced immunogenicity and improve pharmacokinetics while
still retaining the ability to active TLR5 signaling.
[0008] In one aspect, the invention provides a flagellin-related
composition that retains the ability to activate TLR5 signaling. In
a further embodiment, the flagellin-related composition comprises
mutations that decrease the antigenicity and immunogenicity of the
construct. In a further embodiment, the flagellin-related
composition is not recognized by flagellin (FliC) neutralizing
antibodies. In yet a further embodiment, the flagellin-related
composition activates TLR5 signaling at a level the same as or
similar to that of a full-length flagellin-related composition. In
a further embodiment, the flagellin-related composition
demonstrates improved pharmacokinetics compared with a full length
flagellin-related composition. In yet a further embodiment, the
flagellin-related composition demonstrates increased retention in
the host.
[0009] In some embodiments, the flagellin-related composition is
derived from CBLB502 (SEQ ID NO: 2). In a further embodiment, the
flagellin-related composition comprises a truncation in one or more
domains. In a further embodiment, the flagellin-related composition
comprises a deletion in a N-terminal domain. In yet a further
embodiment, the flagellin-related composition comprises a deletion
in the ND0 domain. In yet a further embodiment, the
flagellin-related composition comprises a deletion of the entire
ND0 domain. In a further embodiment, the flagellin-related
composition comprises a deletion in a C-terminal domain. In yet
another embodiment, the flagellin-related composition comprises a
deletion in the CD0 domain. In yet another embodiment, the
flagellin-related composition retains amino acids 470-485 of the
CD0 domain. In yet a further embodiment, the flagellin-related
composition is CBLB502-S33 (SEQ ID NO: 17).
[0010] In some embodiments, the flagellin-related composition
comprises mutations in epitopes recognized by neutralizing
anti-CBLB502 antibodies. In some embodiments, the flagellin-related
composition comprises one or more mutations in the epitopes
recognized by neutralizing anti-CBLB502 antibodies which inhibit
the ability of the antibodies to neutralize the composition. In yet
a further embodiment, the flagellin-related composition comprises a
truncation and mutations in one or more epitopes recognized by
anti-CBLB502 neutralizing antibodies. In a further embodiment, the
mutations comprise replacement of the epitope residues with
alanine. In a further embodiment, the mutations are selected from
one or more of D42A, A45G, N68A, N100A, T102A, S104A, S106A, D107A,
S110A, D113A, Q117A, E120A, R124A, N127A, Q128A, F131A, N132A,
G133A, Q142A, K144A, D151A, G152A, E153A, T154A, Q439A, N440A,
R441A, D443A, S444A, T447A, N448A, N451A, N455A, N457A, R460A,
Y468A; A469G; T470A; S473A, and N474Q. In a further embodiment, the
mutated epitopes comprise one or more of the following residues:
E153, S444, T154, N440, Q142, F131, D443, N68, T447, S110, Q117,
R124, D113, E120, N127, and Q128. In a further embodiment, the
flagellin-related composition is CBLB502-S33MX/"CBLB543" (SEQ ID
NO: 150). In yet a further embodiment, the flagellin-related
composition is CBLB502-485CT/"BCLB533" (SEQ ID NO: 71).
[0011] In some embodiments, the flagellin-related composition
comprises a tag. In yet a further embodiment, the tag is attached
to the N-terminus of the flagellin-related composition. In yet
another embodiment, the tag is attached to the C-terminus of the
flagellin-related composition.
[0012] In some embodiments, the flagellin-related composition
comprises a flexible linker. In a further embodiment, the flexible
linker comprises SEQ ID NO: 16. In yet a further embodiment, the
flexible linker comprises SEQ ID NO: 242.
[0013] In some embodiments, the flagellin-related composition is
encoded by any one of the nucleotide sequences listed in Table 1.
In a further embodiment, the flagellin-related composition
comprises any one of the polypeptides listed in Table 1.
[0014] In some embodiments, the flagellin-related composition
activates TLR5 signaling. In a further embodiment, the
flagellin-related composition induces expression of NF-.kappa.B. In
yet a further embodiment, the minimized flagellin-related
composition induces expression of one or more of cytokines. In yet
a further embodiment, the cytokines are selected from IL-6, IL-12,
keratinocyte chemoattractant (KC), IL-10, G-CSF, MCP-1,
TNF-.alpha., MIG, and MIP-2.
[0015] In one aspect, the invention provides a pharmaceutical
composition comprising the flagellin-related composition of the
invention with a pharmaceutically accepted carrier.
[0016] In one aspect, the invention provides a method of
stimulating TLR5 signaling comprising administering a
flagellin-related composition of the invention to a subject in need
thereof. In some embodiments, the subject has cancer. In a further
embodiment, the tumor expresses TLR5. In a further embodiment, the
tumor does not express TLR5. In yet a further embodiment, the
cancer is selected from breast cancer, lung cancer, colon cancer,
kidney cancer, liver cancer, ovarian cancer, prostate cancer,
testicular cancer, genitourinary tract cancer, lymphatic system
cancer, rectal cancer, pancreatic cancer, esophageal cancer,
stomach cancer, cervical cancer, thyroid cancer, skin cancer,
leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia,
B-cell lymphoma, T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's
lymphoma, hairy cell lymphoma, histiocytic lymphoma, and Burkett's
lymphoma, acute and chronic myelogenous leukemias, myelodysplastic
syndrome, myeloid leukemia, promyelocytic leukemia, astrocytoma,
neuroblastoma, glioma, schwannomas, fibrosarcoma, rhabdomyosarcoma,
osteosarcoma, xenoderoma pigmentosum, keratoctanthoma, seminoma,
thyroid follicular cancer, teratocarcinoma, and cancers of the
gastrointestinal tract or the abdominopelvic cavity.
[0017] In some embodiments, the subject suffers from
radiation-induced damage. In a further embodiment, the subject has
been subjected to a lethal dose of radiation. In yet a further
embodiment, the subject is undergoing radiation treatment. In
another embodiment, the flagellin-related composition is
administered prior to exposure to radiation. In yet another
embodiment, the flagellin-related composition is administered
during exposure to radiation. In yet another embodiment, the
flagellin-related composition is administered after exposure to
radiation.
[0018] In some embodiments, the subject suffers from reperfusion
injury. In a further embodiment the reperfusion is caused by an
injury. In a further embodiment, the injury is ischemia or hypoxia.
In a further embodiment, the flagellin-related composition is
administered prior to the influx of oxygen. In a further
embodiment, the flagellin-related composition is administered
during the influx of oxygen. In a further embodiment, the
flagellin-related composition is administered after the influx of
oxygen.
[0019] In various embodiments, the flagellin-related composition is
administered in conjunction with other therapeutics and/or
treatments. In a further embodiment, the flagellin-related
composition is administered in conjunction with chemotherapy. In a
further embodiment, the flagellin-related composition is
administered with radiation treatment. In a further embodiment, the
flagellin-related composition is administered in conjunction with
an antioxidant. In a further embodiment, the flagellin-related
composition is administered in conjunction with amifostine and/or
vitamin E. In some embodiments, the flagellin-related composition
is administered prior to administration of other therapeutics
and/or treatments. In further embodiments, the flagellin-related
composition is administered at the same time as other therapeutics
and/or treatments. In yet further embodiments, the
flagellin-related composition is administered after administration
of other therapeutics and/or treatments.
[0020] In one aspect, the invention provides a method of treating
cancer comprising administering a flagellin-related composition of
the invention to a subject in need thereof.
[0021] In one aspect, the invention provides a method of treating
radiation-induced damage comprising administering a
flagellin-related composition of the invention to a subject in need
thereof.
[0022] In one aspect, the invention provides a method of treating
reperfusion injury comprising administering a flagellin-related
composition of the invention to a subject in need thereof.
[0023] The details of the invention are set forth in the
accompanying description below. Although methods and materials
similar or equivalent to those described herein can be used in the
practice or testing of the present invention, illustrative methods
and materials are now described. Other features, objects, and
advantages of the invention will be apparent from the description
and from the claims. In the specification and the appended claims,
the singular forms also include the plural unless the context
clearly dictates otherwise. Unless defined otherwise, all technical
and scientific terms used herein have the same meaning as commonly
understood by one of ordinary skill in the art to which this
invention belongs.
BRIEF DESCRIPTION OF THE FIGURES
[0024] FIGS. 1A and 1B show the 13 conserved amino acids of
flagellin that may be important for TLR5 activity. FIGS. 1A and 1B
show a comparison of amino acid sequences of the conserved amino
(FIG. 1A) and carboxy (FIG. 1B) terminus from 21 species of
bacteria. The 13 conserved amine acids important for TLR5 activity
are shown with shading. The amino acid sequences are identified by
their accession numbers from TrEMBL (first letter=Q) or Swiss-Prot
(first letter=P).
[0025] FIG. 2 shows early structure-activity relationship analysis
(SAR) data reflecting the contribution of individual segments and
entire domains of CBLB502 to the efficiency of binding and
signaling. Relative binding and signaling affinities were obtained
using FP biochemical assay and cell-based reporter assay
respectively and normalized to CBLB502. Analyses were performed for
a series of mutations within predicted primary and secondary
dimerization interfaces (A) as well as for a deletion of larger
segments or entire domains D0 or D1 (B) as diagrammatically shown
above the graph.
[0026] FIG. 3 shows the structural regions involved in interactions
between TLR5 ectodomain and CBLB502 (FliC) domain D1. Note a
contribution of loops LRR7 and 9 (characteristic of TLR5 family) to
high-affinity primary interactions.
[0027] FIG. 4, panels A-E show the signaling efficiency of CBLB502
mutants in NF-.kappa.B luciferase reporter mice. The graphs show
the NF-.kappa.B luciferase activity in reporter mice after
subcutaneous administration of the (A) CBLB502, (B) DIM2, (C) DIM
1, (D) PIM, and (E) SY3 constructs. The activity was measured in
the mouse liver, spleen, large intestine, and bladder.
[0028] FIG. 5 shows the iterative minimization of the
flagellin-related composition, CBLB502. The constructs S33 and 33ML
retain nearly full signaling activity in vitro. The schematic shows
domain organization including spacer and tag.
[0029] FIG. 6 panels A and B show that a minimized variant
CBLB502-S33 shows substantially higher signaling activity in vivo
compared to CBLB502. NF-kB-luciferase reporter mice were injected
(s.c) with 0.1 .mu.g of CBLB502 (A) or S33 (B) and imaged 3 hours
later. The measurements in individual organs are illustrated in
FIG. 4.
[0030] FIG. 7 panels A-H show that a minimized variant CBLB502-S33
shows substantially higher signaling activity in vivo compared to
CBLB502, and the effect was particularly strong in bladder and
large intestine. Signaling efficiency of the CBLB502 and
CBLB502-S33 in NF-kB luciferase reporter mice (s.c. injection at
indicated doses and collection of organs 3 hours later) was
established by the analysis of luciferase activity in collected
organs.
[0031] FIG. 8 panels A and B show that a minimized variant
CBLB502-S33 shows higher potency in protection against lethal
irradiation in mice, as compared to CBLB502. Panel A. Kaplan-Meyer
plot showing survival dynamics in C57/BL6 mice injected with
CBLB502 or CBLB502-S33, 30 min prior to total body irradiation at
9.5 Gy (compared with vehicle control. Panel B. Dose dependence for
the 30-day % survival.
[0032] FIG. 9 shows the higher signaling and radioprotective
activity of CBLB502-S33 correlates with higher cytokine production
(PD analysis) in mice compared to CBLB502, including
mechanistically essential biomarkers G-CSF and IL-6. Mice were
injected with either 1 .mu.g/kg or 2 .mu.g/kg of CBLB502 or
S33.
[0033] FIG. 10 shows that the minimized variant CBLB502-S33
displays better PK (higher levels in plasma) in mice compared to
CBLB502.
[0034] FIG. 11 shows the suppression of luciferase activity in
murine liver lysates as a measurement of the in vivo neutralization
of CBLB502 by injection of antisera and antibodies (neutralizing
and not neutralizing) in reporter mice (3 mice/group). PBS,
non-neutralizing human serum, neutralizing serum (D15), the
non-neutralizing monoclonal antibody 7C, or the neutralizing
monoclonal antibody 11D were administered to the mice
intravenously. An hour after, the CBLB502 construct was
administered subcutaneously. The amount of luciferase activity was
measured three hours after administration of CBLB502. Murine serum
samples were collected before administration of CBLB502. Human sera
were diluted 10-fold with PBS for injections. Both monoclonal
antibodies, 7C and 11D were injected at a concentration of 2 mg/ml
in PBS.
[0035] FIG. 12 panels A and B show schematic diagrams of the
constructs (A) 445 (SEQ ID NO: 54) and (B) 467 (SEQ ID NO: 62).
[0036] FIG. 13 panels A-C show examples of predicted, without
wishing to be bound by theory, structural epitopes used for the
design of CBLB502 derivatives.
[0037] FIG. 14 shows that the construct CBLB502-33MX demonstrates
substantial elimination of neutralizing antigenicity. The graph
shows a profile of CBLB502-33MX versus CBLB502 and its truncated
variant CBLB502-ML over a panel of human sera with the appreciable
titer of CBLB502-neutralizing antibodies.
[0038] FIG. 15 shows quantification of CBLB502 and CBLB502-33MX in
mouse plasma samples. BLQ--below the limit of quantification. Panel
A shows raw data while panel B shows a graphical representation of
the data in panel A. CBLB502-33MX has very similar PK properties as
that of parental CBLB502, i.e. it clears from circulation at
approximately the same rate.
[0039] FIG. 16 shows cytokine profiling for the analysis of PD
properties of CBLB502-33MX as compared to CBLB502. CBLB502-33MX has
a very similar PD profile to the parental CBLB502
[0040] FIG. 17 shows luciferase activity in mouse organs after
treatment with CBLB502, CBLB502-S33 and CBLB502-33MX.
[0041] FIG. 18 shows injury scores for a 33MX dose range as
compared to a dose of CBLB502
DETAILED DESCRIPTION OF THE INVENTION
[0042] The present invention is based, in part, on the discovery of
certain mutations of flagellin that improve pharmacologically
relevant properties of this biologic and related agents. Such
mutations yield various flagellin-related compositions that, by way
of non-limiting example, have altered antigenicity and
immunogenicity relative to those without the mutations. The
flagellin-related compositions retain the ability to active TLR5
signaling at levels the same as, or similar to, that of a full
length flagellin-related composition.
Flagellin-Related Compositions
[0043] The present invention is based, in part, of the discovery
that minimized constructs of flagellin-related compositions can
exhibit reduced immunogenicity while still retaining the ability to
active TLR5 signaling at levels the same as, or similar to, that of
a full length flagellin-related composition. The reduced
immunogenicity allows the construct to persist in the host longer
than full length flagellin-related compositions. It is possible to
eliminate at least half of the endogenous C_D0 segment, leaving
only its N-terminal half (470-485) capped by the C-terminal His-tag
and still retain most of the molecule's ability to activate TLR5
signaling. The presence of the cap may be essential for activity as
the variant 33-485 loses about 90% of signaling activity. These
observations taken together suggest that the D_0 domain has only
minor (if any) contribution to direct interactions with TLR5, and
its role may be limited by maintaining structural integrity of the
D1 domain. Conversely, the residual C_D0 segment (470-485) cannot
be removed or replaced by the C-terminal half of C_D0 (485-504) or
other sequences.
[0044] In various embodiments, the present invention provides
flagellin-related compositions. In some embodiments, the present
invention provides for flagellin-related compositions that have (1)
improved pharmacological properties, including reduced antigenicity
and immunogenicity, which, for example, allow for use in wide
variety of disease states and patient types and/or (2) improved
functional properties which, for example, allow for improved
medical effects.
[0045] The flagellin-related compositions may be a
flagellin-related polypeptide. The flagellin-related compositions
may be from various sources, including a variety of Gram-positive
and Gram-negative bacterial species. In some embodiments, the
flagellin-related compositions may have an amino acid sequence that
is derived from any of the flagellins from bacterial species that
are depicted in FIG. 7 of U.S. Patent Publication No. 2003/0044429,
the contents of which are incorporated herein by reference in their
entirety. The flagellin-related compositions may have nucleotide
sequences related to those encoding the flagellin polypeptides
listed in FIG. 7 of U.S. 2003/0044429, which are publicly available
at sources including the NCBI Genbank database.
[0046] The flagellin-related compositions may be the major
component of bacterial flagellum. The flagellin-related
compositions may be composed of one, or two, or three, or four, or
five, or six, or seven domains or fragments thereof (see, e.g. FIG.
10 of U.S. Pat. No. 8,324,163, the contents of which are
incorporated herein by reference in their entirety). The domains
may be selected from ND0, ND1, ND2, D3, CD2, CD1, and CD0. Domains
0 (D0), 1 (D1), and 2 (D2) may be discontinuous and may be formed
when residues in the amino terminus and carboxy terminus are
juxtaposed by the formation of a hairpin structure. The amino and
carboxy terminus comprising the D1 and D2 domains may be most
conserved, whereas the middle hypervariable domain (D3) may be
highly variable. The non-conserved D3 domain may be on the surface
of the flagellar filament and may contain the major antigenic
epitopes. The potent proinflammatory activity of flagellin may
reside in the highly conserved ND1, ND2, CD1, and CD2 regions.
[0047] The flagellin-related compositions may be from a species of
Salmonella, representative examples of which are S. typhimurium and
S. dublin (encoded by GenBank Accession Number M84972). The
flagellin related-polypeptide may be a fragment, variant, analog,
homolog, or derivative of wild type flagellin (SEQ ID NO: 1), or
combination thereof. A fragment, variant, analog, homolog, or
derivative of flagellin may be obtained by rational-based design
based on the domain structure of flagellin and the conserved
structure recognized by TLR5.
[0048] The flagellin-related compositions may be related to a
flagellin polypeptide from any Gram-positive or Gram-negative
bacterial species including, but not limited to, the flagellin
polypeptides disclosed in U.S. Pat. Pub. 2003/000044429, the
contents of which are incorporated herein, and the flagellin
peptides corresponding to the Accession numbers listed in the BLAST
results shown in FIG. 7 (panels A-F) of U.S. Patent Pub.
2003/000044429, or variants thereof.
[0049] Flagellin and previously described variants suffer from high
antigenicity and immunogenicity in large part, without wishing to
be bound by theory, because they are intrinsically immunogenic
bacterial proteins (e.g. flagellin or "FliC"). A practical
limitation in preexisting flagellin constructs is that many
subjects have high titers of pre-existing antibodies capable of
neutralizing the TLR5-stimulating activity of these constructs.
These individuals would be desensitized (or completely resistant)
to flagellin-derived treatment, sometimes even in case of
single-injections and, without wishing to be bound by theory, more
likely upon recurrent treatment. Moreover, the titer of such
pre-existing antibodies, even if initially present at lower levels,
may be rapidly boosted by a single flagellin-derived injection
thereby compromising even a larger group of individuals for the
purpose of multi-dose regimen as projected for medical
applications. The widespread preexistence of anti-FliC antibodies
(including neutralizing Abs) in a population likely reflects
humanity's life-long exposure to numerous species of flagellated
enterobacteria (e.g. Salmonella spp., E. coli) colonizing (and
infecting) the human body. In some embodiments, the presently
described flagellin-related compositions comprise alterations of
epitopes for various antibodies that neutralize flagellin
activity.
[0050] In some embodiments, the flagellin-related composition
comprises mutations in epitopes recognized by neutralizing
anti-CBLB502 antibodies. The flagellin-related composition may
comprise one or more mutations in the epitopes recognized by
neutralizing anti-CBLB502 antibodies which inhibit or abrogate the
ability of the antibodies to neutralize the composition. In yet a
further embodiment, the flagellin-related composition comprises a
truncation and mutations in one or more epitopes. In a further
embodiment, the mutations comprise replacement of the epitope
residues with alanine. In a further embodiment, the mutated
epitopes comprise one or more of the following residues: E153,
S444, T154, N440, Q142, F131, D443, N68, T447, S110, Q117, R124,
D113, E120, N127, and Q128.
[0051] The flagellin-related compositions may comprise insertions,
deletions, transposon insertions, and changes to any one of the D0,
D1, D2, and the variable D3 domains. The D3 domain may be
substituted in part, or in whole, with a hinge or linker
polypeptide that allows the D1 and D2 domains to properly fold such
that the variant stimulates TLR5 activity.
[0052] In some embodiments, the present invention relates to the
development of a minimal functional core of a flagellin, for
example, deleting residues relative to the already shortened
CBLB502 molecule. In some embodiments, the present invention
relates to the development of a flagellin-related composition that
has altered amino acid identity relative to wild type, including
deletions, additions and substitutions, that provide for improved
activity. In some embodiments, the flagellin-related composition is
derived from CBLB502 (SEQ ID NO: 2). In some embodiments, the
flagellin-related composition comprises a truncation in one or more
domains. In a further embodiment, the flagellin-related composition
comprises a deletion in a N-terminal domain. In yet a further
embodiment, the flagellin-related composition comprises a deletion
in the ND0 domain. In yet a further embodiment, the
flagellin-related composition comprises a deletion of the entire
ND0 domain. In a further embodiment, the flagellin-related
composition comprises a deletion in a C-terminal domain. In yet
another embodiment, the flagellin-related composition comprises a
deletion in the CD0 domain. In yet another embodiment, the
flagellin-related composition retains amino acids 470-485 of the
CD0 domain. In yet a further embodiment, the minimized
flagellin-related composition is CBLB502-S33 (SEQ ID NO: 17).
[0053] The flagellin-related compositions may comprise at least 10,
11, 12, or 13 of the 13 conserved amino acids shown in FIG. 1A and
FIG. 1B (positions 89, 90, 91, 95, 98, 101, 115, 422, 423, 426,
431, 436 and 452). The flagellin-related compositions may be at
least 30-99% identical to amino acids 1-174 and 418-505 of SEQ ID
NO: 1.
[0054] In some embodiments, the flagellin-related compositions have
improved functional and pharmacological properties which, for
example, allow for improved medical effects. In some embodiments,
the flagellin-related compositions have improved NF-kB activation
and radioprotection relative to CBLB502. In some embodiments, the
flagellin-related compositions have improved pharmacokinetics
leading to a proportionally stronger pharmacodynamic response (as
detected by, for example, cytokine assays).
[0055] In some embodiments, the flagellin-related compositions have
improved pharmacological properties, including reduced antigenicity
and immunogenicity, which, for example, allows for use in wide
variety of disease states and patient types. A reduced antigenicity
and immunogenicity expands the medical applications for which the
flagellin-related compositions of the invention can be used
including, for example, medical applications requiring recurrent
administration. In some embodiments, the decreased antigenicity
translates to improved resistance against the neutralizing action
of preexisting human antibodies (e.g. anti-flagellin) as well as
those induced in response to CBLB502 injection. In further
embodiments, the flagellin-related compositions have longer
retention times in vivo. A longer retention time may allow the
composition to be effective with fewer doses or with doses spaced
further apart.
[0056] In some embodiments, the flagellin-related composition
comprises a tag. In yet a further embodiment, the tag is attached
to the N-terminus of the flagellin-related composition. In yet
another embodiment, the tag is attached to the C-terminus of the
flagellin-related composition.
[0057] In some embodiments, the flagellin-related composition
comprises a flexible linker. In a further embodiment, the flexible
linker comprises SEQ ID NO: 16. In yet a further embodiment, the
flexible linker comprises SEQ ID NO: 242.
[0058] In some embodiments, the flagellin-related compositions
comprise or consist of any of the polypeptides or nucleic acids
encoding said polypeptides listed in Table 1. In some embodiments,
the flagellin-related composition is encoded by the nucleotide
sequences listed in Table 1. In a further embodiment, the
flagellin-related composition comprises the polypeptides listed in
Table 1. In some embodiments, the flagellin-related compositions
comprise or consist of polypeptides encoded by either SEQ ID NOs:
69 or 70. In some embodiments, the flagellin-related compositions
comprise or consist of the polypeptides of SEQ ID NO: 71,
"CBLB543". In some embodiments, the flagellin-related compositions
comprise or consist of polypeptides encoded by either SEQ ID NOs:
149 or 151. In some embodiments, the flagellin-related compositions
comprise or consist of the polypeptides of SEQ ID NO: 150,
"CBLB533". In some embodiments, the flagellin-related compositions
may be at least 30-99% identical to the sequences listed in Table
1, for instance, about 50%, or about 60%, or about 70%, or about
805, or about 90%, or about 95%, or about 97%, or about 98%, or
about 99%, or about 100% identical to the sequences listed in Table
1.
TABLE-US-00001 TABLE 1 Illustrative Flagellin Compositions SEQ DNA/
ID Construct Name PRT Species Sequence 0001 Wild type PRT
Salmonella
MAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRN
dublin
ANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQ-
FNG
VKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNGPKEATVGDLKSSFKNVTGYDTYAA
GADKYRVDINSGAVVTDAAAPDKVYVNAANGQLTTDDAENNTAVDLFKTTKSTAGTAEAKAIAGAIK
GGKEGDTFDYKGVTFTIDTKTGDDGNGKVSTTINGEKVTLTVADIATGAADVNAATLQSSKNVYTSV
VNGQFTFDDKTKNESAKLSDLEANNAVKGESKITVNGAEYTANATGDKITLAGKTMFIDKTASGVST
LINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADY
ATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0002 CBLB502 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSS
Sequence
GLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATN
GTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSL
GLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFD
SAITNLGNTVTNLNSARSRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0003
T7 Promoter DNA Artificial TAATACGACTCACTATAGGGG (forward) Sequence
0004 FliC AA74-80 DNA Artificial ATTGCGCAGACCACTGAAGG (forward)
Sequence 0005 Thrombin PRT Artificial LVPRGS cleavage site Sequence
0006 Enterokinase Artificial DDDDK cleavage site Sequence 0007 NS
(N-terminal PRT Artificial SSGLRINSAKDDA spoke region; Sequence
Ser32-Ala44) 0008 CS (C-terminal PRT Artificial EDADYA spoke
region; Sequence Glu464 to Ala469) 0009 linker PRT Artificial
AASAGAGQGGGGSG Sequence 0010 linker PRT Artificial EGKSSGSGSESKST
Sequence 0011 linker PRT Artificial GGGRTSSSAASAGAGQGGGGSG Sequence
0012 linker PRT Artificial GPSG Sequence 0013 linker PRT Artificial
GSAGSAAGSGEF Sequence 0014 linker PRT Artificial GSPG Sequence 0015
linker PRT Artificial KESGSVSSEQLAQFRSLD Sequence 0016 linker PRT
Artificial SPGISGGGGGILDSMG Sequence 0017 Mutant 33-485 PRT
Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPSGLRINSAKDDAAGQAIANRFTSNIKGLTQ
Mutant S33 Sequence
ASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQT
QFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINE
DAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEV
SNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0018 Mutant 33-485 DNA Artificial
GCAGATTCTGCAGCAGGCTGGTTGATAATCTGGCGCAGGCTAACCAGG Forward Primer
Sequence CBLB485 0019 Mutant 33-485 DNA Artificial
TCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTT 502
template Sequence sequence 0020 Mutant 33-485 DNA Artificial
CCTGGTTAGCCTGCGCCAGATTATCAACCAGCCTGCTGCAGAATCTGC Reverse Primer
Sequence CBLB485 0021 Mutant 33-485 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
of 485 Mutant
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGTCT
(T7 Promoter
GGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTA
to Stop)
ATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGA
AGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAAC
GGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCG
ATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAAT
CCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTT
GGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCA
TGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAAT
TGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGAT
TCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATG
CTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTTGATAA
0022 Mutant 33-485 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPSGLRINSAKDDAAGQAIANRFTSNIKGLTQ
Expressed Sequence
ASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQT
Mutant 33-485
QFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINE
DAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEV
SNMSKAQILQQAG 0023 Mutant 45CT PRT Artificial
MAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRN
Mutant 506T Sequence
ANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNG
VKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAA
AKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEVSNMS
KAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDP 0024
Mutant 45CT DNA Artificial
ATGGCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGT
Mutant 506T Sequence
CCTCACTGAGTTCCGCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGC
GGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAAC
GCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGC
AGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTAT
CCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGT
GTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTA
CCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGG
AATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCA
GCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTC
GTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAAC
CAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCT
AAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACG
TCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGG
TGGACAGCAAATGGGTCGGGATCTGTACGACGATGACGATAAGGATCCGTAAGTCGACAAGCTTGCG
0025 Mutant 45CT DNA Artificial CGAAAGACCATATGGCAGGCCAGGCGATTGC
Forward F45CT Sequence 0026 Mutant 45CT DNA Artificial
CGCAAGCTTGTCGACTTACGGATCCTTATCGTC Reverse R45CT Sequence 0027
Mutant 45CT DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTAA
Sequence of Sequence
CTTTAAGAAGGAGATATACATATGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAG
45CT construct
GTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCT
GAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAAC
TCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTT
CTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGG
TGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGAT
GGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACAT
TAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGC
ATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATT
ACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATG
CAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCA
GGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCATCATCAT
CATGGTATGGCTAGCATGACTGGTGGACAGCAAATGGGTCGGGATCTGTACGACGATGACGATAAGG
ATCCGTAAGTCGAC 0028 Mutant 45CT PRT Artificial
MAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKS
Expressed Sequence
IQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSP
Mutant 45CT
GISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTV
TNLNSARSRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHGMASMT
GGQQMGRDLYDDDDKDP 0029 Mutant 33GPS DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Expressed Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
Mutant 33ML
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCGGACCATCAGGTCAGGATGAAATTCAGC
AACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCA
GGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAA
ATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCAC
TGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAA
CCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGT
ATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTG
GTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGG
TTCTCATCATCATCATCATCATGGTTAA 0030 Mutant 33GPS PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Expressed Sequence
TNGTNSDSDLKSIGPSGQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQK
Mutant 33ML
IDVKSLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSR
IEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0031 Mutant
33GPS DNA Artificial GATATACATATGAGCGGGTTACGGATCAACAG Forward
primer Sequence FSY3CT 0032 Mutant 33GPS DNA Artificial
AGATCTCCCGGGGAATTAACATTGAACCC Reverse primer Sequence RMIMxN 0033
Mutant 33GPS DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of mutant
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
33GPS
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGT-
GC
GTGAGTTGTCTGTTCAGGCCACTGGACCATCAGGTGAAATTCAGCAACGTCTGGAAGAAATCGATCG
CGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAG
GTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCC
TTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATT
GTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACC
AACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAA
CGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGC
TAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCATCATCATCAT
GGTTAAGTCGAC 0034 Mutant 33GPS PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Expressed Sequence
TGPSGEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVN
Mutant 33GPS
SPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEVSNMS
KAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0035 Mutant 33ML PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant 33CT Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
(Fixed A)
SLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNR
FDSAITNLGNTVTNLNSARSRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGS
HHHHHHG 0036 Mutant 33ML DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Mutant 33CT Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
(Fixed A)
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAG
ACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGC
TTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGC
TTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCG
AAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTAC
TTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCT
CATCATCATCATCATCATGGTTAA 0037 Mutant 33ML DNA Artificial
TCTAGACCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG Forward Sequence primer
F502ML 0038 Mutant 33ML DNA Artificial
CCAGTCATGTCGACTTAACCATGATGATGATGATGATGAG Reverse Sequence primer
R33CT 0039 Mutant 33ML DNA Artificial
CTCATCATCATCATCATCATGGTTAAGTCGACAAGCTTGCGGCCGCAGAGCTCGC 502
template Sequence sequence 0040 Mutant 33ML DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
33ML Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0041 Mutant 33ML DNA
Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Expressed Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
Mutant
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAG-
GCC 33ML
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAA-
G
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTC
TGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCA
TCATCATCATGGTTAA 0042 Mutant 33ML PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant 33ML Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0043 Mutant 37CT
DNA Artificial
ATGGCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGT
delta ND0 Sequence
CCTCACTGAGTTCCGCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACGGCGCGAAAGACGATGC
mutant
GGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCG-
TAAC based on
GCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGC
CBLB506T
AGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTAT
CCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGT
GTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTA
CCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGG
AATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCA
GCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTC
GTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAAC
CAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCT
AAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACG
TCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGG
TGGACAGCAAATGGGTCGGGATCTGTACGACGATGACGATAAGGATCCGTAAGTCGACAAGCTTGCG
0044 Mutant 37CT PRT Artificial
MAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINGAKDDAAGQAIANRFTSNIKGLTQASRN
delta ND0 Sequence
ANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNG
mutant
VKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINE-
DAAA based on
AKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEVSNMS
CBLB506T
KAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDP 0045
Mutant 37CT DNA Artificial CTCTGGTCATATGATCAACAGCGCGAAAGACGATGC
Forward F37CT Sequence 0046 Mutant 37CT DNA Artificial
TCTAGAGTCGACTATTAAGCCATACCATGATGATGATGATGATGAG Reverse R37CT
Sequence 0047 Mutant 37CT DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTAA
37CT Sequence
CTTTAAGAAGGAGATATACATATGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTA
construct
ACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTAT
TGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCT
GTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAAC
GTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGA
CAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATT
GATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTG
GAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAA
CCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATT
CAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTA
GCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCA
GGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCG
CGGGGTTCTCATCATCATCATCATCATGGTATGGCTTAATAGTCGAC 0048 Mutant 37CT
PRT Artificial
MINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGT
Mutant 37CT Sequence
NSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGL
DGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSA
ITNLGNTVTNLNSARSRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHH
HHGMA 0049 Mutant 445 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIE
502-SY1 Sequence
RLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSV
QATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKID
VKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQ
NRFDSAITNLGNTVTNLNSARSRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLR
0050 Mutant 445 DNA Artificial
ATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGGTGGACAGCAAATGGGTC
502-SY1 Sequence
GGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGATGGCACAAGTCATTAATACAAA
CAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGTCCTCACTGAGTTCCGCTATTGAG
CGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACC
GCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGC
GCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTT
CAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTC
TGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAA
CCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGAT
GTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAA
TTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCC
ACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAA
AACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCC
GTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGC
TGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTTAA
0051 Mutant 445 DNA Artificial
GGCAATTCAAAACCGTTTTGATTAAGCCATTACCAACCTTGG Forward Primer Sequence
CBLB445 0052 Mutant 445 DNA Artificial
CCAAGGTTGGTAATGGCTTAATCAAAACGGTTTTGAATTGCC Reverse Primer Sequence
CBLB445 0053 Mutant 445 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
mutant 445 Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGATG
GCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGTCCT
CACTGAGTTCCGCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGCGGC
AGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCT
AACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGC
GTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCA
GGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTT
AAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCA
TCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAT
TTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCC
AAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTT
CTTCTCTGGGGGCAATTCAAAACCGTTTTGATTAA 0054 Mutant 445 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIE
mutant 445 Sequence
RLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSV
QATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKID
VKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQ
NRFD 0055 Mutant 461 DNA Artificial
CAATCTGAACTCCGCGCGTTGACGTATCTAAGATGCTGACTATGC Forward Primer
Sequence CBLB461 0056 Mutant 461 DNA Artificial
GCATAGTCAGCATCTTAGATACGTCAACGCGCGGAGTTCAGATTG Reverse Primer
Sequence CBLB461 0057 Mutant 461 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Mutant 461 Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGATG
GCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGTCCT
CACTGAGTTCCGCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGCGGC
AGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCT
AACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGC
GTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCA
GGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTT
AAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCA
TCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAT
TTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCC
AAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTT
CTTCTCTGGGGGCAATTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAA
TCTGAACTCCGCGCGTTGACGTATCTAA 0058 Mutant 461 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIE
Mutant 461 Sequence
RLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSV
QATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKID
VKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQ
NRFDSAITNLGNTVTNLNSAR 0059 Mutant 467 DNA Artificial
CGTAGCCGTATCGAAGATGCTTAATAGGCAACGGAAGTTTCTAATATG Forward Primer
Sequence CBLB467 0060 Mutant 467 DNA Artificial
CATATTAGAAACTTCCGTTGCCTATTAAGCATCTTCGATACGGCTACG Reverse Primer
Sequence CBLB467 0061 Mutant 467 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Mutant 467 Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGATG
GCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGTCCT
CACTGAGTTCCGCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGCGGC
AGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCT
AACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGC
GTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCA
GGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTT
AAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCA
TCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAT
TTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCC
AAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTT
CTTCTCTGGGGGCAATTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAA
TCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTTAATAG 0062 Mutant 467 PRT
Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIE
Mutant 467 Sequence
RLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSV
QATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKID
VKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQ
NRFDSAITNLGNTVTNLNSARSRIEDA 0063 Mutant 470CT DNA Artificial
ATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGGTGGACAGCAAATGGGTC
CBLB502 Sequence
GGGATCTGTACGACGATGACGATAAGGATCCGATGGCACAAGTCATTAATACAAACAGCCTGTCGCT
GTTGACCCAGAATAACCTGAACAAATCTCAGTCCTCACTGAGTTCCGCTATTGAGCGTCTGTCCTCT
GGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTA
ATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGA
AGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAAC
GGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCG
ATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAAT
CCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTT
GGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCA
TGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAAT
TGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGAT
TCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATG
CTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGT
TCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTTAA 0064 Mutant
470CT DNA Artificial CGATAAGGATCATATGGCACAAGTCATTAATAC Forward
Primer Sequence F470CT 0065 Mutant 470CT DNA Artificial
AGATCTGTCGACTTAACCATGATGATGATGATGATGAGAACCCCGCGGAACCAGTGCATAGTCAGCA
Reverse Primer Sequence TCTTCGATACG R470CT 0066 Mutant 470CT DNA
Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Mutant 470CT Sequence
TTTAAGAAGGAGATATACATATGGCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAA
TAACCTGAACAAATCTCAGTCCTCACTGAGTTCCGCTATTGAGCGTCTGTCCTCTGGTCTGCGTATC
AACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTC
TGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAA
TGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCT
GATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTA
ATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGC
TAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGG
TTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAA
TCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATT
GTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGATTCAGCCATTACC
AACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAC
TGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0067 Mutant 470CT
PRT Artificial
MAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRN
Mutant 470CT Sequence
ANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNG
VKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAA
AKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYALVPRGSH
HHHHHG 0068 Mutant 485CT DNA Artificial
AGATCTCCGCGGAACCAGACCAGCCTGCTGCAGAATCTGC Reverse primer Sequence
R485MC 0069 Mutant 485CT DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of 485CT
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0070
Mutant 485CT DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Mutant 485CT Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTCTGGTTCCGC
GGGGTTCTCATCATCATCATCATCATGGTTAA 0071 Mutant 485CT PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant 485CT Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGLVPRGSHHHHHHG 0072 Mutant 485D DNA Artificial
AACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAA
DNA template Sequence
TTCAAAACCGTTTTGATTCAGCCATTACCGCCCTTGGCAATACGGTAACCAAT for deletion
mutations from Mutant 485CT variant 0073 Mutant 485D PRT Artificial
NPLASIDSALSKVDAVRSSLGAIQNRFDSAITALGNTVTN PRT sequence Sequence for
deletion mutations from Mutant 485CT variant 0074 Mutant 485D DNA
Artificial GTTCGTTCTTCTCTGGGGGCAATTGATTCAGCCATTACCGCCCTTG Forward
Primer Sequence F485D 0075 Mutant 485D DNA Artificial
CAAGGGCGGTAATGGCTGAATCAATTGCCCCCAGAGAAGAACGAAC Reverse Primer
Sequence R485D 0076 Mutant 485D DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
485CT_Delta
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
construct
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTGATTCAGCCATTACCGCCCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCG
AAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTCT
GGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0077 Mutant 485D PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant 485D Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
(CT_Delta
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIDSAITALGNTVTNLNSARSRIEDADYAT
439-442) EVSNMSKAQILQQAGLVPRGSHHHHHHG 0078 Mutant CGD1 DNA
Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Mutant SY3CT Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCACTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAA 0079 Mutant
CGD1 PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant SY3CT Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYALVPRGSHHHHHHG 0080 Mutant CGD1 DNA Artificial
ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTA
GFPuv4 Sequence
ATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAA
ATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTCTGACGTATGGT
GTTCAATGCTTTTCCCGTTATCCGGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCG
AAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGT
CAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGA
AACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAAC
AAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGC
AGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTG
TCGACACAATCTGCCCTTTTGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTG
TAACTGCTGCTGGGATTACACATGGCATGGATGAACTATACAAA 0081 Mutant CGD1 PRT
Artificial
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYG
GFPuv4 Sequence
VQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDG
NILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYL
STQSALLKDPNEKRDHMVLLEFVTAAGITHGMDELYK 0082 Mutant CGD1 DNA
Artificial
ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTA
GFPuv4 Sequence
ATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAA
mutation
ATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTCTGACGTATGGT
of wt
GTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTGCCATGC-
CCG NdeI site
AAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGT
CAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGA
AACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAAC
AAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGC
AGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTG
TCGACACAATCTGCCCTTTTGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTG
TAACTGCTGCTGGGATTACACATGGCATGGATGAACTATACAAATAA 0083 Mutant CGD1
DNA Artificial
TCTAGACGGCCGATCTCAGGTAAGAATGGAATCAAAGCTAACTTCAAAATTCGC Forward
primer Sequence FCGFP 0084 Mutant CGD1 PRT Artificial
NVYIPISGKNGIKANFKIRH PRT altered Sequence GFPuv4 sequence 0085
Mutant CGD1 DNA Artificial
AGATCTCCGCGGTTTGTATAGTTCATCCATGCCATGTGTAATCCC Reverse RCGFP
Sequence 0086 Mutant CGD1 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of CGD1
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCACTGGTTCCGCCGATCTCAGGTAAGAATGGAATCAAAGC
TAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCAGACCATTATCAACAAAAT
ACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGCCCTTT
TGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTAC
ACATGGCATGGATGAACTATACAAACCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC
0087 Mutant CGD1 DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Expressed Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
Mutant CGD1
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCACTGGTTCCGCCGATCTCAGGTAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACA
ACATTGAAGATGGATCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCC
TGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGCCCTTTTGAAAGATCCCAACGAAAAG
CGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAACTAT
ACAAACCGCGGGGTTCTCATCATCATCATCATCATGGTTAA 0088 Mutant CGD1 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Expressed Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
Mutant CGD1
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYALVPPISGKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALLKDPNEK
RDHMVLLEFVTAAGITHGMDELYKPRGSHHHHHHG 0089 Mutant CPM194 DNA
Artificial
ATGAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTT
Mutant CPM194 Sequence
CTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCT
GAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCATCCCCGGGAAGCGGGTTACGGATCAAC
AGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGA
CTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGA
AATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGAT
TCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATC
AGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAA
CGATGGTCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAA 0090 Mutant
CPM194 PRT Artificial
MSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYASPGSGLRIN
Mutant CPM194 Sequence
SAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSD
SDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGLVPRGSHHHHHHG 0091
Mutant CPM194 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Mutant CPM194 Sequence
TTTAAGAAGGAGATATACATATGAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAA
AGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTT
GGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCATCCCCGG
GAAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCAC
TTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACC
ACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCA
CTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGA
AATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATG
AAAATCCAGGTTGGTGCTAACGATGGTCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTT
AAGTCGAC 0092 Mutant CPM194 DNA Artificial
TCTAGACATATGAGTACCGCTAACCCACTGGCTTCAATTG Forward primer Sequence
FCD1 0093 Mutant CPM194 DNA Artificial
GCTTCCCGGGGATGCATAGTCAGCATCTTCGATACGGC Reverse primer Sequence
RCD1J 0094 Mutant CPM194 DNA Artificial
GCATCCCCGGGAAGCGGGTTACGGATCAACAGCG Forward primer Sequence FND1J
0095 Mutant CPM194 DNA Artificial
AGATCTCCGCGGAACCAGACCATCGTTAGCACCAACCTGGATTTTCATCT Reverse primer
Sequence RND1 0096 Mutant CPM217 DNA Artificial
ATGAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTT
Mutant CPM217 Sequence
CTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCT
GAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCATCCCCGGGAAGCGGGTTACGGATCAAC
AGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGA
CTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGA
AATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGAT
TCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATC
AGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAA
CGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTC
AATGTTAATCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAA 0097 Mutant
CPM217 PRT Artificial
MSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYASPGSGLRIN
Mutant CPM217 Sequence
SAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSD
SDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGF
NVNLVPRGSHHHHHHG 0098 Mutant CPM217 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Mutant CPM217 Sequence
TTTAAGAAGGAGATATACATATGAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAA
AGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTT
GGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCATCCCCGG
GAAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCAC
TTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACC
ACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCA
CTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGA
AATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATG
AAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAA
GCCTTGGCCTTGATGGGTTCAATGTTAATCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGG
TTAAGTCGAC 0099 Mutant CPM217 DNA Artificial
AGATCTCCGCGGAACCAGATTAACATTGAACCCATCAAGGCCAAG Reverse primer
Sequence RCPM217 0100 Mutant GD1G DNA Artificial
CCCGTTATCCGGATCACATGAAACGGCATGACTTTTTC Forward Primer Sequence
FGFP77 0101 Mutant GD1G DNA Artificial
GAAAAAGTCATGCCGTTTCATGTGATCCGGATAACGGG Reverse Primer Sequence
RGFP77 0102 Mutant GD1G DNA Artificial CTGTTCCATGGCCAACACTTG FGFP54
Sequence 0103 Mutant GD1G DNA Artificial
TCTAGACATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCC Forward primer
Sequence FNGFP 0104 Mutant GD1G DNA Artificial
GGCCTATGCGGCCGCAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAA
altered GFP Sequence DNA sequence 0105 Mutant GD1G DNA Artificial
AGATCTATTAATGCGGCCTGATAGGCCTTGTTTGTCTGCCGTGATGTATACATTGTG Reverse
RNGFP Sequence 0106 Mutant GD1G PRT Artificial SHNVYITADKQGLSGRNM
altered GFP Sequence PRT sequence 0107 Mutant GD1G DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGT
of GD1G
TGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACA
construct
TACGGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTG
TCACTACTCTGACGTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTT
TTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAAC
TACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTA
TTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGT
ATACATCACGGCAGACAAACAAGGCCTATCAGGCCGCATTATGAGCGGGTTACGGATCAACAGCGCG
AAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGG
CTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAA
CAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGAT
CTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTC
AATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGG
TGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTT
AATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAG
TTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGT
AACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCACTGGTTCCGCCGATCTCA
GGTAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAG
CAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCT
GTCGACACAATCTGCCCTTTTGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTT
GTAACTGCTGCTGGGATTACACATGGCATGGATGAACTATACAAACCGCGGGGTTCTCATCATCATC
ATCATCATGGTTAAGTCGAC 0108 Mutant GD1G DNA Artificial
ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTA
Expressed Sequence
ATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAA
Mutant GD1G
ATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTCTGACGTATGGT
GTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCG
AAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGT
CAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGA
AACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAAC
AAGGCCTATCAGGCCGCATTATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCACTGGTTCCGCCGATCTCAGGTAAGAATGGAATCAAAGC
TAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCAGACCATTATCAACAAAAT
ACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGCCCTTT
TGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTAC
ACATGGCATGGATGAACTATACAAACCGCGGGGTTCTCATCATCATCATCATCATGGTTAA 0109
Mutant GD1G PRT Artificial
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYG
Expressed Sequence
VQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDG
Mutant GD1G
NILGHKLEYNYNSHNVYITADKQGLSGRIMSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNAND
GISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKV
LSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGA
IQNRFDSAITNLGNTVTNLNSARSRIEDADYALVPPISGKNGIKANFKIRHNIEDGSVQLADHYQQN
TPIGDGPVLLPDNHYLSTQSALLKDPNEKRDHMVLLEFVTAAGITHGMDELYKPRGSHHHHHHG
0110 Mutant MF227C DNA Artificial
CTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTACATTAA
mutant 470CT Sequence
TCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTG template
0111 Mutant MF227C PRT Artificial
LGLDGFNVNSPGISGGGGGITLINEDAAAAKKSTANPLASI mutant 470CT Sequence
template 0112 Mutant MF227C DNA Artificial
AGATCTCCGCGGAACCAGTAAAGAGAGGACGTTTTGCGGAACCTGGTTTGCATAGTCAGCATCTTCG
Reverse Primer Sequence ATACG R2YY 0113 Mutant MF227C DNA
Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of Mutant
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
MF227C
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTG-
TGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCC
GCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0114 Mutant MF227C DNA
Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Mutant MF227C Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCATC
ATCATCATGGTTAA 0115 Mutant MF227C PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant MF227C Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYANQVPQNVLSLLVPRGSHHHHHHG 0116 Mutant MF227N DNA Artificial
AGATCTCCCGGGGAACCATCGTTAGCACCAACCTGGATTTTC Reverse Primer Sequence
RMF227N 0117 Mutant MF227N DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of mutant
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
MF227N
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTG-
TGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTTCCCCGGGAAGTACCGCTA
ACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAAT
TCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGT
AGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGC
AGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCC
GCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0118 Mutant MF227N DNA
Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
mutant MF227N Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTGAT
TCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAG
CCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGA
CTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTG
GCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCATC
ATCATCATGGTTAA 0119 Mutant MF227N PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
mutant MF227N Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGSPGSTANPLASID
SALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEVSNMSKAQILQQAGTSVL
AQANQVPQNVLSLLVPRGSHHHHHHG 0120 Mutant MF233 DNA Artificial
AGATCTCCGCGGAACCAGCAGGTTATTCTGGGTCAACAGCGACAGGCTGTTTGTATTAATGACTTGT
Reverse primer Sequence GCATAGTCAGCATCTTCGATACG RMF233 0121 Mutant
MF233 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
MF233
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGT-
GC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCA
GAATAACCTGCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0122
Mutant MF233 DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
MF233 Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCACAAGTCATTAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGCTGGTTCCGC
GGGGTTCTCATCATCATCATCATCATGGTTAA 0123 Mutant MF233 PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
MF233 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYAQVINTNSLSLLTQNNLLVPRGSHHHHHHG 0124 Mutant MF471 DNA Artificial
GCTGACTATGCAACGGCAGTTTCTGCTATGTCTGCAGCGCAGATTCTGC Forward primer
Sequence F471-77 0125 Mutant MF471 DNA Artificial
GCAGAATCTGCGCTGCAGACATAGCAGAAACTGCCGTTGCATAGTCAGC Reverse Primer
Sequence R471-77 0126 Mutant MF471 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
MF471
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGT-
GC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGCAGTTTCTGCTATGTCTGCAGCGCAGATTCTGCA
GCAGGCTGGTCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0127
Mutant MF471 DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
MF471 Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGCAGTTTCTGCTATGTCTGCAGCGCAGATTCTGCAGCAGGCTGGTCTGGTTCCGC
GGGGTTCTCATCATCATCATCATCATGGTTAA 0128 Mutant MF471 PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
MF471 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATAVSAMSAAQILQQAGLVPRGSHHHHHHG 0129 Mutant MF479 DNA Artificial
GTTTCTAATATGTCTAAAGCGGCGATTCTGGGAGCGGCTGGTCTGGTTCCGCGG Forward
primer Sequence F479-83 0130 Mutant MF479 DNA Artificial
CCGCGGAACCAGACCAGCCGCTCCCAGAATCGCCGCTTTAGACATATTAGAAAC Reverse
Primer Sequence R479-83 0131 Mutant MF479 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
MF479
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGT-
GC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGGCGATTCTGGG
AGCGGCTGGTCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0132
Mutant MF479 DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Mutant MF479 Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGGCGATTCTGGGAGCGGCTGGTCTGGTTCCGC
GGGGTTCTCATCATCATCATCATCATGGTTAA 0133 Mutant MF479 PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant MF479 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAAILGAAGLVPRGSHHHHHHG 0134 Mutant N45 DNA Artificial
TCTAGAGGATCCGGCAGGCCAGGCG Forward Sequence primer N45_F 0135 Mutant
N45 DNA Artificial CGCAAGCTTGTCGACTTAACGC Reverse Sequence R502D0
0136 Mutant N45 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
of Mutant
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGGCA
N45
GGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTA
ACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCG
TGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAG
GATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTA
AAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCAT
CGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATT
TCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCCA
AGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTC
TTCTCTGGGGGCAATTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAAT
CTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAG
CGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCT
CTCTTTACTGCGTTAAGTCGACAAGCTTGCGG 0137 Mutant N45 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPAGQAIANRFTSNIKGLTQASRNANDGISIA
Mutant N45 Sequence
QTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDN
QMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANP
LASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEVSNMSKAQILQQA
GTSVLAQANQVPQNVLSLLR 0138 Mutant NGD1 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGT
of NGD1
TGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACA
construct
TACGGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTG
TCACTACTCTGACGTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTT
TTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAAC
TACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTA
TTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGT
ATACATCACGGCAGACAAACAAGGCCTATCAGGCCGCATTATGAGCGGGTTACGGATCAACAGCGCG
AAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGG
CTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAA
CAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGAT
CTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTC
AATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGG
TGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTT
AATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAG
TTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGT
AACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCACTGGTTCCGCGGGGTTCT
CATCATCATCATCATCATGGTTAAGTCGAC 0139 Mutant NGD1 DNA Artificial
ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTA
Expressed Sequence
ATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAA
Mutant
ATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTCTGACGTA-
TGGT SY3-GFP
GTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTGCCATG-
CCCG
AAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGT
CAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGA
AACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAAC
AAGGCCTATCAGGCCGCATTATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCACTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGG
TTAA 0140 Mutant NGD1 PRT Artificial
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYG
Expressed Sequence
VQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDG
Mutant SY3-
NILGHKLEYNYNSHNVYITADKQGLSGRIMSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNAND
GFP/Mutant
GISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKV
NGD1
LSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLG-
A IQNRFDSAITNLGNTVTNLNSARSRIEDADYALVPRGSHHHHHHG 0141 Mutant S33 DNA
Artificial TCTAGAGGATCCGTCTGGTCTGCGTATCAACAGCGC Forward Sequence
F502_S33 0142 Mutant S33 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
of Mutant
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGTCT
S33
GGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTA
ATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGA
AGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAAC
GGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCG
ATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAAT
CCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTT
GGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCA
TGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAAT
TGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGAT
TCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATG
CTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGT
TCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTTAAGTCGAC 0143
Mutant S33 DNA Artificial
ATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGGTGGACAGCAAATGGGTC
Mutant S33 Sequence
GGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGTCTGGTCTGCGTATCAACAGCGC
GAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAG
GCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCA
ACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGA
TCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACT
CAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATG
GTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGT
TAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAA
GACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAG
TGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGG
CAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTT
TCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGG
TTCCGCAAAACGTCCTCTCTTTACTGCGTTAA 0144 Mutant S33 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPSGLRINSAKDDAAGQAIANRFTSNIKGLTQ
Mutant S33 Sequence
ASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQT
QFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINE
DAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDADYATEV
SNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0145 Mutant SY3CT DNA Artificial
AGATCTCCGCGGAACCAGTGCATAGTCAGCATCTTCGATACGGC Reverse primer
Sequence RSY3CT 0146 Mutant SY3CT DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of SY3CT
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCACTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGG
TTAAGTCGAC 0147 Mutant SY3CT DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Expressed Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
Mutant
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAG-
GCC SY3CT
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGA-
AG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCACTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAA 0148 Mutant
SY3CT PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Expressed Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
Mutant
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRI-
EDA SY3CT DYALVPRGSHHHHHHG 0149 Mutant 33MX DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Mutant 33MX Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTGCAGACGGCATTTCTATTGCGCAGAC
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTGCCGGGGCTAACGCTGATGCCGCTCTGAAAGCTATCCAGGCTGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTCAGCAGACTCAAGCTGCCGCTGTTAAAGTCCTGTCTCAGGACAACGCAAT
GGCAATCCAGGTTGGTGCTAACGATGGTGCCGCTATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTCAAATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTC
TGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCA
TCATCATCATGGTTAA 0150 Mutant 33MX PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNAADGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant 33MX Sequence
TAGANADAALKAIQAEIQQRLEEIDRVSQQTQAAAVKVLSQDNAMAIQVGANDGAAITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSQMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0151 Mutant 33MX
DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of 33MX
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTGC-
AGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTGCCGGGGCTAACGCTGATGCCGCTCTGAAAGCTATCCAGGCTGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTCAGCAGACTCAAGCTGCCGCTGTTAAAGTC
CTGTCTCAGGACAACGCAATGGCAATCCAGGTTGGTGCTAACGATGGTGCCGCTATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTCAAATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0152 Mutant 485MX DNA
Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA Sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of 485MX
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTGCAGAC
construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTGCCGGGGCTAACGCTGATGCCGCTCTGAAAGCTATCCAGGCTGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTCAGCAGACTCAAGCTGCCGCTGTTAAAGTC
CTGTCTCAGGACAACGCAATGGCAATCCAGGTTGGTGCTAACGATGGTGCCGCTATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTCAAATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTCTGGTTCCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0153
Mutant 485MX DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
485MX Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTGCAGACGGCATTTCTATTGCGCAGAC
construct
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTGCCGGGGCTAACGCTGATGCCGCTCTGAAAGCTATCCAGGCTGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTCAGCAGACTCAAGCTGCCGCTGTTAAAGTCCTGTCTCAGGACAACGCAAT
GGCAATCCAGGTTGGTGCTAACGATGGTGCCGCTATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTCAAATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTCTGGTTCCGC
GGGGTTCTCATCATCATCATCATCATGGTTAA 0154 Mutant 485MX PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNAADGISIAQTTEGALNEINNNLQRVRELSVQA
485MX Sequence
TAGANADAALKAIQAEIQQRLEEIDRVSQQTQAAAVKVLSQDNAMAIQVGANDGAAITIDLQKIDVK
construct
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSQMSKAQILQQAGLVPRGSHHHHHHG 0155 Mutant MIM4 DNA Artificial
ATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGGTGGACAGCAAATGGGTC
CBLB502 Sequence
GGGATCTGTACGACGATGACGATAAGGATCCGATGGCACAAGTCATTAATACAAACAGCCTGTCGCT
variant
GTTGACCCAGAATAACCTGCAGAAATCTCAGTCCTCACTGAGTTCCGCTATTGAGCGTCTGTC-
CTCT
GGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTA
ATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGACCACTGA
AGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTCAA
GGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCG
ATCGCGTTTCTCAGCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGATGAAAAT
CCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTT
GGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCA
TGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAAT
TGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGTTTTGAT
TCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATG
CTGACTATGCAACGGAAGTTTCTCAAATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGT
TCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTTAA 0156 Mutant
MIM4 DNA Artificial
AACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAA
Primers design Sequence
TTCAAAACCGTTTTGATTCAGCCATTACCGCCCTTGGCGCTACGGTAACCGCTCTGGCCTCCGCGCG
(for deletion TAGCGCTATCGAAGATGCTGACTATGCAACGGAAGTTTCTCAAATG aa
Gln439; Asn440; Arg441; Phe442): 0157 Mutant MIM4 PRT Artificial
NPLASIDSALSKVDAVRSSLGAIQNRFDSAITALGATVTALASARSAIEDADYATEVSNM
Primers design Sequence (for deletion aa Gln439; Asn440; Arg441;
Phe442): 0158 Mutant MIM4 DNA Artificial
GCAGTTCGTTCTTCTCTGGGGGCAATTGATTCAGCCATTACCGCCCTTGG
Forward Primer Sequence MIM4 0159 Mutant MIM4 DNA Artificial
CCAAGGGCGGTAATGGCTGAATCAATTGCCCCCAGAGAAGAACGAACTGC Reverse Primer
Sequence MIM4 0160 Mutant MIM4 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTAA
MIM4 Sequence
CTTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGA
CTGGTGGACAGCAAATGGGTCGGGATCTGTACGACGATGACGATAAGGATCCGATGGCACAAGTCAT
TAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGTCCTCACTGAGTTCC
GCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGA
TTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCAT
TTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAG
TTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTC
AGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTC
TCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAA
AAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTG
GTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTAC
CGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGG
GCAATTGATTCAGCCATTACCGCCCTTGGCGCTACGGTAACCGCTCTGGCCTCCGCGGCTAGCCGTA
TCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGG
TACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTTAA 0161
Mutant MIM4 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSS
MIM4 Sequence
GLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATN
GTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSL
GLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIDSAIT
ALGATVTALASAASRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0162
Mutant MIM5 DNA Artificial
AACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAA
Primers design Sequence
TTGCAAAGGCTTTTGATTCAGCCATTACCGCCCTTGGCGCTACGGTAACCGCTCTGGCCTCCGCGCG
(mutations TAGCGCTATCGAAGATGCTGACTATGCAACGGAAGTTTCTCAAATG
Gln439Ala; Asn440Lys; Arg441Ala): 0163 Mutant MIM5 PRT Artificial
NPLASIDSALSKVDAVRSSLGAIAKAFDSAITALGATVTALASARSAIEDADYATEVSNM
Primers design Sequence (mutations Gln439Ala; Asn440Lys;
Arg441Ala): 0164 Mutant MIM5 DNA Artificial
CGTTCTTCTCTGGGGGCAATTGCAAAGGCTTTTGATTCAGCCATTACCGC Forward Primer
Sequence MIM5 0165 Mutant MIM5 DNA Artificial
GCGGTAATGGCTGAATCAAAAGCCTTTGCAATTGCCCCCAGAGAAGAACG Reverse Primer
Sequence MIM5 0166 Mutant MIM5 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTAA
MIM5 Sequence
CTTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGA
CTGGTGGACAGCAAATGGGTCGGGATCTGTACGACGATGACGATAAGGATCCGATGGCACAAGTCAT
TAATACAAACAGCCTGTCGCTGTTGACCCAGAATAACCTGAACAAATCTCAGTCCTCACTGAGTTCC
GCTATTGAGCGTCTGTCCTCTGGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGA
TTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCAT
TTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAG
TTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTC
AGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTC
TCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAA
AAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTG
GTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTAC
CGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGG
GCAATTGCAAAGGCTTTTGATTCAGCCATTACCGCCCTTGGCGCTACGGTAACCGCTCTGGCCTCCG
CGGCTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCT
GCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTG
CGTTAA 0167 Mutant MIM5 PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPMAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSS
MIM5 Sequence
GLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQATN
GTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVKSL
GLDGFNVNSPGISGGGGGILDSMGTLINEDAAAAKKSTANPLASIDSALSKVDAVRSSLGAIAKAFD
SAITALGATVTALASAASRIEDADYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0168
Mutant MIMX DNA Artificial
ATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGACTGGTGGACAGCAAATGGGTC
Mutant 33MIMX Sequence
GGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGTCTGGTCTGCGTATCAACAGCGC
GAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAG
GCTTCCCGTAACGCTGCAGACGGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCA
ACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGA
TCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACT
CAAGCTAACGGTGTTAAAGTCCTGTCTCAGGACAACGCAATGAAAATCCAGGTTGGTGCTAACGATG
GTGCCGCTATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGT
TAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCATGGGTACATTAATCAATGAA
GACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAG
TGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAGCTCGTTTTGCCGCGGCCATTGCTAACCTTGG
CAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTT
TCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGG
TTCCGCAAAACGTCCTCTCTTTACTGCGTTAA 0169 Mutant MIMX PRT Artificial
MRGSHHHHHHGMASMTGGQQMGRDLYDLVPRGSAKDPSGLRINSAKDDAAGQAIANRFTSNIKGLTQ
MIMx Sequence
ASRNAADGISIAQTTEGALNEINNNLQRVRELSVQATNGTNSDSDLKSIQDEIQQRLEEIDRVSNQT
QANGVKVLSQDNAMKIQVGANDGAAITIDLQKIDVKSLGLDGFNVNSPGISGGGGGILDSMGTLINE
DAAAAKKSTANPLASIDSALSKVDAVRSSLGAIQARFAAAIANLGNTVTNLNSARSRIEDADYATEV
SNMSKAQILQQAGTSVLAQANQVPQNVLSLLR 0170 Mutant MIMX DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGCGGGGTTCTCATCATCATCATCATCATGGTATGGCTAGCATGAC
of 33MIMx
TGGTGGACAGCAAATGGGTCGGGATCTGTACGACCTGGTTCCGCGCGGTAGCGCGAAGGATCCGTCT
GGTCTGCGTATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCACTTCTA
ATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTGCAGACGGCATTTCTATTGCGCAGACCACTGA
AGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCCACTAAC
GGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAGAAATCG
ATCGCGTTTCTAATCAGACTCAAGCTAACGGTGTTAAAGTCCTGTCTCAGGACAACGCAATGAAAAT
CCAGGTTGGTGCTAACGATGGTGCCGCTATTACCATCGATCTGCAAAAAATTGATGTGAAAAGCCTT
GGCCTTGATGGGTTCAATGTTAATTCCCCGGGAATTTCCGGTGGTGGTGGTGGAATTCTAGACTCCA
TGGGTACATTAATCAATGAAGACGCTGCCGCAGCCAAGAAAAGTACCGCTAACCCACTGGCTTCAAT
TGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAGCTCGTTTTGCC
GCGGCCATTGCTAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATG
CTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGT
TCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTTAAGTCGAC 0171
Mutant MIXC DNA Artificial
AGATCTGTCGACTTAACCATGATGATGATGATGATGAGAACCCCGCGGAACCAGTAAAGAGAGGACG
Reverse primer Sequence TTTTGCGGAACC RMIXC 0172 Mutant MIXC DNA
Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of MIXC
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAA-
CGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAGCTCGTTTTGCCGCGGCCATTGCTAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0173 Mutant MIXC PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
MIXC Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQARFAAAIANLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0174 Mutant MIXN
DNA Artificial AGATCTCATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGC
Forward primer Sequence FMIMxN 0175 Mutant MIXN DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
DNA sequence Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
of MIX.N
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTGCAGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAAGCTAACGGTGTTAAAGTC
CTGTCTCAGGACAACGCAATGAAAATCCAGGTTGGTGCTAACGATGGTGCCGCTATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0176 Mutant MIXN PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNAADGISIAQTTEGALNEINNNLQRVRELSVQA
Expressed Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQANGVKVLSQDNAMKIQVGANDGAAITIDLQKIDVK
Mutant
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRI-
EDA MIX.N DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0177
Mutants MIM1; DNA Artificial
AACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAA
MIM2 and MIM3 Sequence
TTCAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCG
502 Mutants
TAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTCAAATGTCTAAAGCGCAGATTCTGCAG
MIM1; MIM2 and
CAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGCGTT
MIM3 C- AA terminal part of CBLB502 0178 Mutants MIM1; DNA
Artificial
ATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGAT MIM2
and MIM3 Sequence Primers design (mutant MIM1) 0179 Mutants MIM1;
PRT Artificial ITNLGNTVTNLNSARSRIED MIM2 and MIM3 Sequence Primers
design (mutant MIM1) 0180 Mutants MIM1; DNA Artificial
CCTTGGCAATACGGTAACCGCTCTGGCCTCCGCGCGTAGCCGTATC MIM2 and MIM3
Sequence Forward Primer 455-57 0181 Mutants MIM1; DNA Artificial
GATACGGCTACGCGCGGAGGCCAGAGCGGTTACCGTATTGCCAAGG MIM2 and MIM3
Sequence Reverse Primer 455-57 0182 Mutants MIM1; DNA Artificial
ACGGTAACCGCTCTGGCCTCCGCGCGTAGCCGTATCGAAGATGCTGACTATGCAACGGAA MIM2
and MIM3 Sequence Primers design (mutant MIM2_MIM1 plus R460A) 0183
Mutants MIM1; PRT Artificial TVTALASARSRIEDADYATE MIM2 and MIM3
Sequence Primers design (mutant MIM2_MIM1 plus R460A) 0184 Mutants
MIM1; DNA Artificial GCTCTGGCCTCCGCGGCTAGCCGTATCGAAGATG MIM2 and
MIM3 Sequence Forward Primer 460 0185 Mutants MIM1; DNA Artificial
CATCTTCGATACGGCTAGCCGCGGAGGCCAGAGC MIM2 and MIM3 Sequence Reverse
Primer
460 0186 Mutants MIM1; DNA Artificial
CAAAACCGTTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCGCTCTGGCCTCC MIM2
and MIM3 Sequence Primers design (mutant MIM3_MIM2 plus N448A;
N451A) 0187 Mutants MIM1; PRT Artificial QNRFDSAITNLGNTVTALAS MIM2
and MIM3 Sequence Primers design (mutant MIM3_MIM2 plus N448A;
N451A) 0188 Mutants MIM1; DNA Artificial
GTTTTGATTCAGCCATTACCGCCCTTGGCGCTACGGTAACCGCTCTGG MIM2 and MIM3
Sequence Forward Primer 448-51 0189 Mutants MIM1; DNA Artificial
CCAGAGCGGTTACCGTAGCGCCAAGGGCGGTAATGGCTGAATCAAAAC MIM2 and MIM3
Sequence Reverse Primer 448-51 0190 Mutant ME42 DNA Artificial
CAACAGCGCGAAAGCCGATGCGGGAGGCCAGGCGATTGC Forward Primer Sequence
ME42 0191 Mutant ME42 DNA Artificial
GCAATCGCCTGGCCTCCCGCATCGGCTTTCGCGCTGTTG Reverse Primer Sequence
ME42 0192 Mutant ME42 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGCCGATGCGGGAGGCCA
ME42 construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0193 Mutant ME42 PRT
Artificial
MSGLRINSAKADAGGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME42 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0194 Mutant ME110
DNA Artificial GTCTGTTCAGGCCACTGCCGGGGCTAACTCTGATTCCGATCTG Forward
Primer Sequence ME100 0195 Mutant ME110 DNA Artificial
CAGATCGGAATCAGAGTTAGCCCCGGCAGTGGCCTGAACAGAC Reverse Primer Sequence
ME100 0196 Mutant ME110 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME100
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAAC-
GAC construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTGCCGGGGCTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0197 Mutant ME110 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME110 Sequence
TAGANSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0198 Mutant DNA
Artificial CTGATTCCGATCTGAAAGCTATCCAGGCTGAAATTCAGCAACGTC ME100/110
Sequence Forward Primer ME110 0199 Mutant DNA Artificial
GACGTTGCTGAATTTCAGCCTGGATAGCTTTCAGATCGGAATCAG ME100/110 Sequence
Reverse Primer ME110 0200 Mutant DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
ME100/110 Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
Sequence of
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
ME100/110
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
construct
GTGAGTTGTCTGTTCAGGCCACTGCCGGGGCTAACTCTGATTCCGATCTGAAAGCTATCCAGGCTGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0201 Mutant ME104N DNA
Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Intermediate Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
Mutant
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCA-
GGCC ME100/110
ACTGCCGGGGCTAACTCTGATTCCGATCTGAAAGCTATCCAGGCTGAAATTCAGCAACGTCTGGAAG
AAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTC
TGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCA
TCATCATCATGGTTAA 0202 Mutant PRT Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
ME100/110 Sequence
TAGANSDSDLKAIQAEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
Mutant
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSR-
IEDA ME110/110 DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG
0203 Mutant ME104 DNA Artificial
GCCACTAACGGGACTAACGCTGATGCCGCTCTGAAATCTATCCAG Forward Primer
Sequence ME104 0204 Mutant ME104 DNA Artificial
CTGGATAGATTTCAGAGCGGCATCAGCGTTAGTCCCGTTAGTGGC Reverse Primer
Sequence ME104 0205 Mutant ME104 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME104
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAAC-
GAC construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACGCTGATGCCGCTCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0206 Mutant ME104 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME104 Sequence
TNGTNADAALKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0207 Mutant
ME104N DNA Artificial GCCACTGCCGGGGCTAACGCTGATGCCGCTCTGAAAGCTATCCAG
Primer Sequence FME104New 0208 Mutant ME104N DNA Artificial
CTGGATAGCTTTCAGAGCGGCATCAGCGTTAGCCCCGGCAGTGGC Primer Sequence
RME104New 0209 Mutant ME104N DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
ME104New
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTGCCGGGGCTAACGCTGATGCCGCTCTGAAAGCTATCCAGGCTGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0210 Mutant ME104N PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME104N Sequence
TAGANADAALKAIQAEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0211 Mutant ME110
DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME110
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAAC-
GAC construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAAGCTATCCAGGCTGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0212 Mutant ME110 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME110 Sequence
TNGTNSDSDLKAIQAEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0213 Mutant ME117
DNA Artificial CTATCCAGGATGAAATTCAGGCACGTCTGGCAGAAATCGATCGCG
Forward Primer Sequence ME117
0214 Mutant ME117 DNA Artificial
CGCGATCGATTTCTGCCAGACGTGCCTGAATTTCATCCTGGATAG Reverse Primer
Sequence ME117 0215 Mutant ME117 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
33ML construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
(should this
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
say ME117?)
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGGCACGTCTGGCAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0216 Mutant ME117 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME117 Sequence
TNGTNSDSDLKSIQDEIQARLAEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0217 Mutant ME124
DNA Artificial
GGAAGAAATCGATGCCGTTTCTGCTGCGACTCAATTTAACGGTGTTAAAGTCCTGTCTC Forward
Primer Sequence ME104 0218 Mutant ME124 DNA Artificial
GAGACAGGACTTTAACACCGTTAAATTGAGTCGCAGCAGAAACGGCATCGATTTCTTCC Reverse
Primer Sequence ME104 0219 Mutant ME124 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME124 construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATGCCGTTTCTGCTGCGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0220 Mutant ME124 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME124 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDAVSAATQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0221 Mutant
ME124P DNA Artificial
CAGCAACGTCTGGAAGAAATCGATGCCGTTTCTAATCAGACTCAATTTAACGG Forward
Primer Sequence ME124P 0222 Mutant ME124P DNA Artificial
CCGTTAAATTGAGTCTGATTAGAAACGGCATCGATTTCTTCCAGACGTTGCTG Reverse
Primer Sequence ME124P 0223 Mutant ME124 DNA Artificial
ATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCAGGCGATTGCTAACCGCTTCA
Expressed Sequence
CTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGACGGCATTTCTATTGCGCAGAC
Mutant ME124P
CACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGCGTGAGTTGTCTGTTCAGGCC
ACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGAAATTCAGCAACGTCTGGAAG
AAATCGATGCCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTCCTGTCTCAGGACAACCAGAT
GAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATCTGCAAAAAATTGATGTGAAA
AGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGCTAACCCACTGGCTTCAATTG
ATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCAATTCAAAACCGCTTTGATTC
AGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGCGTAGCCGTATCGAAGATGCT
GACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCAGCAGGCTGGTACTTCCGTTC
TGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTTCCGCGGGGTTCTCATCATCA
TCATCATCATGGTTAA 0224 Mutant ME124P DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
ME124P Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATGCCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0225 Mutant ME124P PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
ME124P Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDAVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0226 Mutant ME132
DNA Artificial
CGTTTCTAATCAGACTCAATTTGCCGCTGTTAAAGTCCTGTCTCAGGACAACC Forward
Primer Sequence ME132 0227 Mutant ME132 DNA Artificial
GGTTGTCCTGAGACAGGACTTTAACAGCGGCAAATTGAGTCTGATTAGAAACG Reverse
Primer Sequence ME132 0228 Mutant ME132 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME132 construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTGCCGCTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0229 Mutant ME132 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME117 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFAAVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
(ME132?)
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0230 Mutant ME142
DNA Artificial GTTAAAGTCCTGTCTCAGGACAACGCGATGGCAATCCAGGTTGGTGCTAACG
Forward Primer Sequence ME142 0231 Mutant ME142 DNA Artificial
CGTTAGCACCAACCTGGATTGCCATCGCGTTGTCCTGAGACAGGACTTTAAC Reverse Primer
Sequence ME142 0232 Mutant ME142 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME142 construct
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAACGAC
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACGCGATGGCAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0233 Mutant ME142 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME142 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNAMAIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0234 Mutant ME150
DNA Artificial
GATGAAAATCCAGGTTGGTGCTAGCGCTGCTGAAACCATTACCATCGATCTGC Forward
Primer Sequence ME150 0235 Mutant ME150 DNA Artificial
GCAGATCGATGGTAATGGTTTCAGCAGCGCTAGCACCAACCTGGATTTTCATC Reverse
Primer Sequence ME150 0236 Mutant ME150 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME150
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAAC-
GAC construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAGCGCTGCTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACTATGCAACGGAAGTTTCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0237 Mutant ME150 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME150 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGASAAETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DYATEVSNMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0238 Mutant ME468
DNA Artificial
GCCGTATCGAAGATGCTGACGCTGGAGCGGAAGTTGCTAATATGTCTAAAGCGCAG Forward
Primer Sequence ME468 0239 Mutant ME468 DNA Artificial
CTGCGCTTTAGACATATTAGCAACTTCCGCTCCAGCGTCAGCATCTTCGATACGGC Reverse
Primer Sequence ME468 0240 Mutant ME468 DNA Artificial
TAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAATAATTTTGTTTAAC
Sequence of Sequence
TTTAAGAAGGAGATATACATATGAGCGGGTTACGGATCAACAGCGCGAAAGACGATGCGGCAGGCCA
ME468
GGCGATTGCTAACCGCTTCACTTCTAATATCAAAGGTCTGACTCAGGCTTCCCGTAACGCTAAC-
GAC construct
GGCATTTCTATTGCGCAGACCACTGAAGGTGCGCTGAATGAAATCAACAACAACCTGCAGCGTGTGC
GTGAGTTGTCTGTTCAGGCCACTAACGGGACTAACTCTGATTCCGATCTGAAATCTATCCAGGATGA
AATTCAGCAACGTCTGGAAGAAATCGATCGCGTTTCTAATCAGACTCAATTTAACGGTGTTAAAGTC
CTGTCTCAGGACAACCAGATGAAAATCCAGGTTGGTGCTAACGATGGTGAAACCATTACCATCGATC
TGCAAAAAATTGATGTGAAAAGCCTTGGCCTTGATGGGTTCAATGTTAATTCCCCGGGAAGTACCGC
TAACCCACTGGCTTCAATTGATTCTGCATTGTCAAAAGTGGACGCAGTTCGTTCTTCTCTGGGGGCA
ATTCAAAACCGCTTTGATTCAGCCATTACCAACCTTGGCAATACGGTAACCAATCTGAACTCCGCGC
GTAGCCGTATCGAAGATGCTGACGCTGGAGCGGAAGTTGCTAATATGTCTAAAGCGCAGATTCTGCA
GCAGGCTGGTACTTCCGTTCTGGCGCAGGCTAACCAGGTTCCGCAAAACGTCCTCTCTTTACTGGTT
CCGCGGGGTTCTCATCATCATCATCATCATGGTTAAGTCGAC 0241 Mutant ME468 PRT
Artificial
MSGLRINSAKDDAAGQAIANRFTSNIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQA
Mutant ME468 Sequence
TNGTNSDSDLKSIQDEIQQRLEEIDRVSNQTQFNGVKVLSQDNQMKIQVGANDGETITIDLQKIDVK
SLGLDGFNVNSPGSTANPLASIDSALSKVDAVRSSLGAIQNRFDSAITNLGNTVTNLNSARSRIEDA
DAGAEVANMSKAQILQQAGTSVLAQANQVPQNVLSLLVPRGSHHHHHHG 0242 Linker PRT
Artificial SPG Sequence
Uses of Flagellin-Related Compositions
[0059] In some embodiments, the flagellin-related compositions may
stimulate Toll-like receptor activity (e.g. TLR1, and/or TLR2,
and/or TLR3, and/or TLR4, and/or TLR5, and/or TLR6, and/or TLR7,
and/or TLR8, and/or TLR9, and/or TLR10, and/or TLR11, and/or TLR12,
and/or TLR13). The TLR family is composed of at least 10 members
and is essential for innate immune defense against pathogens. The
innate immune system recognizes conserved pathogen-associated
molecular patterns (PAMPs). TLR may recognize a conserved structure
that is particular to bacterial flagellin which may be composed of
a large group of residues that are somewhat permissive to variation
in amino acid content. Smith et al., Nat. Immunol. 4:1247-53 (2003)
have identified 13 conserved amino acids in flagellin that are part
of the conserved structure recognized by TLR5. The 13 conserved
amino acids of flagellin that may be important for TLR5 activity
are shown in FIGS. 1A and 1B.
[0060] In some embodiments, the flagellin-related composition
activates TLR5 signaling. In some embodiments, the
flagellin-related composition activates TLR5 at the same levels, or
levels similar to, CBLB502. Activation of TLR5 induces expression
of the nuclear factor NF-.kappa.B, which in turn activates numerous
inflammatory-related cytokines. In further embodiments, the
flagellin-related compositions induce expression of proinflammatory
cytokines. In further embodiments, the flagellin-related
compositions induce expression of anti-inflammatory molecules. In
another embodiment, the flagellin-related compositions induce
expression of anti-apoptotic molecules. In yet a further
embodiment, the flagellin-related compositions induce expression of
anti-bacterial molecules. The targets of NF-.kappa.B, include, but
are not limited to, IL-.beta., TNF-.alpha., IL-6, IL-8, IL-18,
G-CSF, TNFSF13B, keratinocyte chemoattractant (KC), BLIMP1/PRDM1,
CCL5, CCL15, CCL17, CCL19, CCL20, CCL22, CCL23, CXCL1, CCL28,
CXCL11, CXCL10, CXCL3, CXCL1, GRO-beta, GRO-gamma, CXCL1, ICOS,
IFNG, IL-1A, IL-1B, IL1RN, IL-2, IL-9, IL-10, IL-11, IL-12, IL-12B,
IL-12A, IL-13, IL-15, IL-17, IL-23A, IL-27, EBI3, IFNB1, CXCL5, KC,
liGp1, CXCL5, CXCL6, LTA, LTB, CCL2, CXCL9, MCP-1/JE, CCL3, CCL4,
CXCL3, CCL20, CXCL10, CXCL5, CCL5, CCL1, TNFbeta, TNFSF10, TFF3,
TNFSF15, CD86, complement component 8a, CCL27, defensin-.beta.3,
MIG, MIP-2, and/or NOD2/CARD15.
[0061] In some embodiments, activating TLR5 signaling may regulate
CD4.sup.+ T-cell immune function by increasing the generation of
regulatory T-cells (T.sub.regS), decreasing LPS-induced ERK1/2
activation, and/or activating Natural Killer (NK) T-cells.
Diseases and Methods of Treatment/Prevention
[0062] In various embodiments, the flagellin-related compositions
(and/or additional agents) and methods described herein are
applicable to variety of disease states. In one aspect, the
invention provides a method of stimulating TLR5 signaling
comprising administering a flagellin-related composition of the
invention to a subject in need thereof. Activating TLR5 signaling
may have broad therapeutic applications, including, but not limited
to treating cancer, protecting from radiation-induced or
reperfusion-induced damage, acting as adjuvant in vaccines, or
protecting cells from cytotoxic compounds.
[0063] In some embodiments, the flagellin-related compositions of
the invention, or fragments thereof may be provided as adjuvants to
viral vaccines. In one embodiment, the flagellin-related
compositions or fragments thereof may be administered in
conjunction with an influenza vaccine or antigen to elicit a
greater host immune response to the influenza antigens. In yet a
further embodiment, the flagellin-related compositions of the
invention, or fragments thereof may be provided as adjuvants to
vaccines against parasites. In one embodiment, the
flagellin-related compositions or fragments thereof may be
administered in conjunction with an Plasmodium vaccine or antigen
to elicit a greater host immune response to the Plasmodium
antigen.
[0064] In some embodiments, the flagellin-related compositions of
the invention may be administered to protect cells from toxic
conditions. In some embodiments, the flagellin-related compositions
may prevent liver cells from Fas-mediated injury. The
flagellin-related compositions of the invention may cause a
decrease in liver enzymes in the peripheral blood and caspase
activation.
[0065] Cancers
[0066] In various embodiments, the present invention pertains to
cancers and/or tumors; for example, the treatment or prevention of
cancers and/or tumors. As used herein, "cancer" or "tumor" refers
to an uncontrolled growth of cells and/or abnormal increased cell
survival and/or inhibition of apoptosis which interferes with the
normal functioning of the bodily organs and systems. Included are
benign and malignant cancers, polyps, hyperplasia, as well as
dormant tumors or micrometastases. Also, included are cells having
abnormal proliferation that is not impeded by the immune system
(e.g. virus infected cells). A subject that has a cancer or a tumor
is a subject having objectively measurable cancer cells present in
the subject's body. Cancers which migrate from their original
location and seed vital organs can eventually lead to the death of
the subject through the functional deterioration of the affected
organs. Hematopoietic cancers, such as leukemia, are able to
out-compete the normal hematopoietic compartments in a subject,
thereby leading to hematopoietic failure (in the form of anemia,
thrombocytopenia and neutropenia) ultimately causing death.
[0067] The cancer may be a primary cancer or a metastatic cancer.
The primary cancer may be an area of cancer cells at an originating
site that becomes clinically detectable, and may be a primary
tumor. In contrast, the metastatic cancer may be the spread of a
disease from one organ or part to another non-adjacent organ or
part. The metastatic cancer may be caused by a cancer cell that
acquires the ability to penetrate and infiltrate surrounding normal
tissues in a local area, forming a new tumor, which may be a local
metastasis.
[0068] The cancer may also be caused by a cancer cell that acquires
the ability to penetrate the walls of lymphatic and/or blood
vessels, after which the cancer cell is able to circulate through
the bloodstream (thereby being a circulating tumor cell) to other
sites and tissues in the body. The cancer may be due to a process
such as lymphatic or hematogenous spread. The cancer may also be
caused by a tumor cell that comes to rest at another site,
re-penetrates through the vessel or walls, continues to multiply,
and eventually forms another clinically detectable tumor. The
cancer may be this new tumor, which may be a metastatic (or
secondary) tumor.
[0069] The cancer may be caused by tumor cells that have
metastasized, which may be a secondary or metastatic tumor. The
cells of the tumor may be like those in the original tumor. As an
example, if a breast cancer or colon cancer metastasizes to the
liver, the secondary tumor, while present in the liver, is made up
of abnormal breast or colon cells, not of abnormal liver cells. The
tumor in the liver may thus be a metastatic breast cancer or a
metastatic colon cancer, not liver cancer.
[0070] The cancer may have an origin from any tissue. The cancer
may originate from, for example, melanoma, colon, breast, or
prostate, and thus may be made up of cells that were originally
skin, colon, breast, or prostate, respectively. The cancer may also
be a hematological malignancy, which may be lymphoma. The cancer
may invade a tissue such as liver, lung, bladder, or intestinal.
The invaded tissue may express a TLR, while the cancer may or may
not express a TLR.
[0071] Also provided herein is a method of reducing cancer
recurrence, comprising administering to a mammal in need thereof a
flagellin-related composition of the invention. The cancer may be
or may have been present in a tissue that either does or does not
express TLR, such as TLR5. The method may also prevent cancer
recurrence. The cancer may be an oncological disease. The cancer
may be a dormant tumor, which may result from the metastasis of a
cancer. The dormant tumor may also be left over from surgical
removal of a tumor. The cancer recurrence may be tumor regrowth, a
lung metastasis, or a liver metastasis.
[0072] Representative cancers and/or tumors of the present
invention may or may not express TLR5, and may include, but are not
limited to, a basal cell carcinoma, biliary tract cancer; bladder
cancer; bone cancer; brain and central nervous system cancer;
breast cancer; cancer of the peritoneum; cervical cancer;
choriocarcinoma; colon and rectum cancer; connective tissue cancer;
cancer of the digestive system; endometrial cancer; esophageal
cancer; eye cancer; cancer of the head and neck; gastric cancer
(including gastrointestinal cancer); glioblastoma; hepatic
carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal
cancer; larynx cancer; leukemia; liver cancer; lung cancer (e.g.,
small-cell lung cancer, non-small cell lung cancer, adenocarcinoma
of the lung, and squamous carcinoma of the lung); melanoma;
myeloma; neuroblastoma; oral cavity cancer (lip, tongue, mouth, and
pharynx); ovarian cancer; pancreatic cancer; prostate cancer;
retinoblastoma; rhabdomyosarcoma; rectal cancer; cancer of the
respiratory system; salivary gland carcinoma; sarcoma; skin cancer;
squamous cell cancer; stomach cancer; testicular cancer; thyroid
cancer; uterine or endometrial cancer; cancer of the urinary
system; vulval cancer; lymphoma including Hodgkin's and
non-Hodgkin's lymphoma, as well as B-cell lymphoma (including low
grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic
(SL) NHL; intermediate grade/follicular NHL; intermediate grade
diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic
NHL; high grade small non-cleaved cell NHL; bulky disease NHL;
mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's
Macroglobulinemia; chronic lymphocytic leukemia (CLL); acute
lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic
myeloblastic leukemia; as well as other carcinomas and sarcomas;
and post-transplant lymphoproliferative disorder (PTLD), as well as
abnormal vascular proliferation associated with phakomatoses, edema
(such as that associated with brain tumors), and Meigs'
syndrome.
[0073] The flagellin-related compositions (and/or additional
agents) and methods described herein are applicable metastatic
diseases, including cancers and/or tumors. "Metastasis" refers to
the spread of cancer from a primary site to other places in the
body. Cancer cells can break away from a primary tumor, penetrate
into lymphatic and blood vessels, circulate through the
bloodstream, and grow in a distant focus (metastasize) in normal
tissues elsewhere in the body. Metastasis can be local or distant.
Metastasis is a sequential process, contingent on tumor cells
breaking off from the primary tumor, traveling through the
bloodstream, and stopping at a distant site. At the new site, the
cells establish a blood supply and can grow to form a
life-threatening mass. Both stimulatory and inhibitory molecular
pathways within the tumor cell regulate this behavior, and
interactions between the tumor cell and host cells in the distant
site are also significant.
[0074] Metastases may be detected through the sole or combined use
of magnetic resonance imaging (MRI) scans, computed tomography (CT)
scans, blood and platelet counts, liver function studies, chest
X-rays and bone scans in addition to the monitoring of specific
symptoms.
[0075] In some embodiments, the invention relates to a method of
treating a mammal suffering from a constitutively active
NF-.kappa.B cancer comprising administering to the mammal a
composition comprising a therapeutically effective amount of an
agent that induces NF-.kappa.B activity, including the
flagellin-related compositions (and/or additional agents) described
herein. The agent that induces NF-.kappa.B activity may be
administered in combination with a cancer treatment.
[0076] In some embodiments, the present invention includes methods
for treatment of side effects from cancer treatment comprising
administering the flagellin-related composition (and/or additional
agents) described herein. In some embodiments, the side effects
from cancer treatment include alopecia, myelosuppression, renal
toxicity, weight loss; pain, nausea, vomiting, diarrhea,
constipation, anemia, malnutrition, hair loss, numbness, changes in
tastes, loss of appetite, thinned or brittle hair, mouth sores,
memory loss, hemorrhage, cardiotoxicity, hepatotoxicity,
ototoxicity, and post-chemotherapy cognitive impairment.
[0077] In some embodiments, the present invention relates to a
method of treating a mammal suffering from damage to normal tissue
attributable to treatment of cancer, including but not limited to a
constitutively active NF-.kappa.B cancer, comprising administering
to the mammal a composition comprising a therapeutically effective
amount of the flagellin-related composition (and/or additional
agents) described herein.
[0078] Ageing and Stress
[0079] In some embodiments, the present invention includes methods
for modulation of cell aging comprising administering the
flagellin-related composition (and/or additional agents) described
herein.
[0080] In some embodiments, the present invention includes methods
for treatment of stress comprising administering the
flagellin-related composition (and/or additional agents) described
herein. This invention also relates to a method of treating a
subject suffering from damage to normal tissue attributable to
stress, comprising administering to the mammal a composition
comprising a therapeutically effective amount of a
flagellin-related composition (and/or additional agents). The
stress may be attributable to any source including, but not limited
to, radiation, wounding, poisoning, infection, and temperature
shock.
[0081] In some embodiments, the flagellin-related composition
(and/or additional agents) may be administered at any point prior
to exposure to the stress including, but not limited to, about 48
hr, about 46 hr, about 44 hr, about 42 hr, about 40 hr, about 38
hr, about 36 hr, about 34 hr, about 32 hr, about 30 hr, about 28
hr, about 26 hr, about 24 hr, about 22 hr, about 20 hr, about 18
hr, about 16 hr, about 14 hr, about 12 hr, about 10 hr, about 8 hr,
about 6 hr, about 4 hr, about 3 hr, about 2 hr, or about 1 hr prior
to exposure. In some embodiments, the flagellin-related composition
may be administered at any point after exposure to the stress
including, but not limited to, about 1 hr, about 2 hr, about 3 hr,
about 4 hr, about 6 hr, about 8 hr, about 10 hr, about 12 hr, about
14 hr, about 16 hr, about 18 hr, about 20 hr, about 22 hr, about 24
hr, about 26 hr, about 28 hr, about 30 hr, about 32 hr, about 34
hr, about 36 hr, about 38 hr, about 40 hr, about 42 hr, about 44
hr, about 46 hr, or about 48 hr after exposure.
[0082] Mitigation and Prevention of Radiation Damage
[0083] In still other embodiments, the present invention relates to
treatment of radiation related diseases or damage. In specific
embodiments, the present invention relates to mitigation of or
prevention and/or protection from radiation related diseases.
[0084] In one embodiment, the present invention relates to the
protection of cells from the effects of exposure to radiation. In
some embodiments, the present invention pertains to a method of
protecting a subject from radiation comprising administering a
flagellin-related composition (and/or additional agents) described
herein. In some embodiments, the radiation is ionizing radiation.
In some embodiments, the ionizing radiation is sufficient to cause
gastrointestinal syndrome or hematopoietic syndrome. In some
embodiments, the flagellin-related composition (and/or additional
agents) described herein is administered in combination with a
radioprotectant e.g. an antioxidant (e.g. amifostine and vitamin
E), a cytokine (e.g. a stem cell factor), etc. In some embodiments,
the flagellin-related composition (and/or additional agents)
described herein is administered prior to, together with, or after
radiation. In some embodiments, the flagellin-related composition
(and/or additional agents) described herein is administered in
combination with a growth factor (e.g. keratinocyte growth factor),
a steroid (e.g. 5-androstenediol), ammonium
triohloro(dioxoethylene-O,O')tellurate, thyroid protecting agents
(e.g. Potassium iodide (KI)), anti-nausea agents, anti-diarrhea
agents, analgesics, anxiolytics, sedatives, cytokine therapy,
antibiotics, antifungal agents, and/or antiviral agents.
[0085] In some embodiments, the present invention pertains to a
method of treating and/or mitigating apoptosis-mediated tissue
damage in a subject, comprising administering to a subject in need
thereof a composition comprising a flagellin-related composition
(and/or additional agents) described herein. In some embodiments
the apoptosis is attributable to cellular stress. In some
embodiments, the flagellin-related composition (and/or additional
agents) described herein is administered prior to, together with,
or after the tissue damage. In some embodiments, the cellular
stress is radiation. In some embodiments, the flagellin-related
composition (and/or additional agents) is administered in
combination with a radioprotectant (e.g. an antioxidant (e.g.
amifostine and vitamin E), a cytokine (e.g. a stem cell factor),
etc.
[0086] Injury and death of normal cells from ionizing radiation is
a combination of a direct radiation-induced damage to the exposed
cells and an active genetically programmed cell reaction to
radiation-induced stress resulting in a suicidal death or
apoptosis. Apoptosis plays a key role in massive cell loss
occurring in several radiosensitive organs (e.g., hematopoietic and
immune systems, epithelium of digestive tract, etc.), the failure
of which determines general radiosensitivity of the organism. In
some embodiments, administration of the flagellin-related
compositions of the invention to a subject in need thereof
suppresses apoptosis in cells. In some embodiments, the
flagellin-related compositions of the invention are administered to
a subject undergoing cancer radiotherapy treatment to protect
healthy cells from the damaging effects of the radiation
treatment.
[0087] Exposure to ionizing radiation (IR) may be short- or
long-term, and/or it may be applied as a single or multiple doses
and/or it may be applied to the whole body or locally. The present
invention, in some embodiments, pertains to nuclear accidents or
military attacks, which may involve exposure to a single high dose
of whole body irradiation (sometimes followed by a long-term
poisoning with radioactive isotopes). The same is true (with strict
control of the applied dose), for example, for pretreatment of
patients for bone marrow transplantation when it is necessary to
prepare hematopoietic organs for donor's bone marrow by "cleaning"
them from the host blood precursors. Cancer treatment may involve
multiple doses of local irradiation that greatly exceeds lethal
dose if it were applied as a total body irradiation. Poisoning or
treatment with radioactive isotopes results in a long-term local
exposure to radiation of targeted organs (e.g., thyroid gland in
the case of inhalation of .sup.125I). Further, there are many
physical forms of ionizing radiation differing significantly in the
severity of biological effects.
[0088] At the molecular and cellular level, radiation particles are
able to produce breakage and cross-linking in the DNA, proteins,
cell membranes and other macromolecular structures. Ionizing
radiation also induces the secondary damage to the cellular
components by giving rise to the free radicals and reactive oxygen
species (ROS). Multiple repair systems counteract this damage, such
as, several DNA repair pathways that restore the integrity and
fidelity of the DNA, and antioxidant chemicals and enzymes that
scavenge the free radicals and ROS and reduce the oxidized proteins
and lipids. Cellular checkpoint systems detect the DNA defects and
delay cell cycle progression until damage is repaired or decision
to commit cell to growth arrest or programmed cell death
(apoptosis) is reached
[0089] Radiation can cause damage to mammalian organism ranging
from mild mutagenic and carcinogenic effects of low doses to almost
instant killing by high doses. Overall radiosensitivity of the
organism is determined by pathological alterations developed in
several sensitive tissues that include hematopoietic system,
reproductive system and different epithelia with high rate of cell
turnover.
[0090] Acute pathological outcome of gamma irradiation leading to
death is different for different doses and may be determined by the
failure of certain organs that define the threshold of organism's
sensitivity to each particular dose. Thus, lethality at lower doses
occurs, for example, from bone marrow aplasia, while moderate doses
kill faster, for example, by inducing a gastrointestinal (GI)
syndrome. Very high doses of radiation can cause almost instant
death eliciting neuronal degeneration.
[0091] Organisms that survive a period of acute toxicity of
radiation can suffer from long-term remote consequences that
include radiation-induced carcinogenesis and fibrosis developing in
exposed organs (e.g., kidney, liver or lungs) in the months and
years after irradiation.
[0092] Cellular DNA is a major target of IR that causes a variety
of types of DNA damage (genotoxic stress) by direct and indirect
(e.g. free radical-based) mechanisms. All organisms maintain DNA
repair system capable of effective recovery of radiation-damaged
DNA; errors in DNA repair process may lead to mutations.
[0093] In some embodiments, the radiation exposure experienced by
the subject is a consequence of cancer radiotherapy treatment.
Tumors are generally more sensitive to gamma radiation and can be
treated with multiple local doses that cause relatively low damage
to normal tissue. Nevertheless, in some instances, damage of normal
tissues is a limiting factor in application of gamma radiation for
cancer treatment. The use of gamma-irradiation during cancer
therapy by conventional, three-dimensional conformal or even more
focused BeamCath delivery has also dose-limiting toxicities caused
by cumulative effect of irradiation and inducing the damage of the
stem cells of rapidly renewing normal tissues, such as bone marrow
and gastrointestinal (GI) tract. Administration of the
flagellin-related compositions of the invention may protect the
patient's healthy cells from radiation damage without affecting the
radiosensitivity of the tumor cells.
[0094] In some embodiments, the subject has been exposed to lethal
doses of radiation. At high doses, radiation-induced lethality is
associated with so-called hematopoietic and gastrointestinal
radiation syndromes. Hematopoietic syndrome is characterized by
loss of hematopoietic cells and their progenitors making it
impossible to regenerate blood and lymphoid system. Death usually
occurs as a consequence of infection (result of immunosuppression),
hemorrhage and/or anemia. GI syndrome is caused by massive cell
death in the intestinal epithelium, predominantly in the small
intestine, followed by disintegration of intestinal wall and death
from bacteremia and sepsis. Hematopoietic syndrome usually prevails
at the lower doses of radiation and leads to the more delayed death
than GI syndrome.
[0095] In the past, radioprotectants were typically
antioxidants-both synthetic and natural. More recently, cytokines
and growth factors have been added to the list of radioprotectants;
the mechanism of their radioprotection is considered to be a result
of facilitating the effects on regeneration of sensitive tissues.
There is no clear functional distinction between both groups of
radioprotectants, however, since some cytokines induce the
expression of the cellular antioxidant proteins, such as manganese
superoxide dismutase (MnSOD) and metallothionein.
[0096] The measure of protection for a particular agent may be
expressed by dose modification factor (DMF or DRF). DMF is
determined by irradiating the radioprotector treated subject and
untreated control subjects with a range of radiation doses and then
comparing the survival or some other endpoints. DMF is commonly
calculated for 30-day survival (LD50/30 drug-treated divided by
LD50/30 vehicle-treated) and quantifies the protection of the
hematopoietic system. In order to estimate gastrointestinal system
protection, LD50 and DMF are calculated for 6- or 7-day
survival.
[0097] The flagellin-related compositions described herein possess
strong pro-survival activity at the cellular level and on the
organism as a whole. In response to super-lethal doses of
radiation, the flagellin-related compositions described herein may
inhibit both gastrointestinal and hematopoietic syndromes, which
are major causes of death from acute radiation exposure. As a
result of these properties, the flagellin-related compositions
described herein may be used to treat the effects of natural
radiation events and nuclear accidents. Moreover, the
flagellin-related compositions described herein can be used in
combination with other radioprotectants, thereby, dramatically
increasing the scale of protection from ionizing radiation.
[0098] As opposed to conventional radioprotective agents (e.g.,
scavengers of free radicals), anti-apoptotic agents may not reduce
primary radiation-mediated damage but may act against secondary
events involving active cell reaction on primary damage, therefore
complementing the existing lines of defense. Pifithrin-alpha, a
pharmacological inhibitor of p53 (a key mediator of radiation
response in mammalian cells), is an example of this new class of
radioprotectants. However, the activity of p53 inhibitors is
limited to protection of the hematopoietic system and has no
protective effect in digestive tract (gastrointestinal syndrome),
therefore reducing therapeutic value of these compounds.
[0099] The flagellin-related compositions described herein may be
used as a radioprotective agent to extend the range of tolerable
radiation doses by increasing radioresistance of humans beyond the
levels achievable by currently available measures (shielding and
application of existing bioprotective agents) and drastically
increase the chances of crew survival in case of nuclear accidents
or large-scale solar particle events, for example.
[0100] The flagellin-related compositions described herein are also
useful for treating irreplaceable cell loss caused by low-dose
irradiation, for example, in the central nervous system and
reproductive organs. The flagellin-related compositions described
herein may also be used during cancer chemotherapy to treat the
side effects associated with chemotherapy, including alopecia,
myelosuppression, renal toxicity, weight loss, pain, nausea,
vomiting, diarrhea, constipation, anemia, malnutrition, hair loss,
numbness, changes in tastes, loss of appetite, thinned or brittle
hair, mouth sores, memory loss, hemorrhage, cardiotoxicity,
hepatotoxicity, ototoxicity, and post-chemotherapy cognitive
impairment.
[0101] In one embodiment, a mammal is treated for exposure to
radiation, comprising administering to the mammal a composition
comprising a therapeutically effective amount of a
flagellin-related composition. The flagellin-related composition
may be administered in combination with one or more
radioprotectants. The one or more radioprotectants may be any agent
that treats the effects of radiation exposure including, but not
limited to, antioxidants, free radical scavengers and
cytokines.
[0102] The flagellin-related compositions described herein may
inhibit radiation-induced programmed cell death in response to
damage in DNA and other cellular structures. In some embodiments,
the flagellin-related compositions described herein may not deal
with damage at the cellular and may not prevent mutations. Free
radicals and reactive oxygen species (ROS) are the major cause of
mutations and other intracellular damage. Antioxidants and free
radical scavengers are effective at preventing damage by free
radicals. The combination of a flagellin-related composition and an
antioxidant or free radical scavenger may result in less extensive
injury, higher survival, and improved health for mammals exposed to
radiation. Antioxidants and free radical scavengers that may be
used in the practice of the invention include, but are not limited
to, thiols, such as cysteine, cysteamine, glutathione and
bilirubin; amifostine (WR-2721); vitamin A; vitamin C; vitamin E;
and flavonoids such as Indian holy basil (Ocimum sanctum), orientin
and vicenin.
[0103] The flagellin-related compositions described herein may also
be administered in combination with a number of cytokines and
growth factors that confer radioprotection by replenishing and/or
protecting the radiosensitive stem cell populations.
Radioprotection with minimal side effects may be achieved by the
use of stem cell factor (SCF, c-kit ligand), Flt-3 ligand, and
interleukin-1 fragment IL-1 b-rd. Protection may be achieved
through induction of proliferation of stem cells (all mentioned
cytokines), and prevention of their apoptosis (SCF). The treatment
allows accumulation of leukocytes and their precursors prior to
irradiation thus enabling quicker reconstitution of the immune
system after irradiation. SCF efficiently rescues lethally
irradiated mice with DMF in range 1.3-1.35 and is also effective
against gastrointestinal syndrome. Flt-3 ligand also provides
strong protection in mice and rabbits.
[0104] Several factors, while not cytokines by nature, stimulate
the proliferation of the immunocytes and may be used in combination
with the flagellin-related compositions described herein. For
example, 5-AED (5-androstenediol) is a steroid that stimulates the
expression of cytokines and increases resistance to bacterial and
viral infections. Synthetic compounds, such as ammonium
tri-chloro(dioxoethylene-O,O'-) tellurate (AS-101), may also be
used to induce secretion of numerous cytokines and for combination
with the flagellin-related compositions described herein.
[0105] Growth factors and cytokines may also be used to provide
protection against the gastrointestinal syndrome. Keratinocyte
growth factor (KGF) promotes proliferation and differentiation in
the intestinal mucosa, and increases the post-irradiation cell
survival in the intestinal crypts. Flematopoietic cytokine and
radioprotectant SCF may also increase intestinal stem cell survival
and associated short-term organism survival.
[0106] The flagellin-related compositions described herein may
offer protection against both gastrointestinal (GI) and
hematopoietic syndromes. Such compositions may be used in
combination with one or more inhibitors of GI syndrome (including,
but are not limited to, cytokines such as SCF and KGF).
[0107] The flagellin-related composition may be administered at any
point prior to exposure to radiation including, but not limited to,
about 48 hr, about 46 hr, about 44 hr, about 42 hr, about 40 hr,
about 38 hr, about 36 hr, about 34 hr, about 32 hr, about 30 hr,
about 28 hr, about 26 hr, about 24 hr, about 22 hr, about 20 hr,
about 18 hr, about 16 hr, about 14 hr, about 12 hr, about 10 hr,
about 8 hr, about 6 hr, about 4 hr, about 3 hr, about 2 hr, or
about 1 hr prior to exposure. The flagellin-related composition may
be administered at any point after exposure to radiation including,
but not limited to, about 1 hr, about 2 hr, about 3 hr, about 4 hr,
about 6 hr, about 8 hr, about 10 hr, about 12 hr, about 14 hr,
about 16 hr, about 18 hr, about 20 hr, about 22 hr, about 24 hr,
about 26 hr, about 28 hr, about 30 hr, about 32 hr, about 34 hr,
about 36 hr, about 38 hr, about 40 hr, about 42 hr, about 44 hr,
about 46 hr, or about 48 hr after exposure to radiation.
[0108] In various embodiments, the present methods and compositions
provide treatment or prevention of radiation-related disorders,
such as ARS. In various embodiments, the treatments described
herein reduce morbidity or mortality of an exposed population of
human patients or accelerates recovery from symptoms of ARS. ARS
often presents as a sequence of phased symptoms, which may vary
with individual radiation sensitivity, type of radiation, and the
radiation dose absorbed. Generally, without wishing to be bound by
theory, the extent of symptoms will heighten and the duration of
each phase will shorten with increasing radiation dose. ARS can be
divided into three phases: prodromal phase (a.k.a. N-V-D stage),
latent period and manifest illness. In various embodiments, the
flagellin-related compositions (and/or additional agents), as
described herein, may be administered to a human patient in any one
of these three stages (i.e. the flagellin-related compositions
(and/or additional agents) may be administered to a human patient
in the prodromal phase, the flagellin-related compositions (and/or
additional agents) may be administered to a human patient in latent
period, or the flagellin-related compositions (and/or additional
agents) may be administered to a human patient in manifest illness
stage).
[0109] In the prodromal phase there is often a relatively rapid
onset of nausea, vomiting, and malaise. Use of antiemetics, (e.g.
oral prophylactic antiemetics) such as granisetron (KYTRIL),
ondansetron (ZOFRAN), and 5-HT3 blockers with or without
dexamethasone, may be indicated in situations where high-dose
radiological exposure has occurred, is likely, or is unavoidable.
Accordingly, in various embodiments, the flagellin-related
compositions (and/or additional agents) may be administered to a
human patient in receiving an anti-emetic agent or CBLB502 may be
administered to a human patient in combination with an anti-emetic
agent. For example, the flagellin-related compositions (and/or
additional agents) may also be added to the following antiemetic
regimens: Ondansetron: initially 0.15 mg/kg IV; a continuous IV
dose option consists of 8 mg followed by 1 mg/h for the next 24
hours. Oral dose is 8 mg every 8 hours as needed or Granisetron
(oral dosage form): dose is usually 1 mg initially, then repeated
12 hours after the first dose. Alternatively, 2 mg may be taken as
one dose. IV dose is based on body weight; typically 10 .mu.g/kg
(4.5 .mu.g/lb) of body weight.
[0110] In the latent period, a human patient may be relatively
symptom free. The length of this phase varies with the dose. The
latent phase is longest preceding the bone-marrow depression of the
hematopoietic syndrome and may vary between about 2 and 6 weeks.
The latent period is somewhat shorter prior to the gastrointestinal
syndrome, lasting from a few days to a week. It is shortest of all
preceding the neurovascular syndrome, lasting only a matter of
hours. These times are variable and may be modified by the presence
of other disease or injury. Manifest illness presents with the
clinical symptoms associated with the major organ system injured
(marrow, intestinal, neurovascular).
[0111] In some embodiments, the present invention relates to the
mitigation of, or protection of cells from, the effects of exposure
to radiation. In some embodiments, the present invention pertains
to a method of mitigating and/or protecting a human patient from
radiation comprising administering the flagellin-related
compositions (and/or additional agents). In some embodiments, the
radiation is ionizing radiation. In some embodiments, the ionizing
radiation is sufficient to cause gastrointestinal syndrome or
hematopoietic syndrome.
[0112] In some embodiments, the ARS comprises one of more of
gastrointestinal syndrome; hematopoietic syndrome; neurovascular
syndrome; apoptosis-mediated tissue damage, wherein the apoptosis
is optionally attributable to cellular stress; and ionizing
radiation induced apoptosis tissue damage.
[0113] Hematopoietic syndrome (a.k.a. bone marrow syndrome) is
characterized by loss of hematopoietic cells and their progenitors
making it impossible to regenerate blood and lymphoid system. This
syndrome is often marked by a drop in the number of blood cells,
i.e., aplastic anemia. This may result in infections (e.g.
opportunistic infections) due to a low amount of white blood cells,
bleeding due to a lack of platelets, and anemia due to few red
blood cells in the circulation. These changes can be detected by
blood tests after receiving a whole-body acute dose. Conventional
trauma and burns resulting from a bomb blast are complicated by the
poor wound healing caused by hematopoietic syndrome, increasing
mortality. Death may occur as a consequence of infection (result of
immunosuppression), hemorrhage and/or anemia. Hematopoietic
syndrome usually prevails at the lower doses of radiation and leads
to the more delayed death than GI syndrome.
[0114] Gastrointestinal syndrome is caused by massive cell death in
the intestinal epithelium, predominantly in the small intestine,
followed by disintegration of intestinal wall and death from
bacteremia and sepsis. Symptoms of this form of radiation injury
include nausea, vomiting, loss of appetite, loss of absorptive
capacity, hemorrhage in denuded areas, and abdominal pain.
Illustrative systemic effects of gastrointestinal syndrome include
malnutrition, dehydration, renal failure, anemia, sepsis, etc.
Without treatment (including, for example, bone marrow transplant),
death is common (e.g. via infection from intestinal bacteria). In
some embodiments, the flagellin-related compositions (and/or
additional agents), may be used in combination with bone marrow
transplant. In some embodiments, the flagellin-related compositions
(and/or additional agents), may be used in combination with one or
more inhibitors of GI syndrome and/or any of the additional agents
described herein.
[0115] Neurovascular syndrome presents with neurological symptoms
such as dizziness, headache, or decreased level of consciousness,
occurring within minutes to a few hours, and with an absence of
vomiting. Additional symptoms include extreme nervousness and
confusion; severe nausea, vomiting, and watery diarrhea; loss of
consciousness; and burning sensations of the skin. Neurovascular
syndrome is commonly fatal.
[0116] In some embodiments, the present invention provides a method
for reducing the risk of death following exposure to irradiation
comprising administering an effective amount of the
flagellin-related compositions (and/or additional agents) In some
embodiments, the radiation is potentially lethal, and, optionally,
occurs as the result of a radiation disaster. In various
embodiments, the flagellin-related compositions (and/or additional
agents) is administered within about 25 hours following radiation
exposure. In some embodiments, the present invention provides a
method for reducing the risk of death following exposure to
potentially lethal irradiation occurring as the result of a
radiation disaster, comprising administering the flagellin-related
compositions (and/or additional agents) within about 25 hours
following radiation exposure.
[0117] In various embodiments, the flagellin-related compositions
(and/or additional agents) are administered to a patient who has
been exposed to a high dose of radiation, namely a whole body dose.
In various embodiments, the high dose of radiation may not be
uniform. In various embodiments, the ARS is a result of a high dose
of radiation. In various embodiments, the high dose of radiation is
about 2.0 Gy, or about 2.5 Gy, or about 3.0 Gy, or about 3.5 Gy, or
about 4.0 Gy, or about 4.5 Gy, or about 5 Gy, or about 10 Gy, or
about 15 Gy, or about 20 Gy, or about 25 Gy, or about 30 Gy. In
various embodiments, the high dose of radiation is about 5 to about
30 Gy, or about 10 to 25 Gy, or about 15 to 20 Gy. In some
embodiments, the high dose of radiation is assessed by one or more
of physical dosimetry and/or biological dosimetry (e.g.
multiparameter dose assessments), cytogenics (e.g. chromosomal
analysis for, for example, blood samples (including, by way of
non-limiting example, dicentric analysis). In various embodiments,
whole-body radiation doses can be divided into sublethal (<2
Gy), potentially lethal (2-10 Gy), and supralethal (>10 Gy).
[0118] Reperfusion Injuries
[0119] In some embodiments, the present invention pertains to a
method of treating the effects of reperfusion on a subject's tissue
comprising administering the flagellin-related compositions (and/or
additional agents) described herein. The flagellin-related
compositions (and/or additional agents) described herein may be
administered in combination with an antioxidant, such as, for
example, amifostine and vitamin E.
[0120] Reperfusion may be caused by an injury, which may be
ischemia or hypoxia. The ischemia may result from a condition such
as, for example, tachycardia, infarction, hypotension, embolism,
thromboembolism (blood clot), sickle cell disease, localized
pressure to extremities to the body, and tumors. The hypoxia may be
selected from hypoxemic hypoxia (carbon monoxide poisoning; sleep
apnea, chronic obstructive pulmonary disease, respiratory arrest;
shunts), anemic hypoxia (O.sub.2 content low), hypoxemic hypoxia,
and histotoxic hypoxia. The localized pressure may be due to a
tourniquet.
[0121] The flagellin-related compositions (and/or additional
agents) described herein may be administered prior to, together
with, or after the influx of oxygen. The tissue may be for example,
the GI tract, lung, kidney, liver, cardiovascular system, blood
vessel endothelium, central nervous system, peripheral nervous
system, muscle, bone, and hair follicle.
[0122] Reperfusion may damage a body component when blood supply
returns to the body component after the injury. The effects of
reperfusion may be more damaging to the body component than the
injury itself. There are several mechanism and mediators of
reperfusion including, for example, oxygen free radicals,
intracellular calcium overload, and endothelial dysfunction.
Excessive quantities of reactive oxygen species, when reintroduced
into a previously injured body component, undergo a sequential
reduction leading to the formation of oxygen free radicals. Potent
oxidant radicals, such as superoxide anion, hydroxyl radical, and
peroxynitrite may be produced within the first few minutes of
reflow to the body component and may play a crucial role in the
development of reperfusion injury. Oxygen free radicals also can be
generated from sources other than reduction of molecular oxygen.
These sources include enzymes, such as, for example, xanthine
oxidase, cytochrome oxidase, and cyclooxygenase, and the oxidation
of catecholamines.
[0123] Reperfusion is also a potent stimulus for neutrophil
activation and accumulation, which in turn serve as potent stimuli
for reactive oxygen species production. Specifically, the main
products of the neutrophil respiratory burst are strong oxidizing
agents including hydrogen peroxide, free oxygen radicals and
hypochlorite. Neutrophils are the most abundant type of phagocyte,
normally representing 50 to 60% of the total circulating
leukocytes, and are usually the first cells to arrive at the site
of injured body component. Oxygen-derived free radicals produce
damage by reacting with polyunsaturated fatty acids, resulting in
the formation of lipid peroxides and hydroperoxides that damage the
body component and impair the function of membrane-bound enzyme
systems. Free radicals stimulate the endothelial release of
platelet activating factor and chemokines such as neutrophil
activator factor, chemokine (C-X-C motif) ligand 1, and chemokine
(C-X-C motif) ligand 1 which attracts more neutrophils and
amplifies the production of oxidant radicals and the degree of
reperfusion injury. Reactive oxygen species also quench nitric
oxide, exaggerating endothelial injury and tissue cell dysfunction.
In addition to an increased production, there is also a relative
deficiency in endogenous oxidant scavenging enzymes, which further
exaggerates free radical-mediated cardiac dysfunction.
[0124] Reperfusion may further result in marked endothelial cell
dysfunction. Endothelial dysfunction facilitates the expression of
a prothrombotic phenotype characterized by platelet and neutrophil
activation, important mediators of reperfusion. Once neutrophils
make contact with the dysfunctional endothelium, they are
activated, and in a series of well-defined steps (rolling, firm
adherence, and transmigration) they migrate into areas of tissue
injury through endothelial cell junctions as part of the innate
immune response.
[0125] Changes in intracellular calcium homeostasis play an
important role in the development of reperfusion. Reperfusion may
be associated with an increase in intracellular calcium; this
effect may be related to increased sarcolemmal calcium entry
through L-type calcium channels or may be secondary to alterations
in sarcoplasmic reticulum calcium cycling. In addition to
intracellular calcium overload, alterations in myofilament
sensitivity to calcium have been implicated in reperfusion.
Activation of calcium-dependent proteases (calpain I) with
resultant myofibril proteolysis has been suggested to underscore
reperfusion injury, as has proteolysis of troponin.
[0126] Reperfusion of tissue cells subjected to an injury had an
altered cellular metabolism, which in turn may contribute to
delayed functional recovery. For example, an injury may induce
anaerobic metabolism in the cell with a net production of lactate.
Lactate release persists during reperfusion, suggesting a delayed
recovery of normal aerobic metabolism. Likewise, the activity of
mitochondrial pyruvate dehydrogenase (PDH) may be inhibited up to
40% after an injury and may remain depressed for up to 30 minutes
after reperfusion.
[0127] Each of these events during reperfusion can lead to stress
to the tissue cells and programmed cell death (apoptosis) and
necrosis of the tissue cells. Apoptosis normally functions to
"clean" tissues from wounded and genetically damaged cells, while
cytokines serve to mobilize the defense system of the organism
against the pathogen. However, under conditions of severe injury
both stress response mechanisms can by themselves act as causes of
death.
[0128] In various embodiments, the effects of reperfusion may be
caused by an injury to the body. The injury may be due to ischemia,
hypoxia, an infarction, or an embolism. Treatment of the injury may
lead to reperfusion and further damage to the body component.
[0129] Ischemia may be an absolute or relative shortage of blood
supply to a body component. Relative shortage may be a mismatch,
however small, of blood supplied (oxygen delivery) to a body
component versus blood required to a body component for the
adequate oxygenation. Ischemia may also be an inadequate flow of
blood to a part of the body due to a constriction or blockage of
blood vessels supplying it and may affect any body component in the
body. Insufficient blood supply causes body components to become
hypoxic, or, if no oxygen is supplied at all, anoxic. This may
cause necrosis. The mechanisms of ischemia may vary greatly. For
example, ischemia to any body component may be due to tachycardia
(abnormally rapid beating of the heart), atherosclerosis
(lipid-laden plaque obstructing the lumen of arteries), hypotension
(low blood pressure in septic shock, heart failure),
thromboembolisms (blood clots), outside compression of blood
vessels (tumor), embolisms (foreign bodies in the circulation,
e.g., amniotic fluid embolism), sickle cell disease (abnormally
shaped hemoglobin), infarctions, induced g-forces which restrict
the blood flow and force the blood to extremities of the body,
localized extreme cold due to frostbite, ice, improper cold
compression therapy, and any other force that restricts blood flow
to the extremities such as a tourniquet. Force to restrict blood
flow to extremities may be required due to severe lacerations,
incisions, puncture such as a knifing, crushing injuries due to
blunt force trauma, and ballistic trauma due to gunshot or shrapnel
wounds. Ischemia may be a feature of heart diseases, ischemic
colitis, transient ischemia attacks, cerebrovascular accidents,
acute renal injury, ruptured arteriovenous malformations, and
peripheral artery occlusive disease.
[0130] Hypoxia may be a deprivation of adequate supply of oxygen.
Hypoxia may be pathological condition in which the body as a whole
(generalized hypoxia) or region of the body (tissue hypoxia) is
deprived of adequate oxygen supply. A variation in levels of
arterial oxygen may be due to a mismatch between supply and demand
of oxygen by body components. A complete deprivation of oxygen
supply is anoxia. Hypoxia may be hypoxemic hypoxia, anemic hypoxia,
hypoxemic hypoxia, histotoxic hypoxia, histotoxic hypoxia, and
ischemic hypoxia.
[0131] Hypoxemic hypoxia may be an inadequate supply of oxygen to
the body as a whole caused by low partial pressure of oxygen in
arterial blood. Hypoxemic hypoxia may be due to low partial
pressure of atmospheric oxygen such as at high altitudes,
replacement of oxygen in breathing mix of a modified atmosphere
such as a sewer, replacement of oxygen intentionally as in
recreational use of nitrous oxide, a decrease in oxygen saturation
of the blood due to sleep apnea, or hypopnea, inadequate pulmonary
ventilation such as chronic obstructive pulmonary disease or
respiratory arrest, anatomical or mechanical shunts in the
pulmonary circulation or a right to left shunt in the heart and
lung. Shunts may cause collapsed alveoli that are still perfused or
a block in ventilation to an area of the lung. Shunts may present
blood meant for the pulmonary system to not be ventilated and
prevent gas exchange because the blood vessels empty into the left
ventricle and the bronchial circulation, which supplies the bronchi
with oxygen.
[0132] Anemia hypoxia may be the total oxygen content is reduced
but the arterial oxygen pressure is normal. Hypoxemic hypoxia may
be when blood fails to deliver oxygen to target body components.
Hypoxemic hypoxia may be caused by carbon monoxide poisoning which
inhibits the ability of hemoglobin to release the oxygen bound to
it, or methaemoglobinaemia, an abnormal hemoglobin that accumulates
in the blood. Histotoxic hypoxia may be due to being unable to
effectively use oxygen due to disabled oxidative phosphorylation
enzymes.
[0133] Infarction is a type of pathological condition that can
cause ischemia. Infarction may be a macroscopic area of necrotic
tissue caused the loss of an adequate blood supply due to an
occlusion. The infarction may be a white infarction composed of
platelets and causes necrosis in organ tissues such as heart,
spleen, and kidneys. The infarction may be a red infarction
composed of red blood cells and fibrin strands in organ tissues of
the lung. Disease associated with infarction may include myocardial
infarction, pulmonary embolism, cerebrovascular accident (stroke),
acute renal failure, peripheral artery occlusive disease (example
being gangrene), antiphospholipid syndrome, sepsis, giant cell
arthritis, hernia, and volvulus.
[0134] Embolism is a type of pathological condition that can cause
ischemia. Embolism may be an object that migrates from one part of
the body and causes an occlusion or blockage of a blood vessel in
another part of the body. An embolism may be thromboembolism, fat
embolism, air embolism, septic embolism, tissue embolism, foreign
body embolism, amniotic fluid embolism. Thromboembolism may be a
blood clot that is completely or partially detached from the site
of thrombosis. Fat embolism may be endogenous fat tissues that
escape into the blood circulation. The fracture of bones is one
example of a leakage of fat tissue into the ruptured vessels and
arteries. Air embolism may be a rupture of alveoli and inhaled air
that leaks into the blood vessels. The puncture of the subclavian
vein or intravenous therapy are examples of leakage of air into the
blood vessels. A gas embolism may be gasses such as nitrogen and
helium because insoluble and forming small bubbles in the
blood.
Pharmaceutically Acceptable Salts and Excipients
[0135] The flagellin-related compositions (and/or additional
agents) described herein can possess a sufficiently basic
functional group, which can react with an inorganic or organic
acid, or a carboxyl group, which can react with an inorganic or
organic base, to form a pharmaceutically acceptable salt. A
pharmaceutically acceptable acid addition salt is formed from a
pharmaceutically acceptable acid, as is well known in the art. Such
salts include the pharmaceutically acceptable salts listed in, for
example, Journal of Pharmaceutical Science, 66, 2-19 (1977) and The
Handbook of Pharmaceutical Salts; Properties, Selection, and Use.
P. H. Stahl and C. G. Wermuth (eds.), Verlag, Zurich (Switzerland)
2002, which are hereby incorporated by reference in their
entirety.
[0136] Pharmaceutically acceptable salts include, by way of
non-limiting example, sulfate, citrate, acetate, oxalate, chloride,
bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate,
isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate,
tannate, pantothenate, bitartrate, ascorbate, succinate, maleate,
gentisinate, fumarate, gluconate, glucaronate, saccharate, formate,
benzoate, glutamate, methanesulfonate, ethanesulfonate,
benzenesulfonate, p-toluenesulfonate, camphorsulfonate, pamoate,
phenylacetate, trifluoroacetate, acrylate, chlorobenzoate,
dinitrobenzoate, hydroxybenzoate, methoxybenzoate, methylbenzoate,
o-acetoxybenzoate, naphthalene-2-benzoate, isobutyrate,
phenylbutyrate, .alpha.-hydroxybutyrate, butyne-1,4-dicarboxylate,
hexyne-1,4-dicarboxylate, caprate, caprylate, cinnamate,
glycollate, heptanoate, hippurate, malate, hydroxymaleate,
malonate, mandelate, mesylate, nicotinate, phthalate,
teraphthalate, propiolate, propionate, phenylpropionate, sebacate,
suberate, p-bromobenzenesulfonate, chlorobenzenesulfonate,
ethylsulfonate, 2-hydroxyethylsulfonate, methylsulfonate,
naphthalene-1-sulfonate, naphthalene-2-sulfonate,
naphthalene-1,5-sulfonate, xylenesulfonate, and tartarate
salts.
[0137] The term "pharmaceutically acceptable salt" also refers to a
salt of the compositions of the present invention having an acidic
functional group, such as a carboxylic acid functional group, and a
base. Suitable bases include, but are not limited to, hydroxides of
alkali metals such as sodium, potassium, and lithium; hydroxides of
alkaline earth metal such as calcium and magnesium; hydroxides of
other metals, such as aluminum and zinc; ammonia, and organic
amines, such as unsubstituted or hydroxy-substituted mono-, di-, or
tri-alkylamines, dicyclohexylamine; tributyl amine; pyridine;
N-methyl, N-ethylamine; diethylamine; triethylamine; mono-, bis-,
or tris-(2-OH-lower alkylamines), such as mono-; bis-, or
tris-(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, or
tris-(hydroxymethyl)methylamine, N,N-di-lower
alkyl-N-(hydroxyl-lower alkyl)-amines, such as
N,N-dimethyl-N-(2-hydroxyethyl)amine or tri-(2-hydroxyethyl)amine;
N-methyl-D-glucamine; and amino acids such as arginine, lysine, and
the like.
[0138] In some embodiments, the compositions described herein are
in the form of a pharmaceutically acceptable salt.
[0139] Further, any flagellin-related compositions (and/or
additional agents) described herein can be administered to a
subject as a component of a composition that comprises a
pharmaceutically acceptable carrier or vehicle. Such compositions
can optionally comprise a suitable amount of a pharmaceutically
acceptable excipient so as to provide the form for proper
administration.
[0140] Pharmaceutical excipients can be liquids, such as water and
oils, including those of petroleum, animal, vegetable, or synthetic
origin, such as peanut oil, soybean oil, mineral oil, sesame oil
and the like. The pharmaceutical excipients can be, for example,
saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal
silica, urea and the like. In addition, auxiliary, stabilizing,
thickening, lubricating, and coloring agents can be used. In one
embodiment, the pharmaceutically acceptable excipients are sterile
when administered to a subject. Water is a useful excipient when
any agent described herein is administered intravenously. Saline
solutions and aqueous dextrose and glycerol solutions can also be
employed as liquid excipients, specifically for injectable
solutions. Suitable pharmaceutical excipients also include starch,
glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk,
silica gel, sodium stearate, glycerol monostearate, talc, sodium
chloride, dried skim milk, glycerol, propylene, glycol, water,
ethanol and the like. Any agent described herein, if desired, can
also comprise minor amounts of wetting or emulsifying agents, or pH
buffering agents.
Formulations, Administration, Dosing, and Treatment Regimens
[0141] The present invention includes the described
flagellin-related compositions (and/or additional agents) in
various formulations. Any flagellin-related composition (and/or
additional agents) described herein can take the form of solutions,
suspensions, emulsion, drops, tablets, pills, pellets, capsules,
capsules containing liquids, powders, sustained-release
formulations, suppositories, emulsions, aerosols, sprays,
suspensions, or any other form suitable for use. In one embodiment,
the composition is in the form of a capsule (see, e.g., U.S. Pat.
No. 5,698,155). Other examples of suitable pharmaceutical
excipients are described in Remington's Pharmaceutical Sciences
1447-1676 (Alfonso R. Gennaro eds., 19th ed. 1995), incorporated
herein by reference.
[0142] Where necessary, the flagellin-related compositions (and/or
additional agents) can also include a solubilizing agent. Also, the
agents can be delivered with a suitable vehicle or delivery device
as known in the art. Combination therapies outlined herein can be
co-delivered in a single delivery vehicle or delivery device.
Compositions for administration can optionally include a local
anesthetic such as, for example, lignocaine to lessen pain at the
site of the injection.
[0143] The formulations comprising the flagellin-related
compositions (and/or additional agents) of the present invention
may conveniently be presented in unit dosage forms and may be
prepared by any of the methods well known in the art of pharmacy.
Such methods generally include the step of bringing the therapeutic
agents into association with a carrier, which constitutes one or
more accessory ingredients. Typically, the formulations are
prepared by uniformly and intimately bringing the therapeutic agent
into association with a liquid carrier, a finely divided solid
carrier, or both, and then, if necessary, shaping the product into
dosage forms of the desired formulation (e.g., wet or dry
granulation, powder blends, etc., followed by tableting using
conventional methods known in the art)
[0144] In one embodiment, any flagellin-related composition (and/or
additional agents) described herein is formulated in accordance
with routine procedures as a composition adapted for a mode of
administration described herein.
[0145] Routes of administration include, for example: intradermal,
intramuscular, intraperitoneal, intravenous, subcutaneous,
intranasal, epidural, oral, sublingual, intranasal, intracerebral,
intravaginal, transdermal, rectally, by inhalation, or topically,
particularly to the ears, nose, eyes, or skin. In some embodiments,
the administering is effected orally or by parenteral injection.
The mode of administration can be left to the discretion of the
practitioner, and depends in-part upon the site of the medical
condition. In most instances, administration results in the release
of any agent described herein into the bloodstream.
[0146] Any flagellin-related composition (and/or additional agents)
described herein can be administered orally. Such flagellin-related
compositions (and/or additional agents) can also be administered by
any other convenient route, for example, by intravenous infusion or
bolus injection, by absorption through epithelial or mucocutaneous
linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and
can be administered together with another biologically active
agent. Administration can be systemic or local. Various delivery
systems are known, e.g., encapsulation in liposomes,
microparticles, microcapsules, capsules, etc., and can be used to
administer.
[0147] In specific embodiments, it may be desirable to administer
locally to the area in need of treatment.
[0148] In one embodiment, any flagellin-related composition (and/or
additional agents) described herein is formulated in accordance
with routine procedures as a composition adapted for oral
administration to humans. Compositions for oral delivery can be in
the form of tablets, lozenges, aqueous or oily suspensions,
granules, powders, emulsions, capsules, syrups, or elixirs, for
example. Orally administered compositions can comprise one or more
agents, for example, sweetening agents such as fructose, aspartame
or saccharin; flavoring agents such as peppermint, oil of
wintergreen, or cherry; coloring agents; and preserving agents, to
provide a pharmaceutically palatable preparation. Moreover, where
in tablet or pill form, the compositions can be coated to delay
disintegration and absorption in the gastrointestinal tract thereby
providing a sustained action over an extended period of time.
Selectively permeable membranes surrounding an osmotically active
driving any flagellin-related composition (and/or additional
agents) described herein are also suitable for orally administered
compositions. In these latter platforms, fluid from the environment
surrounding the capsule is imbibed by the driving compound, which
swells to displace the agent or agent composition through an
aperture. These delivery platforms can provide an essentially zero
order delivery profile as opposed to the spiked profiles of
immediate release formulations. A time-delay material such as
glycerol monostearate or glycerol stearate can also be useful. Oral
compositions can include standard excipients such as mannitol,
lactose, starch, magnesium stearate, sodium saccharin, cellulose,
and magnesium carbonate. In one embodiment, the excipients are of
pharmaceutical grade. Suspensions, in addition to the active
compounds, may contain suspending agents such as, for example,
ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and
sorbitan esters, microcrystalline cellulose, aluminum
metahydroxide, bentonite, agar-agar, tragacanth, etc., and mixtures
thereof.
[0149] Dosage forms suitable for parenteral administration (e.g.
intravenous, intramuscular, intraperitoneal, subcutaneous and
intra-articular injection and infusion) include, for example,
solutions, suspensions, dispersions, emulsions, and the like. They
may also be manufactured in the form of sterile solid compositions
(e.g. lyophilized composition), which can be dissolved or suspended
in sterile injectable medium immediately before use. They may
contain, for example, suspending or dispersing agents known in the
art.
[0150] The dosage of any flagellin-related composition (and/or
additional agents) described herein as well as the dosing schedule
can depend on various parameters, including, but not limited to,
the disease being treated, the subject's general health, and the
administering physician's discretion. Any agent described herein,
can be administered prior to (e.g., about 5 minutes, about 15
minutes, about 30 minutes, about 45 minutes, about 1 hour, about 2
hours, about 4 hours, about 6 hours, about 12 hours, about 24
hours, about 48 hours, about 72 hours, about 96 hours, about 1
week, about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks,
about 6 weeks, about 8 weeks, or about 12 weeks before),
concurrently with, or subsequent to (e.g., about 5 minutes, about
15 minutes, about 30 minutes, about 45 minutes, about 1 hour, about
2 hours, about 4 hours, about 6 hours, about 12 hours, about 24
hours, about 48 hours, about 72 hours, about 96 hours, about 1
week, about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks,
about 6 weeks, about 8 weeks, or about 12 weeks after) the
administration of an additional therapeutic agent, to a subject in
need thereof. In various embodiments any agent described herein is
administered about 1 minute apart, about 10 minutes apart, about 30
minutes apart, less than about 1 hour apart, about 1 hour apart,
about 1 hour to about 2 hours apart, about 2 hours to about 3 hours
apart, about 3 hours to about 4 hours apart, about 4 hours to about
5 hours apart, about 5 hours to about 6 hours apart, about 6 hours
to about 7 hours apart, about 7 hours to about 8 hours apart, about
8 hours to about 9 hours apart, about 9 hours to about 10 hours
apart, about 10 hours to about 11 hours apart, about 11 hours to
about 12 hours apart, no more than about 24 hours apart or no more
than 48 hours apart.
[0151] The amount of any flagellin-related composition (and/or
additional agents) described herein that is admixed with the
carrier materials to produce a single dosage can vary depending
upon the subject being treated and the particular mode of
administration. In vitro or in vivo assays can be employed to help
identify optimal dosage ranges.
[0152] In general, the doses that are useful are known to those in
the art. For example, doses may be determined with reference
Physicians' Desk Reference, 66th Edition, PDR Network; 2012 Edition
(Dec. 27, 2011), the contents of which are incorporated by
reference in its entirety.
[0153] The dosage of any flagellin-related composition (and/or
additional agents) described herein can depend on several factors
including the severity of the condition, whether the condition is
to be treated or prevented, and the age, weight, and health of the
subject to be treated. Additionally, pharmacogenomic (the effect of
genotype on the pharmacokinetic, pharmacodynamic or efficacy
profile of a therapeutic) information about a particular subject
may affect dosage used. Furthermore, the exact individual dosages
can be adjusted somewhat depending on a variety of factors,
including the specific combination of the agents being
administered, the time of administration, the route of
administration, the nature of the formulation, the rate of
excretion, the particular disease being treated, the severity of
the disorder, and the anatomical location of the disorder. Some
variations in the dosage can be expected.
[0154] Generally, when orally administered to a mammal, the dosage
of any flagellin-related composition (and/or additional agents)
described herein may be about 0.001 mg/kg/day to about 100
mg/kg/day, about 0.01 mg/kg/day to about 50 mg/kg/day, or about 0.1
mg/kg/day to about 10 mg/kg/day. When orally administered to a
human, the dosage of any agent described herein is normally about
0.001 mg to about 1000 mg per day, about 1 mg to about 600 mg per
day, or about 5 mg to about 30 mg per day.
[0155] For administration of any flagellin-related composition
(and/or additional agents) described herein by parenteral
injection, the dosage is normally about 0.1 mg to about 250 mg per
day, about 1 mg to about 20 mg per day, or about 3 mg to about 5 mg
per day. Injections may be given up to four times daily. Generally,
when orally or parenterally administered, the dosage of any agent
described herein is normally about 0.1 mg to about 1500 mg per day,
or about 0.5 mg to about 10 mg per day, or about 0.5 mg to about 5
mg per day. A dosage of up to about 3000 mg per day can be
administered.
[0156] In another embodiment, delivery can be in a vesicle, in
particular a liposome (see Langer, 1990, Science 249:1527-1533;
Treat et al., in Liposomes in the Therapy of Infectious Disease and
Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp.
353-365 (1989).
[0157] Any flagellin-related composition (and/or additional agents)
described herein can be administered by controlled-release or
sustained-release means or by delivery devices that are well known
to those of ordinary skill in the art. Examples include, but are
not limited to, those described in U.S. Pat. Nos. 3,845,770;
3,916,899; 3,536,809; 3,598,123; 4,008,719; 5,674,533; 5,059,595;
5,591,767; 5,120,548; 5,073,543; 5,639,476; 5,354,556; and
5,733,556, each of which is incorporated herein by reference in its
entirety. Such dosage forms can be useful for providing controlled-
or sustained-release of one or more active ingredients using, for
example, hydropropylmethyl cellulose, other polymer matrices, gels,
permeable membranes, osmotic systems, multilayer coatings,
microparticles, liposomes, microspheres, or a combination thereof
to provide the desired release profile in varying proportions.
Suitable controlled- or sustained-release formulations known to
those skilled in the art, including those described herein, can be
readily selected for use with the active ingredients of the agents
described herein. The invention thus provides single unit dosage
forms suitable for oral administration such as, but not limited to,
tablets, capsules, gelcaps, and caplets that are adapted for
controlled- or sustained-release.
[0158] Controlled- or sustained-release of an active ingredient can
be stimulated by various conditions, including but not limited to,
changes in pH, changes in temperature, stimulation by an
appropriate wavelength of light, concentration or availability of
enzymes, concentration or availability of water, or other
physiological conditions or compounds.
[0159] In another embodiment, polymeric materials can be used (see
Medical Applications of Controlled Release, Langer and Wise (eds.),
CRC Pres., Boca Raton, Fla. (1974); Controlled Drug
Bioavailability, Drug Product Design and Performance, Smolen and
Ball (eds.), Wiley, New York (1984); Ranger and Peppas, 1983, J.
Macromol. Sci. Rev. Macromol. Chem. 23:61; see also Levy et al,
1985, Science 228:190; During et al, 1989, Ann. Neurol. 25:351;
Floward et al., 1989, J. Neurosurg. 71:105).
[0160] In another embodiment, a controlled-release system can be
placed in proximity of the target area to be treated, thus
requiring only a fraction of the systemic dose (see, e.g., Goodson,
in Medical Applications of Controlled Release, supra, vol. 2, pp.
115-138 (1984)). Other controlled-release systems discussed in the
review by Langer, 1990, Science 249:1527-1533) may be used.
[0161] Administration of any flagellin-related composition (and/or
additional agents) described herein can, independently, be one to
four times daily or one to four times per month or one to six times
per year or once every two, three, four or five years.
Administration can be for the duration of about one day or about
one month, about two months, about three months, about six months,
about one year, about two years, about three years, and may even be
for the life of the subject. Chronic, long-term administration will
be indicated in many cases. The dosage may be administered as a
single dose or divided into multiple doses. In general, the desired
dosage should be administered at set intervals for a prolonged
period, usually at least over several weeks or months, although
longer periods of administration of several months or years or more
may be needed.
[0162] The dosage regimen utilizing any flagellin-related
composition (and/or additional agents) described herein can be
selected in accordance with a variety of factors including type,
species, age, weight, sex and medical condition of the subject; the
severity of the condition to be treated; the route of
administration; the renal or hepatic function of the subject; the
pharmacogenomic makeup of the individual; and the specific compound
of the invention employed. Any flagellin-related composition
(and/or additional agents) described herein can be administered in
a single daily dose, or the total daily dosage can be administered
in divided doses of two, three or four times daily. Furthermore,
any flagellin-related composition (and/or additional agents)
described herein can be administered continuously rather than
intermittently throughout the dosage regimen.
Combination Therapies and Conjugation
[0163] In some embodiments, the invention provides for
flagellin-related compositions and methods that further comprise
administering an additional agent to a subject. In some
embodiments, the invention pertains to co-administration and/or
co-formulation. Any of the compositions described herein may be
co-formulated and/or co-administered.
[0164] In some embodiments, any flagellin-related composition
described herein acts synergistically when co-administered with
another agent and is administered at doses that are lower than the
doses commonly employed when such agents are used as monotherapy.
In various embodiments, any agent referenced herein may be used in
combination with any of the flagellin-related compositions
described herein.
[0165] In some embodiments, the present invention pertains to
chemotherapeutic agents as additional agents.
[0166] Examples of chemotherapeutic agents include, but are not
limited to, alkylating agents such as thiotepa and CYTOXAN
cyclophosphamide; alkyl sulfonates such as busulfan, improsulfan
and piposulfan; aziridines such as benzodopa, carboquone,
meturedopa, and uredopa; ethylenimines and methylamelamines
including altretamine, triethylenemelamine,
trietylenephosphoramide, triethiylenethiophosphoramide and
trimethylolomelamine; acetogenins (e.g., bullatacin and
bullatacinone); a camptothecin (including the synthetic analogue
topotecan); bryostatin; cally statin; CC-1065 (including its
adozelesin, carzelesin and bizelesin synthetic analogues);
cryptophycins (e.g., cryptophycin 1 and cryptophycin 8);
dolastatin; duocarmycin (including the synthetic analogues, KW-2189
and CB 1-TM1); eleutherobin; pancratistatin; a sarcodictyin;
spongistatin; nitrogen mustards such as chlorambucil,
chlornaphazine, cholophosphamide, estramustine, ifosfamide,
mechlorethamine, mechlorethamine oxide hydrochloride, melphalan,
novembichin, phenesterine, prednimustine, trofosfamide, uracil
mustard; nitrosureas such as carmustine, chlorozotocin,
fotemustine, lomustine, nimustine, and ranimnustine; antibiotics
such as the enediyne antibiotics (e.g., calicheamicin, especially
calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew,
Chem. Inti. Ed. Engl., 33: 183-186 (1994)); dynemicin, including
dynemicin A; bisphosphonates, such as clodronate; an esperamicin;
as well as neocarzinostatin chromophore and related chromoprotein
enediyne antibiotic chromophores), aclacinomysins, actinomycin,
authramycin, azaserine, bleomycins, cactinomycin, carabicin,
caminomycin, carzinophilin, chromomycinis, dactinomycin,
daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN
doxorubicin (including morpholino-doxorubicin,
cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxy
doxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin,
mitomycins such as mitomycin C, mycophenolic acid, nogalamycin,
olivomycins, peplomycin, potfiromycin, puromycin, quelamycin,
rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex,
zinostatin, zorubicin; anti-metabolites such as methotrexate and
5-fluorouracil (5-FU); folic acid analogues such as denopterin,
methotrexate, pteropterin, trimetrexate; purine analogs such as
fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine
analogs such as ancitabine, azacitidine, 6-azauridine, carmofur,
cytarabine, dideoxyuridine, doxifluridine, enocitabine,
floxuridine; androgens such as calusterone, dromostanolone
propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals
such as minoglutethimide, mitotane, trilostane; folic acid
replenisher such as frolinic acid; aceglatone; aldophosphamide
glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil;
bisantrene; edatraxate; def of amine; demecolcine; diaziquone;
elformithine; elliptinium acetate; an epothilone; etoglucid;
gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids
such as maytansine and ansamitocins; mitoguazone; mitoxantrone;
mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin;
losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine;
PSK polysaccharide complex (JHS Natural Products, Eugene, Oreg.);
razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid;
triaziquone; 2,2',2''-trichlorotriethylamine; trichothecenes (e.g.,
T-2 toxin, verracurin A, roridin A and anguidine); urethan;
vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol;
pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide;
thiotepa; taxoids, e.g., TAXOL paclitaxel (Bristol-Myers Squibb
Oncology, Princeton, N.J.), ABRAXANE Cremophor-free,
albumin-engineered nanoparticle formulation of paclitaxel (American
Pharmaceutical Partners, Schaumberg, 111), and TAXOTERE doxetaxel
(Rhone-Poulenc Rorer, Antony, France); chlorambucil; GEMZAR
gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum
analogs such as cisplatin, oxaliplatin and carboplatin;
vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone;
vincristine; NAVELBINE. vinorelbine; novantrone; teniposide;
edatrexate; daunomycin; aminopterin; xeloda; ibandronate;
irinotecan (Camptosar, CPT-11) (including the treatment regimen of
irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS
2000; difluoromethylornithine (DMFO); retinoids such as retinoic
acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin,
including the oxaliplatin treatment regimen (FOLFOX); lapatinib
(Tykerb); inhibitors of PKC-.alpha., Raf, H-Ras, EGFR (e.g.,
erlotinib (Tarceva)) and VEGF-A that reduce cell proliferation and
pharmaceutically acceptable salts, acids or derivatives of any of
the above. In addition, the methods of treatment can further
include the use of radiation. In addition, the methods of treatment
can further include the use of photodynamic therapy.
[0167] In some embodiments, the flagellin-related compositions
(and/or additional agents) described herein, include derivatives
that are modified, i.e., by the covalent attachment of any type of
molecule to the composition such that covalent attachment does not
prevent the activity of the composition. For example, but not by
way of limitation, derivatives include composition that have been
modified by, inter alia, glycosylation, lipidation, acetylation,
pegylation, phosphorylation, amidation, derivatization by known
protecting/blocking groups, proteolytic cleavage, linkage to a
cellular ligand or other protein, etc. Any of numerous chemical
modifications can be carried out by known techniques, including,
but not limited to specific chemical cleavage, acetylation,
formylation, metabolic synthesis of turicamycin, etc. Additionally,
the derivative can contain one or more non-classical amino
acids.
[0168] In still other embodiments, the flagellin-related
compositions (and/or additional agents) described herein further
comprise a cytotoxic agent, comprising, in exemplary embodiments, a
toxin, a chemotherapeutic agent, a radioisotope, and an agent that
causes apoptosis or cell death. Such agents may be conjugated to a
composition described herein.
[0169] The flagellin-related compositions (and/or additional
agents) described herein may thus be modified post-translationally
to add effector moieties such as chemical linkers, detectable
moieties such as for example fluorescent dyes, enzymes, substrates,
bioluminescent materials, radioactive materials, and
chemiluminescent moieties, or functional moieties such as for
example streptavidin, avidin, biotin, a cytotoxin, a cytotoxic
agent, and radioactive materials.
[0170] Exemplary cytotoxic agents include, but are not limited to,
methotrexate, aminopterin, 6-mercaptopurine, 6-thioguanine,
cytarabine, 5-fluorouracil decarbazine; alkylating agents such as
mechlorethamine, thioepa chlorambucil, melphalan, carmustine
(BSNU), mitomycin C, lomustine (CCNU), 1-methylnitrosourea,
cyclothosphamide, mechlorethamine, busulfan, dibromomannitol,
streptozotocin, mitomycin C, cis-dichlorodiamine platinum (II)
(DDP) cisplatin and carboplatin (paraplatin); anthracyclines
include daunorubicin (formerly daunomycin), doxorubicin
(adriamycin), detorubicin, carminomycin, idarubicin, epirubicin,
mitoxantrone and bisantrene; antibiotics include dactinomycin
(actinomycin D), bleomycin, calicheamicin, mithramycin, and
anthramycin (AMC); and antimytotic agents such as the vinca
alkaloids, vincristine and vinblastine. Other cytotoxic agents
include paditaxel (taxol), ricin, Pseudomonas exotoxin,
gemcitabine, cytochalasin B, gramicidin D, ethidium bromide,
emetine, etoposide, tenoposide, colchicin, dihydroxy anthracin
dione, 1-dehydrotestosterone, glucocorticoids, procaine,
tetracaine, lidocaine, propranolol, puromycin, procarbazine,
hydroxyurea, asparaginase, corticosteroids, mytotane (O,P'-(DDD)),
interferons, and mixtures of these cytotoxic agents.
[0171] Further cytotoxic agents include, but are not limited to,
chemotherapeutic agents such as carboplatin, cisplatin, paclitaxel,
gemcitabine, calicheamicin, doxorubicin, 5-fluorouracil, mitomycin
C, actinomycin D, cyclophosphamide, vincristine, bleomycin, VEGF
antagonists, EGFR antagonists, platins, taxols, irinotecan,
5-fluorouracil, gemcytabine, leucovorine, steroids,
cyclophosphamide, melphalan, vinca alkaloids (e.g., vinblastine,
vincristine, vindesine and vinorelbine), mustines, tyrosine kinase
inhibitors, radiotherapy, sex hormone antagonists, selective
androgen receptor modulators, selective estrogen receptor
modulators, PDGF antagonists, TNF antagonists, IL-1 antagonists,
interleukins (e.g. IL-12 or IL-2), IL-12R antagonists, Toxin
conjugated monoclonal antibodies, tumor antigen specific monoclonal
antibodies, Erbitux, Avastin, Pertuzumab, anti-CD20 antibodies,
Rituxan, ocrelizumab, ofatumumab, DXL625, HERCEPTIN.RTM., or any
combination thereof. Toxic enzymes from plants and bacteria such as
ricin, diphtheria toxin and Pseudomonas toxin may be conjugated to
the therapeutic agents (e.g. antibodies) to generate
cell-type-specific-killing reagents (Youle, et al., Proc. Nat'l
Acad. Sci. USA 77:5483 (1980); Gilliland, et al., Proc. Nat'l Acad.
Sci. USA 77:4539 (1980); Krolick, et al., Proc. Nat'l Acad. Sci.
USA 77:5419 (1980)).
[0172] Other cytotoxic agents include cytotoxic ribonucleases as
described by Goldenberg in U.S. Pat. No. 6,653,104. Embodiments of
the invention also relate to radioimmunoconjugates where a
radionuclide that emits alpha or beta particles is stably coupled
to the antibody, or binding fragments thereof, with or without the
use of a complex-forming agent. Such radionuclides include
beta-emitters such as Phosphorus-32, Scandium-47, Copper-67,
Gallium-67, Yttrium-88, Yttrium-90, Iodine-125, Iodine-131,
Samarium-153, Lutetium-177, Rhenium-186 or Rhenium-188, and
alpha-emitters such as Astatine-211, Lead-212, Bismuth-212,
Bismuth-213 or Actinium-225.
[0173] Exemplary detectable moieties further include, but are not
limited to, horseradish peroxidase, acetylcholinesterase, alkaline
phosphatase, beta-galactosidase and luciferase. Further exemplary
fluorescent materials include, but are not limited to, rhodamine,
fluorescein, fluorescein isothiocyanate, umbelliferone,
dichlorotriazinylamine, phycoerythrin and dansyl chloride. Further
exemplary chemiluminescent moieties include, but are not limited
to, luminol. Further exemplary bioluminescent materials include,
but are not limited to, luciferin and aequorin. Further exemplary
radioactive materials include, but are not limited to, Iodine-125,
Carbon-14, Sulfur-35, Tritium and Phosphorus-32.
[0174] In various embodiments, the additional agents of the present
invention include one or more of blood products, colony stimulating
factors, cytokines and/or growth factors, antibiotics, diluting
and/or blocking agents, mobilizing or chelating agents, stem cell
transplants, antioxidants or free radicals, and
radioprotectants.
[0175] In some embodiments, the blood product is one or more of
hematopoietic growth factors, such as filgrastim (e.g. NEUPOGEN), a
granulocyte colony-stimulating factor (G-CSF), which may be
optionally pegylated (e.g. NEULASTA); sargramostim (LEUKINE); and a
granulocyte-macrophage colony-stimulating factor (GM-CSF) and a
KSF.
[0176] In some embodiments, the additional agent is one or more
cytokines and/or growth factors that may confer radioprotection by
replenishing and/or protecting the radiosensitive stem cell
populations. Radioprotection with minimal side effects may be
achieved by the use of stem cell factor (SCF, c-kit ligand), Flt-3
ligand, and interleukin-1 fragment IL-1 b-rd. Protection may be
achieved through induction of proliferation of stem cells (e.g. via
all mentioned cytokines), and prevention of their apoptosis (e.g.
via SCF). The treatment allows accumulation of leukocytes and their
precursors prior to irradiation thus enabling quicker
reconstitution of the immune system after irradiation. SCF
efficiently rescues lethally irradiated mice with a dose modifying
factor (DMF) in range 1.3-1.35 and is also effective against
gastrointestinal syndrome. Flt-3 ligand also provides strong
protection in mice and rabbits.
[0177] Several factors, while not cytokines by nature, stimulate
the proliferation of the immunocytes and may be used in combination
with the flagellin-related compositions at the doses and regimens
described herein. For example, 5-AED (5-androstenediol) is a
steroid that stimulates the expression of cytokines and increases
resistance to bacterial and viral infections. Synthetic compounds,
such as ammonium tri-chloro(dioxoethylene-O,O'-) tellurate
(AS-101), may also be used to induce secretion of numerous
cytokines and for combination with the flagellin-related
compositions. Growth factors and cytokines may also be used to
provide protection against the gastrointestinal syndrome.
Keratinocyte growth factor (KGF) promotes proliferation and
differentiation in the intestinal mucosa, and increases the
post-irradiation cell survival in the intestinal crypts.
Flematopoietic cytokine and radioprotectant SCF may also increase
intestinal stem cell survival and associated short-term organism
survival.
[0178] In certain embodiments, the flagellin-related compositions
may be added to a regimen of cytokines (e.g. for FILGRASTIM (G-CSF)
2.5-5 .mu.g/kg/d QD s.c. (100-200 .mu.g/m.sup.2/d); for
SARGRAMOSTIM (GM-CSF) 5-10 .mu.g/kg/d QD s.c. (200-400
.mu.g/m.sup.2/d); and/or for PEGFILGRASTIM (pegG-CSF) 6 mg once
s.c).
[0179] In some embodiments, the antibiotic is one or more of an
anti-bacterial (anti-gram positive and anti-gram negative agents),
and/or anti-fungal, and/or anti-viral agent. By way of non-limiting
example, in some embodiments, the antibiotic may be a quinolone,
e.g. ciprofloxacin, levofloxacin, a third- or fourth-generation
cephalosporin with pseudomonal coverage: e.g., cefepime,
ceftazidime, or an aminoglycoside: e.g. gentamicin, amikacin,
penicillin or amoxicillin, acyclovir, vanomycin. In various
embodiments, the antibiotic targets Pseudomonas aeruginosa.
[0180] In some embodiments, the additional agent is a diluting
and/or blocking agents. For example, stable iodide compounds may be
used (e.g. liquid (ThyroShield) and the tablet (losat) KI
(NUKEPILLS), Rad Block, I.A.A.A.M., No-Rad, Life Extension (LEF),
KI4U, NukeProtect, ProKI)). A 130 mg dose of daily of oral
potassium iodide (KI) may be used in conjunction with the
flagellin-related compositions.
[0181] In some embodiments, the additional agent is a mobilizing or
chelating agent. Illustrative mobilizing agents include
propylthiouracil and methimazole, with may reduce the thyroid's
retention of radioactive compounds. Further the flagellin-related
compositions can be used alongside increasing oral fluids to a
human patient to promote excretion. Illustrative chelating agents
are water soluble and excreted in urine. Illustrative chelating
agents include DTPA and EDTA. Dimercaprol forms stable chelates
with mercury, lead, arsenic, gold, bismuth, chromium, and nickel
and therefore may be considered for the treatment of internal
contamination with the radioisotopes of these elements.
Penicillamine chelates copper, iron, mercury, lead, gold, and
possibly other heavy metals.
[0182] In some embodiments, the additional agent is a stem cell
transplant (e.g. bone marrow transplant, PBSCT, MSCT). In some
embodiments the stem cell transplant is Remestemcel-L (Osiris) of
CLT-008 (Cellerant).
[0183] In some embodiments, the additional agent is an antioxidant
or free radical. Antioxidants and free radical scavengers that may
be used in the practice of the invention include, but are not
limited to, thiols, such as cysteine, cysteamine, glutathione and
bilirubin; amifostine (WR-2721); vitamin A; vitamin C; vitamin E;
and flavonoids such as Indian holy basil (Ocimum sanctum), orientin
and vicenin.
[0184] In some embodiments, the additional agent may be a
radioprotectant e.g. an antioxidant (e.g. amifostine and vitamin E,
gamma tocotrienol (a vitamin-E moiety), and genistein (a soy
byproduct)), a cytokine (e.g. a stem cell factor), a growth factor
(e.g. keratinocyte growth factor), a steroid (e.g.
5-androstenediol), ammonium triohloro(dioxoethylene-O,O')tellurate,
thyroid protecting agents (e.g. Potassium iodide (KI) or potassium
iodate (KIO.sub.3) (e.g. liquid (ThyroShield) and the tablet
(losat) KI (NUKEPILLS), Rad Block, I.A.A.A.M., No-Rad, Life
Extension (LEF), KI4U, NukeProtect, ProKI)), anti-nausea agents,
anti-diarrhea agents, antiemetics ((e.g. oral prophylactic
antiemetics) such as granisetron (KYTRIL), ondansetron (ZOFRAN),
and 5-HT3 blockers with or without dexamethasone), analgesics,
anxiolytics, sedatives, cytokine therapy, and antibiotics.
[0185] Gastric lavage and emetics, which can be used as additional
agents, can be used to empty the stomach promptly and completely
after the ingestion of poisonous materials. Purgatives, laxatives,
and enemas, which also can be used as additional agents, can reduce
the residence time of radioactive materials in the colon. Further
additional agents include ion exchange resins which may limit
gastrointestinal uptake of ingested or inhaled radionuclides,
ferric ferrocyanide (Prussian blue) and alginates, which have been
used in humans to accelerate fecal excretion of cesium-137.
[0186] In still other embodiments, the additional agent may be an
agent used to treat radiation-related disorders, such as, for
example, 5-AED (Humanetics), Ex-RAD (Onconova), Beclometasone
Dipropionate (Soligenix), detoxified endotoxin, EA-230 (Exponential
Biotherapies), ON-01210.Na (Onconova), Sothrombomodulin alfa
(PAION), Remestemcel-L (Osiris), BIO-100, BIO-200, BIO-300,
BIO-400, BIO-500 (Flumanetics), CLT-008 (Cellerant), EDL-2000
(RxBio), Homspera (ImmuneRegen), MnDTEIP (Aeolus Pharmaceuticals),
RLIP-76 (Terapio), and RX-100 and RX 101 (RxBio).
[0187] Further, in some embodiments, the flagellin-related
compositions (and/or additional agents) can be used in combination
with shielding; reduction of radiation exposure time; and use of
agents to reduce body exposure (e.g. uses of gloves, face mask,
hood, protective clothing (e.g. anticontamination suits such as
TYVEK ANTI-C SUITS or MOPP-4)).
Viral Vectors Encoding Therapeutic Agents and Cells Expressing
Same
[0188] In various embodiments, the flagellin-related compositions
(and/or additional agents) of the present invention is expressed by
viral vectors and transformed cells. For example, the viral vectors
and transformed human cells described herein may express the
present compositions. In an embodiment, the viral vector or human
cells expressing the therapeutic agent are capable of expressing
the agent proximal to a tumor. The cells can be modified in vivo,
or alternatively cells modified ex vivo can be administered to a
patient by a variety of methods, such as by injection.
[0189] In one embodiment, the cell is a tumor cell. For ex vivo
transformation, such tumor cells can be irradiated to eliminate the
ability of the cell to replicate, as known in the art, while
maintaining the transient expression of the therapeutic agent after
administration. For in vivo transformation, non-integrative
expression vectors may be preferred.
[0190] In certain embodiments, the tumor cell is autologous or
endogenous. In the former instance, the tumor cell is taken from a
patient, transfected or transduced with a construct encoding the
therapeutic agent and re-introduced to the patient, for example
after irradiation. In the latter instance, the tumor cell is
transformed in vivo by local administration of an appropriate
construct as described herein.
[0191] In an alternative embodiment, the modified tumor cell is
allogeneic. The allogeneic tumor cell thus can be maintained in a
cell line. In this instance, the tumor cell can be selected from
the cell line, irradiated, and introduced to the patent.
[0192] Modified human cells capable of producing the
flagellin-related compositions (and/or additional agents) can be
made by transfecting or transducing the cells with an expression
vector encoding the therapeutic agent. Expression vectors for the
expression of the flagellin-related compositions (and/or additional
agents), or a combination of therapeutic agents can be made by
methods well known in the art.
[0193] In various embodiments, the flagellin-related compositions
(and/or additional agents) can be administered to a patient in the
form of one or more nucleic acid construct.
[0194] In one embodiment, the construct comprises a retroviral
vector. Retroviral vectors are capable of permanently integrating
DNA encoding flagellin-related compositions (and/or additional
agents) into the cell genome. Thus, in the case of ex vivo
manipulation of autologous or allogeneic cells, stable cell lines
that constitutively produce the flagellin-related compositions
(and/or additional agents) can be prepared. In an embodiment, the
cells are irradiated prior to administration to a patient. The
irradiated cells produce the flagellin-related compositions (and/or
additional agents) for a limited period of time.
[0195] In one embodiment, the expression construct comprises an SFV
vector, which demonstrates high levels of transient expression in
mammalian cells. The SFV vector is described, for example, in
Lundstrom, Expert Opin. Biol. Ther. 3:771-777 (2003), incorporated
herein by reference in its entirety. Thus, in the case of in vivo
manipulation of endogenous cells in a patient, transient expression
of high levels of the flagellin-related compositions (and/or
additional agents) can be accomplished.
[0196] Systems capable of expressing recombinant protein in vivo
are known in the art. By way of example, the system can use the 2A
mediated antibody expression system disclosed in Fang et al.,
Nature Biotech. 23(5): 584-590 (2005) and U.S. Patent Publication
No. 2005/0003506, the disclosures of which are expressly
incorporated by reference herein in their entirety. Other systems
known in the art are contemplated, and can also be adapted to
produce the flagellin-related compositions (and/or additional
agents) in vivo as described herein.
[0197] In various embodiments, administration of the
flagellin-related composition (and/or additional agents) expressing
cells disclosed herein or the agents of the invention disclosed
herein can be combined with administration of cytokines that
stimulate antigen-presenting cells such as granulocyte-macrophage
colony stimulating factor (GM-CSF), macrophage colony stimulating
factor (M-CSF), granulocyte colony stimulating factor (G-CSF),
interleukin 3 (IL-3), interleukin 12 (IL-12), interferon, etc., or
cellular vaccines capable of expressing such cytokines. In some
embodiments, the flagellin-related composition (and/or additional
agents) expressing cells are further modified to express such
cytokines. Additional proteins and/or cytokines known to enhance T
cell proliferation and secretion, such as IL-1, IL-2, B7, anti-CD3
and anti-CD28 can be employed simultaneously or sequentially with
the flagellin-related compositions (and/or additional agents) of
the invention to augment the immune response, and/or stimulate
co-stimulatory pathways and/or induce activation/proliferation of
effector T cells.
Vectors and Methods of Transformation
[0198] Expression vectors encoding the flagellin-related
compositions (and/or additional agents) may be viral or non-viral.
Viral vectors are preferred for use in vivo. Expression vectors of
the invention comprise a nucleic acid encoding the
flagellin-related compositions (and/or additional agents), or a
complement thereof, operably linked to an expression control
region, or complement thereof, that is functional in a mammalian
cell. The expression control region is capable of driving
expression of the operably linked blocking and/or stimulating agent
encoding nucleic acid such that the blocking and/or stimulating
agent is produced in a human cell transformed with the expression
vector.
[0199] Expression control regions are regulatory polynucleotides
(sometimes referred to herein as elements), such as promoters and
enhancers, that influence expression of an operably linked nucleic
acid.
[0200] An expression control region of an expression vector of the
invention is capable of expressing operably linked encoding nucleic
acid in a human cell. In an embodiment, the cell is a tumor cell.
In another embodiment, the cell is a non-tumor cell.
[0201] In an embodiment, the expression control region confers
regulatable expression to an operably linked nucleic acid. A signal
(sometimes referred to as a stimulus) can increase or decrease
expression of a nucleic acid operably linked to such an expression
control region. Such expression control regions that increase
expression in response to a signal are often referred to as
inducible. Such expression control regions that decrease expression
in response to a signal are often referred to as repressible.
Typically, the amount of increase or decrease conferred by such
elements is proportional to the amount of signal present; the
greater the amount of signal, the greater the increase or decrease
in expression.
[0202] In an embodiment, the present invention contemplates the use
of inducible promoters capable of effecting high level of
expression transiently in response to a cue. When in the proximity
of a tumor cell, a cell transformed with an expression vector for
the flagellin-related compositions (and/or additional agents)
comprising such an expression control sequence is induced to
transiently produce a high level of the agent by exposing the
transformed cell to an appropriate cue. Exemplary inducible
expression control regions include those comprising an inducible
promoter that is stimulated with a cue such as a small molecule
chemical compound. Particular examples can be found, for example,
in U.S. Pat. Nos. 5,989,910, 5,935,934, 6,015,709, and 6,004,941,
each of which is incorporated herein by reference in its
entirety.
[0203] Expression control regions include full-length promoter
sequences, such as native promoter and enhancer elements, as well
as subsequences or polynucleotide variants which retain all or part
of full-length or non-variant function. As used herein, the term
"functional" and grammatical variants thereof, when used in
reference to a nucleic acid sequence, subsequence or fragment,
means that the sequence has one or more functions of native nucleic
acid sequence (e.g., non-variant or unmodified sequence).
[0204] As used herein, "operable linkage" refers to a physical
juxtaposition of the components so described as to permit them to
function in their intended manner. In the example of an expression
control element in operable linkage with a nucleic acid, the
relationship is such that the control element modulates expression
of the nucleic acid. Typically, an expression control region that
modulates transcription is juxtaposed near the 5' end of the
transcribed nucleic acid (i.e., "upstream"). Expression control
regions can also be located at the 3' end of the transcribed
sequence (i.e., "downstream") or within the transcript (e.g., in an
intron). Expression control elements can be located at a distance
away from the transcribed sequence (e.g., 100 to 500, 500 to 1000,
2000 to 5000, or more nucleotides from the nucleic acid). A
specific example of an expression control element is a promoter,
which is usually located 5' of the transcribed sequence. Another
example of an expression control element is an enhancer, which can
be located 5' or 3' of the transcribed sequence, or within the
transcribed sequence.
[0205] Expression systems functional in human cells are well known
in the art, and include viral systems. Generally, a promoter
functional in a human cell is any DNA sequence capable of binding
mammalian RNA polymerase and initiating the downstream (3')
transcription of a B7-H4 ligand coding sequence into mRNA. A
promoter will have a transcription initiating region, which is
usually placed proximal to the 5' end of the coding sequence, and
typically a TATA box located 25-30 base pairs upstream of the
transcription initiation site. The TATA box is thought to direct
RNA polymerase II to begin RNA synthesis at the correct site. A
promoter will also typically contain an upstream promoter element
(enhancer element), typically located within 100 to 200 base pairs
upstream of the TATA box. An upstream promoter element determines
the rate at which transcription is initiated and can act in either
orientation. Of particular use as promoters are the promoters from
mammalian viral genes, since the viral genes are often highly
expressed and have a broad host range. Examples include the SV40
early promoter, mouse mammary tumor virus LTR promoter, adenovirus
major late promoter, herpes simplex virus promoter, and the CMV
promoter.
[0206] Typically, transcription termination and polyadenylation
sequences recognized by mammalian cells are regulatory regions
located 3' to the translation stop codon and thus, together with
the promoter elements, flank the coding sequence. The 3' terminus
of the mature mRNA is formed by site-specific post-translational
cleavage and polyadenylation. Examples of transcription terminator
and polyadenylation signals include those derived from SV40.
Introns may also be included in expression constructs.
[0207] There are a variety of techniques available for introducing
nucleic acids into viable cells. Techniques suitable for the
transfer of nucleic acid into mammalian cells in vitro include the
use of liposomes, electroporation, microinjection, cell fusion,
polymer-based systems, DEAE-dextran, viral transduction, the
calcium phosphate precipitation method, etc. For in vivo gene
transfer, a number of techniques and reagents may also be used,
including liposomes; natural polymer-based delivery vehicles, such
as chitosan and gelatin; viral vectors are also preferred for in
vivo transduction. In some situations it is desirable to provide a
targeting agent, such as an antibody or ligand specific for a tumor
cell surface membrane protein. Where liposomes are employed,
proteins which bind to a cell surface membrane protein associated
with endocytosis may be used for targeting and/or to facilitate
uptake, e.g., capsid proteins or fragments thereof tropic for a
particular cell type, antibodies for proteins which undergo
internalization in cycling, proteins that target intracellular
localization and enhance intracellular half-life. The technique of
receptor-mediated endocytosis is described, for example, by Wu et
al., J. Biol. Chem. 262, 4429-4432 (1987); and Wagner et al, Proc.
Natl. Acad. Sci. USA 87, 3410-3414 (1990).
[0208] Where appropriate, gene delivery agents such as, e.g.,
integration sequences can also be employed. Numerous integration
sequences are known in the art (see, e.g., Nunes-Duby et al.,
Nucleic Acids Res. 26:391-406, 1998; Sadwoski, J. Bacteriol.,
165:341-357, 1986; Bestor, Cell, 122(3):322-325, 2005; Plasterk et
al., TIG 15:326-332, 1999; Kootstra et al., Ann. Rev. Pharm.
Toxicol., 43:413-439, 2003). These include recombinases and
transposases. Examples include Cre (Sternberg and Hamilton, J. Mol.
Biol., 150:467-486, 1981), lambda (Nash, Nature, 247, 543-545,
1974), Flp (Broach, et al., Cell, 29:227-234, 1982), R (Matsuzaki,
et al., J. Bacteriology, 172:610-618, 1990), cpC31 (see, e.g.,
Groth et al., J. Mol. Biol. 335:667-678, 2004), sleeping beauty,
transposases of the mariner family (Plasterk et al., supra), and
components for integrating viruses such as AAV, retroviruses, and
antiviruses having components that provide for virus integration
such as the LTR sequences of retroviruses or lentivirus and the ITR
sequences of AAV (Kootstra et al., Ann. Rev. Pharm. Toxicol.,
43:413-439, 2003).
Viral Vectors
[0209] In one aspect, the invention provides expression vectors for
the expression of the flagellin-related compositions (and/or
additional agents) that are viral vectors. Many viral vectors
useful for gene therapy are known (see, e.g., Lundstrom, Trends
Biotechnol., 21: 1 17, 122, 2003.
[0210] Exemplary viral vectors include those selected from
Antiviruses (LV), retroviruses (RV), adenoviruses (AV),
adeno-associated viruses (AAV), and a viruses, though other viral
vectors may also be used. For in vivo uses, viral vectors that do
not integrate into the host genome are preferred, such as a viruses
and adenoviruses, with a viruses being especially preferred.
Exemplary types of a viruses include Sindbis virus, Venezuelan
equine encephalitis (VEE) virus, and Semliki Forest virus (SFV),
with SFV being especially preferred. For in vitro uses, viral
vectors that integrate into the host genome are preferred, such as
retroviruses, AAV, and Antiviruses.
[0211] In an embodiment, the viral vector provides for transient
high level expression in a transduced human cell.
[0212] In one embodiment, the viral vector does not provide for
integration of the flagellin-related composition (and/or additional
agents) encoding nucleic acid into the genome of a transduced human
cell.
[0213] In another embodiment, the viral vector provides for
integration of the flagellin-related compositions (and/or
additional agents) encoding nucleic acid into the genome of a
transduced human cell.
[0214] In one embodiment, the invention provides methods of
transducing a human cell in vivo, comprising contacting a solid
tumor in vivo with a viral vector of the invention.
[0215] In another embodiment, the invention provides methods of
transducing a human cell ex vivo, comprising contacting a human
cell ex vivo with the viral vector of the invention. In one
embodiment, the human cell is a tumor cell. In one embodiment, the
human cell is allogeneic. In one embodiment, the tumor cell is
derived from the patient. In one embodiment, the human cell is a
non-tumor cell, such as, e.g., an antigen presenting cell (APC), or
a T cell.
[0216] Virus particle coats may be modified to alter specificity
and improve cell/tissue targeting, as is well known in the art.
Viral vectors may also be delivered in other vehicles, for example,
liposomes. Liposomes may also have targeting moieties attached to
their surface to improve cell/tissue targeting.
[0217] In some embodiments, the present invention provides human
cells expressing the therapeutic agent of the invention. In various
embodiments, the human cells express the agent proximal to a tumor
cell of, for example, a patient.
Diagnostic and Predictive Methods
[0218] In some aspects, the invention provides a method for
identifying a subject who may respond to treatment with a TLR5
agonist. In some embodiments, the present invention provides a
method of determining if a patient's tumor expresses TLR5.
[0219] TLR5 expression may be a predictive marker for determining
the grade and/or progression of a patient's tumor or dysplasia. In
some embodiments, the flagellin-related compositions (and/or
additional agents) described herein are useful in determining a
tumor grade and/or stage of a particular cancer.
[0220] Tumor grade is a system used to classify cancer cells in
terms of how abnormal they look under a microscope and how quickly
the tumor is likely to grow and spread. Many factors are considered
when determining tumor grade, including the structure and growth
pattern of the cells. The specific factors used to determine tumor
grade may vary with each type of cancer and are known in the
art.
[0221] Histologic grade, also called differentiation, refers to how
much the tumor cells resemble normal cells of the same tissue type.
Nuclear grade refers to the size and shape of the nucleus in tumor
cells and the percentage of tumor cells that are dividing.
[0222] Based on the microscopic appearance of cancer cells,
pathologists commonly describe tumor grade by four degrees of
severity: Grades 1, 2, 3, and 4. The cells of Grade 1 tumors
resemble normal cells, and tend to grow and multiply slowly. Grade
1 tumors are generally considered the least aggressive in behavior.
Conversely, the cells of Grade 3 or Grade 4 tumors do not look like
normal cells of the same type. Grade 3 and 4 tumors tend to grow
rapidly and spread faster than tumors with a lower grade. The
American Joint Committee on Cancer recommends the following
guidelines for grading tumors: GX-grade cannot be assessed
(Undetermined grade); G1-well-differentiated (Low grade);
G2-moderately differentiated (Intermediate grade); G3-poorly
differentiated (High grade); and G4-undifferentiated (High
grade).
[0223] Grading systems are different for each type of cancer. For
example, pathologists use the Gleason system to describe the degree
of differentiation of prostate cancer cells. The Gleason system
uses scores ranging from Grade 2 to Grade 10. Lower Gleason scores
describe well-differentiated, less aggressive tumors. Higher scores
describe poorly differentiated, more aggressive tumors. Other
grading systems include, for example, the Bloom-Richardson system
for breast cancer and the Fuhrman system for kidney cancer.
[0224] Cancer survival rates or survival statistics may refer to
the percentage of people who survive a certain type of cancer for a
specific amount of time. Cancer statistics often use an overall
five-year survival rate. For example the overall five-year survival
rate for bladder cancer is 80 percent, i.e. 80 of every 100 of
people diagnosed with bladder cancer were living five years after
diagnosis and 20 out of every 100 died within five years of a
bladder cancer diagnosis. Other types of survival rates may be
used, for example: disease-free survival rate (number of people
with cancer who achieve remission) and progression-free survival
rate, (number of people who still have cancer, but their disease is
not progressing).
[0225] In some embodiments, the flagellin-related compositions
(and/or additional agents) described herein are useful in
establishing a tumor grade for the purposes of diagnosis or
prognosis of a particular cancer, including prognosing the survival
rate, disease-free survival rate and/or progression-free survival
rate prior to, during and/or after administration of a
flagellin-related composition (and/or additional agents) disclosed
herein and/or prior to, during and/or after administration of an
anti-cancer agent or therapy.
[0226] In some embodiments, the flagellin-related compositions
(and/or additional agents) described herein are used as part of a
method of scoring tumor grades to assist in the selection and/or
predict the outcome of treatment. For example, the
flagellin-related compositions (and/or additional agents) described
herein may be used to diagnose or identify the cancer from a
patient as stage I (e.g. not locally advanced) predicting the need
for less aggressive treatment. Alternatively, the therapeutic agent
described herein may be used to diagnose or identify the cancer
from a patient as stage II or III, (e.g. the cancer may be locally
advanced) predicting the need for more aggressive treatment.
Similarly, the flagellin-related compositions (and/or additional
agents) described herein may be used to diagnose or identify the
cancer from a patient as stage IV, or is metastatic, predicting the
need for very aggressive treatment.
[0227] In some embodiments, the cancer is non-resectable. A
non-resectable cancer is a malignancy which cannot be surgically
removed, due either to the number of metastatic foci, or because it
is in a surgical danger zone. In some embodiments, the therapeutic
agent described herein is used as part of a method of treating
tumors to assist in selecting the nature and/or
timing/administration of treatment including, for example,
administering anti-cancer agents which reduce tumor volume, prior
to chemotherapeutic and/or radiation treatment, and/or increase or
decrease the dose of chemotherapy or radiation administered to a
patient.
[0228] In some embodiments, the cancer is multidrug resistant. For
example, the patient may have undergone one or more cycles of
chemotherapy, without substantial response. Alternatively or in
addition, the tumor has one or more markers of multidrug
resistance. Thus, as used herein, the term multidrug resistant
means a cancer exhibiting non-responsiveness to at least one cycle
of combination chemotherapy, or alternatively, has scored
(diagnostically) as resistant to at least two of (including
comparable agent to) docetaxel, paclitaxel, doxorubicin,
epirubicin, carboplatin, cisplatin, vinblastine, vincristine,
oxaliplatin, carmustine, fluorouracil, gemcitabine,
cyclophosphamide, ifosfamide, topotecan, erlotinib, etoposide, and
mitomycin. In some embodiments, the therapeutic agents described
herein are useful in establishing whether the tumor is responsive
to one or more chemotherapeutics, radiation therapy and/or other
anti-cancer therapy.
[0229] In other embodiments, the cancer is a recurrence following
conventional chemotherapy of an initial cancer. Often, recurrent
cancer has developed drug resistance, and thus is particularly
difficult to treat and often comes with a poor prognosis for
survival.
[0230] In some embodiments, the flagellin-related compositions
(and/or additional agents) described herein are used as part of a
method of tumor evaluation which takes the place of a performance
status. Performance status can be quantified using any system and
methods for scoring a patient's performance status which are known
in the art. The measure is often used to determine whether a
patient can receive chemotherapy, dose adjustment, and/or to
determine intensity of palliative care. There are various scoring
systems, including the Karnofsky score and the Zubrod score.
Parallel scoring systems include the Global Assessment of
Functioning (GAF) score, which has been incorporated as the fifth
axis of the Diagnostic and Statistical Manual (DSM) of
psychiatry.
[0231] Higher performance status (e.g., at least about 80%, or at
least about 70% using the Karnofsky scoring system) may indicate
treatment to prevent progression of the disease state, and enhance
the patient's ability to accept chemotherapy and/or radiation
treatment. For example, when the therapeutic agent described herein
indicates higher performance status, the patient is ambulatory and
capable of self care. In other embodiments, when the therapeutic
agent described herein indicates a low performance status (e.g.,
less than about 50%, less than about 30%, or less than about 20%
using the Karnofsky scoring system), the patient is largely
confined to bed or chair and is disabled even for self-care.
[0232] The Karnofsky score runs from 100 to 0, where 100 is
"perfect" health and 0 is death. The score may be employed at
intervals of 10, where: about 100% is normal, no complaints, no
signs of disease; about 90% is capable of normal activity, few
symptoms or signs of disease, about 80% is normal activity with
some difficulty, some symptoms or signs; about 70% is caring for
self, not capable of normal activity or work; about 60% is
requiring some help, can take care of most personal requirements;
about 50% requires help often, requires frequent medical care;
about 40% is disabled, requires special care and help; about 30% is
severely disabled, hospital admission indicated but no risk of
death; about 20% is very ill, urgently requiring admission,
requires supportive measures or treatment; and about 10% is
moribund, rapidly progressive fatal disease processes.
[0233] The Zubrod scoring system for performance status includes:
0, fully active, able to carry on all pre-disease performance
without restriction; 1, restricted in physically strenuous activity
but ambulatory and able to carry out work of a light or sedentary
nature, e.g., light house work, office work; 2, ambulatory and
capable of all self-care but unable to carry out any work
activities, up and about more than about 50% of waking hours; 3,
capable of only limited self-care, confined to bed or chair more
than about 50% of waking hours; 4, completely disabled, cannot
carry on any self-care, totally confined to bed or chair; 5,
dead.
[0234] In some embodiments, histological samples of tumors are
graded using the therapeutic agent described herein according to
Elston & Ellis, Histopathology, 1991, 19:403-10, which is
hereby incorporated by reference in its entirety. In some
embodiments, the therapeutic agent described herein is useful in
establishing a tumor grade for the purposes of diagnosis or
prognosis of a particular cancer.
[0235] In some embodiments, the flagellin-related compositions
(and/or additional agents) described herein are useful for
evaluating a subject and/or a specimen from a subject (e.g. a
cancer patient). In some embodiments, evaluation is one or more of
diagnosis, prognosis, and/or response to treatment.
[0236] Diagnosis refers to the process of attempting to determine
or identify a possible disease or disorder, such as, for example,
cancer. Prognosis refers to the predicting of a likely outcome of a
disease or disorder, such as, for example, cancer. A complete
prognosis often includes the expected duration, the function, and a
description of the course of the disease, such as progressive
decline, intermittent crisis, or sudden, unpredictable crisis.
Response to treatment is a prediction of a patient's medical
outcome when receiving a treatment. Responses to treatment can be,
by way of non-limiting example, pathological complete response,
survival, and probability of recurrence.
[0237] In various embodiments, the diagnostic and predictive
methods described herein comprise evaluating a presence, absence,
or level of a protein. In another embodiment, the methods described
herein comprise evaluating a presence, absence, or level of
expression of a nucleic acid. The compositions described herein may
be used for these measurements. For example, in some embodiments,
the methods described herein comprise contacting a specimen of the
tumor or cells cultured from the tumor with a therapeutic agent as
described herein.
[0238] In some embodiments, the present invention includes the
measurement of a tumor specimen, including biopsy or surgical
specimen samples. In some embodiments, the biopsy is a human
biopsy. In various embodiments, the biopsy is any one of a frozen
tumor tissue specimen, cultured cells, circulating tumor cells, and
a formalin-fixed paraffin-embedded tumor tissue specimen. In some
embodiments, the tumor specimen may be a biopsy sample, such as a
frozen tumor tissue (cryosection) specimen. As is known in the art,
a cryosection may employ a cryostat, which comprises a microtome
inside a freezer. The surgical specimen is placed on a metal tissue
disc which is then secured in a chuck and frozen rapidly to about
-20.degree. C. to about -30.degree. C. The specimen is embedded in
a gel like medium consisting of, for example, poly ethylene glycol
and polyvinyl alcohol. The frozen tissue is cut frozen with the
microtome portion of the cryostat, and the section is optionally
picked up on a glass slide and stained. In some embodiments, the
tumor specimen may be a biopsy sample, such as cultured cells.
These cells may be processed using the usual cell culture
techniques that are known in the art. These cells may be
circulating tumor cells. In some embodiments, the tumor specimen
may be a biopsy sample, such as a formalin-fixed paraffin-embedded
(FFPE) tumor tissue specimen. As is known in the art, a biopsy
specimen may be placed in a container with formalin (a mixture of
water and formaldehyde) or some other fluid to preserve it. The
tissue sample may be placed into a mold with hot paraffin wax. The
wax cools to form a solid block that protects the tissue. This
paraffin wax block with the embedded tissue is placed on a
microtome, which cuts very thin slices of the tissue. In certain
embodiments, the tumor specimen contains less than about 100 mg of
tissue, or in certain embodiments, contains about 50 mg of tissue
or less. The tumor specimen (or biopsy) may contain from about 20
mg to about 50 mgs of tissue, such as about 35 mg of tissue. The
tissue may be obtained, for example, as one or more (e.g., 1, 2, 3,
4, or 5) needle biopsies (e.g., using a 14-gauge needle or other
suitable size). In some embodiments, the biopsy is a fine-needle
aspiration in which a long, thin needle is inserted into a
suspicious area and a syringe is used to draw out fluid and cells
for analysis. In some embodiments, the biopsy is a core needle
biopsy in which a large needle with a cutting tip is used during
core needle biopsy to draw a column of tissue out of a suspicious
area. In some embodiments, the biopsy is a vacuum-assisted biopsy
in which a suction device increases the amount of fluid and cells
that is extracted through the needle. In some embodiments, the
biopsy is an image-guided biopsy in which a needle biopsy is
combined with an imaging procedure, such as, for example, X ray,
computerized tomography (CT), magnetic resonance imaging (MRI) or
ultrasound. In other embodiments, the sample may be obtained via a
device such as the MAMMOTOME.RTM. biopsy system, which is a laser
guided, vacuum-assisted biopsy system for breast biopsy.
[0239] In some embodiments, the diagnostic and predictive methods
and/or evaluation may direct treatment (including treatment with
the therapeutic agents described herein). In one embodiment, the
evaluation may direct the use or withholding of adjuvant therapy
after resection. Adjuvant therapy, also called adjuvant care, is
treatment that is given in addition to the primary, main or initial
treatment. By way of non-limiting example, adjuvant therapy may be
an additional treatment usually given after surgery where all
detectable disease has been removed, but where there remains a
statistical risk of relapse due to occult disease. In some
embodiments, the therapeutic agents described herein are used as an
adjuvant therapy in the treatment of a cancer. In some embodiments,
the therapeutic agents described herein are used as the sole
adjuvant therapy in the treatment of a cancer. In some embodiments,
the therapeutic agents described herein are withheld as an adjuvant
therapy in the treatment of a cancer. For example, if a patient is
unlikely to respond to a therapeutic agent described herein or will
have a minimal response, treatment may not be administered in the
interest of quality of life and to avoid unnecessary toxicity from
ineffective chemotherapies. In such cases, palliative care may be
used.
[0240] In some embodiments the therapeutic agents described herein
are administered as a neoadjuvant therapy prior to resection. In
certain embodiments, neoadjuvant therapy refers to therapy to
shrink and/or downgrade the tumor prior to any surgery. In some
embodiments, neoadjuvant therapy means chemotherapy administered to
cancer patients prior to surgery. In some embodiments, neoadjuvant
therapy means a therapeutic agent described herein is administered
to cancer patients prior to surgery. Types of cancers for which
neoadjuvant chemotherapy is commonly considered include, for
example, breast, colorectal, ovarian, cervical, bladder, and lung.
In some embodiments, the therapeutic agents described herein are
used as a neoadjuvant therapy in the treatment of a cancer. In some
embodiments, the use is prior to resection. In some embodiments,
the therapeutic agents described herein are withheld as a
neoadjuvant therapy in the treatment of a cancer. For example, if a
patient is unlikely to respond to a therapeutic agent described
herein or will have a minimal response, treatment may not be
administered in the interest of quality of life and to avoid
unnecessary toxicity from ineffective chemotherapies. In such
cases, palliative care may be used.
Subjects and/or Animals
[0241] In some embodiments, the subject and/or animal is a mammal,
e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig,
rabbit, sheep, or non-human primate, such as a monkey, chimpanzee,
or baboon. In other embodiments, the subject and/or animal is a
non-mammal, such, for example, a zebrafish. In some embodiments,
the subject and/or animal may comprise fluorescently-tagged cells
(with e.g. GFP). In some embodiments, the subject and/or animal is
a transgenic animal comprising a fluorescent cell.
[0242] In some embodiments, the subject and/or animal is a human.
In some embodiments, the human is a pediatric human. In other
embodiments, the human is an adult human. In other embodiments, the
human is a geriatric human. In other embodiments, the human may be
referred to as a patient.
[0243] In certain embodiments, the human has an age in a range of
from about 0 months to about 6 months old, from about 6 to about 12
months old, from about 6 to about 18 months old, from about 18 to
about 36 months old, from about 1 to about 5 years old, from about
5 to about 10 years old, from about 10 to about 15 years old, from
about 15 to about 20 years old, from about 20 to about 25 years
old, from about 25 to about 30 years old, from about 30 to about 35
years old, from about 35 to about 40 years old, from about 40 to
about 45 years old, from about 45 to about 50 years old, from about
50 to about 55 years old, from about 55 to about 60 years old, from
about 60 to about 65 years old, from about 65 to about 70 years
old, from about 70 to about 75 years old, from about 75 to about 80
years old, from about 80 to about 85 years old, from about 85 to
about 90 years old, from about 90 to about 95 years old or from
about 95 to about 100 years old.
[0244] In other embodiments, the subject is a non-human animal, and
therefore the invention pertains to veterinary use. In a specific
embodiment, the non-human animal is a household pet. In another
specific embodiment, the non-human animal is a livestock
animal.
Kits
[0245] The invention provides kits that can simplify the
administration of any agent described herein. An exemplary kit of
the invention comprises any composition described herein in unit
dosage form. In one embodiment, the unit dosage form is a
container, such as a pre-filled syringe, which can be sterile,
containing any agent described herein and a pharmaceutically
acceptable carrier, diluent, excipient, or vehicle. The kit can
further comprise a label or printed instructions instructing the
use of any agent described herein. The kit may also include a lid
speculum, topical anesthetic, and a cleaning agent for the
administration location. The kit can also further comprise one or
more additional agent described herein. In one embodiment, the kit
comprises a container containing an effective amount of a
composition of the invention and an effective amount of another
composition, such those described herein.
Definitions
[0246] The following definitions are used in connection with the
invention disclosed herein. Unless defined otherwise, all technical
and scientific terms used herein have the same meaning as commonly
understood to one of skill in the art to which this invention
belongs.
[0247] As used herein, "a," "an," or "the" can mean one or more
than one.
[0248] Further, the term "about" when used in connection with a
referenced numeric indication means the referenced numeric
indication plus or minus up to 10% of that referenced numeric
indication. For example, the language "about 50" covers the range
of 45 to 55.
[0249] An "effective amount," when used in connection with medical
uses is an amount that is effective for providing a measurable
treatment, prevention, or reduction in the rate of pathogenesis of
a disease of interest.
[0250] As used herein, something is "decreased" if a read-out of
activity and/or effect is reduced by a significant amount, such as
by at least about 10%, at least about 20%, at least about 30%, at
least about 40%, at least about 50%, at least about 60%, at least
about 70%, at least about 80%, at least about 90%, at least about
95%, at least about 97%, at least about 98%, or more, up to and
including at least about 100%, in the presence of an agent or
stimulus relative to the absence of such modulation. As will be
understood by one of ordinary skill in the art, in some
embodiments, activity is decreased and some downstream read-outs
will decrease but others can increase.
[0251] Conversely, activity is "increased" if a read-out of
activity and/or effect is increased by a significant amount, for
example by at least about 10%, at least about 20%, at least about
30%, at least about 40%, at least about 50%, at least about 60%, at
least about 70%, at least about 80%, at least about 90%, at least
about 95%, at least about 97%, at least about 98%, or more, up to
and including at least about 100% or more, at least about 2-fold,
at least about 3-fold, at least about 4-fold, at least about
5-fold, at least about 6-fold, at least about 7-fold, at least
about 8-fold, at least about 9-fold, at least about 10-fold, at
least about 50-fold, at least about 100-fold, in the presence of an
agent or stimulus, relative to the absence of such agent or
stimulus.
[0252] As referred to herein, all compositional percentages are by
weight of the total composition, unless otherwise specified. As
used herein, the word "include," and its variants, is intended to
be non-limiting, such that recitation of items in a list is not to
the exclusion of other like items that may also be useful in the
compositions and methods of this technology. Similarly, the terms
"can" and "may" and their variants are intended to be non-limiting,
such that recitation that an embodiment can or may comprise certain
elements or features does not exclude other embodiments of the
present technology that do not contain those elements or
features.
[0253] Although the open-ended term "comprising," as a synonym of
terms such as including, containing, or having, is used herein to
describe and claim the invention, the present invention, or
embodiments thereof, may alternatively be described using
alternative terms such as "consisting of" or "consisting
essentially of."
[0254] As used herein, the words "preferred" and "preferably" refer
to embodiments of the technology that afford certain benefits,
under certain circumstances. However, other embodiments may also be
preferred, under the same or other circumstances. Furthermore, the
recitation of one or more preferred embodiments does not imply that
other embodiments are not useful, and is not intended to exclude
other embodiments from the scope of the technology.
[0255] The amount of compositions described herein needed for
achieving a therapeutic effect may be determined empirically in
accordance with conventional procedures for the particular purpose.
Generally, for administering therapeutic agents (e.g.
flagellin-related compositions (and/or additional agents) described
herein) for therapeutic purposes, the therapeutic agents are given
at a pharmacologically effective dose. A "pharmacologically
effective amount," "pharmacologically effective dose,"
"therapeutically effective amount," or "effective amount" refers to
an amount sufficient to produce the desired physiological effect or
amount capable of achieving the desired result, particularly for
treating the disorder or disease. An effective amount as used
herein would include an amount sufficient to, for example, delay
the development of a symptom of the disorder or disease, alter the
course of a symptom of the disorder or disease (e.g., slow the
progression of a symptom of the disease), reduce or eliminate one
or more symptoms or manifestations of the disorder or disease, and
reverse a symptom of a disorder or disease. For example,
administration of therapeutic agents to a patient suffering from
cancer provides a therapeutic benefit not only when the underlying
condition is eradicated or ameliorated, but also when the patient
reports a decrease in the severity or duration of the symptoms
associated with the disease, e.g., a decrease in tumor burden, a
decrease in circulating tumor cells, an increase in progression
free survival. Therapeutic benefit also includes halting or slowing
the progression of the underlying disease or disorder, regardless
of whether improvement is realized.
[0256] Effective amounts, toxicity, and therapeutic efficacy can be
determined by standard pharmaceutical procedures in cell cultures
or experimental animals, e.g., for determining the LD50 (the dose
lethal to about 50% of the population) and the ED50 (the dose
therapeutically effective in about 50% of the population). The
dosage can vary depending upon the dosage form employed and the
route of administration utilized. The dose ratio between toxic and
therapeutic effects is the therapeutic index and can be expressed
as the ratio LD50/ED50. In some embodiments, compositions and
methods that exhibit large therapeutic indices are preferred. A
therapeutically effective dose can be estimated initially from in
vitro assays, including, for example, cell culture assays. Also, a
dose can be formulated in animal models to achieve a circulating
plasma concentration range that includes the IC50 as determined in
cell culture, or in an appropriate animal model. Levels of the
described compositions in plasma can be measured, for example, by
high performance liquid chromatography. The effects of any
particular dosage can be monitored by a suitable bioassay. The
dosage can be determined by a physician and adjusted, as necessary,
to suit observed effects of the treatment.
[0257] In certain embodiments, the effect will result in a
quantifiable change of at least about 10%, at least about 20%, at
least about 30%, at least about 50%, at least about 70%, or at
least about 90%. In some embodiments, the effect will result in a
quantifiable change of about 10%, about 20%, about 30%, about 50%,
about 70%, or even about 90% or more. Therapeutic benefit also
includes halting or slowing the progression of the underlying
disease or disorder, regardless of whether improvement is
realized.
[0258] In certain embodiments, a pharmacologically effective amount
that will treat cancer will modulate the symptoms typically by at
least about 10%, at least about 20%, at least about 30%, at least
about 40%, or at least about 50%. In exemplary embodiments, such
modulations will result in, for example, statistically significant
and quantifiable changes in the numbers of cancerous cells.
[0259] This invention is further illustrated by the following
non-limiting examples.
EXAMPLES
Example 1: Engineering of Flagellin-Related Compositions with
Improved Efficacy Relative to CBLB502
[0260] a. Structure-Activity Relationship Analysis (SAR):
[0261] The results of analysis, which included a combination of
site-directed mutagenesis and deletions are illustrated in FIG. 2.
Resulting variants of CBLB502 were expressed in E. coli, purified
and characterized by: (i) relative binding affinity in cell-free
system by competition-based fluorescent polarization (FP) assay
with recombinant purified fragment of TLR5 ectodomain of fish
origin and (ii) relative signaling efficiency by cell-based
luciferase reporter assay using wild-type CBLB502 as a reference
(as described in Yoon et al. (2012)). This analysis confirmed the
role of amino acid segments and certain residues of domain D1 in
the formation of primary and secondary interfaces predicted from 3D
structure (FIG. 3). It also revealed the importance of domain D0
for signaling (but not primary binding) although the actual role of
this domain remained unknown. This analysis also revealed that only
the C-terminal segment of D0 (C_D0) is essential, while the
N-terminal segment can be eliminated without loss of signaling
activity (as in, for example, the deletion variant S33 (SEQ ID NO:
17)).
[0262] In vivo testing of the signaling activity of the mutants in
primary and secondary interface as well as the delta-D0 deletion
variant of CBLB502 revealed a correlation with the in vitro
signaling data. This was established by injection of varying doses
of respective mutants (recombinant purified and detoxed proteins)
into NF-kB-luciferase reporter mice and measurement of luciferase
activity in various organs (See FIG. 4, panels A-E).
[0263] Briefly, NF-kB luciferase reporter mice were injected s.c
with CBLB502 mutants (three mice per group) as indicated. The
relative amounts of injection used were based on their signaling
efficacy in cell based NF-kB reporter assays. Organs were collected
3 hours post injection and snap frozen in dry ice. Tissue
homogenates were prepared by pulverization of organs followed by
lysis using RIPA buffer supplemented with protease inhibitors. For
luciferase assays, 20 ul of each lysate was mixed with 30 ul of
luciferin reagent (Bright-Glo luciferase assay system, Promega
Inc.) and luciferase activity was quantified using a luminometer.
Luciferase activity was normalized based on protein concentration
measured using Bradford assay. The results demonstrate that while
the response in the liver observed for the S33 mutant was
moderately increased about 3-fold, this mutant showed a much
stronger enhancement (>10-fold at the same dose of 0.3 .mu.g)
was observed in the bladder and large intestine.
[0264] During additional systematic SAR, a large number of
truncated variants were generated and characterized primarily for
signaling activity (using luciferase-based or a standard CBLB502
bioactivity assay using LacZ reporter system). These deletions
(partially illustrated by diagrams in FIG. 5) allowed us to refine
the boundaries of the minimal essential core and address a
potential relevance of the length (from 33 aa to 12 aa) and
position of the tag (N-terminal vs. C-terminal) as well as test the
possibility to minimize a linker region (as in the construct "33ML"
(SEQ ID NO: 35)).
[0265] A list of CBLB502 variants comprising an extensive SAR
analysis is provided in Table 2. Among the most important
observations, without wishing to be bound by theory, is the
principle possibility to eliminate at least one half of the
indigenous C_D0 segment, leaving only its N-terminal half (470-485)
capped by the C-terminal His-tag (the presence of the cap is
essential for activity as the variant 33-485 loses about 90% of
signaling activity, see Table 2). These observations taken together
suggest, without wishing to be bound by theory, that the D0 domain
has only minor (if any) contribution to direct interactions with
TLR5, and its role may be limited to maintaining structural
integrity of D1 domain. On the other hand, the residual C_D0
segment (470-485) cannot be removed or replaced by the C-terminal
half of C_D0 (485-504) or other sequences (e.g. fragment of GFP as
in CGD1 or the N-D0 segment as in a new construct MF233 (SEQ ID NO:
123), see below Table 2). At the same time, some of the polar
residues could be replaced by alanine in this segment without
appreciable loss of activity (see Table 2).
TABLE-US-00002 TABLE 2 CBLB502 deletion/fusion variants Relative
EC50 vs 502 CBLB502 Length Binding Signaling Signaling variant ID
Brief description (aa) Modular composition (design) Objectives
Conclusions (FP) (Luc) (LacZ) 502 Starting point- 329
6xH-EK-Tag(33a~"N-Tag-HEK")-ND0_ND1 (1-175)-Linker16-CD1_CD0
(401-504) 1.0 1.0 1.0 original construct ['aa 32-44: N-terminal
spoke region (NS); aa 464-469: C-terminal spoke region (CS)] SY3
Delta D0: described 262 6xH-Thrombin-Tag (37aa; "N-Tag-HT")-ND1
(Start@aa 33)-Linker16-CD1 (Term@ aa465) 2.9 185 309 before 1 445
Delta CD0: 272 N-Tag-HT-ND0_ND1-Linker16-CD1 (Term@ aa 443)
Importance of C-terminal fragment Deletion of CD0 fragment alone
0.4 141000 694 Truncated CD1 of D0 domain (CD0) and 26 C- has
significant effect- 2 451 Delta CD0: 289
N-Tag-HT-ND0-ND1-Linker16-CD1 (Term@ aa 460) terminal aa of D1
fragment (CD1) approximately 50-100 times ND 97 105 Truncated CD1
in signaling? lower activity. Additional 3 467 Delta CD0 295
N-Tag-HT-ND0-ND1-Linker16-CD1 (Term@ aa 466) truncation of 26
C-terminal aa of 1.0 71 57 4 470CT Delta CD0: Minimal 274
ND0-ND1-Linker16-CD1 (Term@ aa 469)-Thrombin- CD1 fragmentieads to
nearly loss ND 44 3 C-Tag 6xH-Tag (13 aa: C-Tag) of activity (at
least 700 times) 5 S33 Delta ND0: N- 300 N-Tag-HT-ND1 (Start@ aa
33)-Linker16-CD1-CD0 [Variant CBLB502-S33 was [Vriant S33 showed
improved 0.8 1.4 ND terminal tag characterized in vivo] PK and
higher in vivo activity 6 33CT Delta ND0: C- 275 ND1 (Start@ aa
33)-Linker16-CD1-CD0-C-Tag Contribution of N-terminal fragment by
PD, Luc-mice and in ND 2.3 ND terminal tag of D0 domain (ND0) and
N-terminal radioprotection.] 7 37CT Delta ND0 273 ND1 (Start@ aa
37)-Linker16-CD1-CD0-C-Tag spoke region (NS; aa 32-44) to Deletion
of ND0 fragment and ND 3.2 ND signaling? truncation of NS has
little effect 8 N45 Delta ND0 288 N-Tag-HT-ND1 (Start@
aa45)-Linker16-CD1-CD0 on activity (1.5-3.5 times ND 3.6 ND 9 45CT
Delta ND0 285 ND1 (Start@ aa 45)-Linker16-CD1-CD0-"Long" C-
decrease), regardless of position ND 3.5 ND Tag (34 aa) of the tag.
10 33-485 Delta ND0: 281 N-Tag-HT-ND1 (Start@ aa
33)-Linker16-CD1-CD0 Minimal essential fragment of Truncation of 20
C-termianl aa of ND 11 ND Truncated CD0 (Term@ aa485) CD0? CD0
leads to 11x-lower activity 11 33ML Delta ND0: 250 ND1 (Start@ aa
33)-Linker3-CD1 (Start@aa413)- Test structure-based
hypothesis-minimize the linker and have start of ND 1.5 1.3
Minimized Linker, CD0-C-Tag CD1 at aa 413 (401 in CBLB502).
Confirmed Truncated CD1 12 MF227C 33ML based: 227 ND1 (Start@ aa
33)-Linker3-CD1-CD0 (deleted aa Continue testing further The
N-terminal part of CD0 is ND ND 5.5 Deletion within CD0
470-492)-C-Tag minimization in 33ML background. essential (5x loss)
13 MF227N 33ML based: 227 ND1 (aa 33-152)-Linker3-CD1-CD0-C-Tag
Hypothesis: C-terminal capping of C-terminal part of ND1 (aa 153-
ND ND 159 Truncated ND1 D1 domain with C-tag may yield 175,
connector) is indispensable. 14 485CT 33ML based: 233
ND1-Linker3-CD1-CD0 (Term@aa485)-C-Tag the shortest active variant.
Partial CD0 (aa 470-485) + C- ND ND 1.2 Truncated CD0 terminal cap
(Thrombin'6xHis Tag) retaine full activity (in contrust with 11x
loss in 33-485 with N-tag 15 485D 485CT baseed: 229
ND1-Linker3-CD1-CD0 (Term@aa485)-C-Tag; Detrimental (44x loss) -
defines ND ND 44 Q439::F442 deletion Q439::F442 deletion boundaries
16 SY3CT Delta D0: minimal 217 ND1-Linker3-CD1-C-Tag Only partially
true: This variant is ND ND 16 linker: C-terminal tag >20x more
active then N-terminal tag version (SV3) Still it is worse than 502
by 18x. 17 NGD1 Fusion: N-terminal 380 GPF (aa
1-157)-Linker7-ND1-Linker3-CD1-C-Tag Hypothesis: (1) capping
(N-terminal (1) N-terminal GFP-cap is not ND ND 58 GFP fragment (1-
and C-terminal separate. or together) helpful: C-terminal brings
activity to 157)-D1 of D1 domain alone can stabilize it 1/ of 502,
(2) GFP fusion was 18 CGD1 Fusion: D1-C- 303
ND1-Linker3-CD1-Linker7'-GFP (aa 158-238)-C- and make active. We
used N-terminal fluorescent but not active ND ND 8 terminal GFP Tag
and C-terminal fragments of GFP for fragment (158-238) capping. (2)
Fusion of N- and C- 19 GD1G Fusion: N-GFP (1- 466 GFP (aa
1-157)-Linker7-ND1-Linker3-CD1-Linker7'- terminal fragments of GFP
to D1 ND ND 259 157)-D1-C-GFP GFP (aa158-238)-C-Tag domain instead
of D0 (GD1G Mutant) (158-238) may stabilize D1 doamin and allow us
to monitor its stabilized conformation through reconstitution of
GFP fluorescence* 20 CPM194 Circular Permutant: 194 CD1-Linker3-ND1
(Term@aa152)-C-Tag Exploring alternative approach in So, far
unsuccessful. One protein ND ND N/A CD1 (413-469) // stabilizing D1
using circular not folded. The other is folded but ND1 (33-152)
permutation technique. inactive 21 CPM217 Circular Permutant: 217
CD1-Linker3-ND1 (Term@aa175)-C-Tag ND ND 1112 CD1 (413-469) // ND1
(33-175) Ghosh, I., Hamilton, A. D. & Regan L. Antiparallel
leucine zipper-directed protein reassembly: application to the
green fluorescent protein. J. Am. Chem. Soc. 122, 5658-5659 (2000).
Jeong, J. et al. Monitoring of conformational change in maltose
binding protein using split green fluorescent protein. Biochem.
Biophys. Res. Commun. 339, 647-651. (2006). Latz E, Verma A,
Visintin A, Gong M, Sirois CM, et al. (2007) Ligand-induced
conformational changes allosterically activate Toll-like receptor
9. Nature. Immunology 8:772-779. indicates data missing or
illegible when filed
[0266] In summary, the variant CBLB502-485CT ("CBLB533" (SEQ ID NO:
71)) represents the result of ultimate minimization of CBLB502
without loss of signaling activity (at least in vitro). This
variant (233 aa long) is 30% shorter than CBLB502 (329 aa). (See
FIG. 5).
[0267] In vivo characterization was accomplished for the key
intermediate in minimization--CBLB502-S33 (SEQ ID NO: 17) with
deleted N_D0 segment and the original 33aa N-terminal tag (FIG. 5).
The respective recombinant purified protein displayed nearly full
signaling activity in vitro (Table 2). Remarkably, the first
results of in vivo testing in NF-kB-Luc-reporter mice performed
side-by-side with CBLB502 revealed a substantially higher potency
of CBLB502-S33 in vivo (FIG. 6) based on Xenogen imaging. A more
quantitative analysis of luciferase activity in individual organs
showed that while the response in the liver was moderately
increased, about 3-fold, a much stronger enhancement (>10-fold,
at the same dose 0.3 .mu.g) was observed in bladder and large
intestine (FIG. 7).
[0268] Importantly, the enhanced response was also observed at the
level of radioprotection potency (FIG. 8).
[0269] This observation suggests, without wishing to be bound by
theory, that a minimized variant of CBLB502 can be efficiently used
for anti-acute radiation syndrome (ARS) indications at lower doses.
This enhanced potency may also be manifested in radiomitigation
mode (post-exposure administration). This expectation is
substantiated by the observed stronger cytokine response (FIG. 9)
including the key cytokines (G-CSF and IL-6) selected as CBLB502
PD-biomarkers and proven to be mechanistically essential for its
radiomitigation activity (Burdelya et al. 2008).
[0270] An apparent rationale for the correlated enhancement of
CBLB502-S33 in vivo activity at the level of NF-kB signaling,
radioprotection and cytokine production (PD) is a substantially
improved PK (FIG. 10). The enhanced persistence of CBLB502-S33 in
plasma might reflect higher stability to proteolysis or, more
likely, less efficient "trapping" in certain organs/tissues (e.g.
in the liver) and slower clearance from circulation thus increasing
exposure of other tissues. The latter interpretation provides
additional evidence of the contribution of such tissues (e.g.
peripheral blood cells) to the MOA of the drug.
[0271] By way of non-limiting summary, characterization of
CBLB502-S33 showed that the SAR analysis and iterative minimization
deliver biologically active protein variants with improved
pharmacological properties. This information was used to design,
engineer and characterize the ultimate design for CBLB533
[0272] The SAR results suggest the ultimate design of CBLB533 based
on the variant CBLB502-485CT (with or without additional
mutations). This protein can be produced in sufficient amount and
characterized in vivo similar to the analysis performed for the
intermediate lead candidate CBLB502-S33 additionally expanded by
testing of radiomitigation properties. Importantly, they provided
an optimal scaffold for designing the de-immunized Nextgen drug
candidate CBLB543.
Example 2: Engineering of Flagellin-Related Compositions with
Reduced Antigenicity Relative to CBLB502
[0273] Anti-CBLB502 antibodies (preexisting or/and boosted by
CBLB502 treatment) showing neutralizing activity in vitro should
also neutralize its NF-kB signaling (and therefore therapeutic)
activity. This was confirmed by the direct experiment in mice (FIG.
11). Indeed, the injection of CBLB502 neutralizing human sera or
monoclonal antibodies in NF-kB luciferase mice completely abrogates
the luciferase activity in organ (live) lysates.
[0274] In this experiment, five groups of NF-kB reporter mice (3
per group) were injected intravenously with (1) PBS (2) non
neutralizing serum, (3) neutralizing serum (day 15 bleed) (4) mAb
7C (5) mAb 11D and animals were bled after 45 minutes. The
monoclonal antibodies were used at the dose of 100 .mu.g per mouse.
CBLB502 (1 .mu.g) was injected subcutaneously to all mice one hour
after the initial injection of antibodies. Animals were imaged
three hours after CBLB502 injection and liver was collected for
preparation of lysates. The results from this study are shown in
Table 3.
[0275] The specific activity of luciferase was measured per the
following protocol. A Bio-pulverizer was used to crush the liver
samples on the dry ice. 750 .mu.l of 1.times. Reporter Lysis Buffer
(Promega cat #E397A)+1.times. protease inhibitor cocktail (PIC,
sigma P8340) was added and the homogenized mixture was centrifuged
at 13,000 rpm at 4.degree. C. for 30 minutes. The supernatant was
collected into a clean eppendorf tube and the protein concentration
of the supernatant was measured. 20 .mu.l of supernatant and 20
.mu.l of luciferase buffer (Promega E2620) were added. Everything
was normalized to the lowest protein sample and added accordingly,
and the volume of the supernatant was adjusted using the Lysis
buffer with PIC. The luciferase activity was measured on a
luminoplate reader.
TABLE-US-00003 TABLE 3 In vivo neutralization of CBLB502 by
injection of antisera and antibodies (neutralizing and not
neutralizing) in reporter mice. Anti-CBLB502 antibody assay results
Anti- Sample NAb % CBLB502 Sample # ID Study group inhibition titer
1 #1-1 PBS -1.08 0 2 #1-2 PBS -4.68 0 3 #1-3 PBS 0.51 0 4 #2-1
Non-neutralizing 1.77 0 human serum 5 #2-2 Non-neutralizing -5.38 0
human serum 6 #2-3 Non-neutralizing 0.15 0 human serum 7 #3-1
Neutralizing 77.37 19462 human serum 8 #3-2 Neutralizing 86.04
20879 human serum 9 #3-3 Neutralizing 83.52 17000 human serum 10
#4-1 Non-neutralizing 5.18 791 MAb 7C 11 #4-2 Non-neutralizing 1.21
487 MAb 7C 12 #4-3 Non-neutralizing 2.63 858 MAb 7C 13 #5-1
Neutralizing 44.81 114496 MAb 11D 14 #5-2 Neutralizing 49.41 87249
MAb 11D 15 #5-3 Neutralizing 54.48 109475 MAb 11D *Human sera were
diluted 10-fold with PBS for injections **Both MAbs, 7C and 11D,
were at 2 mg/ml in PBS for injections ***Mouse serum samples were
collected 1 hr after Ab injections
[0276] A brief summary of is provided below (and shown in Tables 4,
and 5 and FIG. 12).
TABLE-US-00004 TABLE 4 CBLB502 epitope mapping and de-immunization
Signaling EC50 Nor- malized Scaf- Length by Neutralization by
antibodies (IC50 improvement vs. 502) Protein fold Mutations (aa)
CB1B502 mAB4D11 mAb11D04 NSP79 NSP85 NSP99 NSP61 NSP103 P12 P14
Note MIM1 502 N455A; 329 0.9 No improvement in neutralization with
1 based N457A any of the antibodies MIM2 502 N455A; 329 1.2 based
N457A; R460A MIM3 502 N448A; 329 4.6 based N451A; N455A, N457A;
R460A MIM4 502 Q439:: 329 37 based F442 deletion; N448A; N451A;
N455A, N457A; R460A MIM5 502 Q439A; 329 54 based N440K; R441A;
N448A; N451A; N455A, N457A; R460A 33MIMX S33 N68A; 300 1.3 ~10x
4-5X No 2x 1x ~3x ~2x 2 based F131A; improvement Q142A; E153A;
T154A; N440A; D443A; S444A; T447A MIXN 33ML N68A; 250 1.5 ~10x ~10x
4-5X 4-5X 3 based F131A; Q142A; E153A; T154A MIXC 33ML N440A; 250
1.5 ~10x ~10x worse based D443A; S444A; T447A ME42 33ML D42A; 250
1.3 4x 5x 2x 2x 1x 1x 4 based A45G ME100 33ML N100A; 250 0.6 >5x
>10x 3x 2x 1x 2x based T102A ME104 33ML S104A; 250 1.0 >5x
>10x >5x >5x 1x 2x based S106A; D107A ME110 33ML S110A;
250 0.7 >5x >10x 3x 2x 1x 2x based D113A ME117 33ML Q117A;
250 0.8 >5x >10x 2x 2x 1x 1x based E120A ME124P 33ML R124A
250 * based ME124 33ML R124A; 250 0.9 3x 6x 2x 1x 3x 1x based
N127A; Q128A ME132 33ML N132A; 250 0.94 >5x >10x 4x >5x 2x
3x based G133A ME142 33ML Q142A; 250 0.3 >5x >10x 3x >5x
2x 2x based K144A ME150 33ML N150S; 250 0.5 >5x >10x 3x 2x 1x
2x based D151A; G152A ME468 33ML Y468A; 250 0.7 >5x >10x 2x
2x 4x 1x based A469G; T470A; S473A ME100/ 33ML N100A; 250 * 110
based T102A; S110A; D113A ME104N 33ML N100A; 250 0.9 1x 2x 2x 2x 1x
1x based T102A; S104A; S106A; D107A; S110A; D113A 33GPS 33ML
Deletion 240 * based N100:: D113. Replaced with linker "GPSG" 33MX
33ML N68A; 250 1.3 >4x >4x >2x >2x 6x 7x 5 based F131A;
Q142A; E153; T154A; S104A; S106A; D107A; S110A; D113A; N132A;
G133A; K144A; N127Q; N474Q
TABLE-US-00005 TABLE 5 Antigenicity of CBLB502 deletion variants by
antibody titration (ELISA) with multiple human antisera Titers
Plate Plate Plate Plate 1 Plate 2 Plate 3 Plate 4 Plate 5 Plate 6
Plate 7 8 9 Mab 10 Plate 11 Plate 12 Pt. serum Pt. serum Pt. serum
Pt. serum Pt. serum Pt. serum Pt. serum MAb 11D Mab Goat Rabbit
#004 #006 #009 #010 #012 #008 #013 7C Neu- 12D PAb PAb Day 15, Day
15, Day 15, Day 15, Day 15, No No No tral- No CBLB502 CBLB502
CBLB502 CBLB502 CBLB502 CBLB502 CBLB502 CBLB502 CBLB502 effect
izing effect assays assays Deletion 429687 319746 117275 261211
543635 3331 7023 1392 39297 11433 33248 41555 SY3 414991 319843
160498 276131 626631 2413 8462 1619 39722 10233 35372 40853
Deletion 429436 322443 199057 264892 649834 9846 9490 1596 42485
11725 38755 39092 467 67857 152052 21824 57521 150700 978 914 1470
8609 1577 40988 19077 Deletion 519509 357298 296948 337398 761754
12082 23459 1547 52663 15364 59596 46738 S33 Deletion 445 CBLB502
Ref, Std Titer % of CBLB502 reference standard Plate Plate Plate
Plate 1 Plate 2 Plate 3 Plate 4 Plate 5 Plate 6 Plate 7 8 9 Mab 10
Plate 11 Plate 12 Pt. serum Pt. serum Pt. serum Pt. serum Pt. serum
Pt. serum Pt. serum MAb 11D Mab Goat Rabbit #004 #006 #009 #010
#012 #008 #013 7C Neu- 12D PAb PAb Day 15, Day 15, Day 15, Day 15,
Day 15, No No No tral- No CBLB502 CBLB502 CBLB502 CBLB502 CBLB502
CBLB502 CBLB502 CBLB502 CBLB502 effect izing effect assays assays
Deletion 83 89 39 77 71 28 30 90 75 74 56 89 SY3 80 90 54 82 82 20
36 105 75 67 59 87 Deletion 83 90 67 85 85 81 40 103 81 76 65 84
467 13 43 7 20 20 8 4 95 16 10 69 41 Deletion 100 100 100 100 100
100 100 100 100 100 100 100 S33 Deletion 445 CBLB502 Ref, Std
[0277] The initial studies were based on the computational
prediction of linear epitopes, a comparative analysis of
antigenicity (assessed by ELISA with a series of human serum
samples) for a series of truncated variants, and the observation
that the deletion variant 445 (see Table 2 for composition)
significantly lost antigenicity pointing to the existence of the
major epitope within a rather short amino acid segment (440-470).
However the analysis of antigenicity in a number of mutants
generated based on this premise did not confirm these predictions
(see FIG. 12).
[0278] Based on these observations, in the following work, the
approach was adjusted to the use of predicted structural
(potentially noncontiguous) epitopes (FIG. 13), testing
intermediate mutants for "neutralizing antigenicity" assessed by
the extent of inhibition by neutralizing Abs in signaling assay. We
progressed from using a full-size CBLB502 scaffold to the first
truncated lead CBLB502-S33 (see Table 2 for composition), and its
further modification S33MX (SEQ ID NO: 150).
[0279] In the first series of designed mutants, substantial
progress was attained in decreasing sensitivity to neutralizing
monoclonal antibodies and neutralizing antisera raised against
CBLB502. An improvement was observed on a series of human normal
sera containing an appreciable un-induced titer of neutralizing
antibodies.
[0280] To address this problem, an additional series of mutant were
designed and characterized.
[0281] As a result of such iterations, the majority of neutralizing
epitopes were mapped and eliminated without loss of signaling
activity (see Table 4).
[0282] To engineer the first generation of fully active
"deimmunized" CBLB502 lead candidate (CBLB543), the following was
undertaken.
[0283] Epitope mapping data obtained as described above (See Table
5) provided foundation for the ultimate design of the de-immunized
CBLB543 lead candidate (CBLB502-S33MX (SEQ ID NO: 150)). This
protein was engineered and characterized by signaling activity
(unchanged) and neutralizing antigenicity. As illustrated in FIG.
14 (for individual data, see Table 4), in this protein the
neutralizing antigenicity was substantially reduced compared to
CBLB502. The additional comparison with CBLB502-S33ML (SEQ ID NO:
35), a truncated scaffold used for lead engineering shows this
effect is due to a combination of mutations, and not reduced
size.
Example 3: Potency and Pharmacological Properties of De-Immunized
Variants (CBLB502-33MX and CBLB502-S331
[0284] Studies were undertaken to evaluate the PK/PD properties of
selected flagellin-related compositions Specifically, the PK/PD
properties of the partially deimmunized protein CBLB502-33MX were
compared with those of CBLB502. Accordingly, this study established
the functional and pharmacological characteristics of the
engineered new variant CBLB502-33MX with substantially reduced
"neutralizing antigenicity" and thus resistant to neutralization by
human neutralizing antibodies in the in vitro signaling assay.
[0285] In-life phase of PK/PD study: 320 C57Bl6 mice were used for
the experiment in groups of 10 mice. CBLB502 (1 and 2 .mu.g/kg) and
33MX (1 and 2 .mu.g/kg) were injected intravenously. The animals
were sacrificed after 5 min, 15 min, 30 min, 1 hour, 2 hours, 4
hours, 8 hours and 24 hours after treatment, and plasma samples
were collected.
[0286] PK measurements: the concentration of CBLB502 and 33MX in
the plasma samples was measured according to the standard
ELISA-based protocol using CBLB502 and 33MX calibration curves.
[0287] The results of PK measurements are illustrated in FIG. 15.
FIG. 15, panels A and B show quantification of CBLB502 and 33MX in
mouse plasma samples. (BLQ--below the limit of quantification).
Therefore, CBLB502-33MX has very similar PK properties to that of
parental CBLB502, i.e. it clears from circulation at approximately
the same rate. Accordingly, PK features of CBLB502 are not
abrogated by the mutations that were engineered to de-immunize the
construct (e.g. in the context of CBLB502-33MX).
[0288] The same 320 plasma samples were used for cytokine profiling
for the analysis of PD properties of 33MX as compared to CBLB502.
The data (FIG. 16) shows that CBLB502-33MX has a very similar PD
profile to the parental CBLB502. Accordingly, PD features of
CBLB502 also are not abrogated by the mutations that were
engineered to de-immunize the construct (e.g. in the context of
CBLB502-33MX).
[0289] In vivo signaling of the parental CBLB502 was compared to an
intermediate variant CBLB502-S33 (minimized, prior to
deimmunization) and CBLB502-33MX, the final product of Stage I
deimmunization. A NF-kB-luciferase reporter assay in mice was used
and mice were injected with the one of the following proteins:
CBLB502 (at doses of 0.1 .mu.g, 0.3 .mu.g, 1 .mu.g and 3 .mu.g);
CBLB502-S33 (at doses of 0.1 .mu.g, 0.3 .mu.g, 1 .mu.g and 3
.mu.g); and CBLB502-33MX (at doses of 0.1 .mu.g, 0.3 .mu.g, 1 .mu.g
and 3 .mu.g). 3 hours after treatment the mice were sacrificed and
the following organs were harvested and frozen at -80.degree. C.:
liver, bladder, small and large intestine, heart, spleen, lungs,
brain and kidney. Luciferase activity in organ lysates was measured
using Bright-Glo Luciferase Assay solution (Promega) and presented
as specific luciferase activity (RLU/mg of protein+/-SEM).
[0290] The results of experiment shown in FIG. 17 demonstrate that
NF-.kappa.B activating ability of de-immunized candidate 33MX is
similar to S33 and CBLB502 and in some organs (for example, large
intestine and lungs) even exceeds activity of these proteins in
some organs
[0291] Therefore, among others, this Example shows that that
de-immunized variant CBLB502-33MX fully retained or exceeded in
some parameters the biological activity and pharmacological
characteristics of the original CBLB502.
Example 4: In Vivo Efficacy of 33MX in a Murine Model of Local
Head-And-Neck Irradiation
[0292] The in vivo effects of 33MX in the context of irradiation
were evaluated at a variety of doses as compared to CBLB502.
Treatment was injected 1 h after each irradiation preventing damage
and accelerating tissue recovery following fractionated H&N
irradiation.
[0293] Six groups by 8 mice were evaluated and are listed in the
order that the data is presented in FIG. 18 (in series for 8 tissue
types, the bars identified from left to right for each tissue
type): Group 1 (vehicle): 6 Gy.times.5 times with 24 h interval (30
Gy total), inject PBS-Tween 1 h after each IR, Group 6 (33MX, 0.03
.mu.g): 6 Gy.times.5 times with 24 h interval (30 Gy total), inject
0.03 .mu.g 33MX 1 h after each IR, Group 5 (33MX, 0.1 .mu.g): 6
Gy.times.5 times with 24 h interval (30 Gy total), inject 0.1 .mu.g
33MX 1 h after each IR, Group 4 (33MX, 0.3 .mu.g): 6 Gy.times.5
times with 24 h interval (30 Gy total), inject 0.3 .mu.g 33MX 1 h
after each IR, Group 3 (33MX, 1 .mu.g): 6 Gy.times.5 times with 24
h interval (30 Gy total), inject 1 .mu.g 33MX 1 h after each IR,
and Group 2 (CBLB502, 0.1 .mu.g): 6 Gy.times.5 times with 24 h
interval (30 Gy total), to inject 0.1 .mu.g CBLB502 1 h after each
IR (this dose was determined to be particularly efficacious in a
separate study),
[0294] All mice were taken for histopathological analysis of mouse
epithelia, tongue, upper esophagus, salivary glands and skin on day
10 after the first IR (day 0).
[0295] The results of the study are presented in FIG. 18. Injury
scores are based on histological evaluation of the tissue sections.
The scores values scale: 0 for no injury and 4 for the highest
injury.
EQUIVALENTS
[0296] While the invention has been described in connection with
specific embodiments thereof, it will be understood that it is
capable of further modifications and this application is intended
to cover any variations, uses, or adaptations of the invention
following, in general, the principles of the invention and
including such departures from the present disclosure as come
within known or customary practice within the art to which the
invention pertains and as may be applied to the essential features
hereinbefore set forth and as follows in the scope of the appended
claims.
[0297] Those skilled in the art will recognize, or be able to
ascertain, using no more than routine experimentation, numerous
equivalents to the specific embodiments described specifically
herein. Such equivalents are intended to be encompassed in the
scope of the following claims.
INCORPORATION BY REFERENCE
[0298] All patents and publications referenced herein are hereby
incorporated by reference in their entireties.
[0299] The publications discussed herein are provided solely for
their disclosure prior to the filing date of the present
application. Nothing herein is to be construed as an admission that
the present invention is not entitled to antedate such publication
by virtue of prior invention.
[0300] As used herein, all headings are simply for organization and
are not intended to limit the disclosure in any manner. The content
of any individual section may be equally applicable to all
sections.
REFERENCES
[0301] 1. Yoon S I, Kurnasov O, Natarajan V, Hong M, Gudkov A V,
Osterman A L, Wilson I A., 2012. Structural Basis of TLR5-Flagellin
Recognition and Signaling. Science 335:859-864 (PMID: 22344444)
[0302] 2. Smith K D, Andersen-Nissen E, Hayashi F, Strobe K,
Bergman M A, Barrett S L, Cookson B T, Aderem A. 2003. Toll-like
receptor 5 recognizes a conserved site on flagellin required for
protofilament formation and bacterial motility. Nat Immunol.
4:1247-53 (PMID: 14625549) [0303] 3. Mizel, S. B., A. P. West, R.
R. Hantgan. 2003. Identification of a sequence in human Toll-like
receptor 5 required for the binding of Gram-negative flagellin. J.
Biol. Chem. 278:23624-23629 (PMID: 12711596) [0304] 4. Murthy, K.
G., Deb, A., Goonesekera, S., Szabo, C. & Salzman, A. L. (2004)
J. Biol. Chem. 279:5667-5675 (PMID: 14634022) [0305] 5.
Andersen-Nissen E., Smith K. D., Strobe K. L., Barrett S. L.,
Cookson B. T., Logan S. M., Aderem A. (2005) Evasion of Toll-like
receptor 5 by flagellated bacteria. Proc. Natl. Acad. Sci. U.S.A.
102: 9247-9252 (PMID: 15956202) [0306] 6. Andersen-Nissen E, Smith
K D, Bonneau R, Strong R K, Aderem A. 2007. A conserved surface on
Toll-like receptor 5 recognizes bacterial flagellin. J Exp Med.
204:393-403 (PMID: 17283206) [0307] 7. Burdelya L G, Krivokrysenko
V I, Tallant T C, Strom E, Gleiberman A S, Gupta D, Kurnasov O V,
Fort F L, Osterman A L, Didonato J A, Feinstein E, Gudkov A V.,
2008. An agonist of Toll-like receptor 5 has radioprotective
activity in mouse and primate models. Science 320:226-230 (PMID:
18403709). [0308] 8. Huleatt J W, Nakaar V, Desai P, Huang Y,
Hewitt D, Jacobs A, Tang J, McDonald W, Song L, Evans R K et al.
2008. Potent immunogenicity and efficacy of a universal influenza
vaccine candidate comprising a recombinant fusion protein linking
influenza M2e to the TRL5 ligand flagellin. Vaccine. 26:201-214.
Sequence CWU 1
1
2941505PRTSalmonella dublin 1Met Ala Gln Val Ile Asn Thr Asn Ser
Leu Ser Leu Leu Thr Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ser
Leu Ser Ser Ala Ile Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn
Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe
Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn
Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn
Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 85 90 95Val Gln
Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile 100 105
110Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn
115 120 125Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn
Gln Met 130 135 140Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile
Thr Ile Asp Leu145 150 155 160Gln Lys Ile Asp Val Lys Ser Leu Gly
Leu Asp Gly Phe Asn Val Asn 165 170 175Gly Pro Lys Glu Ala Thr Val
Gly Asp Leu Lys Ser Ser Phe Lys Asn 180 185 190Val Thr Gly Tyr Asp
Thr Tyr Ala Ala Gly Ala Asp Lys Tyr Arg Val 195 200 205Asp Ile Asn
Ser Gly Ala Val Val Thr Asp Ala Ala Ala Pro Asp Lys 210 215 220Val
Tyr Val Asn Ala Ala Asn Gly Gln Leu Thr Thr Asp Asp Ala Glu225 230
235 240Asn Asn Thr Ala Val Asp Leu Phe Lys Thr Thr Lys Ser Thr Ala
Gly 245 250 255Thr Ala Glu Ala Lys Ala Ile Ala Gly Ala Ile Lys Gly
Gly Lys Glu 260 265 270Gly Asp Thr Phe Asp Tyr Lys Gly Val Thr Phe
Thr Ile Asp Thr Lys 275 280 285Thr Gly Asp Asp Gly Asn Gly Lys Val
Ser Thr Thr Ile Asn Gly Glu 290 295 300Lys Val Thr Leu Thr Val Ala
Asp Ile Ala Thr Gly Ala Ala Asp Val305 310 315 320Asn Ala Ala Thr
Leu Gln Ser Ser Lys Asn Val Tyr Thr Ser Val Val 325 330 335Asn Gly
Gln Phe Thr Phe Asp Asp Lys Thr Lys Asn Glu Ser Ala Lys 340 345
350Leu Ser Asp Leu Glu Ala Asn Asn Ala Val Lys Gly Glu Ser Lys Ile
355 360 365Thr Val Asn Gly Ala Glu Tyr Thr Ala Asn Ala Thr Gly Asp
Lys Ile 370 375 380Thr Leu Ala Gly Lys Thr Met Phe Ile Asp Lys Thr
Ala Ser Gly Val385 390 395 400Ser Thr Leu Ile Asn Glu Asp Ala Ala
Ala Ala Lys Lys Ser Thr Ala 405 410 415Asn Pro Leu Ala Ser Ile Asp
Ser Ala Leu Ser Lys Val Asp Ala Val 420 425 430Arg Ser Ser Leu Gly
Ala Ile Gln Asn Arg Phe Asp Ser Ala Ile Thr 435 440 445Asn Leu Gly
Asn Thr Val Thr Asn Leu Asn Ser Ala Arg Ser Arg Ile 450 455 460Glu
Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln465 470
475 480Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln
Val 485 490 495Pro Gln Asn Val Leu Ser Leu Leu Arg 500
5052329PRTArtificial SequenceSynthetic sequence 2Met Arg Gly Ser
His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly Gln
Gln Met Gly Arg Asp Leu Tyr Asp Asp Asp Asp Lys Asp 20 25 30Pro Met
Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln 35 40 45Asn
Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile Glu Arg 50 55
60Leu Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly65
70 75 80Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr
Gln 85 90 95Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr
Thr Glu 100 105 110Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
Val Arg Glu Leu 115 120 125Ser Val Gln Ala Thr Asn Gly Thr Asn Ser
Asp Ser Asp Leu Lys Ser 130 135 140Ile Gln Asp Glu Ile Gln Gln Arg
Leu Glu Glu Ile Asp Arg Val Ser145 150 155 160Asn Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln 165 170 175Met Lys Ile
Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp 180 185 190Leu
Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn Val 195 200
205Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu Asp Ser Met
210 215 220Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys Ser
Thr Ala225 230 235 240Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser
Lys Val Asp Ala Val 245 250 255Arg Ser Ser Leu Gly Ala Ile Gln Asn
Arg Phe Asp Ser Ala Ile Thr 260 265 270Asn Leu Gly Asn Thr Val Thr
Asn Leu Asn Ser Ala Arg Ser Arg Ile 275 280 285Glu Asp Ala Asp Tyr
Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln 290 295 300Ile Leu Gln
Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val305 310 315
320Pro Gln Asn Val Leu Ser Leu Leu Arg 325321DNAArtificial
SequenceSynthetic sequence 3taatacgact cactataggg g
21420DNAArtificial SequenceSynthetic sequence 4attgcgcaga
ccactgaagg 2056PRTArtificial SequenceSynthetic sequence 5Leu Val
Pro Arg Gly Ser1 565PRTArtificial SequenceSynthetic sequence 6Asp
Asp Asp Asp Lys1 5713PRTArtificial SequenceSynthetic sequence 7Ser
Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala1 5
1086PRTArtificial SequenceSynthetic sequence 8Glu Asp Ala Asp Tyr
Ala1 5914PRTArtificial SequenceSynthetic sequence 9Ala Ala Ser Ala
Gly Ala Gly Gln Gly Gly Gly Gly Ser Gly1 5 101014PRTArtificial
SequenceSynthetic sequence 10Glu Gly Lys Ser Ser Gly Ser Gly Ser
Glu Ser Lys Ser Thr1 5 101122PRTArtificial SequenceSynthetic
sequence 11Gly Gly Gly Arg Thr Ser Ser Ser Ala Ala Ser Ala Gly Ala
Gly Gln1 5 10 15Gly Gly Gly Gly Ser Gly 20124PRTArtificial
SequenceSynthetic sequence 12Gly Pro Ser Gly11312PRTArtificial
SequenceSynthetic sequence 13Gly Ser Ala Gly Ser Ala Ala Gly Ser
Gly Glu Phe1 5 10144PRTArtificial SequenceSynthetic sequence 14Gly
Ser Pro Gly11518PRTArtificial SequenceSynthetic sequence 15Lys Glu
Ser Gly Ser Val Ser Ser Glu Gln Leu Ala Gln Phe Arg Ser1 5 10 15Leu
Asp1616PRTArtificial SequenceSynthetic sequence 16Ser Pro Gly Ile
Ser Gly Gly Gly Gly Gly Ile Leu Asp Ser Met Gly1 5 10
1517300PRTArtificial SequenceSynthetic sequence 17Met Arg Gly Ser
His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly Gln
Gln Met Gly Arg Asp Leu Tyr Asp Leu Val Pro Arg Gly 20 25 30Ser Ala
Lys Asp Pro Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp 35 40 45Ala
Ala Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly 50 55
60Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln65
70 75 80Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
Val 85 90 95Arg Glu Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp
Ser Asp 100 105 110Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu
Glu Glu Ile Asp 115 120 125Arg Val Ser Asn Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ser Gln 130 135 140Asp Asn Gln Met Lys Ile Gln Val
Gly Ala Asn Asp Gly Glu Thr Ile145 150 155 160Thr Ile Asp Leu Gln
Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly 165 170 175Phe Asn Val
Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu 180 185 190Asp
Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys 195 200
205Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val
210 215 220Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe
Asp Ser225 230 235 240Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn Ser Ala Arg 245 250 255Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser Asn Met Ser 260 265 270Lys Ala Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu Ala Gln Ala 275 280 285Asn Gln Val Pro Gln
Asn Val Leu Ser Leu Leu Arg 290 295 3001848DNAArtificial
SequenceSynthetic sequence 18gcagattctg cagcaggctg gttgataatc
tggcgcaggc taaccagg 481960DNAArtificial SequenceSynthetic sequence
19tctaaagcgc agattctgca gcaggctggt acttccgttc tggcgcaggc taaccaggtt
602048DNAArtificial SequenceSynthetic sequence 20cctggttagc
ctgcgccaga ttatcaacca gcctgctgca gaatctgc 4821936DNAArtificial
SequenceSynthetic sequence 21taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
cggggttctc atcatcatca tcatcatggt 120atggctagca tgactggtgg
acagcaaatg ggtcgggatc tgtacgacct ggttccgcgc 180ggtagcgcga
aggatccgtc tggtctgcgt atcaacagcg cgaaagacga tgcggcaggc
240caggcgattg ctaaccgctt cacttctaat atcaaaggtc tgactcaggc
ttcccgtaac 300gctaacgacg gcatttctat tgcgcagacc actgaaggtg
cgctgaatga aatcaacaac 360aacctgcagc gtgtgcgtga gttgtctgtt
caggccacta acgggactaa ctctgattcc 420gatctgaaat ctatccagga
tgaaattcag caacgtctgg aagaaatcga tcgcgtttct 480aatcagactc
aatttaacgg tgttaaagtc ctgtctcagg acaaccagat gaaaatccag
540gttggtgcta acgatggtga aaccattacc atcgatctgc aaaaaattga
tgtgaaaagc 600cttggccttg atgggttcaa tgttaattcc ccgggaattt
ccggtggtgg tggtggaatt 660ctagactcca tgggtacatt aatcaatgaa
gacgctgccg cagccaagaa aagtaccgct 720aacccactgg cttcaattga
ttctgcattg tcaaaagtgg acgcagttcg ttcttctctg 780ggggcaattc
aaaaccgttt tgattcagcc attaccaacc ttggcaatac ggtaaccaat
840ctgaactccg cgcgtagccg tatcgaagat gctgactatg caacggaagt
ttctaatatg 900tctaaagcgc agattctgca gcaggctggt tgataa
93622281PRTArtificial SequenceSynthetic sequence 22Met Arg Gly Ser
His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly Gln
Gln Met Gly Arg Asp Leu Tyr Asp Leu Val Pro Arg Gly 20 25 30Ser Ala
Lys Asp Pro Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp 35 40 45Ala
Ala Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly 50 55
60Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln65
70 75 80Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
Val 85 90 95Arg Glu Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp
Ser Asp 100 105 110Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu
Glu Glu Ile Asp 115 120 125Arg Val Ser Asn Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ser Gln 130 135 140Asp Asn Gln Met Lys Ile Gln Val
Gly Ala Asn Asp Gly Glu Thr Ile145 150 155 160Thr Ile Asp Leu Gln
Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly 165 170 175Phe Asn Val
Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu 180 185 190Asp
Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys 195 200
205Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val
210 215 220Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe
Asp Ser225 230 235 240Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn Ser Ala Arg 245 250 255Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser Asn Met Ser 260 265 270Lys Ala Gln Ile Leu Gln Gln
Ala Gly 275 28023329PRTArtificial SequenceSynthetic sequence 23Met
Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5 10
15Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile Glu Arg Leu
20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly
Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr
Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr
Thr Glu Gly65 70 75 80Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
Val Arg Glu Leu Ser 85 90 95Val Gln Ala Thr Asn Gly Thr Asn Ser Asp
Ser Asp Leu Lys Ser Ile 100 105 110Gln Asp Glu Ile Gln Gln Arg Leu
Glu Glu Ile Asp Arg Val Ser Asn 115 120 125Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ser Gln Asp Asn Gln Met 130 135 140Lys Ile Gln Val
Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu145 150 155 160Gln
Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 165 170
175Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu Asp Ser Met Gly
180 185 190Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys Ser Thr
Ala Asn 195 200 205Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val
Asp Ala Val Arg 210 215 220Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe
Asp Ser Ala Ile Thr Asn225 230 235 240Leu Gly Asn Thr Val Thr Asn
Leu Asn Ser Ala Arg Ser Arg Ile Glu 245 250 255Asp Ala Asp Tyr Ala
Thr Glu Val Ser Asn Met Ser Lys Ala Gln Ile 260 265 270Leu Gln Gln
Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro 275 280 285Gln
Asn Val Leu Ser Leu Leu Val Pro Arg Gly Ser His His His His 290 295
300His His Gly Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg
Asp305 310 315 320Leu Tyr Asp Asp Asp Asp Lys Asp Pro
325241005DNAArtificial SequenceSynthetic sequence 24atggcacaag
tcattaatac aaacagcctg tcgctgttga cccagaataa cctgaacaaa 60tctcagtcct
cactgagttc cgctattgag cgtctgtcct ctggtctgcg tatcaacagc
120gcgaaagacg atgcggcagg ccaggcgatt gctaaccgct tcacttctaa
tatcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac ggcatttcta
ttgcgcagac cactgaaggt 240gcgctgaatg aaatcaacaa caacctgcag
cgtgtgcgtg agttgtctgt tcaggccact 300aacgggacta actctgattc
cgatctgaaa tctatccagg atgaaattca gcaacgtctg 360gaagaaatcg
atcgcgtttc taatcagact caatttaacg gtgttaaagt cctgtctcag
420gacaaccaga tgaaaatcca ggttggtgct aacgatggtg aaaccattac
catcgatctg 480caaaaaattg atgtgaaaag ccttggcctt gatgggttca
atgttaattc cccgggaatt 540tccggtggtg gtggtggaat tctagactcc
atgggtacat taatcaatga agacgctgcc 600gcagccaaga aaagtaccgc
taacccactg gcttcaattg attctgcatt gtcaaaagtg 660gacgcagttc
gttcttctct gggggcaatt caaaaccgtt ttgattcagc cattaccaac
720cttggcaata cggtaaccaa tctgaactcc gcgcgtagcc gtatcgaaga
tgctgactat 780gcaacggaag tttctaatat gtctaaagcg cagattctgc
agcaggctgg tacttccgtt 840ctggcgcagg ctaaccaggt tccgcaaaac
gtcctctctt tactggttcc gcggggttct 900catcatcatc atcatcatgg
tatggctagc atgactggtg gacagcaaat gggtcgggat 960ctgtacgacg
atgacgataa ggatccgtaa gtcgacaagc ttgcg 10052531DNAArtificial
SequenceSynthetic sequence 25cgaaagacca tatggcaggc caggcgattg c
312633DNAArtificial SequenceSynthetic sequence 26cgcaagcttg
tcgacttacg gatccttatc gtc 3327952DNAArtificial SequenceSynthetic
sequence 27taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaaataattt 60tgtttaactt taagaaggag atatacatat ggcaggccag gcgattgcta
accgcttcac 120ttctaatatc aaaggtctga ctcaggcttc ccgtaacgct
aacgacggca tttctattgc 180gcagaccact gaaggtgcgc
tgaatgaaat caacaacaac ctgcagcgtg tgcgtgagtt 240gtctgttcag
gccactaacg ggactaactc tgattccgat ctgaaatcta tccaggatga
300aattcagcaa cgtctggaag aaatcgatcg cgtttctaat cagactcaat
ttaacggtgt 360taaagtcctg tctcaggaca accagatgaa aatccaggtt
ggtgctaacg atggtgaaac 420cattaccatc gatctgcaaa aaattgatgt
gaaaagcctt ggccttgatg ggttcaatgt 480taattccccg ggaatttccg
gtggtggtgg tggaattcta gactccatgg gtacattaat 540caatgaagac
gctgccgcag ccaagaaaag taccgctaac ccactggctt caattgattc
600tgcattgtca aaagtggacg cagttcgttc ttctctgggg gcaattcaaa
accgctttga 660ttcagccatt accaaccttg gcaatacggt aaccaatctg
aactccgcgc gtagccgtat 720cgaagatgct gactatgcaa cggaagtttc
taatatgtct aaagcgcaga ttctgcagca 780ggctggtact tccgttctgg
cgcaggctaa ccaggttccg caaaacgtcc tctctttact 840ggttccgcgg
ggttctcatc atcatcatca tcatggtatg gctagcatga ctggtggaca
900gcaaatgggt cgggatctgt acgacgatga cgataaggat ccgtaagtcg ac
95228285PRTArtificial SequenceSynthetic sequence 28Met Ala Gly Gln
Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly1 5 10 15Leu Thr Gln
Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln 20 25 30Thr Thr
Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val 35 40 45Arg
Glu Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp 50 55
60Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp65
70 75 80Arg Val Ser Asn Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser
Gln 85 90 95Asp Asn Gln Met Lys Ile Gln Val Gly Ala Asn Asp Gly Glu
Thr Ile 100 105 110Thr Ile Asp Leu Gln Lys Ile Asp Val Lys Ser Leu
Gly Leu Asp Gly 115 120 125Phe Asn Val Asn Ser Pro Gly Ile Ser Gly
Gly Gly Gly Gly Ile Leu 130 135 140Asp Ser Met Gly Thr Leu Ile Asn
Glu Asp Ala Ala Ala Ala Lys Lys145 150 155 160Ser Thr Ala Asn Pro
Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val 165 170 175Asp Ala Val
Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser 180 185 190Ala
Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn Ser Ala Arg 195 200
205Ser Arg Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met Ser
210 215 220Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala
Gln Ala225 230 235 240Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu
Val Pro Arg Gly Ser 245 250 255His His His His His His Gly Met Ala
Ser Met Thr Gly Gly Gln Gln 260 265 270Met Gly Arg Asp Leu Tyr Asp
Asp Asp Asp Lys Asp Pro 275 280 28529765DNAArtificial
SequenceSynthetic sequence 29atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
240ggaccatcag gtcaggatga aattcagcaa cgtctggaag aaatcgatcg
cgtttctaat 300cagactcaat ttaacggtgt taaagtcctg tctcaggaca
accagatgaa aatccaggtt 360ggtgctaacg atggtgaaac cattaccatc
gatctgcaaa aaattgatgt gaaaagcctt 420ggccttgatg ggttcaatgt
taattccccg ggaagtaccg ctaacccact ggcttcaatt 480gattctgcat
tgtcaaaagt ggacgcagtt cgttcttctc tgggggcaat tcaaaaccgc
540tttgattcag ccattaccaa ccttggcaat acggtaacca atctgaactc
cgcgcgtagc 600cgtatcgaag atgctgacta tgcaacggaa gtttctaata
tgtctaaagc gcagattctg 660cagcaggctg gtacttccgt tctggcgcag
gctaaccagg ttccgcaaaa cgtcctctct 720ttactggttc cgcggggttc
tcatcatcat catcatcatg gttaa 76530254PRTArtificial SequenceSynthetic
sequence 30Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala
Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu
Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln
Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp
Ser Asp Leu Lys Ser Ile65 70 75 80Gly Pro Ser Gly Gln Asp Glu Ile
Gln Gln Arg Leu Glu Glu Ile Asp 85 90 95Arg Val Ser Asn Gln Thr Gln
Phe Asn Gly Val Lys Val Leu Ser Gln 100 105 110Asp Asn Gln Met Lys
Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile 115 120 125Thr Ile Asp
Leu Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly 130 135 140Phe
Asn Val Asn Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile145 150
155 160Asp Ser Ala Leu Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly
Ala 165 170 175Ile Gln Asn Arg Phe Asp Ser Ala Ile Thr Asn Leu Gly
Asn Thr Val 180 185 190Thr Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu
Asp Ala Asp Tyr Ala 195 200 205Thr Glu Val Ser Asn Met Ser Lys Ala
Gln Ile Leu Gln Gln Ala Gly 210 215 220Thr Ser Val Leu Ala Gln Ala
Asn Gln Val Pro Gln Asn Val Leu Ser225 230 235 240Leu Leu Val Pro
Arg Gly Ser His His His His His His Gly 245 2503132DNAArtificial
SequenceSynthetic sequence 31gatatacata tgagcgggtt acggatcaac ag
323229DNAArtificial SequenceSynthetic sequence 32agatctcccg
gggaattaac attgaaccc 2933816DNAArtificial SequenceSynthetic
sequence 33taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac tggaccatca 300ggtgaaattc
agcaacgtct ggaagaaatc gatcgcgttt ctaatcagac tcaatttaac
360ggtgttaaag tcctgtctca ggacaaccag atgaaaatcc aggttggtgc
taacgatggt 420gaaaccatta ccatcgatct gcaaaaaatt gatgtgaaaa
gccttggcct tgatgggttc 480aatgttaatt ccccgggaag taccgctaac
ccactggctt caattgattc tgcattgtca 540aaagtggacg cagttcgttc
ttctctgggg gcaattcaaa accgctttga ttcagccatt 600accaaccttg
gcaatacggt aaccaatctg aactccgcgc gtagccgtat cgaagatgct
660gactatgcaa cggaagtttc taatatgtct aaagcgcaga ttctgcagca
ggctggtact 720tccgttctgg cgcaggctaa ccaggttccg caaaacgtcc
tctctttact ggttccgcgg 780ggttctcatc atcatcatca tcatggttaa gtcgac
81634240PRTArtificial SequenceSynthetic sequence 34Met Ser Gly Leu
Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala
Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg
Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala
Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55
60Val Gln Ala Thr Gly Pro Ser Gly Glu Ile Gln Gln Arg Leu Glu Glu65
70 75 80Ile Asp Arg Val Ser Asn Gln Thr Gln Phe Asn Gly Val Lys Val
Leu 85 90 95Ser Gln Asp Asn Gln Met Lys Ile Gln Val Gly Ala Asn Asp
Gly Glu 100 105 110Thr Ile Thr Ile Asp Leu Gln Lys Ile Asp Val Lys
Ser Leu Gly Leu 115 120 125Asp Gly Phe Asn Val Asn Ser Pro Gly Ser
Thr Ala Asn Pro Leu Ala 130 135 140Ser Ile Asp Ser Ala Leu Ser Lys
Val Asp Ala Val Arg Ser Ser Leu145 150 155 160Gly Ala Ile Gln Asn
Arg Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn 165 170 175Thr Val Thr
Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp 180 185 190Tyr
Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln Ile Leu Gln Gln 195 200
205Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro Gln Asn Val
210 215 220Leu Ser Leu Leu Val Pro Arg Gly Ser His His His His His
His Gly225 230 235 24035275PRTArtificial SequenceSynthetic sequence
35Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ile Ser Gly Gly Gly Gly Gly Ile Leu Asp Ser Met Gly145 150 155
160Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys Ser Thr Ala Asn
165 170 175Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val Asp Ala
Val Arg 180 185 190Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser
Ala Ile Thr Asn 195 200 205Leu Gly Asn Thr Val Thr Asn Leu Asn Ser
Ala Arg Ser Arg Ile Glu 210 215 220Asp Ala Asp Tyr Ala Thr Glu Val
Ser Asn Met Ser Lys Ala Gln Ile225 230 235 240Leu Gln Gln Ala Gly
Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro 245 250 255Gln Asn Val
Leu Ser Leu Leu Val Pro Arg Gly Ser His His His His 260 265 270His
His Gly 27536828DNAArtificial SequenceSynthetic sequence
36atgagcgggt tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac
60cgcttcactt ctaatatcaa aggtctgact caggcttccc gtaacgctaa cgacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg actaactctg
attccgatct gaaatctatc 240caggatgaaa ttcagcaacg tctggaagaa
atcgatcgcg tttctaatca gactcaattt 300aacggtgtta aagtcctgtc
tcaggacaac cagatgaaaa tccaggttgg tgctaacgat 360ggtgaaacca
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aatttccggt ggtggtggtg gaattctaga
ctccatgggt 480acattaatca atgaagacgc tgccgcagcc aagaaaagta
ccgctaaccc actggcttca 540attgattctg cattgtcaaa agtggacgca
gttcgttctt ctctgggggc aattcaaaac 600cgctttgatt cagccattac
caaccttggc aatacggtaa ccaatctgaa ctccgcgcgt 660agccgtatcg
aagatgctga ctatgcaacg gaagtttcta atatgtctaa agcgcagatt
720ctgcagcagg ctggtacttc cgttctggcg caggctaacc aggttccgca
aaacgtcctc 780tctttactgg ttccgcgggg ttctcatcat catcatcatc atggttaa
8283741DNAArtificial SequenceSynthetic sequence 37tctagacccg
ggaagtaccg ctaacccact ggcttcaatt g 413840DNAArtificial
SequenceSynthetic sequence 38ccagtcatgt cgacttaacc atgatgatga
tgatgatgag 403955DNAArtificial SequenceSynthetic sequence
39ctcatcatca tcatcatcat ggttaagtcg acaagcttgc ggccgcagag ctcgc
5540846DNAArtificial SequenceSynthetic sequence 40taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 84641753DNAArtificial
SequenceSynthetic sequence 41atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
240caggatgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 300aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 360ggtgaaacca ttaccatcga tctgcaaaaa
attgatgtga aaagccttgg ccttgatggg 420ttcaatgtta attccccggg
aagtaccgct aacccactgg cttcaattga ttctgcattg 480tcaaaagtgg
acgcagttcg ttcttctctg ggggcaattc aaaaccgctt tgattcagcc
540attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 600gctgactatg caacggaagt ttctaatatg tctaaagcgc
agattctgca gcaggctggt 660acttccgttc tggcgcaggc taaccaggtt
ccgcaaaacg tcctctcttt actggttccg 720cggggttctc atcatcatca
tcatcatggt taa 75342250PRTArtificial SequenceSynthetic sequence
42Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser 195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu 210 215 220Ala Gln Ala Asn Gln Val Pro Gln
Asn Val Leu Ser Leu Leu Val Pro225 230 235 240Arg Gly Ser His His
His His His His Gly 245 250431005DNAArtificial SequenceSynthetic
sequence 43atggcacaag tcattaatac aaacagcctg tcgctgttga cccagaataa
cctgaacaaa 60tctcagtcct cactgagttc cgctattgag cgtctgtcct ctggtctgcg
tatcaacggc 120gcgaaagacg atgcggcagg ccaggcgatt gctaaccgct
tcacttctaa tatcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac
ggcatttcta ttgcgcagac cactgaaggt 240gcgctgaatg aaatcaacaa
caacctgcag cgtgtgcgtg agttgtctgt tcaggccact 300aacgggacta
actctgattc cgatctgaaa tctatccagg atgaaattca gcaacgtctg
360gaagaaatcg atcgcgtttc taatcagact caatttaacg gtgttaaagt
cctgtctcag 420gacaaccaga tgaaaatcca ggttggtgct aacgatggtg
aaaccattac catcgatctg 480caaaaaattg atgtgaaaag ccttggcctt
gatgggttca atgttaattc cccgggaatt 540tccggtggtg gtggtggaat
tctagactcc atgggtacat taatcaatga agacgctgcc 600gcagccaaga
aaagtaccgc taacccactg gcttcaattg attctgcatt gtcaaaagtg
660gacgcagttc gttcttctct gggggcaatt caaaaccgct ttgattcagc
cattaccaac 720cttggcaata cggtaaccaa tctgaactcc gcgcgtagcc
gtatcgaaga tgctgactat 780gcaacggaag tttctaatat gtctaaagcg
cagattctgc agcaggctgg tacttccgtt 840ctggcgcagg ctaaccaggt
tccgcaaaac gtcctctctt tactggttcc gcggggttct 900catcatcatc
atcatcatgg tatggctagc atgactggtg gacagcaaat gggtcgggat
960ctgtacgacg atgacgataa ggatccgtaa gtcgacaagc ttgcg
100544329PRTArtificial SequenceSynthetic sequence 44Met Ala Gln Val
Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5 10 15Asn Leu Asn
Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile Glu Arg Leu 20 25 30Ser Ser
Gly Leu Arg Ile Asn Gly Ala Lys Asp Asp Ala
Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly
Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala
Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu Ile Asn Asn Asn Leu
Gln Arg Val Arg Glu Leu Ser 85 90 95Val Gln Ala Thr Asn Gly Thr Asn
Ser Asp Ser Asp Leu Lys Ser Ile 100 105 110Gln Asp Glu Ile Gln Gln
Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 115 120 125Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 130 135 140Lys Ile
Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu145 150 155
160Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn
165 170 175Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu Asp Ser
Met Gly 180 185 190Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys
Ser Thr Ala Asn 195 200 205Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser
Lys Val Asp Ala Val Arg 210 215 220Ser Ser Leu Gly Ala Ile Gln Asn
Arg Phe Asp Ser Ala Ile Thr Asn225 230 235 240Leu Gly Asn Thr Val
Thr Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu 245 250 255Asp Ala Asp
Tyr Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln Ile 260 265 270Leu
Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro 275 280
285Gln Asn Val Leu Ser Leu Leu Val Pro Arg Gly Ser His His His His
290 295 300His His Gly Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly
Arg Asp305 310 315 320Leu Tyr Asp Asp Asp Asp Lys Asp Pro
3254536DNAArtificial SequenceSynthetic sequence 45ctctggtcat
atgatcaaca gcgcgaaaga cgatgc 364646DNAArtificial SequenceSynthetic
sequence 46tctagagtcg actattaagc cataccatga tgatgatgat gatgag
4647918DNAArtificial SequenceSynthetic sequence 47taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaaataattt 60tgtttaactt
taagaaggag atatacatat gatcaacagc gcgaaagacg atgcggcagg
120ccaggcgatt gctaaccgct tcacttctaa tatcaaaggt ctgactcagg
cttcccgtaa 180cgctaacgac ggcatttcta ttgcgcagac cactgaaggt
gcgctgaatg aaatcaacaa 240caacctgcag cgtgtgcgtg agttgtctgt
tcaggccact aacgggacta actctgattc 300cgatctgaaa tctatccagg
atgaaattca gcaacgtctg gaagaaatcg atcgcgtttc 360taatcagact
caatttaacg gtgttaaagt cctgtctcag gacaaccaga tgaaaatcca
420ggttggtgct aacgatggtg aaaccattac catcgatctg caaaaaattg
atgtgaaaag 480ccttggcctt gatgggttca atgttaattc cccgggaatt
tccggtggtg gtggtggaat 540tctagactcc atgggtacat taatcaatga
agacgctgcc gcagccaaga aaagtaccgc 600taacccactg gcttcaattg
attctgcatt gtcaaaagtg gacgcagttc gttcttctct 660gggggcaatt
caaaaccgct ttgattcagc cattaccaac cttggcaata cggtaaccaa
720tctgaactcc gcgcgtagcc gtatcgaaga tgctgactat gcaacggaag
tttctaatat 780gtctaaagcg cagattctgc agcaggctgg tacttccgtt
ctggcgcagg ctaaccaggt 840tccgcaaaac gtcctctctt tactggttcc
gcggggttct catcatcatc atcatcatgg 900tatggcttaa tagtcgac
91848273PRTArtificial SequenceSynthetic sequence 48Met Ile Asn Ser
Ala Lys Asp Asp Ala Ala Gly Gln Ala Ile Ala Asn1 5 10 15Arg Phe Thr
Ser Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn Ala 20 25 30Asn Asp
Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn Glu 35 40 45Ile
Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser Val Gln Ala Thr 50 55
60Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile Gln Asp Glu Ile65
70 75 80Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn Gln Thr Gln
Phe 85 90 95Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met Lys Ile
Gln Val 100 105 110Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
Gln Lys Ile Asp 115 120 125Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn Ser Pro Gly Ile 130 135 140Ser Gly Gly Gly Gly Gly Ile Leu
Asp Ser Met Gly Thr Leu Ile Asn145 150 155 160Glu Asp Ala Ala Ala
Ala Lys Lys Ser Thr Ala Asn Pro Leu Ala Ser 165 170 175Ile Asp Ser
Ala Leu Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly 180 185 190Ala
Ile Gln Asn Arg Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr 195 200
205Val Thr Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr
210 215 220Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln Ile Leu Gln
Gln Ala225 230 235 240Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val
Pro Gln Asn Val Leu 245 250 255Ser Leu Leu Val Pro Arg Gly Ser His
His His His His His Gly Met 260 265 270Ala49333PRTArtificial
SequenceSynthetic sequence 49Met Arg Gly Ser His His His His His
His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly Gln Gln Met Gly Arg Asp
Leu Tyr Asp Leu Val Pro Arg Gly 20 25 30Ser Ala Lys Asp Pro Met Ala
Gln Val Ile Asn Thr Asn Ser Leu Ser 35 40 45Leu Leu Thr Gln Asn Asn
Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser 50 55 60Ala Ile Glu Arg Leu
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp65 70 75 80Asp Ala Ala
Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys 85 90 95Gly Leu
Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala 100 105
110Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
115 120 125Val Arg Glu Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser
Asp Ser 130 135 140Asp Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg
Leu Glu Glu Ile145 150 155 160Asp Arg Val Ser Asn Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ser 165 170 175Gln Asp Asn Gln Met Lys Ile
Gln Val Gly Ala Asn Asp Gly Glu Thr 180 185 190Ile Thr Ile Asp Leu
Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp 195 200 205Gly Phe Asn
Val Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile 210 215 220Leu
Asp Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys225 230
235 240Lys Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser
Lys 245 250 255Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn
Arg Phe Asp 260 265 270Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr
Asn Leu Asn Ser Ala 275 280 285Arg Ser Arg Ile Glu Asp Ala Asp Tyr
Ala Thr Glu Val Ser Asn Met 290 295 300Ser Lys Ala Gln Ile Leu Gln
Gln Ala Gly Thr Ser Val Leu Ala Gln305 310 315 320Ala Asn Gln Val
Pro Gln Asn Val Leu Ser Leu Leu Arg 325 330501002DNAArtificial
SequenceSynthetic sequence 50atgcggggtt ctcatcatca tcatcatcat
ggtatggcta gcatgactgg tggacagcaa 60atgggtcggg atctgtacga cctggttccg
cgcggtagcg cgaaggatcc gatggcacaa 120gtcattaata caaacagcct
gtcgctgttg acccagaata acctgaacaa atctcagtcc 180tcactgagtt
ccgctattga gcgtctgtcc tctggtctgc gtatcaacag cgcgaaagac
240gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 300gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 360gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 420aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 480gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
540atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 600gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaat ttccggtggt 660ggtggtggaa ttctagactc catgggtaca
ttaatcaatg aagacgctgc cgcagccaag 720aaaagtaccg ctaacccact
ggcttcaatt gattctgcat tgtcaaaagt ggacgcagtt 780cgttcttctc
tgggggcaat tcaaaaccgt tttgattcag ccattaccaa ccttggcaat
840acggtaacca atctgaactc cgcgcgtagc cgtatcgaag atgctgacta
tgcaacggaa 900gtttctaata tgtctaaagc gcagattctg cagcaggctg
gtacttccgt tctggcgcag 960gctaaccagg ttccgcaaaa cgtcctctct
ttactgcgtt aa 10025142DNAArtificial SequenceSynthetic sequence
51ggcaattcaa aaccgttttg attaagccat taccaacctt gg
425242DNAArtificial SequenceSynthetic sequence 52ccaaggttgg
taatggctta atcaaaacgg ttttgaattg cc 4253906DNAArtificial
SequenceSynthetic sequence 53taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
cggggttctc atcatcatca tcatcatggt 120atggctagca tgactggtgg
acagcaaatg ggtcgggatc tgtacgacct ggttccgcgc 180ggtagcgcga
aggatccgat ggcacaagtc attaatacaa acagcctgtc gctgttgacc
240cagaataacc tgaacaaatc tcagtcctca ctgagttccg ctattgagcg
tctgtcctct 300ggtctgcgta tcaacagcgc gaaagacgat gcggcaggcc
aggcgattgc taaccgcttc 360acttctaata tcaaaggtct gactcaggct
tcccgtaacg ctaacgacgg catttctatt 420gcgcagacca ctgaaggtgc
gctgaatgaa atcaacaaca acctgcagcg tgtgcgtgag 480ttgtctgttc
aggccactaa cgggactaac tctgattccg atctgaaatc tatccaggat
540gaaattcagc aacgtctgga agaaatcgat cgcgtttcta atcagactca
atttaacggt 600gttaaagtcc tgtctcagga caaccagatg aaaatccagg
ttggtgctaa cgatggtgaa 660accattacca tcgatctgca aaaaattgat
gtgaaaagcc ttggccttga tgggttcaat 720gttaattccc cgggaatttc
cggtggtggt ggtggaattc tagactccat gggtacatta 780atcaatgaag
acgctgccgc agccaagaaa agtaccgcta acccactggc ttcaattgat
840tctgcattgt caaaagtgga cgcagttcgt tcttctctgg gggcaattca
aaaccgtttt 900gattaa 90654272PRTArtificial SequenceSynthetic
sequence 54Met Arg Gly Ser His His His His His His Gly Met Ala Ser
Met Thr1 5 10 15Gly Gly Gln Gln Met Gly Arg Asp Leu Tyr Asp Leu Val
Pro Arg Gly 20 25 30Ser Ala Lys Asp Pro Met Ala Gln Val Ile Asn Thr
Asn Ser Leu Ser 35 40 45Leu Leu Thr Gln Asn Asn Leu Asn Lys Ser Gln
Ser Ser Leu Ser Ser 50 55 60Ala Ile Glu Arg Leu Ser Ser Gly Leu Arg
Ile Asn Ser Ala Lys Asp65 70 75 80Asp Ala Ala Gly Gln Ala Ile Ala
Asn Arg Phe Thr Ser Asn Ile Lys 85 90 95Gly Leu Thr Gln Ala Ser Arg
Asn Ala Asn Asp Gly Ile Ser Ile Ala 100 105 110Gln Thr Thr Glu Gly
Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg 115 120 125Val Arg Glu
Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser 130 135 140Asp
Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile145 150
155 160Asp Arg Val Ser Asn Gln Thr Gln Phe Asn Gly Val Lys Val Leu
Ser 165 170 175Gln Asp Asn Gln Met Lys Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr 180 185 190Ile Thr Ile Asp Leu Gln Lys Ile Asp Val Lys
Ser Leu Gly Leu Asp 195 200 205Gly Phe Asn Val Asn Ser Pro Gly Ile
Ser Gly Gly Gly Gly Gly Ile 210 215 220Leu Asp Ser Met Gly Thr Leu
Ile Asn Glu Asp Ala Ala Ala Ala Lys225 230 235 240Lys Ser Thr Ala
Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys 245 250 255Val Asp
Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp 260 265
2705545DNAArtificial SequenceSynthetic sequence 55caatctgaac
tccgcgcgtt gacgtatcta agatgctgac tatgc 455645DNAArtificial
SequenceSynthetic sequence 56gcatagtcag catcttagat acgtcaacgc
gcggagttca gattg 4557966DNAArtificial SequenceSynthetic sequence
57taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt
60gtttaacttt aagaaggaga tatacatatg cggggttctc atcatcatca tcatcatggt
120atggctagca tgactggtgg acagcaaatg ggtcgggatc tgtacgacct
ggttccgcgc 180ggtagcgcga aggatccgat ggcacaagtc attaatacaa
acagcctgtc gctgttgacc 240cagaataacc tgaacaaatc tcagtcctca
ctgagttccg ctattgagcg tctgtcctct 300ggtctgcgta tcaacagcgc
gaaagacgat gcggcaggcc aggcgattgc taaccgcttc 360acttctaata
tcaaaggtct gactcaggct tcccgtaacg ctaacgacgg catttctatt
420gcgcagacca ctgaaggtgc gctgaatgaa atcaacaaca acctgcagcg
tgtgcgtgag 480ttgtctgttc aggccactaa cgggactaac tctgattccg
atctgaaatc tatccaggat 540gaaattcagc aacgtctgga agaaatcgat
cgcgtttcta atcagactca atttaacggt 600gttaaagtcc tgtctcagga
caaccagatg aaaatccagg ttggtgctaa cgatggtgaa 660accattacca
tcgatctgca aaaaattgat gtgaaaagcc ttggccttga tgggttcaat
720gttaattccc cgggaatttc cggtggtggt ggtggaattc tagactccat
gggtacatta 780atcaatgaag acgctgccgc agccaagaaa agtaccgcta
acccactggc ttcaattgat 840tctgcattgt caaaagtgga cgcagttcgt
tcttctctgg gggcaattca aaaccgtttt 900gattcagcca ttaccaacct
tggcaatacg gtaaccaatc tgaactccgc gcgttgacgt 960atctaa
96658289PRTArtificial SequenceSynthetic sequence 58Met Arg Gly Ser
His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly Gln
Gln Met Gly Arg Asp Leu Tyr Asp Leu Val Pro Arg Gly 20 25 30Ser Ala
Lys Asp Pro Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser 35 40 45Leu
Leu Thr Gln Asn Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser 50 55
60Ala Ile Glu Arg Leu Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp65
70 75 80Asp Ala Ala Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile
Lys 85 90 95Gly Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser
Ile Ala 100 105 110Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn
Asn Leu Gln Arg 115 120 125Val Arg Glu Leu Ser Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser 130 135 140Asp Leu Lys Ser Ile Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile145 150 155 160Asp Arg Val Ser Asn
Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser 165 170 175Gln Asp Asn
Gln Met Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr 180 185 190Ile
Thr Ile Asp Leu Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp 195 200
205Gly Phe Asn Val Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile
210 215 220Leu Asp Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala
Ala Lys225 230 235 240Lys Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp
Ser Ala Leu Ser Lys 245 250 255Val Asp Ala Val Arg Ser Ser Leu Gly
Ala Ile Gln Asn Arg Phe Asp 260 265 270Ser Ala Ile Thr Asn Leu Gly
Asn Thr Val Thr Asn Leu Asn Ser Ala 275 280 285Arg5948DNAArtificial
SequenceSynthetic sequence 59cgtagccgta tcgaagatgc ttaataggca
acggaagttt ctaatatg 486048DNAArtificial SequenceSynthetic sequence
60catattagaa acttccgttg cctattaagc atcttcgata cggctacg
4861978DNAArtificial SequenceSynthetic sequence 61taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg cggggttctc atcatcatca tcatcatggt
120atggctagca tgactggtgg acagcaaatg ggtcgggatc tgtacgacct
ggttccgcgc 180ggtagcgcga aggatccgat ggcacaagtc attaatacaa
acagcctgtc gctgttgacc 240cagaataacc tgaacaaatc tcagtcctca
ctgagttccg ctattgagcg tctgtcctct 300ggtctgcgta tcaacagcgc
gaaagacgat gcggcaggcc aggcgattgc taaccgcttc 360acttctaata
tcaaaggtct gactcaggct tcccgtaacg ctaacgacgg catttctatt
420gcgcagacca ctgaaggtgc gctgaatgaa atcaacaaca acctgcagcg
tgtgcgtgag 480ttgtctgttc aggccactaa cgggactaac tctgattccg
atctgaaatc tatccaggat 540gaaattcagc aacgtctgga agaaatcgat
cgcgtttcta atcagactca atttaacggt 600gttaaagtcc tgtctcagga
caaccagatg aaaatccagg ttggtgctaa cgatggtgaa 660accattacca
tcgatctgca aaaaattgat gtgaaaagcc ttggccttga tgggttcaat
720gttaattccc cgggaatttc cggtggtggt ggtggaattc tagactccat
gggtacatta 780atcaatgaag acgctgccgc agccaagaaa agtaccgcta
acccactggc ttcaattgat 840tctgcattgt caaaagtgga cgcagttcgt
tcttctctgg gggcaattca aaaccgtttt 900gattcagcca ttaccaacct
tggcaatacg gtaaccaatc tgaactccgc gcgtagccgt 960atcgaagatg cttaatag
97862295PRTArtificial SequenceSynthetic sequence 62Met Arg Gly Ser
His His His His His His Gly
Met Ala Ser Met Thr1 5 10 15Gly Gly Gln Gln Met Gly Arg Asp Leu Tyr
Asp Leu Val Pro Arg Gly 20 25 30Ser Ala Lys Asp Pro Met Ala Gln Val
Ile Asn Thr Asn Ser Leu Ser 35 40 45Leu Leu Thr Gln Asn Asn Leu Asn
Lys Ser Gln Ser Ser Leu Ser Ser 50 55 60Ala Ile Glu Arg Leu Ser Ser
Gly Leu Arg Ile Asn Ser Ala Lys Asp65 70 75 80Asp Ala Ala Gly Gln
Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys 85 90 95Gly Leu Thr Gln
Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala 100 105 110Gln Thr
Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg 115 120
125Val Arg Glu Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser
130 135 140Asp Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu Glu
Glu Ile145 150 155 160Asp Arg Val Ser Asn Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ser 165 170 175Gln Asp Asn Gln Met Lys Ile Gln Val
Gly Ala Asn Asp Gly Glu Thr 180 185 190Ile Thr Ile Asp Leu Gln Lys
Ile Asp Val Lys Ser Leu Gly Leu Asp 195 200 205Gly Phe Asn Val Asn
Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile 210 215 220Leu Asp Ser
Met Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys225 230 235
240Lys Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys
245 250 255Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
Phe Asp 260 265 270Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn Ser Ala 275 280 285Arg Ser Arg Ile Glu Asp Ala 290
29563990DNAArtificial SequenceSynthetic sequence 63atgcggggtt
ctcatcatca tcatcatcat ggtatggcta gcatgactgg tggacagcaa 60atgggtcggg
atctgtacga cgatgacgat aaggatccga tggcacaagt cattaataca
120aacagcctgt cgctgttgac ccagaataac ctgaacaaat ctcagtcctc
actgagttcc 180gctattgagc gtctgtcctc tggtctgcgt atcaacagcg
cgaaagacga tgcggcaggc 240caggcgattg ctaaccgctt cacttctaat
atcaaaggtc tgactcaggc ttcccgtaac 300gctaacgacg gcatttctat
tgcgcagacc actgaaggtg cgctgaatga aatcaacaac 360aacctgcagc
gtgtgcgtga gttgtctgtt caggccacta acgggactaa ctctgattcc
420gatctgaaat ctatccagga tgaaattcag caacgtctgg aagaaatcga
tcgcgtttct 480aatcagactc aatttaacgg tgttaaagtc ctgtctcagg
acaaccagat gaaaatccag 540gttggtgcta acgatggtga aaccattacc
atcgatctgc aaaaaattga tgtgaaaagc 600cttggccttg atgggttcaa
tgttaattcc ccgggaattt ccggtggtgg tggtggaatt 660ctagactcca
tgggtacatt aatcaatgaa gacgctgccg cagccaagaa aagtaccgct
720aacccactgg cttcaattga ttctgcattg tcaaaagtgg acgcagttcg
ttcttctctg 780ggggcaattc aaaaccgttt tgattcagcc attaccaacc
ttggcaatac ggtaaccaat 840ctgaactccg cgcgtagccg tatcgaagat
gctgactatg caacggaagt ttctaatatg 900tctaaagcgc agattctgca
gcaggctggt acttccgttc tggcgcaggc taaccaggtt 960ccgcaaaacg
tcctctcttt actgcgttaa 9906433DNAArtificial SequenceSynthetic
sequence 64cgataaggat catatggcac aagtcattaa tac 336578DNAArtificial
SequenceSynthetic sequence 65agatctgtcg acttaaccat gatgatgatg
atgatgagaa ccccgcggaa ccagtgcata 60gtcagcatct tcgatacg
7866918DNAArtificial SequenceSynthetic sequence 66taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg gcacaagtca ttaatacaaa cagcctgtcg
120ctgttgaccc agaataacct gaacaaatct cagtcctcac tgagttccgc
tattgagcgt 180ctgtcctctg gtctgcgtat caacagcgcg aaagacgatg
cggcaggcca ggcgattgct 240aaccgcttca cttctaatat caaaggtctg
actcaggctt cccgtaacgc taacgacggc 300atttctattg cgcagaccac
tgaaggtgcg ctgaatgaaa tcaacaacaa cctgcagcgt 360gtgcgtgagt
tgtctgttca ggccactaac gggactaact ctgattccga tctgaaatct
420atccaggatg aaattcagca acgtctggaa gaaatcgatc gcgtttctaa
tcagactcaa 480tttaacggtg ttaaagtcct gtctcaggac aaccagatga
aaatccaggt tggtgctaac 540gatggtgaaa ccattaccat cgatctgcaa
aaaattgatg tgaaaagcct tggccttgat 600gggttcaatg ttaattcccc
gggaatttcc ggtggtggtg gtggaattct agactccatg 660ggtacattaa
tcaatgaaga cgctgccgca gccaagaaaa gtaccgctaa cccactggct
720tcaattgatt ctgcattgtc aaaagtggac gcagttcgtt cttctctggg
ggcaattcaa 780aaccgttttg attcagccat taccaacctt ggcaatacgg
taaccaatct gaactccgcg 840cgtagccgta tcgaagatgc tgactatgca
ctggttccgc ggggttctca tcatcatcat 900catcatggtt aagtcgac
91867274PRTArtificial SequenceSynthetic sequence 67Met Ala Gln Val
Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5 10 15Asn Leu Asn
Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile Glu Arg Leu 20 25 30Ser Ser
Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45Ala
Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 50 55
60Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65
70 75 80Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu
Ser 85 90 95Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys
Ser Ile 100 105 110Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp
Arg Val Ser Asn 115 120 125Gln Thr Gln Phe Asn Gly Val Lys Val Leu
Ser Gln Asp Asn Gln Met 130 135 140Lys Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr Ile Thr Ile Asp Leu145 150 155 160Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 165 170 175Ser Pro Gly
Ile Ser Gly Gly Gly Gly Gly Ile Leu Asp Ser Met Gly 180 185 190Thr
Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys Ser Thr Ala Asn 195 200
205Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val Asp Ala Val Arg
210 215 220Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser Ala Ile
Thr Asn225 230 235 240Leu Gly Asn Thr Val Thr Asn Leu Asn Ser Ala
Arg Ser Arg Ile Glu 245 250 255Asp Ala Asp Tyr Ala Leu Val Pro Arg
Gly Ser His His His His His 260 265 270His Gly6840DNAArtificial
SequenceSynthetic sequence 68agatctccgc ggaaccagac cagcctgctg
cagaatctgc 4069795DNAArtificial SequenceSynthetic sequence
69taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt
60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcgcaga ttctgcagca ggctggtctg gttccgcggg gttctcatca
tcatcatcat 780catggttaag tcgac 79570702DNAArtificial
SequenceSynthetic sequence 70atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
240caggatgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 300aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 360ggtgaaacca ttaccatcga tctgcaaaaa
attgatgtga aaagccttgg ccttgatggg 420ttcaatgtta attccccggg
aagtaccgct aacccactgg cttcaattga ttctgcattg 480tcaaaagtgg
acgcagttcg ttcttctctg ggggcaattc aaaaccgctt tgattcagcc
540attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 600gctgactatg caacggaagt ttctaatatg tctaaagcgc
agattctgca gcaggctggt 660ctggttccgc ggggttctca tcatcatcat
catcatggtt aa 70271233PRTArtificial SequenceSynthetic sequence
71Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser 195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln
Ala Gly Leu Val Pro Arg 210 215 220Gly Ser His His His His His His
Gly225 23072120DNAArtificial SequenceSynthetic sequence
72aacccactgg cttcaattga ttctgcattg tcaaaagtgg acgcagttcg ttcttctctg
60ggggcaattc aaaaccgttt tgattcagcc attaccgccc ttggcaatac ggtaaccaat
1207340PRTArtificial SequenceSynthetic sequence 73Asn Pro Leu Ala
Ser Ile Asp Ser Ala Leu Ser Lys Val Asp Ala Val1 5 10 15Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser Ala Ile Thr 20 25 30Ala Leu
Gly Asn Thr Val Thr Asn 35 407446DNAArtificial SequenceSynthetic
sequence 74gttcgttctt ctctgggggc aattgattca gccattaccg cccttg
467546DNAArtificial SequenceSynthetic sequence 75caagggcggt
aatggctgaa tcaattgccc ccagagaaga acgaac 4676783DNAArtificial
SequenceSynthetic sequence 76taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 300aactctgatt ccgatctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 420atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattgatt cagccattac cgcccttggc aatacggtaa
ccaatctgaa ctccgcgcgt 660agccgtatcg aagatgctga ctatgcaacg
gaagtttcta atatgtctaa agcgcagatt 720ctgcagcagg ctggtctggt
tccgcggggt tctcatcatc atcatcatca tggttaagtc 780gac
78377229PRTArtificial SequenceSynthetic sequence 77Met Ser Gly Leu
Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala
Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg
Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala
Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55
60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65
70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser
Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn
Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile
Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu
Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro
Leu Ala Ser Ile Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala
Val Arg Ser Ser Leu Gly Ala Ile Asp Ser Ala 165 170 175Ile Thr Ala
Leu Gly Asn Thr Val Thr Asn Leu Asn Ser Ala Arg Ser 180 185 190Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Lys 195 200
205Ala Gln Ile Leu Gln Gln Ala Gly Leu Val Pro Arg Gly Ser His His
210 215 220His His His His Gly22578654DNAArtificial
SequenceSynthetic sequence 78atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
240caggatgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 300aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 360ggtgaaacca ttaccatcga tctgcaaaaa
attgatgtga aaagccttgg ccttgatggg 420ttcaatgtta attccccggg
aagtaccgct aacccactgg cttcaattga ttctgcattg 480tcaaaagtgg
acgcagttcg ttcttctctg ggggcaattc aaaaccgctt tgattcagcc
540attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 600gctgactatg cactggttcc gcggggttct catcatcatc
atcatcatgg ttaa 65479217PRTArtificial SequenceSynthetic sequence
79Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Leu Val Pro Arg 195 200 205Gly Ser His His His His His His Gly 210
21580714DNAArtificial SequenceSynthetic sequence 80atgagtaaag
gagaagaact tttcactgga gttgtcccaa ttcttgttga attagatggt 60gatgttaatg
ggcacaaatt ttctgtcagt ggagagggtg aaggtgatgc aacatacgga
120aaacttaccc ttaaatttat ttgcactact ggaaaactac ctgttccatg
gccaacactt 180gtcactactc tgacgtatgg tgttcaatgc ttttcccgtt
atccggatca tatgaaacgg 240catgactttt tcaagagtgc catgcccgaa
ggttatgtac aggaacgcac tatatctttc 300aaagatgacg ggaactacaa
gacgcgtgct gaagtcaagt ttgaaggtga tacccttgtt 360aatcgtatcg
agttaaaagg tattgatttt aaagaagatg gaaacattct cggacacaaa
420ctcgagtaca actataactc acacaatgta tacatcacgg cagacaaaca
aaagaatgga 480atcaaagcta acttcaaaat tcgccacaac attgaagatg
gatccgttca actagcagac 540cattatcaac aaaatactcc aattggcgat
ggccctgtcc ttttaccaga caaccattac 600ctgtcgacac aatctgccct
tttgaaagat cccaacgaaa agcgtgacca catggtcctt 660cttgagtttg
taactgctgc tgggattaca catggcatgg atgaactata caaa
71481238PRTArtificial SequenceSynthetic sequence 81Met Ser Lys Gly
Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val1 5 10 15Glu Leu Asp
Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly Glu 20 25 30Gly Glu
Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys 35 40
45Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr Leu
50 55 60Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys
Arg65 70 75 80His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val
Gln Glu Arg 85 90 95Thr Ile Ser Phe Lys Asp Asp Gly Asn Tyr Lys Thr
Arg Ala Glu Val 100 105 110Lys Phe Glu Gly Asp Thr Leu Val Asn Arg
Ile Glu Leu Lys Gly Ile 115 120 125Asp Phe Lys Glu Asp Gly Asn Ile
Leu Gly His Lys Leu Glu Tyr Asn 130 135 140Tyr Asn Ser His Asn Val
Tyr Ile Thr Ala Asp Lys Gln Lys Asn Gly145 150 155 160Ile Lys Ala
Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser Val 165 170 175Gln
Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro 180 185
190Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu Leu
195 200 205Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu
Phe Val 210 215 220Thr Ala Ala Gly Ile Thr His Gly Met Asp Glu Leu
Tyr Lys225 230 23582717DNAArtificial SequenceSynthetic sequence
82atgagtaaag gagaagaact tttcactgga gttgtcccaa ttcttgttga attagatggt
60gatgttaatg ggcacaaatt ttctgtcagt ggagagggtg aaggtgatgc aacatacgga
120aaacttaccc ttaaatttat ttgcactact ggaaaactac ctgttccatg
gccaacactt 180gtcactactc tgacgtatgg tgttcaatgc ttttcccgtt
atccggatca catgaaacgg 240catgactttt tcaagagtgc catgcccgaa
ggttatgtac aggaacgcac tatatctttc 300aaagatgacg ggaactacaa
gacgcgtgct gaagtcaagt ttgaaggtga tacccttgtt 360aatcgtatcg
agttaaaagg tattgatttt aaagaagatg gaaacattct cggacacaaa
420ctcgagtaca actataactc acacaatgta tacatcacgg cagacaaaca
aaagaatgga 480atcaaagcta acttcaaaat tcgccacaac attgaagatg
gatccgttca actagcagac 540cattatcaac aaaatactcc aattggcgat
ggccctgtcc ttttaccaga caaccattac 600ctgtcgacac aatctgccct
tttgaaagat cccaacgaaa agcgtgacca catggtcctt 660cttgagtttg
taactgctgc tgggattaca catggcatgg atgaactata caaataa
7178354DNAArtificial SequenceSynthetic sequence 83tctagacggc
cgatctcagg taagaatgga atcaaagcta acttcaaaat tcgc
548420PRTArtificial SequenceSynthetic sequence 84Asn Val Tyr Ile
Pro Ile Ser Gly Lys Asn Gly Ile Lys Ala Asn Phe1 5 10 15Lys Ile Arg
His 208545DNAArtificial SequenceSynthetic sequence 85agatctccgc
ggtttgtata gttcatccat gccatgtgta atccc 45861005DNAArtificial
SequenceSynthetic sequence 86taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 300aactctgatt ccgatctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 420atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcac tggttccgcc gatctcaggt 720aagaatggaa tcaaagctaa
cttcaaaatt cgccacaaca ttgaagatgg atccgttcaa 780ctagcagacc
attatcaaca aaatactcca attggcgatg gccctgtcct tttaccagac
840aaccattacc tgtcgacaca atctgccctt ttgaaagatc ccaacgaaaa
gcgtgaccac 900atggtccttc ttgagtttgt aactgctgct gggattacac
atggcatgga tgaactatac 960aaaccgcggg gttctcatca tcatcatcat
catggttaag tcgac 100587912DNAArtificial SequenceSynthetic sequence
87atgagcgggt tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac
60cgcttcactt ctaatatcaa aggtctgact caggcttccc gtaacgctaa cgacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg actaactctg
attccgatct gaaatctatc 240caggatgaaa ttcagcaacg tctggaagaa
atcgatcgcg tttctaatca gactcaattt 300aacggtgtta aagtcctgtc
tcaggacaac cagatgaaaa tccaggttgg tgctaacgat 360ggtgaaacca
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aagtaccgct aacccactgg cttcaattga
ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg ggggcaattc
aaaaccgctt tgattcagcc 540attaccaacc ttggcaatac ggtaaccaat
ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg cactggttcc
gccgatctca ggtaagaatg gaatcaaagc taacttcaaa 660attcgccaca
acattgaaga tggatccgtt caactagcag accattatca acaaaatact
720ccaattggcg atggccctgt ccttttacca gacaaccatt acctgtcgac
acaatctgcc 780cttttgaaag atcccaacga aaagcgtgac cacatggtcc
ttcttgagtt tgtaactgct 840gctgggatta cacatggcat ggatgaacta
tacaaaccgc ggggttctca tcatcatcat 900catcatggtt aa
91288303PRTArtificial SequenceSynthetic sequence 88Met Ser Gly Leu
Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala
Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg
Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala
Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55
60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65
70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser
Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn
Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile
Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu
Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro
Leu Ala Ser Ile Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala
Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser
Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser
Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Leu Val Pro Pro 195 200
205Ile Ser Gly Lys Asn Gly Ile Lys Ala Asn Phe Lys Ile Arg His Asn
210 215 220Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln Gln
Asn Thr225 230 235 240Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp
Asn His Tyr Leu Ser 245 250 255Thr Gln Ser Ala Leu Leu Lys Asp Pro
Asn Glu Lys Arg Asp His Met 260 265 270Val Leu Leu Glu Phe Val Thr
Ala Ala Gly Ile Thr His Gly Met Asp 275 280 285Glu Leu Tyr Lys Pro
Arg Gly Ser His His His His His His Gly 290 295
30089585DNAArtificial SequenceSynthetic sequence 89atgagtaccg
ctaacccact ggcttcaatt gattctgcat tgtcaaaagt ggacgcagtt 60cgttcttctc
tgggggcaat tcaaaaccgc tttgattcag ccattaccaa ccttggcaat
120acggtaacca atctgaactc cgcgcgtagc cgtatcgaag atgctgacta
tgcatccccg 180ggaagcgggt tacggatcaa cagcgcgaaa gacgatgcgg
caggccaggc gattgctaac 240cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 300tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 360cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
420caggatgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 480aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 540ggtctggttc cgcggggttc tcatcatcat
catcatcatg gttaa 58590194PRTArtificial SequenceSynthetic sequence
90Met Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys1
5 10 15Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe
Asp 20 25 30Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn
Ser Ala 35 40 45Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Ser Pro Gly
Ser Gly Leu 50 55 60Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
Ala Ile Ala Asn65 70 75 80Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr
Gln Ala Ser Arg Asn Ala 85 90 95Asn Asp Gly Ile Ser Ile Ala Gln Thr
Thr Glu Gly Ala Leu Asn Glu 100 105 110Ile Asn Asn Asn Leu Gln Arg
Val Arg Glu Leu Ser Val Gln Ala Thr 115 120 125Asn Gly Thr Asn Ser
Asp Ser Asp Leu Lys Ser Ile Gln Asp Glu Ile 130 135 140Gln Gln Arg
Leu Glu Glu Ile Asp Arg Val Ser Asn Gln Thr Gln Phe145 150 155
160Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met Lys Ile Gln Val
165 170 175Gly Ala Asn Asp Gly Leu Val Pro Arg Gly Ser His His His
His His 180 185 190His Gly91678DNAArtificial SequenceSynthetic
sequence 91taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agtaccgcta acccactggc
ttcaattgat 120tctgcattgt caaaagtgga cgcagttcgt tcttctctgg
gggcaattca aaaccgcttt 180gattcagcca ttaccaacct tggcaatacg
gtaaccaatc tgaactccgc gcgtagccgt 240atcgaagatg ctgactatgc
atccccggga agcgggttac ggatcaacag cgcgaaagac 300gatgcggcag
gccaggcgat tgctaaccgc ttcacttcta atatcaaagg tctgactcag
360gcttcccgta acgctaacga cggcatttct attgcgcaga ccactgaagg
tgcgctgaat 420gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg
ttcaggccac taacgggact 480aactctgatt ccgatctgaa atctatccag
gatgaaattc agcaacgtct ggaagaaatc 540gatcgcgttt ctaatcagac
tcaatttaac ggtgttaaag tcctgtctca ggacaaccag 600atgaaaatcc
aggttggtgc taacgatggt ctggttccgc ggggttctca tcatcatcat
660catcatggtt aagtcgac 6789240DNAArtificial SequenceSynthetic
sequence 92tctagacata tgagtaccgc taacccactg gcttcaattg
409338DNAArtificial SequenceSynthetic sequence 93gcttcccggg
gatgcatagt cagcatcttc gatacggc 389434DNAArtificial
SequenceSynthetic sequence 94gcatccccgg gaagcgggtt acggatcaac agcg
349550DNAArtificial SequenceSynthetic sequence 95agatctccgc
ggaaccagac catcgttagc accaacctgg attttcatct 5096654DNAArtificial
SequenceSynthetic sequence 96atgagtaccg ctaacccact ggcttcaatt
gattctgcat tgtcaaaagt ggacgcagtt 60cgttcttctc tgggggcaat tcaaaaccgc
tttgattcag ccattaccaa ccttggcaat 120acggtaacca atctgaactc
cgcgcgtagc cgtatcgaag atgctgacta tgcatccccg 180ggaagcgggt
tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac
240cgcttcactt ctaatatcaa aggtctgact caggcttccc gtaacgctaa
cgacggcatt 300tctattgcgc agaccactga aggtgcgctg aatgaaatca
acaacaacct gcagcgtgtg 360cgtgagttgt ctgttcaggc cactaacggg
actaactctg attccgatct gaaatctatc 420caggatgaaa ttcagcaacg
tctggaagaa atcgatcgcg tttctaatca gactcaattt 480aacggtgtta
aagtcctgtc tcaggacaac cagatgaaaa tccaggttgg tgctaacgat
540ggtgaaacca ttaccatcga tctgcaaaaa attgatgtga aaagccttgg
ccttgatggg 600ttcaatgtta atctggttcc gcggggttct catcatcatc
atcatcatgg ttaa 65497217PRTArtificial SequenceSynthetic sequence
97Met Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys1
5 10 15Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe
Asp 20 25 30Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn
Ser Ala 35 40 45Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Ser Pro Gly
Ser Gly Leu 50 55 60Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
Ala Ile Ala Asn65 70 75 80Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr
Gln Ala Ser Arg Asn Ala 85 90 95Asn Asp Gly Ile Ser Ile Ala Gln Thr
Thr Glu Gly Ala Leu Asn Glu 100 105 110Ile Asn Asn Asn Leu Gln Arg
Val Arg Glu Leu Ser Val Gln Ala Thr 115 120 125Asn Gly Thr Asn Ser
Asp Ser Asp Leu Lys Ser Ile Gln Asp Glu Ile 130 135 140Gln Gln Arg
Leu Glu Glu Ile Asp Arg Val Ser Asn Gln Thr Gln Phe145 150 155
160Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met Lys Ile Gln Val
165 170 175Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu Gln Lys
Ile Asp 180 185 190Val Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn
Leu Val Pro Arg 195 200 205Gly Ser His His His His His His Gly 210
21598747DNAArtificial SequenceSynthetic sequence 98taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agtaccgcta acccactggc ttcaattgat
120tctgcattgt caaaagtgga cgcagttcgt tcttctctgg gggcaattca
aaaccgcttt 180gattcagcca ttaccaacct tggcaatacg gtaaccaatc
tgaactccgc gcgtagccgt 240atcgaagatg ctgactatgc atccccggga
agcgggttac ggatcaacag cgcgaaagac 300gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 360gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
420gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 480aactctgatt ccgatctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 540gatcgcgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 600atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 660gatgtgaaaa
gccttggcct tgatgggttc aatgttaatc tggttccgcg gggttctcat
720catcatcatc atcatggtta agtcgac 7479945DNAArtificial
SequenceSynthetic sequence 99agatctccgc ggaaccagat taacattgaa
cccatcaagg ccaag 4510038DNAArtificial SequenceSynthetic sequence
100cccgttatcc ggatcacatg aaacggcatg actttttc 3810138DNAArtificial
SequenceSynthetic sequence 101gaaaaagtca tgccgtttca tgtgatccgg
ataacggg 3810221DNAArtificial SequenceSynthetic sequence
102ctgttccatg gccaacactt g 2110346DNAArtificial SequenceSynthetic
sequence 103tctagacata tgagtaaagg agaagaactt ttcactggag ttgtcc
4610463DNAArtificial SequenceSynthetic sequence 104ggcctatgcg
gccgcagtaa aggagaagaa cttttcactg gagttgtccc aattcttgtt 60gaa
6310557DNAArtificial SequenceSynthetic sequence 105agatctatta
atgcggcctg ataggccttg tttgtctgcc gtgatgtata cattgtg
5710618PRTArtificial SequenceSynthetic sequence 106Ser His Asn Val
Tyr Ile Thr Ala Asp Lys Gln Gly Leu Ser Gly Arg1 5 10 15Asn
Met1071494DNAArtificial SequenceSynthetic sequence 107taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agtaaaggag aagaactttt cactggagtt
120gtcccaattc ttgttgaatt agatggtgat gttaatgggc acaaattttc
tgtcagtgga 180gagggtgaag gtgatgcaac atacggaaaa cttaccctta
aatttatttg cactactgga 240aaactacctg ttccatggcc aacacttgtc
actactctga cgtatggtgt tcaatgcttt 300tcccgttatc cggatcacat
gaaacggcat gactttttca agagtgccat gcccgaaggt 360tatgtacagg
aacgcactat atctttcaaa gatgacggga actacaagac gcgtgctgaa
420gtcaagtttg aaggtgatac ccttgttaat cgtatcgagt taaaaggtat
tgattttaaa 480gaagatggaa acattctcgg acacaaactc gagtacaact
ataactcaca caatgtatac 540atcacggcag acaaacaagg cctatcaggc
cgcattatga gcgggttacg gatcaacagc 600gcgaaagacg atgcggcagg
ccaggcgatt gctaaccgct tcacttctaa tatcaaaggt 660ctgactcagg
cttcccgtaa cgctaacgac ggcatttcta ttgcgcagac cactgaaggt
720gcgctgaatg aaatcaacaa caacctgcag cgtgtgcgtg agttgtctgt
tcaggccact 780aacgggacta actctgattc cgatctgaaa tctatccagg
atgaaattca gcaacgtctg 840gaagaaatcg atcgcgtttc taatcagact
caatttaacg gtgttaaagt cctgtctcag 900gacaaccaga tgaaaatcca
ggttggtgct aacgatggtg aaaccattac catcgatctg 960caaaaaattg
atgtgaaaag ccttggcctt gatgggttca atgttaattc cccgggaagt
1020accgctaacc cactggcttc aattgattct gcattgtcaa aagtggacgc
agttcgttct 1080tctctggggg caattcaaaa ccgctttgat tcagccatta
ccaaccttgg caatacggta 1140accaatctga actccgcgcg tagccgtatc
gaagatgctg actatgcact ggttccgccg 1200atctcaggta agaatggaat
caaagctaac ttcaaaattc gccacaacat tgaagatgga 1260tccgttcaac
tagcagacca ttatcaacaa aatactccaa ttggcgatgg ccctgtcctt
1320ttaccagaca accattacct gtcgacacaa tctgcccttt tgaaagatcc
caacgaaaag 1380cgtgaccaca tggtccttct tgagtttgta actgctgctg
ggattacaca tggcatggat 1440gaactataca aaccgcgggg ttctcatcat
catcatcatc atggttaagt cgac 14941081401DNAArtificial
SequenceSynthetic sequence 108atgagtaaag gagaagaact tttcactgga
gttgtcccaa ttcttgttga attagatggt 60gatgttaatg ggcacaaatt ttctgtcagt
ggagagggtg aaggtgatgc aacatacgga 120aaacttaccc ttaaatttat
ttgcactact ggaaaactac ctgttccatg gccaacactt 180gtcactactc
tgacgtatgg tgttcaatgc ttttcccgtt atccggatca catgaaacgg
240catgactttt tcaagagtgc catgcccgaa ggttatgtac aggaacgcac
tatatctttc 300aaagatgacg ggaactacaa gacgcgtgct gaagtcaagt
ttgaaggtga tacccttgtt 360aatcgtatcg agttaaaagg tattgatttt
aaagaagatg gaaacattct cggacacaaa
420ctcgagtaca actataactc acacaatgta tacatcacgg cagacaaaca
aggcctatca 480ggccgcatta tgagcgggtt acggatcaac agcgcgaaag
acgatgcggc aggccaggcg 540attgctaacc gcttcacttc taatatcaaa
ggtctgactc aggcttcccg taacgctaac 600gacggcattt ctattgcgca
gaccactgaa ggtgcgctga atgaaatcaa caacaacctg 660cagcgtgtgc
gtgagttgtc tgttcaggcc actaacggga ctaactctga ttccgatctg
720aaatctatcc aggatgaaat tcagcaacgt ctggaagaaa tcgatcgcgt
ttctaatcag 780actcaattta acggtgttaa agtcctgtct caggacaacc
agatgaaaat ccaggttggt 840gctaacgatg gtgaaaccat taccatcgat
ctgcaaaaaa ttgatgtgaa aagccttggc 900cttgatgggt tcaatgttaa
ttccccggga agtaccgcta acccactggc ttcaattgat 960tctgcattgt
caaaagtgga cgcagttcgt tcttctctgg gggcaattca aaaccgcttt
1020gattcagcca ttaccaacct tggcaatacg gtaaccaatc tgaactccgc
gcgtagccgt 1080atcgaagatg ctgactatgc actggttccg ccgatctcag
gtaagaatgg aatcaaagct 1140aacttcaaaa ttcgccacaa cattgaagat
ggatccgttc aactagcaga ccattatcaa 1200caaaatactc caattggcga
tggccctgtc cttttaccag acaaccatta cctgtcgaca 1260caatctgccc
ttttgaaaga tcccaacgaa aagcgtgacc acatggtcct tcttgagttt
1320gtaactgctg ctgggattac acatggcatg gatgaactat acaaaccgcg
gggttctcat 1380catcatcatc atcatggtta a 1401109466PRTArtificial
SequenceSynthetic sequence 109Met Ser Lys Gly Glu Glu Leu Phe Thr
Gly Val Val Pro Ile Leu Val1 5 10 15Glu Leu Asp Gly Asp Val Asn Gly
His Lys Phe Ser Val Ser Gly Glu 20 25 30Gly Glu Gly Asp Ala Thr Tyr
Gly Lys Leu Thr Leu Lys Phe Ile Cys 35 40 45Thr Thr Gly Lys Leu Pro
Val Pro Trp Pro Thr Leu Val Thr Thr Leu 50 55 60Thr Tyr Gly Val Gln
Cys Phe Ser Arg Tyr Pro Asp His Met Lys Arg65 70 75 80His Asp Phe
Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg 85 90 95Thr Ile
Ser Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val 100 105
110Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile
115 120 125Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu
Tyr Asn 130 135 140Tyr Asn Ser His Asn Val Tyr Ile Thr Ala Asp Lys
Gln Gly Leu Ser145 150 155 160Gly Arg Ile Met Ser Gly Leu Arg Ile
Asn Ser Ala Lys Asp Asp Ala 165 170 175Ala Gly Gln Ala Ile Ala Asn
Arg Phe Thr Ser Asn Ile Lys Gly Leu 180 185 190Thr Gln Ala Ser Arg
Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr 195 200 205Thr Glu Gly
Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg 210 215 220Glu
Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu225 230
235 240Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp
Arg 245 250 255Val Ser Asn Gln Thr Gln Phe Asn Gly Val Lys Val Leu
Ser Gln Asp 260 265 270Asn Gln Met Lys Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr Ile Thr 275 280 285Ile Asp Leu Gln Lys Ile Asp Val Lys
Ser Leu Gly Leu Asp Gly Phe 290 295 300Asn Val Asn Ser Pro Gly Ser
Thr Ala Asn Pro Leu Ala Ser Ile Asp305 310 315 320Ser Ala Leu Ser
Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile 325 330 335Gln Asn
Arg Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr 340 345
350Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Leu
355 360 365Val Pro Pro Ile Ser Gly Lys Asn Gly Ile Lys Ala Asn Phe
Lys Ile 370 375 380Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala
Asp His Tyr Gln385 390 395 400Gln Asn Thr Pro Ile Gly Asp Gly Pro
Val Leu Leu Pro Asp Asn His 405 410 415Tyr Leu Ser Thr Gln Ser Ala
Leu Leu Lys Asp Pro Asn Glu Lys Arg 420 425 430Asp His Met Val Leu
Leu Glu Phe Val Thr Ala Ala Gly Ile Thr His 435 440 445Gly Met Asp
Glu Leu Tyr Lys Pro Arg Gly Ser His His His His His 450 455 460His
Gly465110124DNAArtificial SequenceSynthetic sequence 110cttggccttg
atgggttcaa tgttaattcc ccgggaattt ccggtggtgg tggtggaatt 60acattaatca
atgaagacgc tgccgcagcc aagaaaagta ccgctaaccc actggcttca 120attg
12411141PRTArtificial SequenceSynthetic sequence 111Leu Gly Leu Asp
Gly Phe Asn Val Asn Ser Pro Gly Ile Ser Gly Gly1 5 10 15Gly Gly Gly
Ile Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys 20 25 30Ser Thr
Ala Asn Pro Leu Ala Ser Ile 35 4011272DNAArtificial
SequenceSynthetic sequence 112agatctccgc ggaaccagta aagagaggac
gttttgcgga acctggtttg catagtcagc 60atcttcgata cg
72113777DNAArtificial SequenceSynthetic sequence 113taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgttttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa accaggttcc gcaaaacgtc
720ctctctttac tggttccgcg gggttctcat catcatcatc atcatggtta agtcgac
777114684DNAArtificial SequenceSynthetic sequence 114atgagcgggt
tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac 60cgcttcactt
ctaatatcaa aggtctgact caggcttccc gtaacgctaa cgacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg actaactctg
attccgatct gaaatctatc 240caggatgaaa ttcagcaacg tctggaagaa
atcgatcgcg tttctaatca gactcaattt 300aacggtgtta aagtcctgtc
tcaggacaac cagatgaaaa tccaggttgg tgctaacgat 360ggtgaaacca
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aagtaccgct aacccactgg cttcaattga
ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg ggggcaattc
aaaaccgttt tgattcagcc 540attaccaacc ttggcaatac ggtaaccaat
ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg caaaccaggt
tccgcaaaac gtcctctctt tactggttcc gcggggttct 660catcatcatc
atcatcatgg ttaa 684115227PRTArtificial SequenceSynthetic sequence
115Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Asn Gln Val Pro 195 200 205Gln Asn Val Leu Ser Leu Leu Val Pro Arg
Gly Ser His His His His 210 215 220His His Gly22511642DNAArtificial
SequenceSynthetic sequence 116agatctcccg gggaaccatc gttagcacca
acctggattt tc 42117777DNAArtificial SequenceSynthetic sequence
117taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac taacgggact 300aactctgatt
ccgatctgaa atctatccag gatgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt tccccgggaa
gtaccgctaa cccactggct 480tcaattgatt ctgcattgtc aaaagtggac
gcagttcgtt cttctctggg ggcaattcaa 540aaccgctttg attcagccat
taccaacctt ggcaatacgg taaccaatct gaactccgcg 600cgtagccgta
tcgaagatgc tgactatgca acggaagttt ctaatatgtc taaagcgcag
660attctgcagc aggctggtac ttccgttctg gcgcaggcta accaggttcc
gcaaaacgtc 720ctctctttac tggttccgcg gggttctcat catcatcatc
atcatggtta agtcgac 777118684DNAArtificial SequenceSynthetic
sequence 118atgagcgggt tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc
gattgctaac 60cgcttcactt ctaatatcaa aggtctgact caggcttccc gtaacgctaa
cgacggcatt 120tctattgcgc agaccactga aggtgcgctg aatgaaatca
acaacaacct gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg
actaactctg attccgatct gaaatctatc 240caggatgaaa ttcagcaacg
tctggaagaa atcgatcgcg tttctaatca gactcaattt 300aacggtgtta
aagtcctgtc tcaggacaac cagatgaaaa tccaggttgg tgctaacgat
360ggttccccgg gaagtaccgc taacccactg gcttcaattg attctgcatt
gtcaaaagtg 420gacgcagttc gttcttctct gggggcaatt caaaaccgct
ttgattcagc cattaccaac 480cttggcaata cggtaaccaa tctgaactcc
gcgcgtagcc gtatcgaaga tgctgactat 540gcaacggaag tttctaatat
gtctaaagcg cagattctgc agcaggctgg tacttccgtt 600ctggcgcagg
ctaaccaggt tccgcaaaac gtcctctctt tactggttcc gcggggttct
660catcatcatc atcatcatgg ttaa 684119227PRTArtificial
SequenceSynthetic sequence 119Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Ser Pro Gly Ser Thr Ala Asn
115 120 125Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val Asp Ala
Val Arg 130 135 140Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser
Ala Ile Thr Asn145 150 155 160Leu Gly Asn Thr Val Thr Asn Leu Asn
Ser Ala Arg Ser Arg Ile Glu 165 170 175Asp Ala Asp Tyr Ala Thr Glu
Val Ser Asn Met Ser Lys Ala Gln Ile 180 185 190Leu Gln Gln Ala Gly
Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro 195 200 205Gln Asn Val
Leu Ser Leu Leu Val Pro Arg Gly Ser His His His His 210 215 220His
His Gly22512090DNAArtificial SequenceSynthetic sequence
120agatctccgc ggaaccagca ggttattctg ggtcaacagc gacaggctgt
ttgtattaat 60gacttgtgca tagtcagcat cttcgatacg 90121795DNAArtificial
SequenceSynthetic sequence 121taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 300aactctgatt ccgatctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 420atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcac aagtcattaa tacaaacagc 720ctgtcgctgt tgacccagaa
taacctgctg gttccgcggg gttctcatca tcatcatcat 780catggttaag tcgac
795122702DNAArtificial SequenceSynthetic sequence 122atgagcgggt
tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac 60cgcttcactt
ctaatatcaa aggtctgact caggcttccc gtaacgctaa cgacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg actaactctg
attccgatct gaaatctatc 240caggatgaaa ttcagcaacg tctggaagaa
atcgatcgcg tttctaatca gactcaattt 300aacggtgtta aagtcctgtc
tcaggacaac cagatgaaaa tccaggttgg tgctaacgat 360ggtgaaacca
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aagtaccgct aacccactgg cttcaattga
ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg ggggcaattc
aaaaccgctt tgattcagcc 540attaccaacc ttggcaatac ggtaaccaat
ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg cacaagtcat
taatacaaac agcctgtcgc tgttgaccca gaataacctg 660ctggttccgc
ggggttctca tcatcatcat catcatggtt aa 702123233PRTArtificial
SequenceSynthetic sequence 123Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Gln Val Ile Asn 195 200 205Thr Asn Ser
Leu Ser Leu Leu Thr Gln Asn Asn Leu Leu Val Pro Arg 210 215 220Gly
Ser His His His His His His Gly225 23012449DNAArtificial
SequenceSynthetic sequence 124gctgactatg caacggcagt ttctgctatg
tctgcagcgc agattctgc 4912549DNAArtificial SequenceSynthetic
sequence 125gcagaatctg cgctgcagac atagcagaaa ctgccgttgc atagtcagc
49126795DNAArtificial SequenceSynthetic sequence 126taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggcagtttc tgctatgtct
720gcagcgcaga ttctgcagca ggctggtctg gttccgcggg gttctcatca
tcatcatcat 780catggttaag tcgac 795127702DNAArtificial
SequenceSynthetic sequence
127atgagcgggt tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc
gattgctaac 60cgcttcactt ctaatatcaa aggtctgact caggcttccc gtaacgctaa
cgacggcatt 120tctattgcgc agaccactga aggtgcgctg aatgaaatca
acaacaacct gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg
actaactctg attccgatct gaaatctatc 240caggatgaaa ttcagcaacg
tctggaagaa atcgatcgcg tttctaatca gactcaattt 300aacggtgtta
aagtcctgtc tcaggacaac cagatgaaaa tccaggttgg tgctaacgat
360ggtgaaacca ttaccatcga tctgcaaaaa attgatgtga aaagccttgg
ccttgatggg 420ttcaatgtta attccccggg aagtaccgct aacccactgg
cttcaattga ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg
ggggcaattc aaaaccgctt tgattcagcc 540attaccaacc ttggcaatac
ggtaaccaat ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg
caacggcagt ttctgctatg tctgcagcgc agattctgca gcaggctggt
660ctggttccgc ggggttctca tcatcatcat catcatggtt aa
702128233PRTArtificial SequenceSynthetic sequence 128Met Ser Gly
Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile
Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser
Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40
45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser
50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser
Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg
Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln
Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu
Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val Lys Ser Leu
Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly Ser Thr Ala
Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155 160Ser Lys Val
Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe
Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185
190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Thr Ala Val Ser
195 200 205Ala Met Ser Ala Ala Gln Ile Leu Gln Gln Ala Gly Leu Val
Pro Arg 210 215 220Gly Ser His His His His His His Gly225
23012954DNAArtificial SequenceSynthetic sequence 129gtttctaata
tgtctaaagc ggcgattctg ggagcggctg gtctggttcc gcgg
5413054DNAArtificial SequenceSynthetic sequence 130ccgcggaacc
agaccagccg ctcccagaat cgccgcttta gacatattag aaac
54131795DNAArtificial SequenceSynthetic sequence 131taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcggcga ttctgggagc ggctggtctg gttccgcggg gttctcatca
tcatcatcat 780catggttaag tcgac 795132702DNAArtificial
SequenceSynthetic sequence 132atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
240caggatgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 300aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 360ggtgaaacca ttaccatcga tctgcaaaaa
attgatgtga aaagccttgg ccttgatggg 420ttcaatgtta attccccggg
aagtaccgct aacccactgg cttcaattga ttctgcattg 480tcaaaagtgg
acgcagttcg ttcttctctg ggggcaattc aaaaccgctt tgattcagcc
540attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 600gctgactatg caacggaagt ttctaatatg tctaaagcgg
cgattctggg agcggctggt 660ctggttccgc ggggttctca tcatcatcat
catcatggtt aa 702133233PRTArtificial SequenceSynthetic sequence
133Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser 195 200 205Asn Met Ser Lys Ala Ala Ile Leu Gly Ala
Ala Gly Leu Val Pro Arg 210 215 220Gly Ser His His His His His His
Gly225 23013425DNAArtificial SequenceSynthetic sequence
134tctagaggat ccggcaggcc aggcg 2513522DNAArtificial
SequenceSynthetic sequence 135cgcaagcttg tcgacttaac gc
22136970DNAArtificial SequenceSynthetic sequence 136taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg cggggttctc atcatcatca tcatcatggt
120atggctagca tgactggtgg acagcaaatg ggtcgggatc tgtacgacct
ggttccgcgc 180ggtagcgcga aggatccggc aggccaggcg attgctaacc
gcttcacttc taatatcaaa 240ggtctgactc aggcttcccg taacgctaac
gacggcattt ctattgcgca gaccactgaa 300ggtgcgctga atgaaatcaa
caacaacctg cagcgtgtgc gtgagttgtc tgttcaggcc 360actaacggga
ctaactctga ttccgatctg aaatctatcc aggatgaaat tcagcaacgt
420ctggaagaaa tcgatcgcgt ttctaatcag actcaattta acggtgttaa
agtcctgtct 480caggacaacc agatgaaaat ccaggttggt gctaacgatg
gtgaaaccat taccatcgat 540ctgcaaaaaa ttgatgtgaa aagccttggc
cttgatgggt tcaatgttaa ttccccggga 600atttccggtg gtggtggtgg
aattctagac tccatgggta cattaatcaa tgaagacgct 660gccgcagcca
agaaaagtac cgctaaccca ctggcttcaa ttgattctgc attgtcaaaa
720gtggacgcag ttcgttcttc tctgggggca attcaaaacc gttttgattc
agccattacc 780aaccttggca atacggtaac caatctgaac tccgcgcgta
gccgtatcga agatgctgac 840tatgcaacgg aagtttctaa tatgtctaaa
gcgcagattc tgcagcaggc tggtacttcc 900gttctggcgc aggctaacca
ggttccgcaa aacgtcctct ctttactgcg ttaagtcgac 960aagcttgcgg
970137288PRTArtificial SequenceSynthetic sequence 137Met Arg Gly
Ser His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly
Gln Gln Met Gly Arg Asp Leu Tyr Asp Leu Val Pro Arg Gly 20 25 30Ser
Ala Lys Asp Pro Ala Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser 35 40
45Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile
50 55 60Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn
Asn65 70 75 80Leu Gln Arg Val Arg Glu Leu Ser Val Gln Ala Thr Asn
Gly Thr Asn 85 90 95Ser Asp Ser Asp Leu Lys Ser Ile Gln Asp Glu Ile
Gln Gln Arg Leu 100 105 110Glu Glu Ile Asp Arg Val Ser Asn Gln Thr
Gln Phe Asn Gly Val Lys 115 120 125Val Leu Ser Gln Asp Asn Gln Met
Lys Ile Gln Val Gly Ala Asn Asp 130 135 140Gly Glu Thr Ile Thr Ile
Asp Leu Gln Lys Ile Asp Val Lys Ser Leu145 150 155 160Gly Leu Asp
Gly Phe Asn Val Asn Ser Pro Gly Ile Ser Gly Gly Gly 165 170 175Gly
Gly Ile Leu Asp Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala 180 185
190Ala Ala Lys Lys Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala
195 200 205Leu Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile
Gln Asn 210 215 220Arg Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr
Val Thr Asn Leu225 230 235 240Asn Ser Ala Arg Ser Arg Ile Glu Asp
Ala Asp Tyr Ala Thr Glu Val 245 250 255Ser Asn Met Ser Lys Ala Gln
Ile Leu Gln Gln Ala Gly Thr Ser Val 260 265 270Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val Leu Ser Leu Leu Arg 275 280
2851381236DNAArtificial SequenceSynthetic sequence 138taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agtaaaggag aagaactttt cactggagtt
120gtcccaattc ttgttgaatt agatggtgat gttaatgggc acaaattttc
tgtcagtgga 180gagggtgaag gtgatgcaac atacggaaaa cttaccctta
aatttatttg cactactgga 240aaactacctg ttccatggcc aacacttgtc
actactctga cgtatggtgt tcaatgcttt 300tcccgttatc cggatcacat
gaaacggcat gactttttca agagtgccat gcccgaaggt 360tatgtacagg
aacgcactat atctttcaaa gatgacggga actacaagac gcgtgctgaa
420gtcaagtttg aaggtgatac ccttgttaat cgtatcgagt taaaaggtat
tgattttaaa 480gaagatggaa acattctcgg acacaaactc gagtacaact
ataactcaca caatgtatac 540atcacggcag acaaacaagg cctatcaggc
cgcattatga gcgggttacg gatcaacagc 600gcgaaagacg atgcggcagg
ccaggcgatt gctaaccgct tcacttctaa tatcaaaggt 660ctgactcagg
cttcccgtaa cgctaacgac ggcatttcta ttgcgcagac cactgaaggt
720gcgctgaatg aaatcaacaa caacctgcag cgtgtgcgtg agttgtctgt
tcaggccact 780aacgggacta actctgattc cgatctgaaa tctatccagg
atgaaattca gcaacgtctg 840gaagaaatcg atcgcgtttc taatcagact
caatttaacg gtgttaaagt cctgtctcag 900gacaaccaga tgaaaatcca
ggttggtgct aacgatggtg aaaccattac catcgatctg 960caaaaaattg
atgtgaaaag ccttggcctt gatgggttca atgttaattc cccgggaagt
1020accgctaacc cactggcttc aattgattct gcattgtcaa aagtggacgc
agttcgttct 1080tctctggggg caattcaaaa ccgctttgat tcagccatta
ccaaccttgg caatacggta 1140accaatctga actccgcgcg tagccgtatc
gaagatgctg actatgcact ggttccgcgg 1200ggttctcatc atcatcatca
tcatggttaa gtcgac 12361391143DNAArtificial SequenceSynthetic
sequence 139atgagtaaag gagaagaact tttcactgga gttgtcccaa ttcttgttga
attagatggt 60gatgttaatg ggcacaaatt ttctgtcagt ggagagggtg aaggtgatgc
aacatacgga 120aaacttaccc ttaaatttat ttgcactact ggaaaactac
ctgttccatg gccaacactt 180gtcactactc tgacgtatgg tgttcaatgc
ttttcccgtt atccggatca catgaaacgg 240catgactttt tcaagagtgc
catgcccgaa ggttatgtac aggaacgcac tatatctttc 300aaagatgacg
ggaactacaa gacgcgtgct gaagtcaagt ttgaaggtga tacccttgtt
360aatcgtatcg agttaaaagg tattgatttt aaagaagatg gaaacattct
cggacacaaa 420ctcgagtaca actataactc acacaatgta tacatcacgg
cagacaaaca aggcctatca 480ggccgcatta tgagcgggtt acggatcaac
agcgcgaaag acgatgcggc aggccaggcg 540attgctaacc gcttcacttc
taatatcaaa ggtctgactc aggcttcccg taacgctaac 600gacggcattt
ctattgcgca gaccactgaa ggtgcgctga atgaaatcaa caacaacctg
660cagcgtgtgc gtgagttgtc tgttcaggcc actaacggga ctaactctga
ttccgatctg 720aaatctatcc aggatgaaat tcagcaacgt ctggaagaaa
tcgatcgcgt ttctaatcag 780actcaattta acggtgttaa agtcctgtct
caggacaacc agatgaaaat ccaggttggt 840gctaacgatg gtgaaaccat
taccatcgat ctgcaaaaaa ttgatgtgaa aagccttggc 900cttgatgggt
tcaatgttaa ttccccggga agtaccgcta acccactggc ttcaattgat
960tctgcattgt caaaagtgga cgcagttcgt tcttctctgg gggcaattca
aaaccgcttt 1020gattcagcca ttaccaacct tggcaatacg gtaaccaatc
tgaactccgc gcgtagccgt 1080atcgaagatg ctgactatgc actggttccg
cggggttctc atcatcatca tcatcatggt 1140taa 1143140380PRTArtificial
SequenceSynthetic sequence 140Met Ser Lys Gly Glu Glu Leu Phe Thr
Gly Val Val Pro Ile Leu Val1 5 10 15Glu Leu Asp Gly Asp Val Asn Gly
His Lys Phe Ser Val Ser Gly Glu 20 25 30Gly Glu Gly Asp Ala Thr Tyr
Gly Lys Leu Thr Leu Lys Phe Ile Cys 35 40 45Thr Thr Gly Lys Leu Pro
Val Pro Trp Pro Thr Leu Val Thr Thr Leu 50 55 60Thr Tyr Gly Val Gln
Cys Phe Ser Arg Tyr Pro Asp His Met Lys Arg65 70 75 80His Asp Phe
Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg 85 90 95Thr Ile
Ser Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val 100 105
110Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile
115 120 125Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu
Tyr Asn 130 135 140Tyr Asn Ser His Asn Val Tyr Ile Thr Ala Asp Lys
Gln Gly Leu Ser145 150 155 160Gly Arg Ile Met Ser Gly Leu Arg Ile
Asn Ser Ala Lys Asp Asp Ala 165 170 175Ala Gly Gln Ala Ile Ala Asn
Arg Phe Thr Ser Asn Ile Lys Gly Leu 180 185 190Thr Gln Ala Ser Arg
Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr 195 200 205Thr Glu Gly
Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg 210 215 220Glu
Leu Ser Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu225 230
235 240Lys Ser Ile Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp
Arg 245 250 255Val Ser Asn Gln Thr Gln Phe Asn Gly Val Lys Val Leu
Ser Gln Asp 260 265 270Asn Gln Met Lys Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr Ile Thr 275 280 285Ile Asp Leu Gln Lys Ile Asp Val Lys
Ser Leu Gly Leu Asp Gly Phe 290 295 300Asn Val Asn Ser Pro Gly Ser
Thr Ala Asn Pro Leu Ala Ser Ile Asp305 310 315 320Ser Ala Leu Ser
Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile 325 330 335Gln Asn
Arg Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr 340 345
350Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Leu
355 360 365Val Pro Arg Gly Ser His His His His His His Gly 370 375
38014136DNAArtificial SequenceSynthetic sequence 141tctagaggat
ccgtctggtc tgcgtatcaa cagcgc 36142996DNAArtificial
SequenceSynthetic sequence 142taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
cggggttctc atcatcatca tcatcatggt 120atggctagca tgactggtgg
acagcaaatg ggtcgggatc tgtacgacct ggttccgcgc 180ggtagcgcga
aggatccgtc tggtctgcgt atcaacagcg cgaaagacga tgcggcaggc
240caggcgattg ctaaccgctt cacttctaat atcaaaggtc tgactcaggc
ttcccgtaac 300gctaacgacg gcatttctat tgcgcagacc actgaaggtg
cgctgaatga aatcaacaac 360aacctgcagc gtgtgcgtga gttgtctgtt
caggccacta acgggactaa ctctgattcc 420gatctgaaat ctatccagga
tgaaattcag caacgtctgg aagaaatcga tcgcgtttct 480aatcagactc
aatttaacgg tgttaaagtc ctgtctcagg acaaccagat gaaaatccag
540gttggtgcta acgatggtga aaccattacc atcgatctgc aaaaaattga
tgtgaaaagc 600cttggccttg atgggttcaa tgttaattcc ccgggaattt
ccggtggtgg tggtggaatt 660ctagactcca tgggtacatt aatcaatgaa
gacgctgccg cagccaagaa aagtaccgct 720aacccactgg cttcaattga
ttctgcattg tcaaaagtgg acgcagttcg ttcttctctg 780ggggcaattc
aaaaccgttt tgattcagcc attaccaacc ttggcaatac ggtaaccaat
840ctgaactccg cgcgtagccg tatcgaagat gctgactatg caacggaagt
ttctaatatg 900tctaaagcgc agattctgca gcaggctggt acttccgttc
tggcgcaggc taaccaggtt 960ccgcaaaacg tcctctcttt actgcgttaa gtcgac
996143903DNAArtificial SequenceSynthetic sequence 143atgcggggtt
ctcatcatca tcatcatcat ggtatggcta gcatgactgg tggacagcaa 60atgggtcggg
atctgtacga cctggttccg cgcggtagcg cgaaggatcc gtctggtctg
120cgtatcaaca gcgcgaaaga cgatgcggca ggccaggcga ttgctaaccg
cttcacttct 180aatatcaaag gtctgactca ggcttcccgt aacgctaacg
acggcatttc tattgcgcag 240accactgaag gtgcgctgaa tgaaatcaac
aacaacctgc agcgtgtgcg tgagttgtct 300gttcaggcca ctaacgggac
taactctgat tccgatctga aatctatcca ggatgaaatt 360cagcaacgtc
tggaagaaat cgatcgcgtt tctaatcaga
ctcaatttaa cggtgttaaa 420gtcctgtctc aggacaacca gatgaaaatc
caggttggtg ctaacgatgg tgaaaccatt 480accatcgatc tgcaaaaaat
tgatgtgaaa agccttggcc ttgatgggtt caatgttaat 540tccccgggaa
tttccggtgg tggtggtgga attctagact ccatgggtac attaatcaat
600gaagacgctg ccgcagccaa gaaaagtacc gctaacccac tggcttcaat
tgattctgca 660ttgtcaaaag tggacgcagt tcgttcttct ctgggggcaa
ttcaaaaccg ttttgattca 720gccattacca accttggcaa tacggtaacc
aatctgaact ccgcgcgtag ccgtatcgaa 780gatgctgact atgcaacgga
agtttctaat atgtctaaag cgcagattct gcagcaggct 840ggtacttccg
ttctggcgca ggctaaccag gttccgcaaa acgtcctctc tttactgcgt 900taa
903144300PRTArtificial SequenceSynthetic sequence 144Met Arg Gly
Ser His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly
Gln Gln Met Gly Arg Asp Leu Tyr Asp Leu Val Pro Arg Gly 20 25 30Ser
Ala Lys Asp Pro Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp 35 40
45Ala Ala Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly
50 55 60Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala
Gln65 70 75 80Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu
Gln Arg Val 85 90 95Arg Glu Leu Ser Val Gln Ala Thr Asn Gly Thr Asn
Ser Asp Ser Asp 100 105 110Leu Lys Ser Ile Gln Asp Glu Ile Gln Gln
Arg Leu Glu Glu Ile Asp 115 120 125Arg Val Ser Asn Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ser Gln 130 135 140Asp Asn Gln Met Lys Ile
Gln Val Gly Ala Asn Asp Gly Glu Thr Ile145 150 155 160Thr Ile Asp
Leu Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly 165 170 175Phe
Asn Val Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu 180 185
190Asp Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys Lys
195 200 205Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser
Lys Val 210 215 220Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn
Arg Phe Asp Ser225 230 235 240Ala Ile Thr Asn Leu Gly Asn Thr Val
Thr Asn Leu Asn Ser Ala Arg 245 250 255Ser Arg Ile Glu Asp Ala Asp
Tyr Ala Thr Glu Val Ser Asn Met Ser 260 265 270Lys Ala Gln Ile Leu
Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala 275 280 285Asn Gln Val
Pro Gln Asn Val Leu Ser Leu Leu Arg 290 295 30014544DNAArtificial
SequenceSynthetic sequence 145agatctccgc ggaaccagtg catagtcagc
atcttcgata cggc 44146747DNAArtificial SequenceSynthetic sequence
146taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac taacgggact 300aactctgatt
ccgatctgaa atctatccag gatgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcac tggttccgcg
gggttctcat 720catcatcatc atcatggtta agtcgac 747147654DNAArtificial
SequenceSynthetic sequence 147atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactaacggg actaactctg attccgatct gaaatctatc
240caggatgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 300aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 360ggtgaaacca ttaccatcga tctgcaaaaa
attgatgtga aaagccttgg ccttgatggg 420ttcaatgtta attccccggg
aagtaccgct aacccactgg cttcaattga ttctgcattg 480tcaaaagtgg
acgcagttcg ttcttctctg ggggcaattc aaaaccgctt tgattcagcc
540attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 600gctgactatg cactggttcc gcggggttct catcatcatc
atcatcatgg ttaa 654148217PRTArtificial SequenceSynthetic sequence
148Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp
Leu Lys Ser Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Leu Val Pro Arg 195 200 205Gly Ser His His His His His His Gly 210
215149753DNAArtificial SequenceSynthetic sequence 149atgagcgggt
tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac 60cgcttcactt
ctaatatcaa aggtctgact caggcttccc gtaacgctgc agacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactgccggg gctaacgctg
atgccgctct gaaagctatc 240caggctgaaa ttcagcaacg tctggaagaa
atcgatcgcg tttctcagca gactcaagct 300gccgctgtta aagtcctgtc
tcaggacaac gcaatggcaa tccaggttgg tgctaacgat 360ggtgccgcta
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aagtaccgct aacccactgg cttcaattga
ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg ggggcaattc
aaaaccgctt tgattcagcc 540attaccaacc ttggcaatac ggtaaccaat
ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg caacggaagt
ttctcaaatg tctaaagcgc agattctgca gcaggctggt 660acttccgttc
tggcgcaggc taaccaggtt ccgcaaaacg tcctctcttt actggttccg
720cggggttctc atcatcatca tcatcatggt taa 753150250PRTArtificial
SequenceSynthetic sequence 150Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Ala Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Ala
Gly Ala Asn Ala Asp Ala Ala Leu Lys Ala Ile65 70 75 80Gln Ala Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Gln 85 90 95Gln Thr
Gln Ala Ala Ala Val Lys Val Leu Ser Gln Asp Asn Ala Met 100 105
110Ala Ile Gln Val Gly Ala Asn Asp Gly Ala Ala Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Gln Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
250151846DNAArtificial SequenceSynthetic sequence 151taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctgcaga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac tgccggggct 300aacgctgatg ccgctctgaa
agctatccag gctgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctcagcagac tcaagctgcc gctgttaaag tcctgtctca ggacaacgca
420atggcaatcc aggttggtgc taacgatggt gccgctatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc tcaaatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 846152795DNAArtificial
SequenceSynthetic sequence 152taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctgcaga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
tgccggggct 300aacgctgatg ccgctctgaa agctatccag gctgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctcagcagac tcaagctgcc
gctgttaaag tcctgtctca ggacaacgca 420atggcaatcc aggttggtgc
taacgatggt gccgctatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcaa cggaagtttc tcaaatgtct 720aaagcgcaga ttctgcagca
ggctggtctg gttccgcggg gttctcatca tcatcatcat 780catggttaag tcgac
795153702DNAArtificial SequenceSynthetic sequence 153atgagcgggt
tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac 60cgcttcactt
ctaatatcaa aggtctgact caggcttccc gtaacgctgc agacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactgccggg gctaacgctg
atgccgctct gaaagctatc 240caggctgaaa ttcagcaacg tctggaagaa
atcgatcgcg tttctcagca gactcaagct 300gccgctgtta aagtcctgtc
tcaggacaac gcaatggcaa tccaggttgg tgctaacgat 360ggtgccgcta
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aagtaccgct aacccactgg cttcaattga
ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg ggggcaattc
aaaaccgctt tgattcagcc 540attaccaacc ttggcaatac ggtaaccaat
ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg caacggaagt
ttctcaaatg tctaaagcgc agattctgca gcaggctggt 660ctggttccgc
ggggttctca tcatcatcat catcatggtt aa 702154233PRTArtificial
SequenceSynthetic sequence 154Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Ala Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Ala
Gly Ala Asn Ala Asp Ala Ala Leu Lys Ala Ile65 70 75 80Gln Ala Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Gln 85 90 95Gln Thr
Gln Ala Ala Ala Val Lys Val Leu Ser Gln Asp Asn Ala Met 100 105
110Ala Ile Gln Val Gly Ala Asn Asp Gly Ala Ala Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Gln Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Leu Val Pro Arg 210 215 220Gly
Ser His His His His His His Gly225 230155990DNAArtificial
SequenceSynthetic sequence 155atgcggggtt ctcatcatca tcatcatcat
ggtatggcta gcatgactgg tggacagcaa 60atgggtcggg atctgtacga cgatgacgat
aaggatccga tggcacaagt cattaataca 120aacagcctgt cgctgttgac
ccagaataac ctgcagaaat ctcagtcctc actgagttcc 180gctattgagc
gtctgtcctc tggtctgcgt atcaacagcg cgaaagacga tgcggcaggc
240caggcgattg ctaaccgctt cacttctaat atcaaaggtc tgactcaggc
ttcccgtaac 300gctaacgacg gcatttctat tgcgcagacc actgaaggtg
cgctgaatga aatcaacaac 360aacctgcagc gtgtgcgtga gttgtctgtt
caggccactc aagggactaa ctctgattcc 420gatctgaaat ctatccagga
tgaaattcag caacgtctgg aagaaatcga tcgcgtttct 480cagcagactc
aatttaacgg tgttaaagtc ctgtctcagg acaaccagat gaaaatccag
540gttggtgcta acgatggtga aaccattacc atcgatctgc aaaaaattga
tgtgaaaagc 600cttggccttg atgggttcaa tgttaattcc ccgggaattt
ccggtggtgg tggtggaatt 660ctagactcca tgggtacatt aatcaatgaa
gacgctgccg cagccaagaa aagtaccgct 720aacccactgg cttcaattga
ttctgcattg tcaaaagtgg acgcagttcg ttcttctctg 780ggggcaattc
aaaaccgttt tgattcagcc attaccaacc ttggcaatac ggtaaccaat
840ctgaactccg cgcgtagccg tatcgaagat gctgactatg caacggaagt
ttctcaaatg 900tctaaagcgc agattctgca gcaggctggt acttccgttc
tggcgcaggc taaccaggtt 960ccgcaaaacg tcctctcttt actgcgttaa
990156180DNAArtificial SequenceSynthetic sequence 156aacccactgg
cttcaattga ttctgcattg tcaaaagtgg acgcagttcg ttcttctctg 60ggggcaattc
aaaaccgttt tgattcagcc attaccgccc ttggcgctac ggtaaccgct
120ctggcctccg cgcgtagcgc tatcgaagat gctgactatg caacggaagt
ttctcaaatg 18015760PRTArtificial SequenceSynthetic sequence 157Asn
Pro Leu Ala Ser Ile Asp Ser Ala Leu Ser Lys Val Asp Ala Val1 5 10
15Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser Ala Ile Thr
20 25 30Ala Leu Gly Ala Thr Val Thr Ala Leu Ala Ser Ala Arg Ser Ala
Ile 35 40 45Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met 50 55
6015850DNAArtificial SequenceSynthetic sequence 158gcagttcgtt
cttctctggg ggcaattgat tcagccatta ccgcccttgg 5015950DNAArtificial
SequenceSynthetic sequence 159ccaagggcgg taatggctga atcaattgcc
cccagagaag aacgaactgc 501601066DNAArtificial SequenceSynthetic
sequence 160taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaaataattt 60tgtttaactt taagaaggag atatacatat gcggggttct catcatcatc
atcatcatgg 120tatggctagc atgactggtg gacagcaaat gggtcgggat
ctgtacgacg atgacgataa 180ggatccgatg gcacaagtca ttaatacaaa
cagcctgtcg ctgttgaccc agaataacct 240gaacaaatct cagtcctcac
tgagttccgc tattgagcgt ctgtcctctg gtctgcgtat 300caacagcgcg
aaagacgatg cggcaggcca ggcgattgct aaccgcttca cttctaatat
360caaaggtctg actcaggctt cccgtaacgc taacgacggc atttctattg
cgcagaccac 420tgaaggtgcg ctgaatgaaa tcaacaacaa cctgcagcgt
gtgcgtgagt tgtctgttca 480ggccactaac gggactaact ctgattccga
tctgaaatct atccaggatg aaattcagca 540acgtctggaa gaaatcgatc
gcgtttctaa tcagactcaa tttaacggtg ttaaagtcct 600gtctcaggac
aaccagatga aaatccaggt tggtgctaac gatggtgaaa ccattaccat
660cgatctgcaa aaaattgatg tgaaaagcct tggccttgat gggttcaatg
ttaattcccc 720gggaatttcc ggtggtggtg gtggaattct agactccatg
ggtacattaa tcaatgaaga 780cgctgccgca gccaagaaaa gtaccgctaa
cccactggct tcaattgatt ctgcattgtc 840aaaagtggac gcagttcgtt
cttctctggg ggcaattgat tcagccatta ccgcccttgg 900cgctacggta
accgctctgg cctccgcggc tagccgtatc gaagatgctg actatgcaac
960ggaagtttct aatatgtcta aagcgcagat tctgcagcag gctggtactt
ccgttctggc 1020gcaggctaac caggttccgc aaaacgtcct ctctttactg cgttaa
1066161325PRTArtificial SequenceSynthetic sequence 161Met Arg Gly
Ser His His His His His His Gly Met Ala Ser Met Thr1 5
10 15Gly Gly Gln Gln Met Gly Arg Asp Leu Tyr Asp Asp Asp Asp Lys
Asp 20 25 30Pro Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu
Thr Gln 35 40 45Asn Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser Ala
Ile Glu Arg 50 55 60Leu Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp
Asp Ala Ala Gly65 70 75 80Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn
Ile Lys Gly Leu Thr Gln 85 90 95Ala Ser Arg Asn Ala Asn Asp Gly Ile
Ser Ile Ala Gln Thr Thr Glu 100 105 110Gly Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu 115 120 125Ser Val Gln Ala Thr
Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser 130 135 140Ile Gln Asp
Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser145 150 155
160Asn Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln
165 170 175Met Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr
Ile Asp 180 185 190Leu Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp
Gly Phe Asn Val 195 200 205Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly
Gly Ile Leu Asp Ser Met 210 215 220Gly Thr Leu Ile Asn Glu Asp Ala
Ala Ala Ala Lys Lys Ser Thr Ala225 230 235 240Asn Pro Leu Ala Ser
Ile Asp Ser Ala Leu Ser Lys Val Asp Ala Val 245 250 255Arg Ser Ser
Leu Gly Ala Ile Asp Ser Ala Ile Thr Ala Leu Gly Ala 260 265 270Thr
Val Thr Ala Leu Ala Ser Ala Ala Ser Arg Ile Glu Asp Ala Asp 275 280
285Tyr Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln Ile Leu Gln Gln
290 295 300Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro Gln
Asn Val305 310 315 320Leu Ser Leu Leu Arg 325162180DNAArtificial
SequenceSynthetic sequence 162aacccactgg cttcaattga ttctgcattg
tcaaaagtgg acgcagttcg ttcttctctg 60ggggcaattg caaaggcttt tgattcagcc
attaccgccc ttggcgctac ggtaaccgct 120ctggcctccg cgcgtagcgc
tatcgaagat gctgactatg caacggaagt ttctcaaatg 18016360PRTArtificial
SequenceSynthetic sequence 163Asn Pro Leu Ala Ser Ile Asp Ser Ala
Leu Ser Lys Val Asp Ala Val1 5 10 15Arg Ser Ser Leu Gly Ala Ile Ala
Lys Ala Phe Asp Ser Ala Ile Thr 20 25 30Ala Leu Gly Ala Thr Val Thr
Ala Leu Ala Ser Ala Arg Ser Ala Ile 35 40 45Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser Asn Met 50 55 6016450DNAArtificial
SequenceSynthetic sequence 164cgttcttctc tgggggcaat tgcaaaggct
tttgattcag ccattaccgc 5016550DNAArtificial SequenceSynthetic
sequence 165gcggtaatgg ctgaatcaaa agcctttgca attgccccca gagaagaacg
501661078DNAArtificial SequenceSynthetic sequence 166taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaaataattt 60tgtttaactt
taagaaggag atatacatat gcggggttct catcatcatc atcatcatgg
120tatggctagc atgactggtg gacagcaaat gggtcgggat ctgtacgacg
atgacgataa 180ggatccgatg gcacaagtca ttaatacaaa cagcctgtcg
ctgttgaccc agaataacct 240gaacaaatct cagtcctcac tgagttccgc
tattgagcgt ctgtcctctg gtctgcgtat 300caacagcgcg aaagacgatg
cggcaggcca ggcgattgct aaccgcttca cttctaatat 360caaaggtctg
actcaggctt cccgtaacgc taacgacggc atttctattg cgcagaccac
420tgaaggtgcg ctgaatgaaa tcaacaacaa cctgcagcgt gtgcgtgagt
tgtctgttca 480ggccactaac gggactaact ctgattccga tctgaaatct
atccaggatg aaattcagca 540acgtctggaa gaaatcgatc gcgtttctaa
tcagactcaa tttaacggtg ttaaagtcct 600gtctcaggac aaccagatga
aaatccaggt tggtgctaac gatggtgaaa ccattaccat 660cgatctgcaa
aaaattgatg tgaaaagcct tggccttgat gggttcaatg ttaattcccc
720gggaatttcc ggtggtggtg gtggaattct agactccatg ggtacattaa
tcaatgaaga 780cgctgccgca gccaagaaaa gtaccgctaa cccactggct
tcaattgatt ctgcattgtc 840aaaagtggac gcagttcgtt cttctctggg
ggcaattgca aaggcttttg attcagccat 900taccgccctt ggcgctacgg
taaccgctct ggcctccgcg gctagccgta tcgaagatgc 960tgactatgca
acggaagttt ctaatatgtc taaagcgcag attctgcagc aggctggtac
1020ttccgttctg gcgcaggcta accaggttcc gcaaaacgtc ctctctttac tgcgttaa
1078167329PRTArtificial SequenceSynthetic sequence 167Met Arg Gly
Ser His His His His His His Gly Met Ala Ser Met Thr1 5 10 15Gly Gly
Gln Gln Met Gly Arg Asp Leu Tyr Asp Asp Asp Asp Lys Asp 20 25 30Pro
Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln 35 40
45Asn Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile Glu Arg
50 55 60Leu Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala
Gly65 70 75 80Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly
Leu Thr Gln 85 90 95Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala
Gln Thr Thr Glu 100 105 110Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu
Gln Arg Val Arg Glu Leu 115 120 125Ser Val Gln Ala Thr Asn Gly Thr
Asn Ser Asp Ser Asp Leu Lys Ser 130 135 140Ile Gln Asp Glu Ile Gln
Gln Arg Leu Glu Glu Ile Asp Arg Val Ser145 150 155 160Asn Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln 165 170 175Met
Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp 180 185
190Leu Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn Val
195 200 205Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly Ile Leu Asp
Ser Met 210 215 220Gly Thr Leu Ile Asn Glu Asp Ala Ala Ala Ala Lys
Lys Ser Thr Ala225 230 235 240Asn Pro Leu Ala Ser Ile Asp Ser Ala
Leu Ser Lys Val Asp Ala Val 245 250 255Arg Ser Ser Leu Gly Ala Ile
Ala Lys Ala Phe Asp Ser Ala Ile Thr 260 265 270Ala Leu Gly Ala Thr
Val Thr Ala Leu Ala Ser Ala Ala Ser Arg Ile 275 280 285Glu Asp Ala
Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln 290 295 300Ile
Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val305 310
315 320Pro Gln Asn Val Leu Ser Leu Leu Arg 325168903DNAArtificial
SequenceSynthetic sequence 168atgcggggtt ctcatcatca tcatcatcat
ggtatggcta gcatgactgg tggacagcaa 60atgggtcggg atctgtacga cctggttccg
cgcggtagcg cgaaggatcc gtctggtctg 120cgtatcaaca gcgcgaaaga
cgatgcggca ggccaggcga ttgctaaccg cttcacttct 180aatatcaaag
gtctgactca ggcttcccgt aacgctgcag acggcatttc tattgcgcag
240accactgaag gtgcgctgaa tgaaatcaac aacaacctgc agcgtgtgcg
tgagttgtct 300gttcaggcca ctaacgggac taactctgat tccgatctga
aatctatcca ggatgaaatt 360cagcaacgtc tggaagaaat cgatcgcgtt
tctaatcaga ctcaagctaa cggtgttaaa 420gtcctgtctc aggacaacgc
aatgaaaatc caggttggtg ctaacgatgg tgccgctatt 480accatcgatc
tgcaaaaaat tgatgtgaaa agccttggcc ttgatgggtt caatgttaat
540tccccgggaa tttccggtgg tggtggtgga attctagact ccatgggtac
attaatcaat 600gaagacgctg ccgcagccaa gaaaagtacc gctaacccac
tggcttcaat tgattctgca 660ttgtcaaaag tggacgcagt tcgttcttct
ctgggggcaa ttcaagctcg ttttgccgcg 720gccattgcta accttggcaa
tacggtaacc aatctgaact ccgcgcgtag ccgtatcgaa 780gatgctgact
atgcaacgga agtttctaat atgtctaaag cgcagattct gcagcaggct
840ggtacttccg ttctggcgca ggctaaccag gttccgcaaa acgtcctctc
tttactgcgt 900taa 903169300PRTArtificial SequenceSynthetic sequence
169Met Arg Gly Ser His His His His His His Gly Met Ala Ser Met Thr1
5 10 15Gly Gly Gln Gln Met Gly Arg Asp Leu Tyr Asp Leu Val Pro Arg
Gly 20 25 30Ser Ala Lys Asp Pro Ser Gly Leu Arg Ile Asn Ser Ala Lys
Asp Asp 35 40 45Ala Ala Gly Gln Ala Ile Ala Asn Arg Phe Thr Ser Asn
Ile Lys Gly 50 55 60Leu Thr Gln Ala Ser Arg Asn Ala Ala Asp Gly Ile
Ser Ile Ala Gln65 70 75 80Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val 85 90 95Arg Glu Leu Ser Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp 100 105 110Leu Lys Ser Ile Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp 115 120 125Arg Val Ser Asn Gln
Thr Gln Ala Asn Gly Val Lys Val Leu Ser Gln 130 135 140Asp Asn Ala
Met Lys Ile Gln Val Gly Ala Asn Asp Gly Ala Ala Ile145 150 155
160Thr Ile Asp Leu Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly
165 170 175Phe Asn Val Asn Ser Pro Gly Ile Ser Gly Gly Gly Gly Gly
Ile Leu 180 185 190Asp Ser Met Gly Thr Leu Ile Asn Glu Asp Ala Ala
Ala Ala Lys Lys 195 200 205Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp
Ser Ala Leu Ser Lys Val 210 215 220Asp Ala Val Arg Ser Ser Leu Gly
Ala Ile Gln Ala Arg Phe Ala Ala225 230 235 240Ala Ile Ala Asn Leu
Gly Asn Thr Val Thr Asn Leu Asn Ser Ala Arg 245 250 255Ser Arg Ile
Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met Ser 260 265 270Lys
Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala 275 280
285Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Arg 290 295
300170996DNAArtificial SequenceSynthetic sequence 170taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg cggggttctc atcatcatca tcatcatggt
120atggctagca tgactggtgg acagcaaatg ggtcgggatc tgtacgacct
ggttccgcgc 180ggtagcgcga aggatccgtc tggtctgcgt atcaacagcg
cgaaagacga tgcggcaggc 240caggcgattg ctaaccgctt cacttctaat
atcaaaggtc tgactcaggc ttcccgtaac 300gctgcagacg gcatttctat
tgcgcagacc actgaaggtg cgctgaatga aatcaacaac 360aacctgcagc
gtgtgcgtga gttgtctgtt caggccacta acgggactaa ctctgattcc
420gatctgaaat ctatccagga tgaaattcag caacgtctgg aagaaatcga
tcgcgtttct 480aatcagactc aagctaacgg tgttaaagtc ctgtctcagg
acaacgcaat gaaaatccag 540gttggtgcta acgatggtgc cgctattacc
atcgatctgc aaaaaattga tgtgaaaagc 600cttggccttg atgggttcaa
tgttaattcc ccgggaattt ccggtggtgg tggtggaatt 660ctagactcca
tgggtacatt aatcaatgaa gacgctgccg cagccaagaa aagtaccgct
720aacccactgg cttcaattga ttctgcattg tcaaaagtgg acgcagttcg
ttcttctctg 780ggggcaattc aagctcgttt tgccgcggcc attgctaacc
ttggcaatac ggtaaccaat 840ctgaactccg cgcgtagccg tatcgaagat
gctgactatg caacggaagt ttctaatatg 900tctaaagcgc agattctgca
gcaggctggt acttccgttc tggcgcaggc taaccaggtt 960ccgcaaaacg
tcctctcttt actgcgttaa gtcgac 99617179DNAArtificial
SequenceSynthetic sequence 171agatctgtcg acttaaccat gatgatgatg
atgatgagaa ccccgcggaa ccagtaaaga 60gaggacgttt tgcggaacc
79172846DNAArtificial SequenceSynthetic sequence 172taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaag ctcgttttgc
cgcggccatt gctaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 846173250PRTArtificial
SequenceSynthetic sequence 173Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Ala Arg 165 170 175Phe Ala Ala Ala Ile Ala Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25017447DNAArtificial SequenceSynthetic sequence 174agatctcata
tgagcgggtt acggatcaac agcgcgaaag acgatgc 47175846DNAArtificial
SequenceSynthetic sequence 175taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctgcaga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 300aactctgatt ccgatctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctaatcagac tcaagctaac
ggtgttaaag tcctgtctca ggacaacgca 420atgaaaatcc aggttggtgc
taacgatggt gccgctatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcaa cggaagtttc taatatgtct 720aaagcgcaga ttctgcagca
ggctggtact tccgttctgg cgcaggctaa ccaggttccg 780caaaacgtcc
tctctttact ggttccgcgg ggttctcatc atcatcatca tcatggttaa 840gtcgac
846176250PRTArtificial SequenceSynthetic sequence 176Met Ser Gly
Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile
Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser
Arg Asn Ala Ala Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40
45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser
50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser
Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg
Val Ser Asn 85 90 95Gln Thr Gln Ala Asn Gly Val Lys Val Leu Ser Gln
Asp Asn Ala Met 100 105 110Lys Ile Gln Val Gly Ala Asn Asp Gly Ala
Ala Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val Lys Ser Leu
Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly Ser Thr Ala
Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155 160Ser Lys Val
Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe
Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185
190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser
195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser
Val Leu 210 215 220Ala Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser
Leu Leu Val Pro225 230 235 240Arg Gly Ser His His His His
His His Gly 245 250177270DNAArtificial SequenceSynthetic sequence
177aacccactgg cttcaattga ttctgcattg tcaaaagtgg acgcagttcg
ttcttctctg 60ggggcaattc aaaaccgttt tgattcagcc attaccaacc ttggcaatac
ggtaaccaat 120ctgaactccg cgcgtagccg tatcgaagat gctgactatg
caacggaagt ttctcaaatg 180tctaaagcgc agattctgca gcaggctggt
acttccgttc tggcgcaggc taaccaggtt 240ccgcaaaacg tcctctcttt
actgcgttaa 27017860DNAArtificial SequenceSynthetic sequence
178attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 6017920PRTArtificial SequenceSynthetic sequence 179Ile
Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn Ser Ala Arg Ser1 5 10
15Arg Ile Glu Asp 2018046DNAArtificial SequenceSynthetic sequence
180ccttggcaat acggtaaccg ctctggcctc cgcgcgtagc cgtatc
4618146DNAArtificial SequenceSynthetic sequence 181gatacggcta
cgcgcggagg ccagagcggt taccgtattg ccaagg 4618260DNAArtificial
SequenceSynthetic sequence 182acggtaaccg ctctggcctc cgcgcgtagc
cgtatcgaag atgctgacta tgcaacggaa 6018320PRTArtificial
SequenceSynthetic sequence 183Thr Val Thr Ala Leu Ala Ser Ala Arg
Ser Arg Ile Glu Asp Ala Asp1 5 10 15Tyr Ala Thr Glu
2018434DNAArtificial SequenceSynthetic sequence 184gctctggcct
ccgcggctag ccgtatcgaa gatg 3418534DNAArtificial SequenceSynthetic
sequence 185catcttcgat acggctagcc gcggaggcca gagc
3418660DNAArtificial SequenceSynthetic sequence 186caaaaccgtt
ttgattcagc cattaccaac cttggcaata cggtaaccgc tctggcctcc
6018720PRTArtificial SequenceSynthetic sequence 187Gln Asn Arg Phe
Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr1 5 10 15Ala Leu Ala
Ser 2018848DNAArtificial SequenceSynthetic sequence 188gttttgattc
agccattacc gcccttggcg ctacggtaac cgctctgg 4818948DNAArtificial
SequenceSynthetic sequence 189ccagagcggt taccgtagcg ccaagggcgg
taatggctga atcaaaac 4819039DNAArtificial SequenceSynthetic sequence
190caacagcgcg aaagccgatg cgggaggcca ggcgattgc 3919139DNAArtificial
SequenceSynthetic sequence 191gcaatcgcct ggcctcccgc atcggctttc
gcgctgttg 39192846DNAArtificial SequenceSynthetic sequence
192taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagcc 120gatgcgggag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac taacgggact 300aactctgatt
ccgatctgaa atctatccag gatgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcaa cggaagtttc
taatatgtct 720aaagcgcaga ttctgcagca ggctggtact tccgttctgg
cgcaggctaa ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg
ggttctcatc atcatcatca tcatggttaa 840gtcgac 846193250PRTArtificial
SequenceSynthetic sequence 193Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Ala Asp Ala Gly Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25019443DNAArtificial SequenceSynthetic sequence 194gtctgttcag
gccactgccg gggctaactc tgattccgat ctg 4319543DNAArtificial
SequenceSynthetic sequence 195cagatcggaa tcagagttag ccccggcagt
ggcctgaaca gac 43196846DNAArtificial SequenceSynthetic sequence
196taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac tgccggggct 300aactctgatt
ccgatctgaa atctatccag gatgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcaa cggaagtttc
taatatgtct 720aaagcgcaga ttctgcagca ggctggtact tccgttctgg
cgcaggctaa ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg
ggttctcatc atcatcatca tcatggttaa 840gtcgac 846197250PRTArtificial
SequenceSynthetic sequence 197Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Ala
Gly Ala Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25019845DNAArtificial SequenceSynthetic sequence 198ctgattccga
tctgaaagct atccaggctg aaattcagca acgtc 4519945DNAArtificial
SequenceSynthetic sequence 199gacgttgctg aatttcagcc tggatagctt
tcagatcgga atcag 45200846DNAArtificial SequenceSynthetic sequence
200taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac tgccggggct 300aactctgatt
ccgatctgaa agctatccag gctgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcaa cggaagtttc
taatatgtct 720aaagcgcaga ttctgcagca ggctggtact tccgttctgg
cgcaggctaa ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg
ggttctcatc atcatcatca tcatggttaa 840gtcgac 846201753DNAArtificial
SequenceSynthetic sequence 201atgagcgggt tacggatcaa cagcgcgaaa
gacgatgcgg caggccaggc gattgctaac 60cgcttcactt ctaatatcaa aggtctgact
caggcttccc gtaacgctaa cgacggcatt 120tctattgcgc agaccactga
aggtgcgctg aatgaaatca acaacaacct gcagcgtgtg 180cgtgagttgt
ctgttcaggc cactgccggg gctaactctg attccgatct gaaagctatc
240caggctgaaa ttcagcaacg tctggaagaa atcgatcgcg tttctaatca
gactcaattt 300aacggtgtta aagtcctgtc tcaggacaac cagatgaaaa
tccaggttgg tgctaacgat 360ggtgaaacca ttaccatcga tctgcaaaaa
attgatgtga aaagccttgg ccttgatggg 420ttcaatgtta attccccggg
aagtaccgct aacccactgg cttcaattga ttctgcattg 480tcaaaagtgg
acgcagttcg ttcttctctg ggggcaattc aaaaccgctt tgattcagcc
540attaccaacc ttggcaatac ggtaaccaat ctgaactccg cgcgtagccg
tatcgaagat 600gctgactatg caacggaagt ttctaatatg tctaaagcgc
agattctgca gcaggctggt 660acttccgttc tggcgcaggc taaccaggtt
ccgcaaaacg tcctctcttt actggttccg 720cggggttctc atcatcatca
tcatcatggt taa 753202250PRTArtificial SequenceSynthetic sequence
202Met Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1
5 10 15Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln
Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ser 50 55 60Val Gln Ala Thr Ala Gly Ala Asn Ser Asp Ser Asp
Leu Lys Ala Ile65 70 75 80Gln Ala Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser 195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu 210 215 220Ala Gln Ala Asn Gln Val Pro Gln
Asn Val Leu Ser Leu Leu Val Pro225 230 235 240Arg Gly Ser His His
His His His His Gly 245 25020345DNAArtificial SequenceSynthetic
sequence 203gccactaacg ggactaacgc tgatgccgct ctgaaatcta tccag
4520445DNAArtificial SequenceSynthetic sequence 204ctggatagat
ttcagagcgg catcagcgtt agtcccgtta gtggc 45205846DNAArtificial
SequenceSynthetic sequence 205taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 300aacgctgatg ccgctctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 420atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcaa cggaagtttc taatatgtct 720aaagcgcaga ttctgcagca
ggctggtact tccgttctgg cgcaggctaa ccaggttccg 780caaaacgtcc
tctctttact ggttccgcgg ggttctcatc atcatcatca tcatggttaa 840gtcgac
846206250PRTArtificial SequenceSynthetic sequence 206Met Ser Gly
Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile
Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser
Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40
45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser
50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ala Asp Ala Ala Leu Lys Ser
Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg
Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln
Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu
Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val Lys Ser Leu
Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly Ser Thr Ala
Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155 160Ser Lys Val
Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe
Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185
190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser
195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser
Val Leu 210 215 220Ala Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser
Leu Leu Val Pro225 230 235 240Arg Gly Ser His His His His His His
Gly 245 25020745DNAArtificial SequenceSynthetic sequence
207gccactgccg gggctaacgc tgatgccgct ctgaaagcta tccag
4520845DNAArtificial SequenceSynthetic sequence 208ctggatagct
ttcagagcgg catcagcgtt agccccggca gtggc 45209846DNAArtificial
SequenceSynthetic sequence 209taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
tgccggggct 300aacgctgatg ccgctctgaa agctatccag gctgaaattc
agcaacgtct ggaagaaatc 360gatcgcgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 420atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcaa cggaagtttc taatatgtct 720aaagcgcaga ttctgcagca
ggctggtact tccgttctgg cgcaggctaa ccaggttccg 780caaaacgtcc
tctctttact ggttccgcgg ggttctcatc atcatcatca tcatggttaa 840gtcgac
846210250PRTArtificial SequenceSynthetic sequence 210Met Ser Gly
Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile
Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser
Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40
45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser
50 55 60Val Gln Ala Thr Ala Gly Ala Asn Ala Asp Ala Ala
Leu Lys Ala Ile65 70 75 80Gln Ala Glu Ile Gln Gln Arg Leu Glu Glu
Ile Asp Arg Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ser Gln Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn
Asp Gly Glu Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val
Lys Ser Leu Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly
Ser Thr Ala Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155
160Ser Lys Val Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg
165 170 175Phe Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn
Leu Asn 180 185 190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala
Thr Glu Val Ser 195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu 210 215 220Ala Gln Ala Asn Gln Val Pro Gln
Asn Val Leu Ser Leu Leu Val Pro225 230 235 240Arg Gly Ser His His
His His His His Gly 245 250211846DNAArtificial SequenceSynthetic
sequence 211taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac taacgggact 300aactctgatt
ccgatctgaa agctatccag gctgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcaa cggaagtttc
taatatgtct 720aaagcgcaga ttctgcagca ggctggtact tccgttctgg
cgcaggctaa ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg
ggttctcatc atcatcatca tcatggttaa 840gtcgac 846212250PRTArtificial
SequenceSynthetic sequence 212Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ala Ile65 70 75 80Gln Ala Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25021345DNAArtificial SequenceSynthetic sequence 213ctatccagga
tgaaattcag gcacgtctgg cagaaatcga tcgcg 4521445DNAArtificial
SequenceSynthetic sequence 214cgcgatcgat ttctgccaga cgtgcctgaa
tttcatcctg gatag 45215846DNAArtificial SequenceSynthetic sequence
215taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac taacgggact 300aactctgatt
ccgatctgaa atctatccag gatgaaattc aggcacgtct ggcagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaaccag 420atgaaaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcaa cggaagtttc
taatatgtct 720aaagcgcaga ttctgcagca ggctggtact tccgttctgg
cgcaggctaa ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg
ggttctcatc atcatcatca tcatggttaa 840gtcgac 846216250PRTArtificial
SequenceSynthetic sequence 216Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Ala Arg Leu Ala Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25021759DNAArtificial SequenceSynthetic sequence 217ggaagaaatc
gatgccgttt ctgctgcgac tcaatttaac ggtgttaaag tcctgtctc
5921859DNAArtificial SequenceSynthetic sequence 218gagacaggac
tttaacaccg ttaaattgag tcgcagcaga aacggcatcg atttcttcc
59219846DNAArtificial SequenceSynthetic sequence 219taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatgccgttt
ctgctgcgac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 846220250PRTArtificial
SequenceSynthetic sequence 220Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Ala Val Ser Ala 85 90 95Ala Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25022153DNAArtificial SequenceSynthetic sequence 221cagcaacgtc
tggaagaaat cgatgccgtt tctaatcaga ctcaatttaa cgg
5322253DNAArtificial SequenceSynthetic sequence 222ccgttaaatt
gagtctgatt agaaacggca tcgatttctt ccagacgttg ctg
53223753DNAArtificial SequenceSynthetic sequence 223atgagcgggt
tacggatcaa cagcgcgaaa gacgatgcgg caggccaggc gattgctaac 60cgcttcactt
ctaatatcaa aggtctgact caggcttccc gtaacgctaa cgacggcatt
120tctattgcgc agaccactga aggtgcgctg aatgaaatca acaacaacct
gcagcgtgtg 180cgtgagttgt ctgttcaggc cactaacggg actaactctg
attccgatct gaaatctatc 240caggatgaaa ttcagcaacg tctggaagaa
atcgatgccg tttctaatca gactcaattt 300aacggtgtta aagtcctgtc
tcaggacaac cagatgaaaa tccaggttgg tgctaacgat 360ggtgaaacca
ttaccatcga tctgcaaaaa attgatgtga aaagccttgg ccttgatggg
420ttcaatgtta attccccggg aagtaccgct aacccactgg cttcaattga
ttctgcattg 480tcaaaagtgg acgcagttcg ttcttctctg ggggcaattc
aaaaccgctt tgattcagcc 540attaccaacc ttggcaatac ggtaaccaat
ctgaactccg cgcgtagccg tatcgaagat 600gctgactatg caacggaagt
ttctaatatg tctaaagcgc agattctgca gcaggctggt 660acttccgttc
tggcgcaggc taaccaggtt ccgcaaaacg tcctctcttt actggttccg
720cggggttctc atcatcatca tcatcatggt taa 753224846DNAArtificial
SequenceSynthetic sequence 224taatacgact cactataggg gaattgtgag
cggataacaa ttcccctcta gaataatttt 60gtttaacttt aagaaggaga tatacatatg
agcgggttac ggatcaacag cgcgaaagac 120gatgcggcag gccaggcgat
tgctaaccgc ttcacttcta atatcaaagg tctgactcag 180gcttcccgta
acgctaacga cggcatttct attgcgcaga ccactgaagg tgcgctgaat
240gaaatcaaca acaacctgca gcgtgtgcgt gagttgtctg ttcaggccac
taacgggact 300aactctgatt ccgatctgaa atctatccag gatgaaattc
agcaacgtct ggaagaaatc 360gatgccgttt ctaatcagac tcaatttaac
ggtgttaaag tcctgtctca ggacaaccag 420atgaaaatcc aggttggtgc
taacgatggt gaaaccatta ccatcgatct gcaaaaaatt 480gatgtgaaaa
gccttggcct tgatgggttc aatgttaatt ccccgggaag taccgctaac
540ccactggctt caattgattc tgcattgtca aaagtggacg cagttcgttc
ttctctgggg 600gcaattcaaa accgctttga ttcagccatt accaaccttg
gcaatacggt aaccaatctg 660aactccgcgc gtagccgtat cgaagatgct
gactatgcaa cggaagtttc taatatgtct 720aaagcgcaga ttctgcagca
ggctggtact tccgttctgg cgcaggctaa ccaggttccg 780caaaacgtcc
tctctttact ggttccgcgg ggttctcatc atcatcatca tcatggttaa 840gtcgac
846225250PRTArtificial SequenceSynthetic sequence 225Met Ser Gly
Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile
Ala Asn Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser
Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40
45Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ser
50 55 60Val Gln Ala Thr Asn Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser
Ile65 70 75 80Gln Asp Glu Ile Gln Gln Arg Leu Glu Glu Ile Asp Ala
Val Ser Asn 85 90 95Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln
Asp Asn Gln Met 100 105 110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu
Thr Ile Thr Ile Asp Leu 115 120 125Gln Lys Ile Asp Val Lys Ser Leu
Gly Leu Asp Gly Phe Asn Val Asn 130 135 140Ser Pro Gly Ser Thr Ala
Asn Pro Leu Ala Ser Ile Asp Ser Ala Leu145 150 155 160Ser Lys Val
Asp Ala Val Arg Ser Ser Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe
Asp Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185
190Ser Ala Arg Ser Arg Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser
195 200 205Asn Met Ser Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser
Val Leu 210 215 220Ala Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser
Leu Leu Val Pro225 230 235 240Arg Gly Ser His His His His His His
Gly 245 25022653DNAArtificial SequenceSynthetic sequence
226cgtttctaat cagactcaat ttgccgctgt taaagtcctg tctcaggaca acc
5322753DNAArtificial SequenceSynthetic sequence 227ggttgtcctg
agacaggact ttaacagcgg caaattgagt ctgattagaa acg
53228846DNAArtificial SequenceSynthetic sequence 228taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttgcc gctgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 846229250PRTArtificial
SequenceSynthetic sequence 229Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Ala Ala Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210
215 220Ala Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val
Pro225 230 235 240Arg Gly Ser His His His His His His Gly 245
25023052DNAArtificial SequenceSynthetic sequence 230gttaaagtcc
tgtctcagga caacgcgatg gcaatccagg ttggtgctaa cg 5223152DNAArtificial
SequenceSynthetic sequence 231cgttagcacc aacctggatt gccatcgcgt
tgtcctgaga caggacttta ac 52232846DNAArtificial SequenceSynthetic
sequence 232taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta
gaataatttt 60gtttaacttt aagaaggaga tatacatatg agcgggttac ggatcaacag
cgcgaaagac 120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta
atatcaaagg tctgactcag 180gcttcccgta acgctaacga cggcatttct
attgcgcaga ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca
gcgtgtgcgt gagttgtctg ttcaggccac taacgggact 300aactctgatt
ccgatctgaa atctatccag gatgaaattc agcaacgtct ggaagaaatc
360gatcgcgttt ctaatcagac tcaatttaac ggtgttaaag tcctgtctca
ggacaacgcg 420atggcaatcc aggttggtgc taacgatggt gaaaccatta
ccatcgatct gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc
aatgttaatt ccccgggaag taccgctaac 540ccactggctt caattgattc
tgcattgtca aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa
accgctttga ttcagccatt accaaccttg gcaatacggt aaccaatctg
660aactccgcgc gtagccgtat cgaagatgct gactatgcaa cggaagtttc
taatatgtct 720aaagcgcaga ttctgcagca ggctggtact tccgttctgg
cgcaggctaa ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg
ggttctcatc atcatcatca tcatggttaa 840gtcgac 846233250PRTArtificial
SequenceSynthetic sequence 233Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Ala Met 100 105
110Ala Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25023453DNAArtificial SequenceSynthetic sequence 234gatgaaaatc
caggttggtg ctagcgctgc tgaaaccatt accatcgatc tgc
5323553DNAArtificial SequenceSynthetic sequence 235gcagatcgat
ggtaatggtt tcagcagcgc tagcaccaac ctggattttc atc
53236846DNAArtificial SequenceSynthetic sequence 236taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc tagcgctgct gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gactatgcaa cggaagtttc taatatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 846237250PRTArtificial
SequenceSynthetic sequence 237Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Ser Ala Ala Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Tyr Ala Thr Glu Val Ser 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
25023856DNAArtificial SequenceSynthetic sequence 238gccgtatcga
agatgctgac gctggagcgg aagttgctaa tatgtctaaa gcgcag
5623956DNAArtificial SequenceSynthetic sequence 239ctgcgcttta
gacatattag caacttccgc tccagcgtca gcatcttcga tacggc
56240846DNAArtificial SequenceSynthetic sequence 240taatacgact
cactataggg gaattgtgag cggataacaa ttcccctcta gaataatttt 60gtttaacttt
aagaaggaga tatacatatg agcgggttac ggatcaacag cgcgaaagac
120gatgcggcag gccaggcgat tgctaaccgc ttcacttcta atatcaaagg
tctgactcag 180gcttcccgta acgctaacga cggcatttct attgcgcaga
ccactgaagg tgcgctgaat 240gaaatcaaca acaacctgca gcgtgtgcgt
gagttgtctg ttcaggccac taacgggact 300aactctgatt ccgatctgaa
atctatccag gatgaaattc agcaacgtct ggaagaaatc 360gatcgcgttt
ctaatcagac tcaatttaac ggtgttaaag tcctgtctca ggacaaccag
420atgaaaatcc aggttggtgc taacgatggt gaaaccatta ccatcgatct
gcaaaaaatt 480gatgtgaaaa gccttggcct tgatgggttc aatgttaatt
ccccgggaag taccgctaac 540ccactggctt caattgattc tgcattgtca
aaagtggacg cagttcgttc ttctctgggg 600gcaattcaaa accgctttga
ttcagccatt accaaccttg gcaatacggt aaccaatctg 660aactccgcgc
gtagccgtat cgaagatgct gacgctggag cggaagttgc taatatgtct
720aaagcgcaga ttctgcagca ggctggtact tccgttctgg cgcaggctaa
ccaggttccg 780caaaacgtcc tctctttact ggttccgcgg ggttctcatc
atcatcatca tcatggttaa 840gtcgac 846241250PRTArtificial
SequenceSynthetic sequence 241Met Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln1 5 10 15Ala Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala 20 25 30Ser Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly 35 40 45Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 50 55 60Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile65 70 75 80Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 85 90 95Gln Thr
Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 100 105
110Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp Leu
115 120 125Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly Phe Asn
Val Asn 130 135 140Ser Pro Gly Ser Thr Ala Asn Pro Leu Ala Ser Ile
Asp Ser Ala Leu145 150 155 160Ser Lys Val Asp Ala Val Arg Ser Ser
Leu Gly Ala Ile Gln Asn Arg 165 170 175Phe Asp Ser Ala Ile Thr Asn
Leu Gly Asn Thr Val Thr Asn Leu Asn 180 185 190Ser Ala Arg Ser Arg
Ile Glu Asp Ala Asp Ala Gly Ala Glu Val Ala 195 200 205Asn Met Ser
Lys Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 210 215 220Ala
Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Val Pro225 230
235 240Arg Gly Ser His His His His His His Gly 245
2502423PRTArtificial SequenceSynthetic sequence 242Ser Pro
Gly1243293PRTArtificial SequenceSynthetic sequence 243Met Gly His
His His His His His Ser Gly Met Glu Glu Phe Asn Met1 5 10 15Arg Ile
Asn Thr Asn Val Ala Ala Met Asn Thr Tyr Ser Arg Leu Thr 20 25 30Ala
Ala Asn Thr Ala Lys Ser Asn Ser Leu Ala Lys Leu Ser Ser Gly 35 40
45Leu Arg Ile Asn Lys Ala Gly Asp Asp Ala Ala Gly Leu Ala Ile Ser
50 55 60Glu Lys Met Lys Ser Gln Ile Gly Gly Leu Thr Gln Ala Lys Arg
Asn65 70 75 80Ala Gln Asp Gly Ile Ser Leu Val Gln Thr Ala Glu Gly
Ala Leu Asn 85 90 95Glu Thr His Ser Ile Leu Glu Arg Met Arg Asp Leu
Ala Val Gln Gly 100 105 110Ser Asn Gly Thr Leu Thr Ser Ser Asp Arg
Gly Ser Ile Asn Lys Glu 115 120 125Leu Lys Ala Leu His Gln Glu Leu
Thr Arg Ile Ser Asn Thr Thr Glu 130 135 140Phe Asn Thr Gln Lys Leu
Phe Ser Gln Thr Lys Gln Lys Ser Val Thr145 150 155 160Phe Thr Phe
Gln Ile Gly Ala Asn Ala Gly Gln Thr Leu Ser Val Ala 165 170 175Ile
Thr Ala Met Ser Gly Glu Ala Leu Leu Val Ser Thr Asp Ala Lys 180 185
190Phe Ser Leu Asn Ala Ala Gly Thr Asn Ala Gly Ala Met Ile Lys Ser
195 200 205Ile Asp Ala Ala Ile Ala Lys Val Ser Asp Gln Arg Ala Asp
Leu Gly 210 215 220Ala Val Gln Asn Arg Leu Glu His Thr Ile Asn Asn
Leu Thr Ala Thr225 230 235 240Asn Glu Asn Leu Ser Asp Ala Asn Ser
Arg Ile Arg Asp Val Asp Met 245 250 255Ala Glu Glu Met Met Thr Phe
Thr Lys Ser Asn Ile Leu Ser Gln Ala 260 265 270Ala Thr Ser Met Leu
Ala Gln Ala Asn Ala Met Pro Asn Ser Val Leu 275 280 285Asn Leu Leu
Gln Gly 290244280PRTArtificial SequenceSynthetic sequence 244Met
Gly His His His His His His Ser Gly Met Arg Ile Asn His Asn1 5 10
15Ile Ser Ala Leu Asn Ala Trp Arg Asn Ile Asp Gln Thr Gln Tyr Ser
20 25 30Met Ser Lys Thr Leu Glu Arg Leu Ser Ser Gly Leu Arg Ile Asn
Arg 35 40 45Ala Gly Asp Asp Ala Ala Gly Leu Ala Ile Ser Glu Lys Met
Arg Gly 50 55 60Gln Ile Lys Gly Leu Asn Met Ala Ile Lys Asn Ala Gln
Asp Ala Ile65 70 75 80Ser Leu Ile Gln Thr Ala Glu Gly Ala Leu Thr
Glu Val His Ser Ile 85 90 95Leu Gln Arg Met Arg Glu Leu Ala Val Gln
Ala Ala Ser Asp Thr Asn 100 105 110Thr Asn Val Asp Arg Glu Gln Ile
Gln Lys Glu Ile Asp Gln Leu Arg 115 120 125Glu Glu Ile Asp Arg Ile
Ala Arg Thr Thr Glu Phe Asn Thr Lys Lys 130 135 140Leu Leu Asp Gly
Lys Leu Glu Gly Phe Arg Ser Gln Val Asp Ala Lys145 150 155 160Val
Val Thr Gly Gly Asn Ile Asn Val Gln Leu Gly Thr Val Ser Ser 165 170
175Lys Ala Val Glu Gly Thr Tyr Val Ile Glu Val Gly Ala Ala Glu Arg
180 185 190Ala Ile Met Val Val Asp Ala Ala Ile His Arg Val Ser Thr
Ala Arg 195 200 205Ala Ala Leu Gly Ala Ile Gln Asn Arg Leu Glu His
Thr Ile Ser Asn 210 215 220Leu Gly Val Ala Ala Glu Asn Leu Thr Ala
Ala Glu Ser Arg Ile Arg225 230 235 240Asp Ala Asp Met Ala Lys Glu
Met Met Glu Phe Thr Lys Gln Gln Ile 245 250 255Leu Leu Gln Ser Ser
Met Ala Met Leu Ala Gln Ser Asn Thr Leu Pro 260 265 270Gln Asn Val
Leu Gln Leu Met Arg 275 280245168PRTArtificial SequenceSynthetic
sequence 245Met Gly His His His His His His Ser Gly Leu Asn Met Ala
Ile Lys1 5 10 15Asn Ala Gln Asp Ala Ile Ser Leu Ile Gln Thr Ala Glu
Gly Ala Leu 20 25 30Thr Glu Val His Ser Ile Leu Gln Arg Met Arg Glu
Leu Ala Val Gln 35 40 45Ala Ala Ser Asp Thr Asn Thr Asn Val Asp Arg
Glu Gln Ile Gln Lys 50 55 60Glu Ile Asp Gln Leu Arg Glu Glu Ile Asp
Arg Ile Ala Arg Thr Thr65 70 75 80Glu Phe Asn Thr Lys Lys Leu Leu
Asp Gly Lys Leu Glu Gly Phe Arg 85 90 95Ser Gln Val Asp Ala Lys Val
Val Thr Gly Gly Asn Ile Asn Val Gln 100 105 110Leu Gly Thr Val Ser
Ser Lys Ala Val Glu Gly Thr Tyr Val Ile Glu 115 120 125Val Gly Ala
Ala Glu Arg Ala Ile Met Val Val Asp Ala Ala Ile His 130 135 140Arg
Val Ser Thr Ala Arg Ala Ala Leu Gly Ala Ile Gln Asn Arg Leu145 150
155 160Glu His Thr Ile Ser Asn Leu Gly 165246285PRTArtificial
SequenceSynthetic sequence 246Met Gly His His His His His His Ser
Gly Met Ser Leu Arg Ile Asn1 5 10 15Asn Asn Ile Glu Ala Leu Asn Ala
Trp Arg Ala Leu Asn Ser Thr Ser 20 25 30Asn Ala Leu Gln Lys Ser Met
Glu Lys Leu Ser Ser Gly Leu Arg Ile 35 40 45Asn Arg Ala Gly Asp Asp
Ala Ala Gly Leu Ala Ile Ser Glu Lys Leu 50 55 60Arg Ala Gln Ile Arg
Gly Leu Asn Gln Ala Ile Arg Asn Ala Gln Asp65 70 75 80Gly Ile Ser
Leu Ile Gln Thr Ala Glu Gly Gly Leu Ser Glu Ile Gln 85 90 95Asn Ile
Leu Gln Arg Met Arg Glu Leu Gly Val Gln Ala Ala Asn Gly 100 105
110Thr Leu Asn Asn Gln Asp Ile Ser Ala Ile Thr Thr Glu Leu Asn Gln
115 120 125Leu Phe Asn Glu Ile Asp Arg Ile Ala Gly Ala Thr Glu Phe
Asn Thr 130 135 140Lys Asn Leu Leu Ala Val Ser Thr Gly Leu Val Val
Thr Leu Gln Val145 150 155 160Gly Ala Asn Ala Gly Gln Val Ile Ala
Phe Thr Ile Asp Asn Ala Gly 165 170 175Thr Ala Ser Leu Gly Leu Ser
Ser Ala Asp Leu Ala Ile Asn Asp Asn 180 185 190Ala Ser Ala Ser Ala
Phe Ile Ser Lys Val Asp Ser Ala Leu Gln Lys 195 200 205Val Ser Thr
Tyr Arg Ala Asn Leu Gly Ser Ile Gln Asn Arg Leu Glu 210 215 220His
Thr Ile Ala Asn Leu Gly Ile Ala Ser Glu Asn Leu Ser Ala Ser225 230
235 240Glu Ser Arg Ile Arg Asp Val Asp Met Ala Ala Glu Met Met Asn
Phe 245 250 255Thr Lys Asn Gln Ile Leu Gln Gln Ala Gly Val Ala Ile
Leu Ala Gln 260 265 270Ala Asn Gln Ala Pro Gln Ala Val Leu Gln Leu
Leu Arg 275 280 285247171PRTArtificial SequenceSynthetic sequence
247Met Gly His His His His His His Ser Gly Leu Asn Gln Ala Ile Arg1
5 10 15Asn Ala Gln Asp Gly Ile Ser Leu Ile Gln Thr Ala Glu Gly Gly
Leu 20 25 30Ser Glu Ile Gln Asn Ile Leu Gln Arg Met Arg Glu Leu Gly
Val Gln 35 40
45Ala Ala Asn Gly Thr Leu Asn Asn Gln Asp Ile Ser Ala Ile Thr Thr
50 55 60Glu Leu Asn Gln Leu Phe Asn Glu Ile Asp Arg Ile Ala Gly Ala
Thr65 70 75 80Glu Phe Asn Thr Lys Asn Leu Leu Ala Val Ser Thr Gly
Leu Val Val 85 90 95Thr Leu Gln Val Gly Ala Asn Ala Gly Gln Val Ile
Ala Phe Thr Ile 100 105 110Asp Asn Ala Gly Thr Ala Ser Leu Gly Leu
Ser Ser Ala Asp Leu Ala 115 120 125Ile Asn Asp Asn Ala Ser Ala Ser
Ala Phe Ile Ser Lys Val Asp Ser 130 135 140Ala Leu Gln Lys Val Ser
Thr Tyr Arg Ala Asn Leu Gly Ser Ile Gln145 150 155 160Asn Arg Leu
Glu His Thr Ile Ala Asn Leu Gly 165 170248146PRTArtificial
SequenceSynthetic sequence 248Met Gly His His His His His His Ser
Gly Leu Asn Gln Ala Ile Arg1 5 10 15Asn Ala Gln Asp Gly Ile Ser Leu
Ile Gln Thr Ala Glu Gly Gly Leu 20 25 30Ser Glu Ile Gln Asn Ile Leu
Gln Arg Met Arg Glu Leu Gly Val Gln 35 40 45Ala Ala Asn Gly Thr Leu
Asn Asn Gln Asp Ile Ser Ala Ile Thr Thr 50 55 60Glu Leu Asn Gln Leu
Phe Asn Glu Ile Asp Arg Ile Ala Gly Ala Thr65 70 75 80Glu Phe Asn
Thr Lys Asn Leu Leu Ala Ala Gly Thr Ala Ser Leu Gly 85 90 95Leu Ser
Ser Ala Asp Leu Ala Ile Asn Asp Asn Ala Ser Ala Ser Ala 100 105
110Phe Ile Ser Lys Val Asp Ser Ala Leu Gln Lys Val Ser Thr Tyr Arg
115 120 125Ala Asn Leu Gly Ser Ile Gln Asn Arg Leu Glu His Thr Ile
Ala Asn 130 135 140Leu Gly145249116PRTArtificial SequenceSynthetic
sequence 249Met Gly His His His His His His Ser Ala Ser Ala Phe Ile
Ser Lys1 5 10 15Val Asp Ser Ala Leu Gln Lys Val Ser Thr Tyr Arg Ala
Asn Leu Gly 20 25 30Ser Ile Gln Asn Arg Leu Glu His Thr Ile Ala Asn
Leu Gly Pro Asp 35 40 45Gly Leu Asn Gln Ala Ile Arg Asn Ala Gln Asp
Gly Ile Ser Leu Ile 50 55 60Gln Thr Ala Glu Gly Gly Leu Ser Glu Ile
Gln Asn Ile Leu Gln Arg65 70 75 80Met Arg Glu Leu Gly Val Gln Ala
Ala Asn Gly Thr Leu Asn Asn Gln 85 90 95Asp Ile Ser Ala Ile Thr Thr
Glu Leu Asn Gln Leu Phe Asn Glu Ile 100 105 110Asp Arg Ile Ala
115250103PRTArtificial SequenceSynthetic sequence 250Met Gly His
His His His His His Ser Asn Asn Gln Asp Ile Ser Ala1 5 10 15Ile Thr
Thr Glu Leu Asn Gln Leu Phe Asn Glu Ile Asp Arg Ile Ala 20 25 30Gly
Ala Thr Gly Ser Gly Gly Leu Ser Glu Ile Gln Asn Ile Leu Gln 35 40
45Arg Met Arg Glu Leu Gly Val Gln Ala Ala Asn Gly Thr Leu Asn Gly
50 55 60Gly Ser Ala Ser Ala Phe Ile Ser Lys Val Asp Ser Ala Leu Gln
Lys65 70 75 80Val Ser Thr Tyr Arg Ala Asn Leu Gly Ser Ile Gln Asn
Arg Leu Glu 85 90 95His Thr Ile Ala Asn Leu Gly
100251170PRTArtificial SequenceSynthetic sequence 251Met Gly His
His His His His His Ser Gly Leu Ala Gln Ala Ser Arg1 5 10 15Asn Ala
Gln Asp Ala Ile Ser Ile Ala Gln Thr Ala Glu Gly Ala Leu 20 25 30Asp
Glu Thr Gln Ser Ile Leu Gln Arg Val Arg Glu Leu Gly Val Gln 35 40
45Gly Ala Asn Gly Thr Leu Thr Ala Asp Asp Ile Asn Ala Leu Gln Ala
50 55 60Glu Val Asp Gln Leu Ile Ala Glu Ile Asp Arg Ile Ala Gly Ala
Thr65 70 75 80Glu Phe Asn Thr Gln Asn Leu Leu Asp Gly Ser Phe Thr
Thr Lys Ala 85 90 95Phe Gln Val Gly Ala Asn Ser Gly Gln Asn Met Thr
Leu Thr Ile Gly 100 105 110Lys Met Asp Thr Thr Thr Leu Gly Leu Ser
Ser Ala Asp Leu Ala Ile 115 120 125Asn Asp Asn Ala Phe Ala Asn Gly
Ala Ile Ser Thr Val Asp Ser Ala 130 135 140Leu Gln Lys Val Ser Ala
Glu Arg Ala Lys Leu Gly Ala Ile Gln Asn145 150 155 160Arg Leu Glu
His Thr Ile Ala Asn Leu Gly 165 170252170PRTArtificial
SequenceSynthetic sequence 252Met Gly His His His His His His Ser
Gly Leu Ala Gln Ala Ser Arg1 5 10 15Gln Ala Gln Asp Ala Ile Ser Ile
Ala Gln Thr Ala Glu Gly Ala Leu 20 25 30Asp Glu Thr Gln Ser Ile Leu
Gln Arg Val Arg Glu Leu Gly Val Gln 35 40 45Gly Ala Asp Gly Thr Leu
Thr Ala Asp Asp Ile Asp Ala Leu Gln Ala 50 55 60Glu Val Asp Gln Leu
Ile Ala Glu Ile Asp Arg Ile Ala Gly Ala Thr65 70 75 80Glu Phe Ala
Thr Gln Lys Leu Leu Asp Gly Ser Phe Thr Thr Lys Ala 85 90 95Phe Gln
Val Gly Ala Ala Ser Gly Gln Asp Val Thr Leu Thr Ile Gly 100 105
110Lys Val Asp Thr Thr Thr Leu Gly Leu Ser Ser Ala Asp Leu Ala Ile
115 120 125Asp Ser Ala Ala Phe Ala Asp Gly Ala Ile Ser Thr Val Asp
Ser Ala 130 135 140Leu Gln Lys Val Ser Ala Glu Arg Ala Lys Leu Gly
Ala Ile Gln Asn145 150 155 160Arg Leu Glu His Thr Ile Ala Gln Leu
Gly 165 170253174PRTArtificial SequenceSynthetic peptide accession
number Q53970 253Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu
Leu Thr Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser
Ala Ile Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys
Asp Asp Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr Ser Asn
Ile Lys Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile
Ser Ile Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu Ile Asn
Asn Asn Leu Gln Arg Val Arg Glu Leu Ser 85 90 95Val Gln Ala Thr Asn
Gly Thr Asn Ser Asp Ser Asp Leu Lys Ser Ile 100 105 110Gln Asp Glu
Ile Gln Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Asn 115 120 125Gln
Thr Gln Phe Asn Gly Val Lys Val Leu Ser Gln Asp Asn Gln Met 130 135
140Lys Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asp
Leu145 150 155 160Gln Lys Ile Asp Val Lys Ser Leu Gly Leu Asp Gly
Phe Asn 165 170254189PRTArtificial SequenceSynthetic peptide
accession number P72151 254Met Ala Leu Thr Val Asn Thr Asn Ile Ala
Ser Leu Asn Thr Gln Arg1 5 10 15Asn Leu Asn Ala Ser Ser Asn Asp Leu
Asn Thr Ser Leu Gln Arg Leu 20 25 30Thr Thr Gly Tyr Arg Ile Asn Ser
Ala Lys Asp Asp Ala Ala Gly Leu 35 40 45Gln Ile Ser Asn Arg Leu Ser
Asn Gln Ile Ser Gly Leu Asn Val Ala 50 55 60Thr Arg Asn Ala Asn Asp
Gly Ile Ser Leu Ala Gln Thr Ala Glu Gly65 70 75 80Ala Leu Gln Gln
Ser Thr Asn Ile Leu Gln Arg Ile Arg Asp Leu Ala 85 90 95Leu Gln Ser
Ala Asn Gly Ser Asn Ser Asp Ala Asp Arg Ala Ala Leu 100 105 110Gln
Lys Glu Val Ala Ala Gln Gln Ala Glu Leu Thr Arg Ile Ser Asp 115 120
125Thr Thr Thr Phe Gly Gly Arg Lys Leu Leu Asp Gly Ser Phe Gly Thr
130 135 140Thr Ser Phe Gln Val Gly Ser Asn Ala Tyr Glu Thr Ile Asp
Ile Ser145 150 155 160Leu Gln Asn Ala Ser Ala Ser Ala Ile Gly Ser
Tyr Gln Val Gly Ser 165 170 175Asn Gly Ala Gly Thr Val Ala Ser Val
Ala Gly Thr Ala 180 185255179PRTArtificial SequenceSynthetic
peptide accession number Q5X5M6 255Met Ala Gln Val Ile Asn Thr Asn
Val Ala Ser Leu Thr Ala Gln Arg1 5 10 15Asn Leu Gly Val Ser Gly Asn
Met Met Gln Thr Ser Ile Gln Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile
Asn Ser Ala Lys Asp Asp Ala Ala Gly Leu 35 40 45Ala Ile Ser Gln Arg
Met Thr Ala Gln Ile Arg Gly Met Asn Gln Ala 50 55 60Val Arg Asn Ala
Asn Asp Gly Ile Ser Leu Ala Gln Val Ala Glu Gly65 70 75 80Ala Met
Gln Glu Thr Thr Asn Ile Leu Gln Arg Met Arg Glu Leu Ser 85 90 95Val
Gln Ala Ala Asn Ser Thr Asn Asn Ser Ser Asp Arg Ala Ser Ile 100 105
110Gln Ser Glu Ile Ser Gln Leu Lys Ser Glu Leu Glu Arg Ile Ala Gln
115 120 125Asn Thr Glu Phe Asn Gly Gln Arg Ile Leu Asp Gly Ser Phe
Ser Gly 130 135 140Ala Ser Phe Gln Val Gly Ala Asn Ser Asn Gln Thr
Ile Asn Phe Ser145 150 155 160Ile Gly Ser Ile Lys Ala Ser Ser Ile
Gly Gly Ile Ala Thr Ala Thr 165 170 175Gly Thr
Glu256174PRTArtificial SequenceSynthetic peptide accession number
Q6VMV6 256Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr
Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile
Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys
Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Val
Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu Ile Asn Asn Asn
Leu Gln Arg Val Arg Glu Leu Thr 85 90 95Val Gln Ala Thr Asn Gly Thr
Asn Ser Asp Ser Asp Leu Ser Ser Ile 100 105 110Gln Ala Glu Ile Thr
Gln Arg Leu Glu Glu Ile Asp Arg Val Ser Glu 115 120 125Gln Thr Gln
Phe Asn Gly Val Lys Val Leu Ala Glu Asn Asn Glu Met 130 135 140Lys
Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Thr Ile Asn Leu145 150
155 160Ala Lys Ile Asp Ala Lys Thr Leu Gly Leu Asp Gly Phe Asn 165
170257173PRTArtificial SequenceSynthetic peptide accession number
P13713 257Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Met Ala
Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ser Leu Gly Thr Ala Ile
Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45Ala Ile Ser Asn Arg Phe Thr Ala Asn Ile Lys
Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Leu
Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu Val Asn Asp Asn
Leu Gln Asn Ile Arg Arg Leu Thr 85 90 95Val Gln Ala Gln Asn Gly Ser
Asn Ser Thr Ser Asp Leu Lys Ser Ile 100 105 110Gln Asp Glu Ile Thr
Gln Arg Leu Ser Glu Ile Asn Arg Ile Ser Glu 115 120 125Gln Thr Asp
Phe Asn Gly Val Lys Val Leu Ser Ser Asp Gln Lys Leu 130 135 140Thr
Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Thr Asp Ile Asp Leu145 150
155 160Lys Lys Ile Asp Ala Lys Gln Leu Gly Met Asp Thr Phe 165
170258168PRTArtificial SequenceSynthetic peptide accession number
Q93RK8 258Met Arg Ile Asn His Asn Ile Ala Ala Leu Asn Thr Ser Arg
Gln Leu1 5 10 15Asn Ala Gly Ser Asn Ser Ala Ala Lys Asn Met Glu Lys
Leu Ser Ser 20 25 30Gly Leu Arg Ile Asn Arg Ala Gly Asp Asp Ala Ala
Gly Leu Ala Ile 35 40 45Ser Glu Lys Met Arg Ser Gln Ile Arg Gly Leu
Asp Met Ala Ser Lys 50 55 60Asn Ala Gln Asp Gly Ile Ser Leu Ile Gln
Thr Ser Glu Gly Ala Leu65 70 75 80Asn Glu Thr His Ser Ile Leu Gln
Arg Met Ser Glu Leu Ala Thr Gln 85 90 95Ala Ala Asn Asp Thr Asn Thr
Asp Ser Asp Arg Ser Glu Leu Gln Lys 100 105 110Glu Met Asp Gln Leu
Ala Ser Glu Val Thr Arg Ile Ser Thr Asp Thr 115 120 125Glu Phe Asn
Thr Lys Lys Leu Leu Asp Gly Thr Ala Gln Asn Leu Thr 130 135 140Phe
Gln Ile Gly Ala Asn Glu Gly Gln Thr Met Ser Leu Ser Ile Asn145 150
155 160Lys Met Asp Ser Glu Ser Leu Lys 165259192PRTArtificial
SequenceSynthetic peptide accession number Q02551 259Met Lys Val
Asn Thr Asn Ile Ile Ser Leu Lys Thr Gln Glu Tyr Leu1 5 10 15Arg Lys
Asn Asn Glu Gly Met Thr Gln Ala Gln Arg Arg Leu Ala Ser 20 25 30Gly
Lys Arg Ile Asn Ser Ser Leu Asp Asp Ala Ala Gly Leu Ala Val 35 40
45Val Thr Arg Met Asn Val Lys Ser Thr Gly Leu Asp Ala Ala Ser Lys
50 55 60Asn Ser Ser Met Gly Ile Asp Leu Leu Gln Thr Ala Asp Ser Ala
Leu65 70 75 80Ser Ser Met Ser Ser Ile Leu Gln Arg Met Arg Gln Leu
Ala Val Gln 85 90 95Ser Ser Asn Gly Ser Phe Ser Asp Glu Asp Arg Lys
Gln Tyr Thr Ala 100 105 110Glu Phe Gly Ser Leu Ile Lys Glu Leu Asp
His Val Ala Asp Thr Thr 115 120 125Asn Tyr Asn Asn Ile Lys Leu Leu
Asp Gln Thr Ala Thr Gly Ala Ala 130 135 140Thr Gln Val Ser Ile Gln
Ala Ser Asp Lys Ala Asn Asp Leu Ile Asn145 150 155 160Ile Asp Leu
Phe Asn Ala Lys Gly Leu Ser Ala Gly Thr Ile Thr Leu 165 170 175Gly
Ser Gly Ser Thr Val Ala Gly Tyr Ser Ala Leu Ser Val Ala Asp 180 185
190260174PRTArtificial SequenceSynthetic peptide accession number
Q09012 260Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr
Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ser Leu Ser Ser Ala Ile
Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys
Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Val
Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Ser Glu Ile Asn Asn Asn
Leu Gln Arg Ile Arg Glu Leu Ser 85 90 95Val Gln Ala Thr Asn Gly Thr
Asn Ser Asp Ser Asp Leu Asn Ser Ile 100 105 110Gln Asp Glu Ile Thr
Gln Arg Leu Ser Glu Ile Asp Arg Val Ser Asn 115 120 125Gln Thr Gln
Phe Asn Gly Val Lys Val Leu Ala Ser Asp Gln Thr Met 130 135 140Lys
Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Glu Ile Ala Leu145 150
155 160Asp Lys Ile Asp Ala Lys Thr Leu Gly Leu Asp Asn Phe Ser 165
170261174PRTArtificial SequenceSynthetic peptide accession number
Q8GNT8 261Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Met Ala
Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile
Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45Ala Ile Ser Asn Arg Phe Thr Ala Asn Ile Asn
Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Leu
Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu Val Asn Asp Asn
Leu Gln Asn Ile Arg Arg Leu Thr 85 90 95Val Gln Ala Gln Asn Gly Ser
Asn Ser Ser Ser Asp Leu Gln Ser Ile 100 105
110Gln Asp Glu Ile Thr Gln Arg Leu Ser Glu Ile Asp Arg Ile Ser Gln
115 120 125Gln Thr Asp Phe Asn Gly Val Lys Val Leu Ser Lys Asp Gln
Lys Leu 130 135 140Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile
Asp Ile Asp Leu145 150 155 160Lys Asn Ile Asn Ala Gln Ser Leu Gly
Leu Asp Lys Phe Asn 165 170262186PRTArtificial SequenceSynthetic
peptide accession number Q9FAE7 262Met Ala Ser Thr Ile Asn Thr Asn
Val Ser Ser Leu Thr Ala Gln Arg1 5 10 15Asn Leu Ser Leu Ser Gln Ser
Ser Leu Asn Thr Ser Ile Gln Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile
Asn Ser Ala Lys Asp Asp Ala Ala Gly Leu 35 40 45Ala Ile Ser Glu Arg
Phe Thr Ser Gln Ile Arg Gly Leu Asn Gln Ala 50 55 60Val Arg Asn Ala
Asn Asp Gly Ile Ser Leu Ala Gln Thr Ala Glu Gly65 70 75 80Ala Leu
Lys Ser Thr Gly Asp Ile Leu Gln Arg Val Arg Glu Leu Ala 85 90 95Val
Gln Ser Ala Asn Ala Thr Asn Ser Ser Gly Asp Arg Lys Ala Ile 100 105
110Gln Ala Glu Val Gly Gln Leu Leu Ser Glu Met Asp Arg Ile Ala Gly
115 120 125Asn Thr Glu Phe Asn Gly Gln Lys Leu Leu Asp Gly Ser Phe
Gly Ser 130 135 140Ala Thr Phe Gln Val Gly Ala Asn Ala Asn Gln Thr
Ile Thr Ala Thr145 150 155 160Thr Gly Asn Phe Arg Thr Asn Asn Tyr
Gly Ala Gln Leu Thr Ala Ser 165 170 175Ala Ser Gly Ala Ala Thr Ser
Gly Ala Ser 180 185263173PRTArtificial SequenceSynthetic peptide
accession number Q8ZF76 263Met Ala Val Ile Asn Thr Asn Ser Leu Ser
Leu Leu Thr Gln Asn Asn1 5 10 15Leu Asn Lys Ser Gln Ser Ser Leu Gly
Thr Ala Ile Glu Arg Leu Ser 20 25 30Ser Gly Leu Arg Ile Asn Ser Ala
Lys Asp Asp Ala Ala Gly Gln Ala 35 40 45Ile Ala Asn Arg Phe Thr Ser
Asn Ile Lys Gly Leu Thr Gln Ala Ala 50 55 60Arg Asn Ala Asn Asp Gly
Ile Ser Ile Ala Gln Thr Thr Glu Gly Ser65 70 75 80Leu Asn Glu Ile
Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Thr Val 85 90 95Gln Ala Gln
Asn Gly Ser Asn Ser Ser Ser Asp Leu Asp Ser Ile Gln 100 105 110Asp
Glu Ile Ser Leu Arg Leu Ala Glu Ile Asp Arg Val Ser Asp Gln 115 120
125Thr Gln Phe Asn Gly Lys Lys Val Leu Ala Glu Asn Thr Thr Met Ser
130 135 140Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asn
Leu Gln145 150 155 160Lys Ile Asp Ser Lys Ser Leu Gly Leu Gly Ser
Tyr Ser 165 170264174PRTArtificial SequenceSynthetic peptide
accession number Q7N5J4 264Met Ala Gln Val Ile Asn Thr Asn Ser Leu
Ser Leu Leu Thr Gln Asn1 5 10 15Asn Leu Asn Arg Ser Gln Gly Thr Leu
Gly Ser Ala Ile Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser
Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr
Ala Asn Val Arg Gly Leu Thr Gln Ala 50 55 60Ala Arg Asn Ala Asn Asp
Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu
Ile Asn Thr Asn Leu Gln Arg Ile Arg Glu Leu Thr 85 90 95Val Gln Ser
Gln Asn Gly Ser Asn Ser Glu Ser Asp Ile Lys Ser Ile 100 105 110Gln
Glu Glu Val Thr Gln Arg Leu Lys Glu Ile Asp Arg Ile Ser Glu 115 120
125Gln Thr Gln Phe Asn Gly Val Arg Val Leu Arg Glu Asp Ser Lys Met
130 135 140Thr Ile Gln Val Gly Ala Asn Asp Asn Glu Val Ile Asp Ile
Asp Leu145 150 155 160Lys Lys Ile Asp Lys Glu Ala Leu Asn Leu Gly
Lys Phe Thr 165 170265189PRTArtificial SequenceSynthetic peptide
accession number O33578 265Met Thr Thr Ile Asn Thr Asn Ile Gly Ala
Ile Ala Ala Gln Ala Asn1 5 10 15Met Thr Lys Val Asn Asp Gln Phe Asn
Thr Ala Met Thr Arg Leu Ser 20 25 30Thr Gly Leu Arg Ile Asn Ala Ala
Lys Asp Asp Ala Ala Gly Met Ala 35 40 45Ile Gly Glu Lys Met Thr Ala
Gln Val Met Gly Leu Asn Gln Ala Ile 50 55 60Arg Asn Ala Gln Asp Gly
Lys Asn Leu Val Asp Thr Thr Glu Gly Ala65 70 75 80His Val Glu Val
Ser Ser Met Leu Gln Arg Leu Arg Glu Leu Ala Val 85 90 95Gln Ser Ser
Asn Asp Thr Asn Thr Ala Ala Asp Arg Gly Ser Leu Ala 100 105 110Ala
Glu Gly Lys Gln Leu Ile Ala Glu Ile Asn Arg Val Ala Glu Ser 115 120
125Thr Thr Phe Asn Gly Met Lys Val Leu Asp Gly Ser Phe Thr Gly Lys
130 135 140Gln Leu Gln Ile Gly Ala Asp Ser Gly Gln Thr Met Ala Ile
Asn Val145 150 155 160Asp Ser Ala Ala Ala Thr Asp Ile Gly Ala His
Lys Ile Ser Ser Ala 165 170 175Ser Thr Val Val Ala Asp Ala Ala Leu
Thr Asp Thr Thr 180 185266175PRTArtificial SequenceSynthetic
peptide accession number Q56826 266Met Ala Ser Val Ile Asn Thr Asn
Asp Ser Ala Leu Leu Ala Gln Asn1 5 10 15Asn Leu Thr Lys Ser Lys Gly
Ile Leu Gly Ser Ala Ile Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile
Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg
Phe Thr Ala Asn Val Lys Gly Leu Thr Gln Ala 50 55 60Ala Arg Asn Ala
Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu
Asn Glu Ile Asn Asn Asn Leu Gln Arg Ile Arg Glu Leu Thr 85 90 95Val
Gln Ser Glu Asn Gly Ser Asn Ser Lys Ser Asp Leu Asp Ser Ile 100 105
110Gln Lys Glu Val Thr Gln Arg Leu Glu Glu Ile Asp Arg Ile Ser Thr
115 120 125Gln Thr Gln Phe Asn Gly Ile Lys Val Leu Asn Gly Asp Val
Thr Glu 130 135 140Met Lys Ile Gln Val Gly Ala Asn Asp Asn Glu Thr
Ile Gly Ile Lys145 150 155 160Leu Gly Lys Ile Asn Ser Glu Lys Leu
Asn Leu Lys Glu Phe Ser 165 170 175267175PRTArtificial
SequenceSynthetic peptide accession number P42273 267Met Ala Gln
Val Ile Asn Thr Asn Tyr Leu Ser Leu Val Thr Gln Asn1 5 10 15Asn Leu
Asn Arg Ser Gln Ser Ala Leu Gly Asn Ala Ile Glu Arg Leu 20 25 30Ser
Ser Gly Met Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40
45Ala Ile Ala Asn Arg Phe Thr Ser Asn Ile Asn Gly Leu Thr Gln Ala
50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Val Ser Gln Thr Thr Glu
Gly65 70 75 80Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Ile Arg
Glu Leu Thr 85 90 95Val Gln Ala Lys Asn Gly Thr Asn Ser Asn Ser Asp
Ile Asn Ser Ile 100 105 110Gln Asn Glu Val Asn Gln Arg Leu Asp Glu
Ile Asn Arg Val Ser Glu 115 120 125Gln Thr Gln Phe Asn Gly Val Lys
Val Leu Ser Gly Glu Lys Ser Lys 130 135 140Met Thr Ile Gln Val Gly
Thr Asn Asp Asn Glu Val Ile Glu Phe Asn145 150 155 160Leu Asp Lys
Ile Asp Asn Asp Thr Leu Gly Val Ala Ser Asp Lys 165 170
175268200PRTArtificial SequenceSynthetic peptide accession number
O31059 268Met Val Val Gln His Asn Met Gln Ala Ala Asn Ala Ser Arg
Met Leu1 5 10 15Gly Ile Thr Thr Gly Asp Gln Ser Lys Ser Thr Glu Lys
Leu Ser Ser 20 25 30Gly Phe Lys Ile Asn Arg Ala Ala Asp Asp Ala Ala
Gly Leu Ser Ile 35 40 45Ser Glu Lys Met Arg Lys Gln Ile Arg Gly Leu
Asp Gln Ala Ser Thr 50 55 60Asn Ala Ser Asp Gly Ile Ser Ala Val Gln
Thr Ala Glu Gly Ala Leu65 70 75 80Thr Glu Val His Ser Met Leu Gln
Arg Met Asn Glu Leu Ala Val Gln 85 90 95Ala Ala Asn Gly Thr Asn Ser
Glu Ser Asp Arg Ser Ser Ile Gln Asp 100 105 110Glu Ile Asn Gln Leu
Thr Thr Glu Ile Asp Arg Val Ala Glu Thr Thr 115 120 125Lys Phe Asn
Glu Thr Tyr Leu Leu Lys Gly Gly Asn Gly Asp Arg Thr 130 135 140Val
Arg Val Tyr Ala His Asp Ala Gly Leu Val Gly Ser Leu Ser Gln145 150
155 160Asn Thr Thr Lys Ala Thr Phe Gln Met Arg Lys Leu Glu Ile Gly
Asp 165 170 175Ser Tyr Thr Ile Gly Gly Thr Thr Tyr Lys Ile Gly Ala
Glu Thr Val 180 185 190Lys Glu Ala Met Thr Ala Leu Lys 195
200269177PRTArtificial SequenceSynthetic peptide accession number
Q7VZC2 269Met Ala Ala Val Ile Asn Thr Asn Tyr Leu Ser Leu Val Ala
Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Ser Ala Ile
Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe Thr Ala Asn Val Lys
Gly Leu Thr Gln Ala 50 55 60Ala Arg Asn Ala Asn Asp Gly Ile Ser Ile
Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn Glu Ile Asn Asn Asn
Leu Gln Arg Ile Arg Glu Leu Thr 85 90 95Val Gln Ala Ser Asn Gly Thr
Asn Ser Ala Ser Asp Ile Asp Ser Ile 100 105 110Gln Gln Glu Val Asn
Gln Arg Leu Glu Glu Ile Asn Arg Ile Ala Glu 115 120 125Gln Thr Asp
Phe Asn Gly Ile Lys Val Leu Lys Ser Asn Ala Thr Asp 130 135 140Met
Thr Leu Ser Ile Gln Val Gly Ala Lys Asp Asn Glu Thr Ile Asp145 150
155 160Ile Lys Ile Asp Arg Asn Ser Asn Trp Asn Leu Tyr Asp Ala Val
Gly 165 170 175Thr270167PRTArtificial SequenceSynthetic peptide
accession number Q9F4A4 270Met Ile Ile Asn His Asn Met Asn Ala Leu
Asn Ala His Arg Asn Met1 5 10 15Met Gly Asn Ile Ala Thr Ala Gly Lys
Ser Met Glu Lys Leu Ser Ser 20 25 30Gly Leu Arg Ile Asn Arg Ala Gly
Asp Asp Ala Ala Gly Leu Ala Ile 35 40 45Ser Glu Lys Met Arg Gly Gln
Ile Arg Gly Leu Asp Gln Ala Ser Arg 50 55 60Asn Ala Gln Asp Gly Ile
Ser Leu Ile Gln Thr Ala Glu Gly Ala Leu65 70 75 80Ala Glu Thr His
Ser Ile Leu Gln Arg Met Arg Glu Leu Ser Val Gln 85 90 95Ser Ala Asn
Asp Thr Asn Val Ala Val Asp Arg Thr Ala Ile Gln Asp 100 105 110Glu
Ile Asn Ser Leu Thr Glu Glu Ile Asn Arg Ile Ser Gly Asp Thr 115 120
125Glu Phe Asn Thr Gln Lys Leu Leu Asp Gly Gly Phe Lys Gly Glu Phe
130 135 140Gln Ile Gly Ala Asn Ser Asn Gln Thr Val Lys Leu Asp Ile
Gly Asn145 150 155 160Met Ser Ala Ala Ser Leu Gly
165271178PRTArtificial SequenceSynthetic peptide accession number
Q8P9C4 271Met Ala Gln Val Ile Asn Thr Asn Val Met Ser Leu Asn Ala
Gln Arg1 5 10 15Asn Leu Asn Thr Asn Ser Ser Ser Met Ala Leu Ser Ile
Gln Gln Leu 20 25 30Ser Ser Gly Lys Arg Ile Thr Ser Ala Ser Val Asp
Ala Ala Gly Leu 35 40 45Ala Ile Ser Glu Arg Phe Thr Thr Gln Ile Arg
Gly Leu Asp Val Ala 50 55 60Ser Arg Asn Ala Asn Asp Gly Ile Ser Leu
Ala Gln Thr Ala Glu Gly65 70 75 80Ala Met Val Glu Ile Gly Asn Asn
Leu Gln Arg Ile Arg Glu Leu Ser 85 90 95Val Gln Ser Ala Asn Ala Thr
Asn Ser Ala Thr Asp Arg Glu Ala Leu 100 105 110Asn Ser Glu Val Lys
Gln Leu Thr Ser Glu Ile Asp Arg Val Ala Asn 115 120 125Gln Thr Ser
Phe Asn Gly Thr Lys Leu Leu Asn Gly Asp Phe Ser Gly 130 135 140Ala
Leu Phe Gln Val Gly Ala Asp Ala Gly Gln Thr Ile Gly Ile Asn145 150
155 160Ser Ile Val Asp Ala Asn Val Asp Ser Leu Gly Lys Ala Asn Phe
Ala 165 170 175Ala Ser272161PRTArtificial SequenceSynthetic peptide
accession number Q82UA3 272Met Pro Gln Val Ile Asn Thr Asn Ile Ala
Ser Leu Asn Ala Gln Arg1 5 10 15Asn Leu Asn Val Ser Gln Asn Ser Leu
Ser Thr Ala Leu Gln Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn Ser
Ala Lys Asp Asp Ala Ala Gly Leu 35 40 45Ala Ile Ser Glu Arg Met Thr
Ser Gln Ile Arg Gly Met Asn Gln Ala 50 55 60Ala Arg Asn Ala Asn Asp
Gly Ile Ser Leu Ala Gln Thr Ala Glu Gly65 70 75 80Ala Leu Val Glu
Ile Gly Asn Asn Leu Gln Arg Ile Arg Glu Leu Ala 85 90 95Val Gln Ser
Ala Asn Ala Thr Asn Ser Glu Asp Asp Arg Glu Ala Leu 100 105 110Gln
Lys Glu Val Thr Gln Leu Ile Asp Glu Ile Gln Arg Val Gly Glu 115 120
125Gln Thr Ser Phe Asn Gly Thr Lys Leu Leu Asp Gly Ser Phe Ala Ser
130 135 140Gln Ile Phe Gln Val Gly Ala Asn Glu Gly Glu Thr Ile Asp
Phe Thr145 150 155 160Asp273178PRTArtificial SequenceSynthetic
peptide accession number Q84IC5 273Gly Phe Arg Ile Asn Thr Asn Gly
Ala Ser Leu Asn Ala Gln Val Asn1 5 10 15Ala Gly Leu Asn Ser Arg Asn
Leu Asp Ser Ser Leu Ala Arg Leu Ser 20 25 30Ser Gly Leu Arg Ile Asn
Ser Ala Ala Asp Asp Ala Ser Gly Leu Ala 35 40 45Ile Ala Asp Ser Leu
Lys Thr Gln Ala Asn Ser Leu Gly Gln Ala Ile 50 55 60Asn Asn Ala Asn
Asp Ala Asn Ser Met Leu Gln Ile Ala Asp Lys Ala65 70 75 80Met Asp
Glu Gln Leu Lys Ile Leu Asp Thr Ile Lys Val Lys Ala Thr 85 90 95Gln
Ala Ala Gln Asp Gly Gln Thr Ala Lys Thr Arg Ala Met Ile Gln 100 105
110Gly Glu Ile Asn Lys Leu Met Glu Glu Leu Asp Asn Ile Ala Asn Thr
115 120 125Thr Thr Tyr Asn Gly Lys Gln Leu Leu Ser Gly Ser Phe Ser
Asn Ala 130 135 140Gln Phe Gln Ile Gly Asp Lys Ala Asn Gln Thr Val
Asn Ala Thr Ile145 150 155 160Gly Ser Thr Asn Ser Ala Lys Val Gly
Gln Thr Arg Phe Glu Thr Gly 165 170 175Ala Val27488PRTArtificial
SequenceSynthetic polypeptide accession number Q53970 274Pro Leu
Ala Ser Ile Asp Ser Ala Leu Ser Lys Val Asp Ala Val Arg1 5 10 15Ser
Ser Leu Gly Ala Ile Gln Asn Arg Phe Asp Ser Ala Ile Thr Asn 20 25
30Leu Gly Asn Thr Val Thr Asn Leu Asn Ser Ala Arg Ser Arg Ile Glu
35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Lys Ala Gln
Ile 50 55 60Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln
Val Pro65 70 75 80Gln Asn Val Leu Ser Leu Leu Arg
8527588PRTArtificial SequenceSynthetic peptide accession number
P72151 275Ala Ile Ala Val Val Asp Asn Ala Leu Ala Ala Ile Asp Ala
Gln Arg1 5 10 15Ala Asp Leu Gly Ala Val Gln Asn Arg Phe Lys Asn Thr
Ile Asp Asn 20 25 30Leu Thr Asn Ile Ser Glu Asn Ala Thr Asn Ala Arg
Ser Arg Ile Lys 35 40 45Asp Thr Asp Phe Ala Ala Glu Thr Ala Ala Leu
Ser Lys Asn Gln Val 50
55 60Leu Gln Gln Ala Gly Thr Ala Ile Leu Ala Gln Ala Asn Gln Leu
Pro65 70 75 80Gln Ala Val Leu Ser Leu Leu Arg 8527689PRTArtificial
SequenceSynthetic peptide accession number Q5X5M6 276Ala Ile Lys
Arg Ile Asp Ala Ala Leu Asn Ser Val Asn Ser Asn Arg1 5 10 15Ala Asn
Met Gly Ala Leu Gln Asn Arg Phe Glu Ser Thr Ile Ala Asn 20 25 30Leu
Gln Asn Val Ser Asp Asn Leu Ser Ala Ala Arg Ser Arg Ile Gln 35 40
45Asp Ala Asp Tyr Ala Ala Glu Met Ala Ser Leu Thr Lys Asn Gln Ile
50 55 60Leu Gln Gln Ala Gly Thr Ala Met Leu Ala Gln Ala Asn Ser Leu
Pro65 70 75 80Gln Ser Val Leu Ser Leu Leu Gly Arg
8527789PRTArtificial SequenceSynthetic peptide accession number
Q6VMV6 277Pro Leu Glu Thr Ile Asp Lys Ala Leu Ala Lys Val Asp Asn
Leu Arg1 5 10 15Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asp Ser Ala
Ile Thr Asn 20 25 30Leu Gly Asn Thr Val Asn Asn Leu Ser Ser Ala Arg
Ser Arg Ile Arg 35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met
Ser Arg Ala Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr Ser Val Leu Ala
Gln Ala Asn Gln Thr Thr65 70 75 80Gln Asn Val Leu Ser Leu Leu Gln
Gly 8527888PRTArtificial SequenceSynthetic peptide accession number
P13713 278Pro Leu Ala Thr Leu Asp Lys Ala Leu Ala Gln Val Asp Gly
Leu Arg1 5 10 15Ser Ser Leu Gly Ala Val Gln Asn Arg Phe Asp Ser Val
Ile Asn Asn 20 25 30Leu Asn Ser Thr Val Asn Asn Leu Ser Ala Ser Gln
Ser Arg Ile Gln 35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser Asn Met
Ser Arg Ala Asn Ile 50 55 60Leu Gln Gln Ala Gly Thr Ser Val Leu Ala
Gln Ala Asn Gln Ser Thr65 70 75 80Gln Asn Val Leu Ser Leu Leu Arg
8527989PRTArtificial SequenceSynthetic peptide accession number
Q93RK8misc_feature(6)..(6)Xaa can be any naturally occurring amino
acid 279Ala Leu Thr Thr Ile Xaa Thr Ala Ile Asp Thr Val Ser Ser Glu
Arg1 5 10 15Ala Lys Leu Gly Ala Val Gln Asn Arg Leu Glu His Thr Ile
Asn Asn 20 25 30Leu Gly Thr Ser Ser Glu Asn Leu Thr Ser Ala Asx Ser
Arg Ile Arg 35 40 45Asp Val Asp Met Ala Ser Glu Met Met Glu Tyr Thr
Lys Asn Asn Ile 50 55 60Leu Thr Gln Ala Ser Gln Ala Met Leu Ala Gln
Ala Asn Gln Gln Pro65 70 75 80Gln Gln Val Leu Gln Leu Leu Lys Gly
8528090PRTArtificial SequenceSynthetic peptide accession number
Q02551 280Val Ile Gly Leu Ala Asp Ala Ala Leu Thr Lys Ile Met Lys
Gln Arg1 5 10 15Ala Asp Met Gly Ala Tyr Tyr Asn Arg Leu Glu Tyr Thr
Ala Lys Gly 20 25 30Leu Met Gly Ala Tyr Glu Asn Met Gln Ala Ser Glu
Ser Arg Ile Arg 35 40 45Asp Ala Asp Met Ala Glu Glu Val Val Ser Leu
Thr Thr Lys Gln Ile 50 55 60Leu Val Gln Ser Gly Thr Ala Met Leu Ala
Gln Ala Asn Met Lys Pro65 70 75 80Asn Ser Val Leu Lys Leu Leu Gln
Gln Ile 85 9028188PRTArtificial SequenceSynthetic peptide accession
number Q09012 281Pro Leu Ser Lys Leu Asp Glu Ala Leu Ala Lys Val
Asp Lys Leu Arg1 5 10 15Ser Ser Leu Gly Ala Val Gln Asn Arg Phe Asp
Ser Ala Ile Thr Asn 20 25 30Leu Gly Asn Thr Val Asn Asp Leu Ser Ser
Ala Arg Ser Arg Ile Glu 35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser
Asn Met Ser Arg Ala Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr Ser Val
Leu Ala Gln Ala Asn Gln Thr Thr65 70 75 80Gln Asn Val Leu Ser Leu
Leu Arg 8528288PRTArtificial SequenceSynthetic peptide accession
number Q8GNT8 282Pro Leu Ala Thr Leu Asp Lys Ala Leu Ser Gln Val
Asp Ile Leu Arg1 5 10 15Ser Gly Leu Gly Ala Val Gln Asn Arg Phe Asp
Ser Val Ile Asn Asn 20 25 30Leu Asn Ser Thr Val Asn Asn Leu Ser Ala
Ser Arg Ser Arg Ile Gln 35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser
Asn Met Ser Arg Ala Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr Ser Val
Leu Ala Gln Ala Asn Gln Ser Thr65 70 75 80Gln Asn Val Leu Ser Leu
Leu Arg 8528388PRTArtificial SequenceSynthetic peptide accession
number Q9FAE7 283Ala Leu Lys Ile Ile Asp Ala Ala Leu Ser Ala Val
Asn Gln Gln Arg1 5 10 15Ala Ser Phe Gly Ala Leu Gln Ser Arg Phe Glu
Thr Thr Val Asn Asn 20 25 30Leu Gln Ser Thr Ser Glu Asn Met Ser Ala
Ser Arg Ser Arg Ile Gln 35 40 45Asp Ala Asp Phe Ala Ala Glu Thr Ala
Asn Leu Ser Arg Ser Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr Ala Met
Val Ala Gln Ala Asn Gln Leu Pro65 70 75 80Gln Gly Val Leu Ser Leu
Leu Lys 8528488PRTArtificial SequenceSynthetic peptide accession
number Q8ZF76 284Pro Leu Glu Thr Leu Asp Asp Ala Ile Lys Gln Val
Asp Gly Leu Arg1 5 10 15Ser Ser Leu Gly Ala Val Gln Asn Arg Phe Glu
Ser Ala Val Thr Asn 20 25 30Leu Asn Asn Thr Val Thr Asn Leu Thr Ser
Ala Arg Ser Arg Ile Glu 35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser
Asn Met Ser Arg Ala Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr Ser Val
Leu Ser Gln Ala Asn Gln Val Pro65 70 75 80Gln Thr Val Leu Ser Leu
Leu Asn 8528588PRTArtificial SequenceSynthetic peptide accession
number Q7N5J4 285Pro Leu Glu Thr Leu Asp Ser Ala Leu Ala Gln Val
Asp Ser Leu Arg1 5 10 15Ser Ser Leu Gly Ala Ile Gln Asn Arg Leu Glu
Ser Thr Val Asn Asn 20 25 30Leu Asn Asn Thr Val Asn Asn Leu Ser Ala
Ala Arg Ser Arg Ile Glu 35 40 45Asp Ala Asp Tyr Ala Thr Glu Val Ser
Asn Met Ser Arg Gly Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr Ala Val
Leu Ala Gln Ala Met Gln Val Pro65 70 75 80Gln Asn Val Met Ser Leu
Leu Arg 8528689PRTArtificial SequenceSynthetic peptide accession
number O33578 286Ala Ile Gly Val Ile Asp Val Ala Leu Ser Lys Ile
Ser Gln Ser Arg1 5 10 15Ser Glu Leu Gly Ala Val Ser Asn Arg Leu Asp
Ser Thr Ile Ser Asn 20 25 30Leu Thr Asn Ile Ser Thr Ser Val Gln Ala
Ala Lys Ser Gln Val Met 35 40 45Asp Ala Asp Phe Ala Ala Glu Ser Thr
Asn Leu Ala Arg Ser Gln Ile 50 55 60Leu Ser Gln Ala Ser Thr Ala Met
Leu Ala Gln Ala Asn Ser Ser Lys65 70 75 80Gln Asn Val Leu Ser Leu
Leu Arg Gly 8528788PRTArtificial SequenceSynthetic peptide
accession number Q56826 287Pro Leu Asp Thr Leu Asp Lys Ala Leu Ala
Gln Val Asp Asp Asn Arg1 5 10 15Ser Ser Leu Gly Ala Val Gln Asn Arg
Leu Glu Ser Thr Val Asn Asn 20 25 30Leu Asn Asn Thr Val Asn Asn Leu
Ser Ala Ala Arg Ser Arg Ile Glu 35 40 45Asp Ala Asp Tyr Ala Val Glu
Val Ser Asn Met Ser Arg Gly Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr
Ser Val Leu Ala Gln Ala Asn Gln Val Pro65 70 75 80Gln Thr Val Leu
Ser Leu Leu Arg 8528888PRTArtificial SequenceSynthetic peptide
accession number P42273 288Ala Leu Ala Thr Leu Asp Asn Ala Ile Ser
Lys Val Asp Glu Ser Arg1 5 10 15Ser Lys Leu Gly Ala Ile Gln Asn Arg
Phe Gln Ser Thr Ile Asn Asn 20 25 30Leu Asn Asn Thr Val Asn Asn Leu
Ser Ala Ser Arg Ser Arg Ile Leu 35 40 45Asp Ala Asp Tyr Ala Thr Glu
Val Ser Asn Met Ser Lys Asn Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr
Ala Val Leu Ala Gln Ala Asn Gln Val Pro65 70 75 80Gln Thr Val Leu
Ser Leu Leu Arg 8528988PRTArtificial SequenceSynthetic peptide
accession number O31059 289Ala Ile Asp Ala Ile Ser Asp Ala Leu Ala
Lys Val Ser Ala Gln Arg1 5 10 15Ser Ala Leu Gly Ser Ile Gln Asn Arg
Leu Glu His Ser Ile Ala Asn 20 25 30Leu Asp Asn Val Val Glu Asn Thr
Asn Ala Ala Glu Ser Arg Ile Arg 35 40 45Asp Thr Asp Met Ala Asp Glu
Met Val Thr Tyr Ser Lys Asn Asn Ile 50 55 60Leu Met Gln Ala Gly Gln
Ser Met Leu Ala Gln Ala Asn Gln Ala Thr65 70 75 80Gln Gly Val Leu
Ser Ile Leu Gln 8529088PRTArtificial SequenceSynthetic peptide
accession number Q7VZC2 290Ala Leu Ser Lys Leu Asp Asp Ala Met Lys
Ala Val Asp Glu Gln Arg1 5 10 15Ser Ser Leu Gly Ala Ile Gln Asn Arg
Phe Glu Ser Thr Val Ala Asn 20 25 30Leu Asn Asn Thr Ile Thr Asn Leu
Ser Ala Ala Arg Ser Arg Ile Glu 35 40 45Asp Ser Asp Tyr Ala Thr Glu
Val Ser Asn Met Thr Lys Asn Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr
Ser Val Leu Ala Gln Ala Asn Gln Val Pro65 70 75 80Gln Asn Val Leu
Ser Leu Leu Arg 8529188PRTArtificial SequenceSynthetic peptide
accession number Q9F4A4 291Ser Ile Lys Thr Ile Asn Ser Ala Ile Glu
Gln Val Ser Thr Gln Arg1 5 10 15Ser Lys Leu Gly Ala Val Gln Asn Arg
Leu Glu His Thr Ile Asn Asn 20 25 30Leu Asn Thr Ser Ser Glu Asn Leu
Thr Ala Ala Glu Ser Arg Val Arg 35 40 45Asp Val Asp Met Ala Lys Glu
Met Met Ala Phe Ser Lys Asn Asn Ile 50 55 60Leu Ser Gln Ala Ala Gln
Ala Met Leu Gly Gln Ala Asn Gln Gln Pro65 70 75 80Gln Gly Val Leu
Gln Leu Leu Arg 8529288PRTArtificial SequenceSynthetic peptide
accession number Q8P9C4 292Ala Leu Glu Ile Val Asp Lys Ala Leu Thr
Ser Val Asn Ser Ser Arg1 5 10 15Ala Asp Met Gly Ala Val Gln Asn Arg
Phe Thr Ser Thr Leu Ala Asn 20 25 30Leu Ala Ala Thr Ser Glu Asn Leu
Thr Ala Ser Arg Ser Arg Ile Ala 35 40 45Asp Thr Asp Tyr Ala Lys Thr
Thr Ala Glu Leu Thr Arg Thr Gln Ile 50 55 60Leu Gln Gln Ala Gly Thr
Ala Met Leu Ala Gln Ala Lys Ser Val Pro65 70 75 80Gln Asn Val Leu
Ser Leu Leu Gln 8529384PRTArtificial SequenceSynthetic peptide
accession number Q82UA3 293Ile Asp Asp Ala Leu Lys Ile Val Asn Ser
Thr Arg Ala Asp Leu Gly1 5 10 15Ala Ile Gln Asn Arg Phe Ser Ser Ala
Ile Ala Asn Leu Gln Thr Ser 20 25 30Ala Glu Asn Leu Ser Ala Ser Arg
Ser Arg Ile Gln Asp Ala Asp Phe 35 40 45Ala Ala Glu Thr Ala Ala Leu
Thr Arg Ala Gln Ile Leu Gln Gln Ala 50 55 60Gly Val Ala Met Leu Ser
Gln Ala Asn Ala Leu Pro Asn Asn Val Leu65 70 75 80Ser Leu Leu
Arg29489PRTArtificial SequenceSynthetic peptide accession number
Q84IC5 294Val Met Asp Ile Ala Asp Thr Ala Ile Ala Asn Leu Asp Thr
Ile Arg1 5 10 15Ala Asn Ile Gly Ala Thr Gln Asn Gln Ile Thr Ser Thr
Ile Asn Asn 20 25 30Ile Ser Val Thr Gln Val Asn Val Lys Ala Ala Glu
Ser Gln Ile Arg 35 40 45Asp Val Asp Phe Ala Ser Glu Lys Ser Ala Asn
Tyr Ser Lys Ala Asn 50 55 60Ile Leu Ala Gln Ser Gly Ser Tyr Ala Met
Ala Gln Ala Asn Ala Ala65 70 75 80Ser Gln Asn Val Leu Arg Leu Leu
Gln 85
* * * * *