U.S. patent application number 17/366648 was filed with the patent office on 2021-10-28 for nsp-interleukin-10 proteins and uses thereof.
The applicant listed for this patent is UNIVERSITY OF PITTSBURGH-OF THE COMMONWEALTH SYSTEM OF HIGHER EDUCATION. Invention is credited to Yangzi Jiang, Rocky S. Tuan.
Application Number | 20210332098 17/366648 |
Document ID | / |
Family ID | 1000005697680 |
Filed Date | 2021-10-28 |
United States Patent
Application |
20210332098 |
Kind Code |
A1 |
Jiang; Yangzi ; et
al. |
October 28, 2021 |
NSP-INTERLEUKIN-10 PROTEINS AND USES THEREOF
Abstract
Disclosed herein are Nsp-IL10 polypeptides comprising an Nsp
polypeptide and an IL10 polypeptide. In some embodiments, Nsp-IL10
polypeptide is capable of activating an NGF signaling pathway, an
IL10 signaling pathway, or both. Also disclosed are methods for
treating a disease comprising administering an Nsp-IL10
polypeptide. The methods include treating diseases associated with
joint inflammation, such as osteoarthritis.
Inventors: |
Jiang; Yangzi; (Pittsburgh,
PA) ; Tuan; Rocky S.; (Pittsburgh, PA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
UNIVERSITY OF PITTSBURGH-OF THE COMMONWEALTH SYSTEM OF HIGHER
EDUCATION |
Pittsburgh |
PA |
US |
|
|
Family ID: |
1000005697680 |
Appl. No.: |
17/366648 |
Filed: |
July 2, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16704308 |
Dec 5, 2019 |
11084857 |
|
|
17366648 |
|
|
|
|
62775433 |
Dec 5, 2018 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 14/48 20130101;
C07K 2319/02 20130101; A61K 38/00 20130101; C07K 14/5428
20130101 |
International
Class: |
C07K 14/54 20060101
C07K014/54; C07K 14/48 20060101 C07K014/48 |
Claims
1. An Nsp-IL10 polypeptide comprising an Nsp polypeptide and an
IL10 polypeptide.
2. The Nsp-IL10 polypeptide of claim 1, wherein the Nsp polypeptide
and the IL10 polypeptide are directly linked.
3. The Nsp-IL10 polypeptide of claim 1, wherein the Nsp polypeptide
comprises SEQ ID NO: 2.
4. The Nsp-IL10 polypeptide of claim 1, wherein the IL10
polypeptide comprises SEQ ID NO: 4.
5. The Nsp-IL10 polypeptide of claim 1, further comprising a signal
peptide.
6. The Nsp-IL10 polypeptide of claim 5, wherein the signal peptide
comprises SEQ ID NO: 5.
7. The Nsp-IL10 polypeptide of claim 1, further comprising one or
more linkers.
8. The Nsp-IL10 polypeptide of claim 7, where the one linker is
between the Nsp polypeptide and the IL10 polypeptide.
9. The Nsp-IL10 polypeptide of claim 7, wherein the linker
comprises SEQ ID NO: 6.
10. The Nsp-IL10 polypeptide of claim 1, wherein the IL10
polypeptide comprises an amino acid sequence having at least 60%
identity with SEQ ID NO: 4.
11. The Nsp-IL10 polypeptide of claim 1, wherein the polypeptide
comprises SEQ ID NO: 7.
12. A polynucleotide encoding the polypeptide of claim 1.
13.-19. (canceled)
20. A kit comprising a vector comprising a polynucleotide sequence
encoding an Nsp-IL10 polynucleotide operably linked to a promoter,
wherein the Nsp-IL10 polynucleotide comprises an Nsp polynucleotide
and an IL10 polynucleotide.
Description
RELATED APPLICATIONS
[0001] This application claims priority to U.S. Application Ser.
No. 62/775,433 filed Dec. 5, 2018. U.S. Application Ser. No.
62/775,433 is incorporated herein by reference in its entirety for
all purposes.
FIELD
[0002] The disclosure generally relates to proteins, including
fusion proteins, and methods for their use in treating diseases,
particularly inflammatory diseases. Specifically, the disclosed
polypeptides contain sequences from Nerve Growth Factor (NGF) and
Interleukin-10.
BACKGROUND
[0003] Pain and loss of tissue function caused chronic inflammatory
diseases has long been a major clinical challenge. For example,
osteoarthritis (OA), the most prevalent degenerative joint disease
worldwide, affects up to 20% of the population in the U.S., and is
the most common cause of mobility loss, severely affecting the
quality of life, work productivity, cost of healthcare. There is no
cure for OA, and current clinical OA management is mainly concerned
with symptom reduction, e.g., pain, swelling, stiffness, with oral
non-steroidal anti-inflammatory drugs (NSAIDs) being the most
commonly used pharmacological treatment at mid-stage of the
disease, and arthroplasty, an irreversible procedure, as the final
solution to maintain joint function. There are substantial gaps in
the knowledge of the pathogenesis and effective interventions for
early stage OA, which may prevent or delay disease development and
maintain proper joint functions.
[0004] Interleukin-10 (IL10) exhibits a range of physiological
properties, including anti-cancer and anti-tumor properties as well
as having roles in inflammation. Dysregulation of IL10 is
associated with autoimmune diseases and increased pathology in
response to infection. Through a variety of mechanisms, IL10
produces anti-inflammatory responses which serve to modulate immune
responses.
[0005] Nerve Growth Factor (NGF) was originally identified (and
therefore named) based on its functions in promoting neuronal
survival and differentiation. However, recent studies show that NGF
functions in an array of biological processes. In particular, NGF
has been implicated in the transmission and maintenance of
persistent or chronic pain and inflammation. However, mechanisms by
which NGF and NGF-derived polypeptides bind surface receptors may
influence the signaling pathway and hence, overall response of
activated cells.
[0006] While numerous factors are known to be involved in the
control of inflammatory responses, the network of molecular
interactions are poorly understood and thus, existing treatments
are limited in their capacities to treat underlying causes of
inflammation. The polypeptide compositions and methods disclosed
herein address these and other needs.
SUMMARY
[0007] The present invention relates to polypeptides containing
amino acid sequences derived from Nerve Growth Factor (NGF) and
Interleukin-10 (IL-10; IL10) and methods for uses thereof. The
present disclosure addresses at least a portion of the problems in
the prior art by providing a polypeptide comprising an NGF
polypeptide and an IL-10 polypeptide which can be co-expressed and
used to treat various inflammatory conditions.
[0008] In one aspect, disclosed herein is an Nsp-IL10 polypeptide
wherein Nsp is a portion of an NGF polypeptide that binds to an NGF
receptor. In some embodiments, the Nsp polypeptide and the IL10
polypeptide are directly linked. In some embodiments, the
polypeptide comprises a linker between the Nsp polypeptide and the
IL10 polypeptide.
[0009] In another aspect, provided herein are methods of treating a
subject with a disease comprising administering to the subject an
Nsp-IL10 polypeptide comprising an Nsp polypeptide and an IL10
polypeptide. In some embodiments, the disease is an inflammatory
disease, for instance, joint inflammation (e.g., osteoarthritis).
In some embodiments, the method treats the disease by reducing
inflammation, pain, tissue degeneration, or combinations
thereof.
[0010] In another aspect, provided herein are kits comprising a
vector comprising a polynucleotide sequence encoding an Nsp-IL10
polynucleotide operably linked to a gene promoter (referred to
herein as promoter). The Nsp-IL10 polynucleotide comprises an Nsp
polynucleotide and an IL10 polynucleotide.
[0011] Additional aspects and advantages of the disclosure will be
set forth, in part, in the detailed description and any claims
which follow, and in part will be derived from the detailed
description or can be learned by practice of the various aspects of
the disclosure. The advantages described below will be realized and
attained by means of the elements and combinations particularly
pointed out in the appended claims. It is to be understood that
both the foregoing general description and the following detailed
description are for purposes of example, are explanatory only, and
are not restrictive of the disclosure.
BRIEF DESCRIPTION OF THE DRAWINGS
[0012] The accompanying drawings, which are incorporated in and
constitute a part of this specification, illustrate certain
examples of the present disclosure and together with the
description, serve to explain, without limitation, the principles
of the disclosure. Like numbers represent the same element(s)
throughout the figures.
[0013] FIGS. 1A to 1C are schematics showing Nsp-IL10 polypeptide
expression constructs and resultant Nsp-IL10 polypeptides. FIG. 1A
is a schematic showing organization of genetic elements in some
Nsp-IL10 polypeptide expression constructs. FIG. 1B is a schematic
showing predicted tertiary structure of an Nsp-IL10 polypeptide
expressed from construct b in FIG. 1A.
[0014] FIG. 1C is a schematic showing an Nsp-IL10 polypeptide
binding cell-surface receptors in NGFR+ cells, found for example in
a joint cavity.
[0015] FIGS. 2A and 2B depict a strategy for expression of an
Nsp-IL10 polypeptide. FIG. 2A is a schematic showing an IL-10
expression plasmid usable for cloning Nsp-IL10 constructs. FIG. 2B
is a schematic showing an Nsp-IL10 polypeptide construct and the
results of a Western blot demonstrating expression of the construct
in HEK293 cells.
[0016] FIG. 3 is an immunoblot showing the downstream effects
(expression of P-TrkA, TrkA, SIRT1 and GAPDH) of Nsp-IL10
polypeptide expression in healthy (left) and diseased
(osteoarthritis; right) articular chondrocytes (AC) via Western
blot analysis.
DETAILED DESCRIPTION
[0017] The following description of the disclosure is provided as
an enabling teaching of the disclosure in its best, currently known
embodiment(s). To this end, those skilled in the relevant art will
recognize and appreciate that many changes can be made to the
various embodiments of the invention described herein, while still
obtaining the beneficial results of the present disclosure. It will
also be apparent that some of the desired benefits of the present
disclosure can be obtained by selecting some of the features of the
present disclosure without utilizing other features. Accordingly,
those who work in the art will recognize that many modifications
and adaptations to the present disclosure are possible and can even
be desirable in certain circumstances and are a part of the present
disclosure. Thus, the following description is provided as
illustrative of the principles of the present disclosure and not in
limitation thereof.
Terminology
[0018] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood to one of
ordinary skill in the art to which this invention belongs. The
following definitions are provided for the full understanding of
terms used in this specification.
[0019] Disclosed are the components to be used to prepare the
disclosed compositions as well as the compositions themselves to be
used within the methods disclosed herein. These and other materials
are disclosed herein, and it is understood that when combinations,
subsets, interactions, groups, etc. of these materials are
disclosed that while specific reference of each various individual
and collective combinations and permutation of these compounds may
not be explicitly disclosed, each is specifically contemplated and
described herein. For example, if a particular polypeptide is
disclosed and discussed and a number of modifications that can be
made to the polypeptide are discussed, specifically contemplated is
each and every combination and permutation of the polypeptide and
the modifications that are possible unless specifically indicated
to the contrary. Thus, if a class of polypeptides A, B, and C are
disclosed as well as a class of polypeptides D, E, and F and an
example of a combination polypeptide, or, for example, a
combination polypeptide comprising A-D is disclosed, then even if
each is not individually recited each is individually and
collectively contemplated meaning combinations, A-E, A-F, B-D, B-E,
B-F, C-D, C-E, and C-F are considered disclosed. Likewise, any
subset or combination of these is also disclosed. Thus, for
example, the sub-group of A-E, B-F, and C-E would be considered
disclosed. This concept applies to all aspects of this application
including, but not limited to, steps in methods of making and using
the disclosed compositions. Thus, if there are a variety of
additional steps that can be performed it is understood that each
of these additional steps can be performed with any specific
embodiment or combination of embodiments of the disclosed
methods.
[0020] It is understood that the compositions disclosed herein have
certain functions. Disclosed herein are certain structural
requirements for performing the disclosed functions, and it is
understood that there are a variety of structures which can perform
the same function which are related to the disclosed structures,
and that these structures will ultimately achieve the same
result.
[0021] Unless otherwise expressly stated, it is in no way intended
that any method set forth herein be construed as requiring that its
steps be performed in a specific order. Accordingly, where a method
claim does not actually recite an order to be followed by its steps
or it is not otherwise specifically stated in the claims or
descriptions that the steps are to be limited to a specific order,
it is no way intended that an order be inferred, in any respect.
This holds for any possible non-express basis for interpretation,
including: matters of logic with respect to arrangement of steps or
operational flow; plain meaning derived from grammatical
organization or punctuation; and the number or type of embodiments
described in the specification.
[0022] Ranges can be expressed herein as from "about" one
particular value, and/or to "about" another particular value. When
such a range is expressed, another embodiment includes from the one
particular value and/or to the other particular value. Similarly,
when values are expressed as approximations, by use of the
antecedent "about," it will be understood that the particular value
forms another embodiment. It will be further understood that the
endpoints of each of the ranges are significant both in relation to
the other endpoint, and independently of the other endpoint. It is
also understood that there are a number of values disclosed herein,
and that each value is also herein disclosed as "about" that
particular value in addition to the value itself. For example, if
the value "10" is disclosed, then "about 10" is also disclosed.
[0023] As used in the specification and claims, the singular form
"a," "an," and "the" include plural references unless the context
clearly dictates otherwise. For example, the term "an agent"
includes a plurality of agents, including mixtures thereof.
[0024] As used herein, the terms "may," "optionally," and "may
optionally" are used interchangeably and are meant to include cases
in which the condition occurs as well as cases in which the
condition does not occur. Thus, for example, the statement that a
formulation "may include an excipient" is meant to include cases in
which the formulation includes an excipient as well as cases in
which the formulation does not include an excipient.
[0025] "Administration" to a subject includes any route of
introducing or delivering to a subject an agent. Administration can
be carried out by any suitable route, including oral, topical,
intravenous, subcutaneous, transcutaneous, transdermal,
intramuscular, intra joint, parenteral, intra-arteriole,
intradermal, intraventricular, intracranial, intraperitoneal,
intralesional, intranasal, rectal, vaginal, by inhalation, via an
implanted reservoir, parenteral (e.g., subcutaneous, intravenous,
intramuscular, intra-articular, intra-synovial, intrasternal,
intrathecal, intraperitoneal, intrahepatic, intralesional, and
intracranial injections or infusion techniques), and the like.
"Concurrent administration", "administration in combination",
"simultaneous administration" or "administered simultaneously" as
used herein, means that the compounds are administered at the same
point in time, overlapping in time, or essentially immediately
following one another. In the latter case, the two compounds are
administered at times sufficiently close that the results observed
are indistinguishable from those achieved when the compounds are
administered at the same point in time. "Systemic administration"
refers to the introducing or delivering to a subject an agent via a
route which introduces or delivers the agent to extensive areas of
the subject's body (e.g. greater than 50% of the body), for example
through entrance into the circulatory or lymph systems. By
contrast, "local administration" refers to the introducing or
delivery to a subject an agent via a route which introduces or
delivers the agent to the area or area immediately adjacent to the
point of administration and does not introduce the agent
systemically in a therapeutically significant amount. For example,
locally administered agents are easily detectable in the local
vicinity of the point of administration, but are undetectable or
detectable at negligible amounts in distal parts of the subject's
body. Administration includes self-administration and the
administration by another.
[0026] "Codon optimized" as it refers to genes or coding regions of
nucleic acid molecules for the transformation of various hosts,
refers to the alteration of codons in the gene or coding regions of
polynucleic acid molecules to reflect the typical codon usage of a
selected organism without altering the polypeptide encoded by the
DNA. Due to redundancy in the genetic code, multiple codons can
encode the same amino acid. Some organisms have a preference for
using a particular codon to encode a particular amino acid, as
determined by the percentage in which that particular amino acid is
encoded by that particular codon throughout the organism's genome.
Such optimization includes replacing at least one, or more than
one, or a significant number, of codons with one or more codons
that are more frequently used in the genes of that selected
organism.
[0027] "Gene expression" and "protein expression" refer to the
process by which polynucleotides are transcribed into mRNA and the
process by which the transcribed mRNA is subsequently being
translated into peptides, polypeptides, or proteins, respectively.
If the polynucleotide is derived from genomic DNA, expression may
include splicing of the mRNA in a eukaryotic cell.
[0028] "Identical" or percent "identity," in the context of two or
more nucleic acids or polypeptide sequences, refer to two or more
sequences or subsequences that are the same or have a specified
percentage of amino acid residues or nucleotides that are the same
(e.g., about 60% identity, preferably 61%, 62%, 63%, 64%, 65%, 66%,
67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%,
80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity over a
specified region when compared and aligned for maximum
correspondence over a comparison window or designated region) as
measured using a BLAST or BLAST 2.0 sequence comparison algorithms
with default parameters described below, or by manual alignment and
visual inspection (see, e.g., NCBI web site or the like). Such
sequences are then said to be "substantially identical." This
definition also refers to, or may be applied to, the complement of
a test sequence. The definition also includes sequences that have
deletions and/or additions, as well as those that have
substitutions. As described below, the preferred algorithms can
account for gaps and the like. Preferably, identity exists over a
region that is at least about 10 amino acids or 20 nucleotides in
length, or more preferably over a region that is 10-50 amino acids
or 20-50 nucleotides in length. As used herein, percent (%) amino
acid sequence identity is defined as the percentage of amino acids
in a candidate sequence that are identical to the amino acids in a
reference sequence, after aligning the sequences and introducing
gaps, if necessary, to achieve the maximum percent sequence
identity. Alignment for purposes of determining percent sequence
identity can be achieved in various ways that are within the skill
in the art, for instance, using publicly available computer
software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign
(DNASTAR) software. Appropriate parameters for measuring alignment,
including any algorithms needed to achieve maximal alignment over
the full-length of the sequences being compared can be determined
by known methods.
[0029] For sequence comparisons, typically one sequence acts as a
reference sequence, to which test sequences are compared. When
using a sequence comparison algorithm, test and reference sequences
are entered into a computer, subsequence coordinates are
designated, if necessary, and sequence algorithm program parameters
are designated. Preferably, default program parameters can be used,
or alternative parameters can be designated. The sequence
comparison algorithm then calculates the percent sequence
identities for the test sequences relative to the reference
sequence, based on the program parameters.
[0030] One example of an algorithm that is suitable for determining
percent sequence identity and sequence similarity are the BLAST and
BLAST 2.0 algorithms, which are described in Altschul et al. (1977)
Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J Mol.
Biol. 215:403-410, respectively. Software for performing BLAST
analyses is publicly available through the National Center for
Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This
algorithm involves first identifying high scoring sequence pairs
(HSPs) by identifying short words of length W in the query
sequence, which either match or satisfy some positive-valued
threshold score T when aligned with a word of the same length in a
database sequence. T is referred to as the neighborhood word score
threshold (Altschul et al. (1990) J Mol. Biol. 215:403-410). These
initial neighborhood word hits act as seeds for initiating searches
to find longer HSPs containing them. The word hits are extended in
both directions along each sequence for as far as the cumulative
alignment score can be increased. Cumulative scores are calculated
using, for nucleotide sequences, the parameters M (reward score for
a pair of matching residues; always >0) and N (penalty score for
mismatching residues; always <0). For amino acid sequences, a
scoring matrix is used to calculate the cumulative score. Extension
of the word hits in each direction are halted when: the cumulative
alignment score falls off by the quantity X from its maximum
achieved value; the cumulative score goes to zero or below, due to
the accumulation of one or more negative-scoring residue
alignments; or the end of either sequence is reached. The BLAST
algorithm parameters W, T, and X determine the sensitivity and
speed of the alignment. The BLASTN program (for nucleotide
sequences) uses as defaults a word length (W) of 11, an expectation
(E) or 10, M=5, N=-4 and a comparison of both strands. For amino
acid sequences, the BLASTP program uses as defaults a word length
of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix
(see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA
89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4,
and a comparison of both strands.
[0031] The BLAST algorithm also performs a statistical analysis of
the similarity between two sequences (see, e.g., Karlin and
Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One
measure of similarity provided by the BLAST algorithm is the
smallest sum probability (P(N)), which provides an indication of
the probability by which a match between two nucleotide or amino
acid sequences would occur by chance. For example, a nucleic acid
is considered similar to a reference sequence if the smallest sum
probability in a comparison of the test nucleic acid to the
reference nucleic acid is less than about 0.2, more preferably less
than about 0.01.
[0032] The "linker" used herein refers to at least a bivalent
moiety with a site of attachment for a first polypeptide and a site
of attachment for a second polypeptide. For example, the first
polypeptide or the second polypeptide can be attached to the linker
at its N-terminus, its C-terminus or via a functional group on one
of the side chains. The linker is sufficient to separate the first
and the second polypeptides by at least one amino acid and in some
embodiments by more than one amino acid. In some embodiments, the
linker is sufficiently flexible to allow the first polypeptide to
bind target molecules in a manner which is independent of the
second polypeptide. In some embodiments, the linker is sufficiently
flexible to allow the second polypeptide to bind target molecules
in a manner which is independent of the first polypeptide. In some
embodiments, the first polypeptide is an Nsp polypeptide and the
second polypeptide is an IL-10 polypeptide. In some embodiments,
the first polypeptide is an IL-10 polypeptide and the second
polypeptide is an Nsp polypeptide.
[0033] A nucleic acid is "operably linked" when it is placed into a
functional relationship with another nucleic acid sequence. For
example, DNA for a presequence or secretory leader is operably
linked to DNA for a polypeptide if it is expressed as a preprotein
that participates in the secretion of the polypeptide; a promoter
or enhancer is operably linked to a coding sequence if it affects
the transcription of the sequence; or a ribosome binding site is
operably linked to a coding sequence if it is positioned so as to
facilitate translation. Generally, "operably linked" means that the
DNA sequences being linked are near each other, and, in the case of
a secretory leader, contiguous and in reading phase. However,
operably linked nucleic acids (e.g. enhancers and coding sequences)
do not have to be contiguous. Linking is accomplished by ligation
at convenient restriction sites. If such sites do not exist, the
synthetic oligonucleotide adaptors or linkers are used in
accordance with conventional practice. In some embodiments, a
promoter is operably linked with a coding sequence when it is
capable of affecting (e.g. modulating relative to the absence of
the promoter) the expression of a protein from that coding sequence
(e.g., the coding sequence is under the transcriptional control of
the promoter).
[0034] "Pharmaceutically acceptable" component can refer to a
component that is not biologically or otherwise undesirable, e.g.,
the component may be incorporated into a pharmaceutical formulation
of the invention and administered to a subject as described herein
without causing significant undesirable biological effects or
interacting in a deleterious manner with any of the other
components of the formulation in which it is contained. When used
in reference to administration to a human, the term generally
implies the component has met the required standards of
toxicological and manufacturing testing or that it is included on
the Inactive Ingredient Guide prepared by the U.S. Food and Drug
Administration.
[0035] "Pharmaceutically acceptable carrier" (sometimes referred to
as a "carrier") means a carrier or excipient that is useful in
preparing a pharmaceutical or therapeutic composition that is
generally safe and non-toxic, and includes a carrier that is
acceptable for veterinary and/or human pharmaceutical or
therapeutic use. The terms "carrier" or "pharmaceutically
acceptable carrier" can include, but are not limited to, phosphate
buffered saline solution, water, emulsions (such as an oil/water or
water/oil emulsion) and/or various types of wetting agents. As used
herein, the term "carrier" encompasses, but is not limited to, any
excipient, diluent, filler, salt, buffer, stabilizer, solubilizer,
lipid, stabilizer, or other material well known in the art for use
in pharmaceutical formulations and as described further herein.
[0036] "Polynucleotide" and "oligonucleotide" are used
interchangeably, and refer to a polymeric form of nucleotides of
any length, either deoxyribonucleotides or ribonucleotides, or
analogs thereof. Polynucleotides may have any three-dimensional
structure, and may perform any function, known or unknown. The
following are non-limiting examples of polynucleotides: a gene or
gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA,
ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides,
branched polynucleotides, plasmids, vectors, isolated DNA of any
sequence, isolated RNA of any sequence, nucleic acid probes, and
primers. A polynucleotide may comprise modified nucleotides, such
as methylated nucleotides and nucleotide analogs. If present,
modifications to the nucleotide structure may be imparted before or
after assembly of the polymer. The sequence of nucleotides may be
interrupted by non-nucleotide components. A polynucleotide may be
further modified after polymerization, such as by conjugation with
a labeling component. A polynucleotide is composed of a specific
sequence of four nucleotide bases: adenine (A); cytosine (C);
guanine (G); thymine (T); and uracil (U) for thymine (T) when the
polynucleotide is RNA. Thus, the term "polynucleotide sequence" is
the alphabetical representation of a polynucleotide molecule.
[0037] "Polypeptide" is used in its broadest sense to refer to a
compound of two or more subunit amino acids, amino acid analogs, or
peptidomimetics. The subunits may be linked by peptide bonds. In
another embodiment, the subunit may be linked by other bonds, e.g.
ester, ether, etc. As used herein the term "amino acid" refers to
either natural and/or unnatural or synthetic amino acids, including
glycine and both the D or L optical isomers, and amino acid analogs
and peptidomimetics.
[0038] "Specifically binds" when referring to a polypeptide
(including antibodies) or receptor, refers to a binding reaction
which is determinative of the presence of the protein or
polypeptide or receptor in a heterogeneous population of proteins
and other biologics. Thus, under designated conditions (e.g.
immunoassay conditions in the case of an antibody), a specified
ligand or antibody "specifically binds" to its particular "target"
(e.g. an antibody specifically binds to an endothelial antigen)
when it does not bind in a significant amount to other proteins
present in the sample or to other proteins to which the ligand or
antibody may come in contact in an organism. Generally, a first
molecule that "specifically binds" a second molecule has an
affinity constant (Ka) greater than about 10.sup.5 M.sup.-1 (e.g.,
10.sup.6 M.sup.-1, 10.sup.7 M.sup.-1, 10.sup.8 M.sup.-1, 10.sup.9
M.sup.-1, 10.sup.10 M.sup.-1, 10.sup.11 M.sup.-1, and 10.sup.12
M.sup.-1 or more) with that second molecule.
[0039] "Therapeutic agent" refers to any composition that has a
beneficial biological effect. Beneficial biological effects include
both therapeutic effects, e.g., treatment of a disorder or other
undesirable physiological condition, and prophylactic effects,
e.g., preventing symptoms of a disorder or other undesirable
physiological condition (e.g., rheumatoid arthritis). The terms
also encompass pharmaceutically acceptable, pharmacologically
active derivatives of beneficial agents specifically mentioned
herein, including, but not limited to, salts, esters, amides,
proagents, active metabolites, isomers, fragments, analogs, and the
like. When the terms "therapeutic agent" is used, then, or when a
particular agent is specifically identified, it is to be understood
that the term includes the agent per se as well as pharmaceutically
acceptable, pharmacologically active salts, esters, amides,
proagents, conjugates, active metabolites, isomers, fragments,
analogs, etc.
[0040] "Therapeutically effective amount" or "therapeutically
effective dose" of a composition (e.g. a composition comprising an
agent) refers to an amount that is effective to achieve a desired
therapeutic result. In some embodiments, a desired therapeutic
result is the control of chronic inflammation. Therapeutically
effective amounts of a given therapeutic agent will typically vary
with respect to factors such as the type and severity of the
disorder or disease being treated and the age, gender, weight, and
general condition of the subject. Thus, it is not always possible
to specify a quantified "therapeutically effective amount."
However, an appropriate "therapeutically effective amount" in any
subject case may be determined by one of ordinary skill in the art
using routine experimentation. The term can also refer to an amount
of a therapeutic agent, or a rate of delivery of a therapeutic
agent (e.g., amount over time), effective to facilitate a desired
therapeutic effect, such as pain relief. The precise desired
therapeutic effect will vary according to the condition to be
treated, the tolerance of the subject, the agent and/or agent
formulation to be administered (e.g., the potency of the
therapeutic agent, the concentration of agent in the formulation,
and the like), and a variety of other factors that are appreciated
by those of ordinary skill in the art. It is understood that,
unless specifically stated otherwise, a "therapeutically effective
amount" of a therapeutic agent can also refer to an amount that is
a prophylactically effective amount. In some instances, a desired
biological or medical response is achieved following administration
of multiple dosages of the composition to the subject over a period
of days, weeks, or years.
[0041] As used herein, "transgene" refers to exogenous genetic
material (e.g., one or more polynucleotides) that has been or can
be artificially provided to a cell. The term can be used to refer
to a "recombinant" polynucleotide encoding any of the herein
disclosed polypeptides that are the subject of the present
disclosure. The term "recombinant" refers to a sequence (e.g.,
polynucleotide or polypeptide sequence) which does not occur in the
cell to be artificially provided with the sequence, or is linked to
another polynucleotide in an arrangement which does not occur in
the cell to be artificially provided with the sequence. It is
understood that "artificial" refers to non-natural occurrence in
the host cell and includes manipulation by man, machine, exogenous
factors (e.g., enzymes, viruses, etc.), other non-natural
manipulations, or combinations thereof. A transgene can comprise a
gene operably linked to a promoter (e.g., an open reading frame),
although is not limited thereto. Upon artificially providing a
transgene to a cell, the transgene may integrate into the host cell
chromosome, exist extrachromosomally, or exist in any combination
thereof.
[0042] "Treat", "treating", "treatment" and grammatical variations
thereof, in some instances include partially or completely reducing
the severity of inflammation, reducing the overall area affected by
inflammation, and reducing the duration of inflammation as compared
with prior to treatment of the subject or as compared with the
incidence of such symptom in a general or study population.
"Treat", "treating", "treatment" and grammatical variations
thereof, in some or further instances include partially or
completely reducing the severity of arthritis (e.g.,
osteoarthritis), reducing the overall area affected by arthritis,
and reducing the duration of arthritis as compared with prior to
treatment of the subject or as compared with the incidence of such
symptom in a general or study population.
[0043] "Vector" means a DNA construct containing a DNA sequence
which is operably linked to a suitable control sequence capable of
effecting the expression of the DNA in a suitable host. Such
control sequences include a promoter to effect transcription, an
optional operator sequence to control such transcription, a
sequence encoding suitable mRNA ribosome binding sites, and
sequences which control the termination of transcription and
translation. The vector may be a plasmid, a phage particle, or
simply a potential genomic insert. Once transformed into a suitable
host, the vector may replicate and function independently of the
host genome, or may in some instances, integrate into the genome
itself. A plasmid is the most commonly used form of a vector;
however, the invention is intended to include such other forms of
vectors which serve equivalent function as and which are, or
become, known in the art.
Nsp-IL10 Polypeptides
[0044] It should be understood that the Nsp-IL10 polypeptides of
the present disclosure can be used in combination with the various
compositions, methods, products, and applications disclosed
herein.
[0045] In one aspect, disclosed herein are Nsp-IL10 polypeptides
comprising an Nsp polypeptide and an IL10 polypeptide. A surprising
discovery of the present invention is that these Nsp-IL10
polypeptides can coordinately or simultaneously activate both NGF
and IL-10 signaling pathways. The Nsp-IL10 polypeptide, when
administered to a subject, can treat chronic inflammatory diseases
such as osteoarthritis. In some embodiments, the Nsp-IL10
polypeptide maintains tissue homeostasis and/or enhances immune
modulation at least by reducing inflammation, pain, and/or delaying
tissue degeneration. The herein disclosed Nsp-IL10 polypeptides
are, in some embodiments, therefore capable of treating the
underlying causes of chronic inflammatory diseases rather than
simply reducing or ameliorating symptoms of such diseases.
[0046] As used herein, the term "Nsp" refers to an NGF small
protein, or a portion of an NGF polypeptide that binds an NGF
receptor (also called "NGFR"). "NGF" refers to a Nerve Growth
Factor (NGF) polypeptide also known as NGF.beta. and, in humans, is
encoded by the NGF gene. In some embodiments, the NGF polypeptide
or polynucleotide is that identified in one or more publicly
available databases as follows: HGNC: 7808, Entrez Gene: 4803,
Ensembl: ENSG00000134259, OMIM: 162030, and UniProtKB: P01138. In
some embodiments, the NGF polypeptide or polynucleotide comprises
the sequence of SEQ ID NO: 1, or a polypeptide sequence having at
or greater than about 80%, at or greater than about 85%, at or
greater than about 90%, at or greater than about 95%, or at or
greater than about 98% homology with SEQ ID NO: 1, or a fragment
thereof. The NGF protein can be from any vertebrate, particularly
from any mammal such as livestock such as cows, pigs, and sheep,
primates such as humans, gorillas and monkeys, rodents such as
mice, rats and guinea pigs, and other mammals such as horse, dog,
bear, deer, dolphin, felines, etc. In some embodiments, the Nsp
polypeptide is a portion of human NGF.
[0047] The Nsp polypeptide comprises a portion of an NGF
polypeptide that binds an NGF receptor. The Nsp polypeptide can
comprise more than one portion of NGF (e.g. an N-terminal portion
and a C-terminal portion). In some embodiments, the Nsp polypeptide
comprises the N-terminal half of NGF. Optionally, the Nsp
polypeptide comprises the unstructured N-terminal domain of NGF. By
"unstructured," it is meant the N-terminal domain lacks substantial
alpha-helical or .beta.-strand structure, and comprises primarily
flexible loops with large degrees of freedom. In some embodiments,
the Nsp polypeptide comprises amino acids 1-14 of NGF. In other
embodiments, the Nsp polypeptide comprises amino acids 1-12, 1-13,
2-15, 3-16 or 4-17 of NGF.
[0048] In some embodiments, the Nsp polypeptide contains at least
60% (for example, at least 60%, at least 65%, at least 70%, at
least 80%, at least 85%, at least 90%, at least 95%, at least 99%)
identity to SEQ ID NO: 2. In some embodiments, the Nsp polypeptide
comprises the amino acid sequence of SEQ ID NO: 2.
[0049] In some embodiments, a polynucleotide encoding the Nsp
polypeptide comprises a nucleic acid sequence which is at least
60%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 98%, or at least 99% identical to SEQ ID NO: 9.
In some embodiments, a polynucleotide encoding the Nsp polypeptide
comprises SEQ ID NO: 9.
[0050] NGF is a polypeptide known to bind at least two receptors
accessible at the outer surface of cell membranes: TrkA and p75NTR.
In some embodiments, the NGF receptor is selected from a tyrosine
kinase membrane receptor (Trk) and p75NTR. In some embodiments, the
NGF receptor comprises Tyrosine kinase membrane Receptor A (TrkA).
Accordingly, in some embodiments, the Nsp-IL10 polypeptide binds to
TrkA or p75NTR. In some embodiments, the Nsp-IL10 polypeptide
selectively binds TrkA (e.g., does not bind p75NTR). In some
embodiments, the Nsp-IL10 polypeptide preferably binds TrkA as
compared to p75NTR. In some embodiments, the Nsp-IL10 binding is
agonistic. In other embodiments, the Nsp-IL10 binding is
antagonistic. In some embodiments, the Nsp-IL10 polypeptide is
capable of selectively binding TrkA without substantially
activating the p75NTR-mediated apoptotic pathway. In some
embodiments, binding of the Nsp-IL10 polypeptide to an NGF receptor
activates an NGF signaling pathway. In some embodiments, binding of
the Nsp-IL10 polypeptide to an NGF receptor facilitates (e.g.,
promotes) dimerization of the NGF receptor. In some embodiments,
binding of the Nsp-IL10 polypeptide to an NGF receptor facilitates
(e.g., promotes, increases) phosphorylation of the NGF receptor. In
some embodiments, the phosphorylation comprises
autophosphorylation. For example, in some embodiments, binding of
NGF to TrkA results in dimerization and phosphorylation of TrkA,
thereby initiating the NGF signaling pathway.
[0051] The NGF signaling pathway comprises several different
signaling mediators, each having the potential to slightly or
significantly alter the cellular response to binding of NGF or the
Nsp polypeptide to an NGF receptor. For example, NGF-p75NTR binding
can result in a signaling pathway which triggers apoptosis.
Alternatively, NGF-TrkA binding can result in a signaling pathway
which activates a mitogen activated protein kinase (MAPK; also
known as extracellular signal-regulated kinase ERK) via ERK1/2
proteins. Alternatively, NGF-TrkA binding can result in a signaling
pathway which activates a phosphoinositide 3-kinase. The
phosphoinositide 3-kinase PI3K can phosphorylate and activate
protein kinase B (PKB; also known as AKT). Activation of PI3K/AKT
can result in cell protection, survival, and/or proliferation.
[0052] In some embodiments, the NGF signaling pathway comprises
PI3K/AKT activation. In some or further embodiments, the NGF
signaling pathway avoids p75NTR-mediated apoptosis, MAPK activation
(ERK1/2 activation), or both. Thus, in some embodiments, the NGF
signaling pathway includes only PI3K/AKT activation. In some
embodiments, the Nsp-IL10 polypeptide selectively binds TrkA and
selectively activates signaling via the PI3K/AKT pathway.
[0053] The Nsp-IL10 polypeptide disclosed herein further comprises
an IL10 polypeptide. As used herein, "IL10" refers to
Interleukin-10 or IL-10, an immune modulating cytokine. In some
embodiments, the IL10 polypeptide or polynucleotide is that
identified in one or more publicly available databases as follows:
HGNC: 5962, Entrez Gene: 3586, Ensembl: ENSG00000136634, OMIM:
124092, and UniProtKB: P22301. In some embodiments, the IL10
polypeptide or polynucleotide comprises the sequence of SEQ ID NO:
3, or a polypeptide sequence having at or greater than about 80%,
at or greater than about 85%, at or greater than about 90%, at or
greater than about 95%, or at or greater than about 98% homology
with SEQ ID NO: 3, or a fragment thereof.
[0054] As used herein, the term "IL10 polypeptide" refers to a
polypeptide that comprises at least a portion of IL10, which
portion binds an IL10 receptor. In some embodiments, the IL10
polypeptide comprises a full-length IL10 including a signal
peptide. The polypeptide of SEQ ID NO: 5 is an exemplary signal
peptide. In other embodiments, the IL10 polypeptide comprises a
secreted form of IL10 (lacking a signal peptide). In some
embodiments, the IL10 polypeptide is from any vertebrate,
particularly from any mammal such as livestock such as cows, pigs,
and sheep, primates such as humans, gorillas and monkeys, rodents
such as mice, rats and guinea pigs, and other mammals such as
horse, dog, bear, deer, dolphin, felines, etc.
[0055] In some embodiments, the IL10 polypeptide contains at least
60% (for example, at least 60%, at least 65%, at least 70%, at
least 80%, at least 85%, at least 90%, at least 95%, at least 99%)
identity to the amino acid sequence of SEQ ID NO: 4. In some
embodiments, the IL10 polypeptide comprises the amino acid sequence
of SEQ ID NO: 4.
[0056] In some embodiments, a polynucleotide encoding the IL10
polypeptide comprises a nucleic acid sequence which is at least
60%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 98%, or at least 99% identical to SEQ ID NO:
11. In some embodiments, a polynucleotide encoding the IL10
polypeptide comprises SEQ ID NO: 11.
[0057] In some embodiments, binding of the Nsp-IL10 peptide to an
IL-10 receptor (IL-10R) activates an IL10 signaling pathway. The
IL-10 receptor (IL-10R) can be tetrameric, being comprised of
intracellular domains which bind JAK1 and TYK2 kinases. Subsequent
autophosphorylation of these kinases activates Signal Transducer
and Activator of Transcription (STAT) family proteins including
STAT1 and STATS and primarily including STAT3. STAT activation
leads to transcriptional regulation of an array of genes.
[0058] In some embodiments, Nsp-IL10 binding facilitates (e.g.,
promotes, increases) phosphorylation of IL-10R. In some
embodiments, the phosphorylation comprises autophosphorylation. For
example, binding of Nsp-IL10 to IL-10R results in phosphorylation
of at least one of JAK1 and TYK2, thereby initiating the IL10
signaling pathway. Optionally, the IL10 signaling pathway comprises
transcriptional inhibition of cytokine expression, for example, of
pro-inflammatory cytokines. In some embodiments, the IL10 signaling
pathway reduces expression of a cytokine selected from IFN-.gamma.,
IL-2, IL-3, TNF.alpha. and GM-CSF.
[0059] In some or further embodiments, the IL10 signaling pathway
comprises increased expression of a deacetylase protein.
Optionally, the deacetylase is NAD-dependent. In some or further
embodiments, the IL10 signaling pathway comprises increased
expression of a tissue aging marker. Optionally, the tissue aging
marker is a sirtuin family protein (e.g., SIRT1, SIRT2, SIRT3,
SIRT4, SIRT5, SIRT6, or SIRT7). Optionally, the tissue aging marker
is Sirtuin1 (SIRT1).
[0060] Without wishing to be bound by any one particular mechanism,
it is thought that the Nsp polypeptide in the Nsp-IL10 polypeptide
functions to bind NGFR, thereby delivering the IL-10 polypeptide to
NGFR+ cells. In some embodiments, binding of the Nsp polypeptide to
NGFR activates an NGFR signaling pathway, while the IL-10
polypeptide activates an IL-10 signaling pathway in the same cell.
In some embodiments, the Nsp-IL10 polypeptide activates the NGFR
signaling pathway in one cell, and activates the IL-10 signaling
pathway in a separate, adjacent or nearby cell.
[0061] The Nsp polypeptide and the IL10 polypeptide can be arranged
within the Nsp-IL10 polypeptide in a number of ways. The Nsp
polypeptide and the IL10 polypeptide can be expressed from separate
genetic constructs. Alternatively, the Nsp polypeptide and the IL10
polypeptide can be expressed from the same genetic construct, for
example as a single transcript.
[0062] In some embodiments, the Nsp polypeptide and the IL10
polypeptide are directly linked. By "directly linked," it is meant
that the two polypeptides are covalently attached in a single
macromolecule, where there are no intervening amino acids between
the different polypeptides or where the individual polypeptides are
connected to one another via one or more intervening amino acids
(e.g., linkers). In some embodiments, the Nsp and IL10 polypeptides
are directly linked in a single polypeptide, for example as a
fusion protein comprising the Nsp and IL10 polypeptides. In some
embodiments, the Nsp and IL10 polypeptides are directly linked by a
post-translational modification, for example by a disulfide bridge
(e.g., cysteine-cysteine disulfide bond).
[0063] In some embodiments, an Nsp polypeptide is directly linked
to the N-terminal end of an IL10 polypeptide. In some embodiments,
the Nsp polypeptide is directly linked to the C-terminal end of the
IL10 polypeptide. In some embodiments, the continuous Nsp
polypeptide is inserted within the sequence of an IL10 polypeptide,
wherein the IL10 polypeptide includes an IL10 signal sequence. In
some embodiments, the Nsp polypeptide is inserted within the
sequence of the IL10 polypeptide C-terminal to the IL10 signal
peptide but N-terminal to the IL10 mature, secreted polypeptide. In
some embodiments, the Nsp polypeptide is inserted between the
N-terminal 18.sup.th and 19.sup.th amino acids of an IL10
polypeptide which includes an IL10 signal sequence. In other
embodiments, the Nsp polypeptide is directly linked to an IL10
polypeptide that does not comprise a signal peptide.
[0064] In some embodiments, the Nsp-IL10 polypeptide further
comprises a linker. For example, the Nsp polypeptide may be linked
to the IL10 polypeptide by an intervening linker comprising one or
more amino acids. The linker can contain one, two, three, four,
five, six, seven, eight, nine, ten, or a plurality of amino acids.
The Nsp-IL10 polypeptide can comprise more than one linkers (e.g.,
one, two, three, four, five, six, seven, eight, nine, ten, or a
plurality of linkers).
[0065] In some embodiments, a linker is between the Nsp polypeptide
and the IL10 polypeptide. In some embodiments, the linker is
positioned between an N-terminal Nsp polypeptide and a C-terminal
IL10 polypeptide. Alternatively, the linker is positioned between a
C-terminal Nsp polypeptide and an N-terminal IL10 polypeptide. In
some embodiments, the continuous Nsp polypeptide is inserted within
the sequence of the IL10 polypeptide, wherein a linker is
positioned between the Nsp polypeptide and the IL10 polypeptide. In
some embodiments, the Nsp polypeptide is inserted within the
sequence of the IL10 polypeptide C-terminal to an IL10 signal
peptide and N-terminal to an IL10 polypeptide, wherein a linker is
positioned between the Nsp polypeptide and the IL10 polypeptide. In
some embodiments, the Nsp polypeptide is inserted between the
N-terminal 18.sup.th and 19.sup.th amino acids of the IL10
polypeptide, wherein a linker is positioned between the Nsp
polypeptide and the IL10 polypeptide. In some embodiments, the
polypeptide comprises an Nsp polypeptide flanked by two linkers
inserted within the sequence of an IL10 polypeptide.
[0066] In some embodiments, the linker contains at least 60% (for
example, at least 60%, at least 65%, at least 70%, at least 80%, at
least 85%, at least 90%, at least 95%, at least 99%) identity to
the amino acid sequence of SEQ ID NO: 6. In some embodiments, the
linker comprises the amino acid sequence of SEQ ID NO: 6.
[0067] In some embodiments, a polynucleotide encoding the linker
comprises a nucleic acid sequence which is at least 60%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 98%, or at least 99% identical to SEQ ID NO: 13. In some
embodiments, a polynucleotide encoding the linker comprises SEQ ID
NO: 13.
[0068] The Nsp-IL10 polypeptide can contain additional amino acid
sequences which are not involved in activating either the NGF
pathway or the IL10 pathway. For example, the Nsp-IL10 polypeptide
can contain a signal peptide for export of the polypeptide from a
biological cell. The signal peptide can be from a neurotrophin
(e.g., NGF), IL10, or another exported protein. As another
non-limiting example, the Nsp-IL10 polypeptide can contain
additional sequences for affinity-based purification (e.g.,
Myc-DDK) and/or post-translational modifications (e.g., cysteines
for forming disulfide bonds).
[0069] In some embodiments, the Nsp-IL10 polypeptide contains at
least 60% (for example, at least 60%, at least 65%, at least 70%,
at least 80%, at least 85%, at least 90%, at least 95%, at least
99%) identity to the amino acid sequence of SEQ ID NO: 7. In some
embodiments, the Nsp-IL10 polypeptide comprises the amino acid
sequence of SEQ ID NO: 7.
[0070] In some embodiments, a polynucleotide encoding the Nsp-IL10
polypeptide comprises a nucleic acid sequence which is at least
60%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 98%, or at least 99% identical to SEQ ID NO:
14. In some embodiments, a polynucleotide encoding the Nsp-IL10
polypeptide comprises SEQ ID NO: 14.
[0071] Functional IL10 is often in the form of a dimer. As such,
the Nsp-IL10 polypeptide can comprise Nsp-IL10 polypeptide
homodimers. Alternatively, the Nsp-IL10 polypeptide can comprise an
IL10 polypeptide and Nsp-IL10 polypeptide heterodimer. As an
example, FIG. 1B is a predicted structure of Nsp-IL10 polypeptide
heterodimerized with IL10. In some embodiments, the Nsp-IL10
polypeptide can comprise a mixture of Nsp-IL10 polypeptide
homodimers and heterodimers comprising IL10 polypeptide and
Nsp-IL10 polypeptide.
[0072] The Nsp-IL10 polypeptide optionally comprises additional
components such as amino acid sequences (e.g., sequences of other
proteins, linker sequences, non-proteinogenic amino acids, etc.)
and other protein-bound molecules (e.g., cofactors, small
molecules, lipids, carbohydrates, nucleic acids, post-translational
modifications such as acylation, glycosylation, hydroxylation,
iodination, carbonylation, pegylation, etc.).
[0073] Also disclosed herein is a biological cell comprising an
Nsp-IL10 polypeptide comprising an Nsp polypeptide and an IL10
polypeptide. For example, a host cell (e.g., E. coli, mammalian
cells) can be used for production of the Nsp-IL10 polypeptide.
Alternatively, the biological cell can be bound by an Nsp-IL10
polypeptide. For example, a biological cell in a cell culture,
tissue culture, or in a subject can be bound by an Nsp-IL10
polypeptide via a cell-membrane receptor (e.g., NGFR, IL10R). The
biological cell bound by an Nsp-IL10 polypeptide can be in various
states of activation. For example, the biological cell may be bound
but be non-activated for both NGF and IL10 pathways, bound and
activated for either NGF or IL10 pathway but not both, or be
activated for both NGF and IL10 pathways.
[0074] Also disclosed herein is a composition comprising an
Nsp-IL10 polypeptide comprising an Nsp polypeptide and an IL10
polypeptide, and a pharmaceutically acceptable excipient. Suitable
excipients include, but are not limited to, salts, diluents,
binders, fillers, solubilizers, disintegrants, preservatives,
sorbents, and other components. Also disclosed herein is a
medicament comprising a pharmaceutically effective amount of an
Nsp-IL10 polypeptide comprising an Nsp polypeptide and an IL10
polypeptide. As an example, a pharmaceutically effective amount of
Nsp-IL10 polypeptide can be formulated in a hydrogel, particularly
a photocrosslinkable and biodegradable hydrogel scaffold.
Methods of Treating
[0075] Also disclosed herein are methods of treating a subject with
a disease comprising administering to the subject an Nsp-IL10
polypeptide comprising an Nsp polypeptide and an IL10 polypeptide
or an Nsp-IL10 polynucleotide comprising an Nsp polynucleotide and
an IL10 polynucleotide. The Nsp-IL10 polypeptide and polynucleotide
can be any herein disclosed.
[0076] In some embodiments, the administering step can include any
method of introducing the Nsp-IL10 polypeptide into the subject
appropriate for the polypeptide formulation. The administering step
can include at least one, two, three, four, five, six, seven,
eight, nine, or at least ten dosages. The administering step can be
performed before the subject exhibits disease symptoms (e.g.,
prophylactically), or during or after disease symptoms occur. The
administering step can be performed prior to, concurrent with, or
subsequent to administration of other agents to the subject. The
administering step can be performed with or without
co-administration of additional agents (e.g., immunosuppressive
agents, additional anti-inflammation agents).
[0077] The administering step can comprise administering the
Nsp-IL10 polypeptide as a purified polypeptide composition or in a
cellular extract. In other embodiments, the administering step
comprises administering a cell comprising a polynucleotide sequence
encoding an Nsp-IL10 polynucleotide operably linked to a promoter,
wherein the Nsp-IL10 polynucleotide comprises an Nsp polynucleotide
and an IL10 polynucleotide, and expressing the polypeptide from the
polynucleotide. In some embodiments, the cell is a chondrocyte. In
some embodiments, the administering step comprises administering a
polynucleotide sequence encoding an Nsp-IL10 polynucleotide
operably linked to a promoter, wherein the Nsp-IL10 polynucleotide
comprises an Nsp polynucleotide and an IL10 polynucleotide, and
expressing the polypeptide from the polynucleotide. In some
embodiments, the Nsp-IL10 polypeptide is expressed by a virus.
Unless specifically stated otherwise, administering a polypeptide,
as used herein, includes administering a polypeptide (e.g., in
purified or extract form), administering a polynucleotide which
encodes the polypeptide (e.g., a transgene), and administering both
a polypeptide and a polynucleotide which encodes the polypeptide.
Unless specifically stated otherwise, administering a
polynucleotide, as used herein, includes administering a
polynucleotide which encodes a polypeptide, and administering both
a polypeptide and a polynucleotide which encodes the
polypeptide.
[0078] The subject can be any mammalian subject, for example a
human, dog, cow, horse, mouse, rabbit, etc. In some embodiments,
the subject is a primate, particularly a human. The subject can be
a male or female of any age, race, creed, ethnicity, socio-economic
status, or other general classifiers.
[0079] The disease can be any disease in which administration of an
Nsp-IL10 polypeptide can be used to treat. In some embodiments, the
disease is an inflammatory disease. In some embodiments, the
disease is chronic inflammation. Non-limiting examples of
inflammatory diseases include joint inflammation (e.g.,
osteoarthritis), rheumatoid arthritis, collagen antibody-induced
arthritis, asthma, chronic peptic ulcer, tuberculosis,
periodontitis, ulcerative colitis, Crohn's disease, sinusitis,
hepatitis, bronchitis, appendicitis, dermatitis, meningitis,
ankylosing spondylitis, celiac disease, idiopathic pulmonary
fibrosis, lupus, systemic lupus erythematosus, psoriasis, type 1
diabetes, Addison's disease, allergy, arthritis, prostatitis,
diverticulitis, glomerulonephritis, hidradenitis suppurativa,
inflammatory bowel disease, interstitial cystitis, mast cell
activation syndrome, mastocytosis, otitis, pelvic inflammatory
disease, reperfusion injury, rheumatic fever, rhinitis,
sarcoidosis, transplant rejection, vasculitis, atherosclerosis,
gout, pleurisy, eczema, gastritis, splenitis, laryngitis,
thyroiditis, pharyngitis, multiple sclerosis, myopathies,
seborrheic dermatitis, Wegener's granulomatosis, acne vulgaris,
Alzheimer's disease, autoimmune diseases, hypersensitivities,
Parkinson's disease, etc., and combinations thereof.
[0080] The method can include systemic administration of the
Nsp-IL10 polypeptide or polynucleotide. Alternatively, the method
can include local administration of the Nsp-IL10 polypeptide or
polynucleotide. For example, the Nsp-IL10 polypeptide or
polynucleotide can be administered locally to areas of inflammation
such as inflamed joints. In some embodiments, the Nsp-IL10
polypeptide or polynucleotide is administered to areas of the
subject comprising chondrocytes.
[0081] In some embodiments, the method treats the disease by
reducing inflammation, pain, tissue degeneration, or combinations
thereof. In some embodiments, the method reduces inflammation
locally in areas affected by osteoarthritis. In some embodiments,
the method treats the disease by activating an NGF signaling
pathway, an IL10 signaling pathway, or combinations thereof. In
some embodiments, the method increases phosphorylation of TrkA,
increases expression of SIRT1, increases phosphorylation of cAMP
response element-binding protein (CREB), or combinations
thereof.
[0082] In some embodiments, the method includes treating a subject
with a disease comprising administering to the subject a medicament
comprising an Nsp-IL10 polypeptide comprising an Nsp polypeptide
and an IL10 polypeptide. Generally, the medicament comprises a
pharmaceutically acceptable excipient and a pharmaceutically
effective amount of an Nsp-IL10 polypeptide comprising an Nsp
polypeptide and an IL10 polypeptide.
[0083] Also disclosed herein are methods of activating an
anti-inflammatory signaling pathway in a biological cell comprising
administering to the cell an Nsp-IL10 polypeptide comprising an Nsp
polypeptide and an IL10 polypeptide. The anti-inflammatory
signaling pathway can comprise an NGF pathway or an IL10 pathway.
In some embodiments, both an NGF pathway and an IL10 pathway are
activated. In some embodiments, the biological cell is a human
cell. In some embodiments, the cell is a chondrocyte.
Kits
[0084] Also disclosed herein are kits comprising a vector
comprising a polynucleotide sequence encoding an Nsp-IL10
polynucleotide operably linked to a promoter. The Nsp-10
polynucleotide comprises an Nsp polynucleotide and an IL10
polynucleotide.
[0085] In some embodiments, the NGF polypeptide or polynucleotide
is that identified in one or more publicly available databases as
follows: HGNC: 7808, Entrez Gene: 4803, Ensembl: ENSG00000134259,
OMIM: 162030, and UniProtKB: P01138. In some embodiments, the NGF
polynucleotide comprises the sequence of SEQ ID NO: 8, or a
polynucleotide sequence having at or greater than about 80%, at or
greater than about 85%, at or greater than about 90%, at or greater
than about 95%, or at or greater than about 98% homology with SEQ
ID NO: 8. The NGF polynucleotide can be from any vertebrate,
particularly from any mammal such as livestock such as cows, pigs,
and sheep, primates such as humans, gorillas and monkeys, rodents
such as mice, rats and guinea pigs, and other mammals such as
horse, dog, bear, deer, dolphin, felines, etc. In some embodiments,
the Nsp polynucleotide is a portion of human NGF.
[0086] The Nsp polynucleotide can encode more than one portion of
NGF (e.g. an N-terminal portion and a C-terminal portion). In some
embodiments, the Nsp polynucleotide encodes the N-terminal half of
NGF. Optionally, the Nsp polynucleotide encodes the unstructured
N-terminal domain of NGF. In some embodiments, the Nsp
polynucleotide encodes amino acids 1-14 of NGF.
[0087] In some embodiments, the Nsp polynucleotide contains at
least 60% (for example, at least 60%, at least 65%, at least 70%,
at least 80%, at least 85%, at least 90%, at least 95%, at least
99%) identity to SEQ ID NO: 9. In some embodiments, the Nsp
polynucleotide comprises the sequence of SEQ ID NO: 9.
[0088] In some embodiments, the IL10 polynucleotide encodes a
full-length IL10 including a signal peptide. In other embodiments,
the IL10 polynucleotide encodes a form of IL10 lacking a signal
peptide. In some embodiments, the IL10 polynucleotide is from any
vertebrate, particularly from any mammal such as livestock such as
cows, pigs, and sheep, primates such as humans, gorillas and
monkeys, rodents such as mice, rats and guinea pigs, and other
mammals such as horse, dog, bear, deer, dolphin, felines, etc.
[0089] In some embodiments, a polynucleotide encoding the IL10
polypeptide comprises a nucleic acid sequence which is at least
60%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 98%, or at least 99% identical to SEQ ID NO:
11. In some embodiments, a polynucleotide encoding the IL10
polypeptide comprises SEQ ID NO: 11.
[0090] In some embodiments, the Nsp-IL10 polynucleotide further
comprises a linker. For example, the Nsp polynucleotide may be
linked to the IL10 polynucleotide by an intervening linker
comprising one or more nucleotides. The linker can contain one,
two, three, four, five, six, seven, eight, nine, ten, or a
plurality of nucleotides. The Nsp-IL10 polynucleotide can comprise
more than one linkers (e.g., one, two, three, four, five, six,
seven, eight, nine, ten, or a plurality of linkers).
[0091] In some embodiments, a linker is between the Nsp
polynucleotide and the IL10 polynucleotide. In some embodiments,
the linker is positioned between a 5' end of an Nsp polynucleotide
and a 3' end of a IL10 polynucleotide. Alternatively, the linker is
positioned between a 3' end of an Nsp polynucleotide and a 5' end
of a IL10 polynucleotide. In some embodiments, the continuous Nsp
polynucleotide is inserted within the sequence of the IL10
polynucleotide, wherein a linker is positioned between the Nsp
polynucleotide and the IL10 polynucleotide. In some embodiments,
the Nsp polynucleotide is inserted within the sequence of the IL10
polynucleotide 3' to an IL10 signal peptide and 5' to an IL10
polynucleotide, wherein a linker is positioned between the Nsp
polynucleotide and the IL10 polynucleotide. In some embodiments,
the polynucleotide comprises an Nsp polynucleotide flanked by two
linkers inserted within the sequence of an IL10 polynucleotide.
[0092] In some embodiments, a polynucleotide encoding the linker
comprises a nucleic acid sequence which is at least 60%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 98%, or at least 99% identical to SEQ ID NO: 13. In some
embodiments, a polynucleotide encoding the linker comprises SEQ ID
NO: 13.
[0093] In some embodiments, a polynucleotide encoding the Nsp-IL10
polypeptide comprises a nucleic acid sequence which is at least
60%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 98%, or at least 99% identical to SEQ ID NO:
14. In some embodiments, a polynucleotide encoding the Nsp-IL10
polypeptide comprises SEQ ID NO: 14.
[0094] Non-limiting examples of vectors that can be used to
introduce expression vectors that encode Nsp-10 polypeptide in
various cell types: a nucleic acid vector (e.g., a plasmid vector)
encoding Nsp-10 polypeptide can be delivered directly to bacterial
cells or cultured cells (e.g., mammalian cells) by electroporation;
a polynucleotide vector (e.g., a plasmid vector) encoding Nsp-10
polypeptide can be delivered directly to bacterial cells by
chemical transformation; a viral vector (e.g., a retroviral vector,
adenoviral vector, an adeno associated viral vector, an alphavirus
vector, a vaccinia viral vector, a herpes viral vector, etc., as
are known in the art) comprising a polynucleotide sequence encoding
Nsp-10 polypeptide can be used to deliver Nsp-10 polypeptide to
cells (e.g., mammalian cells); a baculovirus expression system can
be used to deliver Nsp-10 polypeptide to insect cells;
Agrobacterium mediated delivery can be employed in plants; and/or
lipid mediated delivery (e.g., lipofectamine, oligofectamine) can
also be employed for mammalian cells.
[0095] In some embodiments, the gene sequence (for example, of a
gene expressing Nsp-10 polypeptide) may be codon optimized, without
changing the resulting polypeptide sequence. In some embodiments,
the codon optimization includes replacing at least one, or more
than one, or a significant number, of codons with one or more
codons that are more frequently used in various organisms. In some
embodiments, the codon optimization increases expression of the
optimized gene sequence.
EXAMPLES
[0096] To further illustrate the principles of the present
disclosure, the following examples are put forth so as to provide
those of ordinary skill in the art with a complete disclosure and
description of how the compositions, articles, and methods claimed
herein are made and evaluated. They are not intended to limit the
scope of the present invention. These examples are not intended to
exclude equivalents and variations of the present invention which
are apparent to one skilled in the art. Unless indicated otherwise,
temperature is .degree. C. or is at ambient temperature, and
pressure is at or near atmospheric. There are numerous variations
and combinations of process conditions that can be used to optimize
product quality and performance. Only reasonable and routine
experimentation will be required to optimize such process
conditions.
Example 1. Development and Functional Analysis of Nsp-IL10
Polypeptide Expression System in Chondrocytes
[0097] The polypeptide Nsp-IL10 can be constructed in numerous
ways. Several embodiments of an Nsp-IL10 polypeptide containing the
NGFR targeted domain NGF Small Peptide ("Nsp") inserted at the N-
and/or C-terminus of an IL10 polypeptide are shown in FIG. 1A. The
expression constructs can contain, for example, a Myc-DDK tag for
purification and/or identification purposes. A cytomegalovirus
(CMV) promoter is an example promoter which can be used to drive
expression of the polypeptide mRNA. Three example construct
strategies (a, b, and c) are shown, representing different
placements of an Nsp sequence within the recombinant construct.
Strategy a includes fusion of an Nsp sequence at the C-terminal end
of an IL10 polypeptide. Strategy b, further detailed in FIG. 2,
includes insertion of an Nsp sequence at the N-terminus of an IL10
polypeptide and at the C-terminal end of an IL10 signal peptide.
Strategy c includes a combination of strategies a and b. Item d
depicts the human IL-10 vector control, in which no Nsp sequence is
included. Internal ribosome entry sites (IRES) are included in each
construct, which can drive expression of a reporter gene to track
transcription of the overall construct. Any reporter gene capable
of tracking transcription can be used; for example, green
fluorescent protein (Gfp).
[0098] The predicted protein structure of Nsp-IL10 construct b from
RaptorX shows no conformational change in IL-10 in polypeptide
expression strategy b (FIG. 1B). Amino acids 19-178 of IL-10 retain
native structure, despite insertion of the Nsp sequence near the
N-terminus of IL-10.
[0099] Because Nsp specifically binds NGFR, Nsp functions to target
Nsp-IL10 polypeptide to NGFR for specific delivery of IL-10 to
NGFR+ cells (FIG. 1C). Nsp specifically binds the NGF receptor
TrkA, thereby additionally positioning IL-10 adjacent to NGFR+
cells. Thus, Nsp-IL10 polypeptide is capable of activating both the
NGFR and IL-10 signaling pathways, either in the same cell or in
separate, adjacent or nearby cells.
[0100] Plasmid-based transgene constructs can be sub-cloned into
viral vectors, which can be transduced into mammalian cells for
efficient, heterologous expression of proteins. An example
construct used for Nsp-IL10 polypeptide construction and expression
in mammalian cells is shown in FIG. 2A. In one example embodiment,
strategy b of FIG. 1A was used to develop an Nsp-IL10 polypeptide
and determine expression in human cells (FIG. 2B). The Nsp sequence
was placed at the N-terminus of IL10 polypeptide lacking a signal
peptide and at the C-terminus of an IL10 signal peptide in a human
IL-10 expression construct. The construct further contained a
Myc-DDK tag for purification and/or identification purposes. The
gene construct was transduced into a HEK293 cell line and analyzed
for expression (FIG. 2B). IL-10 Western blot analysis of
supernatants from cultures of HEK293 cells showed results from
cells harboring non-transgene control (Ctrl), human IL-10 transgene
(hIL10) and Nsp-IL10 polypeptide transgene (Nsp-IL10),
respectively.
[0101] The function of Nsp-IL10 protein from HEK293 culture medium
was analyzed. Primary isolated human derived articular chondrocytes
(AC) were used as reporter cells of NGF and IL-10 signaling. ACs
were isolated from healthy ("Healthy AC") and diseased ("OA AC")
areas of the same total knee joint replacement patient. ACs were
treated with Nsp-IL10-containing medium for 48 hours. Western blot
analysis showed that within 48 hours Nsp-IL10 treatment activated
the NGF receptor Tyrosine kinase membrane receptor A (TrkA), as
shown by appearance of phosphorylated TrkA (p-TrkA). Further,
expression of a marker gene related to the control of cellular
aging, Sirtuin 1 (SIRT1) was enhanced with IL-10 treatment compared
to untreated controls (Ctrl). SIRT1 inhibits apoptosis and enhances
survival of human OA chondrocytes. Results of p-TrkA and SIRT1
Western blot analysis indicated simultaneous activation of both NGF
and IL10 mediated signaling pathways. P2, DMEM:F12 1:1, 10% fetal
bovine serum (FBS) was used as the HEK293 cell culture conditions.
Cultures were grown to full confluence, then pre-incubated in 2%
FBS hDMEM for 24 hours. Cells were then removed by centrifugation,
and culture medium was added to AC cultures for 48 hours.
Anti-GAPDH antibody was used as a loading control in Western blot
experiments.
REFERENCES
[0102] Jiang, Y. & Tuan, R. S. Origin and function of cartilage
stem/progenitor cells in osteoarthritis. Nat Rev Rheumatol,
doi:10.1038/nrrheum.2014.200 (2014). [0103] Jiang, Y. et al.
Cartilage stem/progenitor cells are activated in osteoarthritis via
interleukin-1beta/nerve growth factor signaling. Arthritis Res Ther
17, 327, doi:10.1186/s13075-015-0840-x (2015). [0104] Travaglia, A.
et al. A small linear peptide encompassing the NGF N-terminus
partly mimics the biological activities of the entire neurotrophin
in PC12 cells. ACS chemical neuroscience 6, 1379-1392,
doi:10.1021/acschemneuro.5b00069 (2015). [0105] Lin, H., Cheng, A.
W., Alexander, P. G., Beck, A. M. & Tuan, R. S. Cartilage
tissue engineering application of injectable gelatin hydrogel with
in situ visible-light-activated gelation capability in both air and
aqueous solution. Tissue Eng Part A 20, 2402-2411,
doi:10.1089/ten.TEA.2013.0642 (2014). [0106] Lin, H., Xue, J., Yin,
W., Wang, B, Tuan, R S. BMP-2 gene and cell-functionalized 3D
scaffolds for the repair of cranial bone defect. Orthopaedic
Research Society 2013 Annual Meeting, San Antonio, Tex. (2013).
TABLE-US-00001 [0106] Example 2. Sequences. An NGF amino acid
sequence SEQ ID NO: 1
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRR
ARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADT
QDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTAT
DIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSY
CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA An Nsp amino acid
sequence SEQ ID NO: 2 SSSHPIFHRGEFSV An IL-10 amino acid sequence.
SEQ ID NO: 3 MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSR
VKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAEN
QDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ
EKGIYKAMSEFDIFINYIEAYMTMKIRN An IL-10 amino acid sequence SEQ ID
NO: 4 SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKE
SLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKT
LRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYI EAYMTMKIRN An
IL-10 amino acid sequence SEQ ID NO: 5 MHSSALLCCLVLLTGVRA A linker
amino acid sequence SEQ ID NO: 6 GGSG An Nsp-IL10 polypeptide amino
acid sequence SEQ ID NO: 7
MHSSALLCCLVLLTGVRAGGSGSSSHPIFHRGEFSVGGSGSPGQGTQSEN
SCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYL
GCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHR
FLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN A DNA sequence
encoding the NGF polypeptide of SEQ ID NO: 1 SEQ ID NO: 8
ATGTCCATGTTGTTCTACACTCTGATCACAGCTTTTCTGATCGGCATACA
GGCGGAACCACACTCAGAGAGCAATGTCCCTGCAGGACACACCATCCCCC
AAGCCCACTGGACTAAACTTCAGCATTCCCTTGACACTGCCCTTCGCAGA
GCCCGCAGCGCCCCGGCAGCGGCGATAGCTGCACGCGTGGCGGGGCAGAC
CCGCAACATTACTGTGGACCCCAGGCTGTTTAAAAAGCGGCGACTCCGTT
CACCCCGTGTGCTGTTTAGCACCCAGCCTCCCCGTGAAGCTGCAGACACT
CAGGATCTGGACTTCGAGGTCGGTGGTGCTGCCCCCTTCAACAGGACTCA
CAGGAGCAAGCGGTCATCATCCCATCCCATCTTCCACAGGGGCGAATTCT
CGGTGTGTGACAGTGTCAGCGTGTGGGTTGGGGATAAGACCACCGCCACA
GACATCAAGGGCAAGGAGGTGATGGTGTTGGGAGAGGTGAACATTAACAA
CAGTGTATTCAAACAGTACTTTTTTGAGACCAAGTGCCGGGACCCAAATC
CCGTTGACAGCGGGTGCCGGGGCATTGACTCAAAGCACTGGAACTCATAT
TGTACCACGACTCACACCTTTGTCAAGGCGCTGACCATGGATGGCAAGCA
GGCTGCCTGGCGGTTTATCCGGATAGATACGGCCTGTGTGTGTGTGCTCA
GCAGGAAGGCTGTGAGAAGAGCCTGA A DNA sequence encoding the Nsp
polypeptide of SEQ ID NO: 2 SEQ ID NO: 9
TCATCATCCCATCCCATCTTCCACAGGGGCGAATTCTCGGTG A DNA sequence encoding
the IL-10 polypeptide of SEQ ID NO: 3 SEQ ID NO: 10
ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAG
GGCCAGCCCAGGCCAGGGCACCCAGTCTGAGAACAGCTGCACCCACTTCC
CAGGCAACCTGCCTAACATGCTTCGAGATCTCCGAGATGCCTTCAGCAGA
GTGAAGACTTTCTTTCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAA
GGAGTCCTTGCTGGAGGACTTTAAGGGTTACCTGGGTTGCCAAGCCTTGT
CTGAGATGATCCAGTTTTACCTGGAGGAGGTGATGCCCCAAGCTGAGAAC
CAAGACCCAGACATCAAGGCGCATGTGAACTCCCTGGGGGAGAACCTGAA
GACCCTCAGGCTGAGGCTACGGCGCTGTCATCGATTTCTTCCCTGTGAAA
ACAAGAGCAAGGCCGTGGAGCAGGTGAAGAATGCCTTTAATAAGCTCCAA
GAGAAAGGCATCTACAAAGCCATGAGTGAGTTTGACATCTTCATCAACTA
CATAGAAGCCTACATGACAATGAAGATACGAAACTGA A DNA sequence encoding the
IL10 amino acid sequence of SEQ ID NO: 4 SEQ ID NO: 11
AGCCCAGGCCAGGGCACCCAGTCTGAGAACAGCTGCACCCACTTCCCAGG
CAACCTGCCTAACATGCTTCGAGATCTCCGAGATGCCTTCAGCAGAGTGA
AGACTTTCTTTCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAAGGAG
TCCTTGCTGGAGGACTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCTGA
GATGATCCAGTTTTACCTGGAGGAGGTGATGCCCCAAGCTGAGAACCAAG
ACCCAGACATCAAGGCGCATGTGAACTCCCTGGGGGAGAACCTGAAGACC
CTCAGGCTGAGGCTACGGCGCTGTCATCGATTTCTTCCCTGTGAAAACAA
GAGCAAGGCCGTGGAGCAGGTGAAGAATGCCTTTAATAAGCTCCAAGAGA
AAGGCATCTACAAAGCCATGAGTGAGTTTGACATCTTCATCAACTACATA
GAAGCCTACATGACAATGAAGATACGAAACTGA A DNA sequence encoding the IL10
amino acid sequence of SEQ ID NO: 5 SEQ ID NO: 12
ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAG GGCC A DNA
sequence encoding the linker amino acid sequence of SEQ ID NO: 6
SEQ ID NO: 13 GGAGGATCAGGC A DNA sequence encoding the Nsp-IL10
polypeptide of SEQ ID NO: 7 SEQ ID NO: 14
ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAG
GGCCGGAGGATCAGGCTCATCATCCCATCCCATCTTCCACAGGGGCGAAT
TCTCGGTGGGAGGATCAGGCAGCCCAGGCCAGGGCACCCAGTCTGAGAAC
AGCTGCACCCACTTCCCAGGCAACCTGCCTAACATGCTTCGAGATCTCCG
AGATGCCTTCAGCAGAGTGAAGACTTTCTTTCAAATGAAGGATCAGCTGG
ACAACTTGTTGTTAAAGGAGTCCTTGCTGGAGGACTTTAAGGGTTACCTG
GGTTGCCAAGCCTTGTCTGAGATGATCCAGTTTTACCTGGAGGAGGTGAT
GCCCCAAGCTGAGAACCAAGACCCAGACATCAAGGCGCATGTGAACTCCC
TGGGGGAGAACCTGAAGACCCTCAGGCTGAGGCTACGGCGCTGTCATCGA
TTTCTTCCCTGTGAAAACAAGAGCAAGGCCGTGGAGCAGGTGAAGAATGC
CTTTAATAAGCTCCAAGAGAAAGGCATCTACAAAGCCATGAGTGAGTTTG
ACATCTTCATCAACTACATAGAAGCCTACATGACAATGAAGATACGAAAC TGA
[0107] Publications cited herein are hereby specifically
incorporated by reference in their entireties and at least for the
material for which they are cited.
[0108] It should be understood that, while the present disclosure
has been provided in detail with respect to certain illustrative
and specific aspects thereof, it should not be considered limited
to such, as numerous modifications are possible without departing
from the broad spirit and scope of the present disclosure as
defined in the appended claims. It is, therefore, intended that the
appended claims cover all such equivalent variations as fall within
the true spirit and scope of the invention.
Sequence CWU 1
1
141241PRTHomo sapiens 1Met Ser Met Leu Phe Tyr Thr Leu Ile Thr Ala
Phe Leu Ile Gly Ile1 5 10 15Gln Ala Glu Pro His Ser Glu Ser Asn Val
Pro Ala Gly His Thr Ile 20 25 30Pro Gln Ala His Trp Thr Lys Leu Gln
His Ser Leu Asp Thr Ala Leu 35 40 45Arg Arg Ala Arg Ser Ala Pro Ala
Ala Ala Ile Ala Ala Arg Val Ala 50 55 60Gly Gln Thr Arg Asn Ile Thr
Val Asp Pro Arg Leu Phe Lys Lys Arg65 70 75 80Arg Leu Arg Ser Pro
Arg Val Leu Phe Ser Thr Gln Pro Pro Arg Glu 85 90 95Ala Ala Asp Thr
Gln Asp Leu Asp Phe Glu Val Gly Gly Ala Ala Pro 100 105 110Phe Asn
Arg Thr His Arg Ser Lys Arg Ser Ser Ser His Pro Ile Phe 115 120
125His Arg Gly Glu Phe Ser Val Cys Asp Ser Val Ser Val Trp Val Gly
130 135 140Asp Lys Thr Thr Ala Thr Asp Ile Lys Gly Lys Glu Val Met
Val Leu145 150 155 160Gly Glu Val Asn Ile Asn Asn Ser Val Phe Lys
Gln Tyr Phe Phe Glu 165 170 175Thr Lys Cys Arg Asp Pro Asn Pro Val
Asp Ser Gly Cys Arg Gly Ile 180 185 190Asp Ser Lys His Trp Asn Ser
Tyr Cys Thr Thr Thr His Thr Phe Val 195 200 205Lys Ala Leu Thr Met
Asp Gly Lys Gln Ala Ala Trp Arg Phe Ile Arg 210 215 220Ile Asp Thr
Ala Cys Val Cys Val Leu Ser Arg Lys Ala Val Arg Arg225 230 235
240Ala214PRTArtificial SequenceSynthetic construct 2Ser Ser Ser His
Pro Ile Phe His Arg Gly Glu Phe Ser Val1 5 103178PRTHomo sapiens
3Met His Ser Ser Ala Leu Leu Cys Cys Leu Val Leu Leu Thr Gly Val1 5
10 15Arg Ala Ser Pro Gly Gln Gly Thr Gln Ser Glu Asn Ser Cys Thr
His 20 25 30Phe Pro Gly Asn Leu Pro Asn Met Leu Arg Asp Leu Arg Asp
Ala Phe 35 40 45Ser Arg Val Lys Thr Phe Phe Gln Met Lys Asp Gln Leu
Asp Asn Leu 50 55 60Leu Leu Lys Glu Ser Leu Leu Glu Asp Phe Lys Gly
Tyr Leu Gly Cys65 70 75 80Gln Ala Leu Ser Glu Met Ile Gln Phe Tyr
Leu Glu Glu Val Met Pro 85 90 95Gln Ala Glu Asn Gln Asp Pro Asp Ile
Lys Ala His Val Asn Ser Leu 100 105 110Gly Glu Asn Leu Lys Thr Leu
Arg Leu Arg Leu Arg Arg Cys His Arg 115 120 125Phe Leu Pro Cys Glu
Asn Lys Ser Lys Ala Val Glu Gln Val Lys Asn 130 135 140Ala Phe Asn
Lys Leu Gln Glu Lys Gly Ile Tyr Lys Ala Met Ser Glu145 150 155
160Phe Asp Ile Phe Ile Asn Tyr Ile Glu Ala Tyr Met Thr Met Lys Ile
165 170 175Arg Asn4160PRTArtificial SequenceSynthetic construct
4Ser Pro Gly Gln Gly Thr Gln Ser Glu Asn Ser Cys Thr His Phe Pro1 5
10 15Gly Asn Leu Pro Asn Met Leu Arg Asp Leu Arg Asp Ala Phe Ser
Arg 20 25 30Val Lys Thr Phe Phe Gln Met Lys Asp Gln Leu Asp Asn Leu
Leu Leu 35 40 45Lys Glu Ser Leu Leu Glu Asp Phe Lys Gly Tyr Leu Gly
Cys Gln Ala 50 55 60Leu Ser Glu Met Ile Gln Phe Tyr Leu Glu Glu Val
Met Pro Gln Ala65 70 75 80Glu Asn Gln Asp Pro Asp Ile Lys Ala His
Val Asn Ser Leu Gly Glu 85 90 95Asn Leu Lys Thr Leu Arg Leu Arg Leu
Arg Arg Cys His Arg Phe Leu 100 105 110Pro Cys Glu Asn Lys Ser Lys
Ala Val Glu Gln Val Lys Asn Ala Phe 115 120 125Asn Lys Leu Gln Glu
Lys Gly Ile Tyr Lys Ala Met Ser Glu Phe Asp 130 135 140Ile Phe Ile
Asn Tyr Ile Glu Ala Tyr Met Thr Met Lys Ile Arg Asn145 150 155
160518PRTArtificial SequenceSynthetic construct 5Met His Ser Ser
Ala Leu Leu Cys Cys Leu Val Leu Leu Thr Gly Val1 5 10 15Arg
Ala64PRTArtificial SequenceSynthetic construct 6Gly Gly Ser
Gly17200PRTArtificial SequenceSynthetic construct 7Met His Ser Ser
Ala Leu Leu Cys Cys Leu Val Leu Leu Thr Gly Val1 5 10 15Arg Ala Gly
Gly Ser Gly Ser Ser Ser His Pro Ile Phe His Arg Gly 20 25 30Glu Phe
Ser Val Gly Gly Ser Gly Ser Pro Gly Gln Gly Thr Gln Ser 35 40 45Glu
Asn Ser Cys Thr His Phe Pro Gly Asn Leu Pro Asn Met Leu Arg 50 55
60Asp Leu Arg Asp Ala Phe Ser Arg Val Lys Thr Phe Phe Gln Met Lys65
70 75 80Asp Gln Leu Asp Asn Leu Leu Leu Lys Glu Ser Leu Leu Glu Asp
Phe 85 90 95Lys Gly Tyr Leu Gly Cys Gln Ala Leu Ser Glu Met Ile Gln
Phe Tyr 100 105 110Leu Glu Glu Val Met Pro Gln Ala Glu Asn Gln Asp
Pro Asp Ile Lys 115 120 125Ala His Val Asn Ser Leu Gly Glu Asn Leu
Lys Thr Leu Arg Leu Arg 130 135 140Leu Arg Arg Cys His Arg Phe Leu
Pro Cys Glu Asn Lys Ser Lys Ala145 150 155 160Val Glu Gln Val Lys
Asn Ala Phe Asn Lys Leu Gln Glu Lys Gly Ile 165 170 175Tyr Lys Ala
Met Ser Glu Phe Asp Ile Phe Ile Asn Tyr Ile Glu Ala 180 185 190Tyr
Met Thr Met Lys Ile Arg Asn 195 2008726DNAHomo sapiens 8atgtccatgt
tgttctacac tctgatcaca gcttttctga tcggcataca ggcggaacca 60cactcagaga
gcaatgtccc tgcaggacac accatccccc aagcccactg gactaaactt
120cagcattccc ttgacactgc ccttcgcaga gcccgcagcg ccccggcagc
ggcgatagct 180gcacgcgtgg cggggcagac ccgcaacatt actgtggacc
ccaggctgtt taaaaagcgg 240cgactccgtt caccccgtgt gctgtttagc
acccagcctc cccgtgaagc tgcagacact 300caggatctgg acttcgaggt
cggtggtgct gcccccttca acaggactca caggagcaag 360cggtcatcat
cccatcccat cttccacagg ggcgaattct cggtgtgtga cagtgtcagc
420gtgtgggttg gggataagac caccgccaca gacatcaagg gcaaggaggt
gatggtgttg 480ggagaggtga acattaacaa cagtgtattc aaacagtact
tttttgagac caagtgccgg 540gacccaaatc ccgttgacag cgggtgccgg
ggcattgact caaagcactg gaactcatat 600tgtaccacga ctcacacctt
tgtcaaggcg ctgaccatgg atggcaagca ggctgcctgg 660cggtttatcc
ggatagatac ggcctgtgtg tgtgtgctca gcaggaaggc tgtgagaaga 720gcctga
726942DNAArtificial SequenceSynthetic construct 9tcatcatccc
atcccatctt ccacaggggc gaattctcgg tg 4210537DNAHomo sapiens
10atgcacagct cagcactgct ctgttgcctg gtcctcctga ctggggtgag ggccagccca
60ggccagggca cccagtctga gaacagctgc acccacttcc caggcaacct gcctaacatg
120cttcgagatc tccgagatgc cttcagcaga gtgaagactt tctttcaaat
gaaggatcag 180ctggacaact tgttgttaaa ggagtccttg ctggaggact
ttaagggtta cctgggttgc 240caagccttgt ctgagatgat ccagttttac
ctggaggagg tgatgcccca agctgagaac 300caagacccag acatcaaggc
gcatgtgaac tccctggggg agaacctgaa gaccctcagg 360ctgaggctac
ggcgctgtca tcgatttctt ccctgtgaaa acaagagcaa ggccgtggag
420caggtgaaga atgcctttaa taagctccaa gagaaaggca tctacaaagc
catgagtgag 480tttgacatct tcatcaacta catagaagcc tacatgacaa
tgaagatacg aaactga 53711483DNAArtificial SequenceSynthetic
construct 11agcccaggcc agggcaccca gtctgagaac agctgcaccc acttcccagg
caacctgcct 60aacatgcttc gagatctccg agatgccttc agcagagtga agactttctt
tcaaatgaag 120gatcagctgg acaacttgtt gttaaaggag tccttgctgg
aggactttaa gggttacctg 180ggttgccaag ccttgtctga gatgatccag
ttttacctgg aggaggtgat gccccaagct 240gagaaccaag acccagacat
caaggcgcat gtgaactccc tgggggagaa cctgaagacc 300ctcaggctga
ggctacggcg ctgtcatcga tttcttccct gtgaaaacaa gagcaaggcc
360gtggagcagg tgaagaatgc ctttaataag ctccaagaga aaggcatcta
caaagccatg 420agtgagtttg acatcttcat caactacata gaagcctaca
tgacaatgaa gatacgaaac 480tga 4831254DNAArtificial SequenceSynthetic
construct 12atgcacagct cagcactgct ctgttgcctg gtcctcctga ctggggtgag
ggcc 541312DNAArtificial SequenceSynthetic construct 13ggaggatcag
gc 1214603DNAArtificial SequenceSynthetic construct 14atgcacagct
cagcactgct ctgttgcctg gtcctcctga ctggggtgag ggccggagga 60tcaggctcat
catcccatcc catcttccac aggggcgaat tctcggtggg aggatcaggc
120agcccaggcc agggcaccca gtctgagaac agctgcaccc acttcccagg
caacctgcct 180aacatgcttc gagatctccg agatgccttc agcagagtga
agactttctt tcaaatgaag 240gatcagctgg acaacttgtt gttaaaggag
tccttgctgg aggactttaa gggttacctg 300ggttgccaag ccttgtctga
gatgatccag ttttacctgg aggaggtgat gccccaagct 360gagaaccaag
acccagacat caaggcgcat gtgaactccc tgggggagaa cctgaagacc
420ctcaggctga ggctacggcg ctgtcatcga tttcttccct gtgaaaacaa
gagcaaggcc 480gtggagcagg tgaagaatgc ctttaataag ctccaagaga
aaggcatcta caaagccatg 540agtgagtttg acatcttcat caactacata
gaagcctaca tgacaatgaa gatacgaaac 600tga 603
* * * * *
References