U.S. patent application number 17/096931 was filed with the patent office on 2021-10-21 for garp-tgf-beta antibodies.
The applicant listed for this patent is argenx BVBA, Universite Catholique de Louvain. Invention is credited to Filip Borgions, Pierre Coulie, Gitte De Boeck, Torsten Dreier, Stephanie Lienart, Sophie Lucas, Lore Marien, Sebastian van der Woning.
Application Number | 20210324061 17/096931 |
Document ID | / |
Family ID | 1000005681700 |
Filed Date | 2021-10-21 |
United States Patent
Application |
20210324061 |
Kind Code |
A1 |
van der Woning; Sebastian ;
et al. |
October 21, 2021 |
GARP-TGF-BETA ANTIBODIES
Abstract
The present invention relates to antibodies and antigen binding
fragments thereof, which bind to a complex of GARP and TGF-.beta.1,
particularly a complex of human GARP and human TGF-.beta.1. These
antibodies and antigen binding fragments exhibit a combination of
advantageous properties including high affinity antigen binding and
the ability to inhibit the release of active TGF-.beta. from
regulatory T cells. The antibodies and antigen binding fragments of
the present invention are relatively resistant to deamidation,
isomerization and oxidation, such that they display improved
stability.
Inventors: |
van der Woning; Sebastian;
(Bachte-Maria-Leerne, BE) ; Borgions; Filip;
(Herk-de-Stad, BE) ; Dreier; Torsten;
(Sint-Martens-Latem, BE) ; Marien; Lore; (Gent,
BE) ; De Boeck; Gitte; (Malderen, BE) ;
Lienart; Stephanie; (Sawston, GB) ; Lucas;
Sophie; (Duisburg, BE) ; Coulie; Pierre;
(Kraainem, BE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
argenx BVBA
Universite Catholique de Louvain |
Zwijnaarde
Louvain-la-Neuve |
|
BE
BE |
|
|
Family ID: |
1000005681700 |
Appl. No.: |
17/096931 |
Filed: |
November 12, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16409679 |
May 10, 2019 |
10875914 |
|
|
17096931 |
|
|
|
|
15977449 |
May 11, 2018 |
10479829 |
|
|
16409679 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/94 20130101;
C07K 2317/565 20130101; C07K 16/28 20130101; C07K 2317/732
20130101; C07K 2317/55 20130101; C07K 2317/33 20130101; C07K 16/22
20130101; C07K 2317/56 20130101; C07K 2317/32 20130101; C07K
2317/22 20130101; A61K 2039/505 20130101; C07K 2317/76 20130101;
C07K 2317/526 20130101; C07K 2317/92 20130101 |
International
Class: |
C07K 16/22 20060101
C07K016/22; C07K 16/28 20060101 C07K016/28 |
Foreign Application Data
Date |
Code |
Application Number |
May 11, 2017 |
GB |
1707561.5 |
Claims
1. A recombinant antibody or antigen binding fragment thereof,
which binds to a complex of human glycoprotein A repetitions
predominant (GARP) and TGF-.beta.1, wherein the antibody or antigen
binding fragment thereof comprises a heavy chain variable domain
(VH), wherein: the VH CDR3 comprises the amino acid sequence
YEWETVVVGDLMYEYEY (SEQ ID NO: 13), the VH CDR2 comprises the amino
acid sequence RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), and the VH CDR1
comprises the amino acid sequence SYYID (SEQ ID NO: 4); and a light
chain variable domain (VL), wherein: the VL CDR3 comprises the
amino acid sequence QQYASVPVT (SEQ ID NO: 11), the VL CDR2
comprises the amino acid sequence GASRLKT (SEQ ID NO: 10), and the
VL CDR1 comprises the amino acid sequence QASQSISSYLA (SEQ ID NO:
9).
2. The antibody or antigen binding fragment of claim 1, wherein the
heavy chain variable domain (VH) is a humanised, germlined or
affinity variant of a camelid-derived VH domain.
3. The antibody or antigen binding fragment of claim 1, wherein the
light chain variable domain (VL) is a humanised, germlined or
affinity variant of a camelid-derived VL domain.
4. The antibody or antigen binding fragment of claim 1, wherein the
heavy chain variable domain (VH) comprises the amino acid sequence
of SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%,
98% or 99% identical thereto.
5. The antibody or antigen binding fragment of claim 1, wherein the
light chain variable domain (VL) comprises the amino acid sequence
of SEQ ID NO: 15 or an amino acid sequence at least 90%, 95%, 97%,
98% or 99% identical thereto.
6. The antibody or antigen binding fragment of claim 1, wherein the
heavy chain variable domain (VH) comprises the amino acid sequence
of SEQ ID NO: 14, and the light chain variable domain (VL)
comprises the amino acid sequence of SEQ ID NO: 15.
7. The antibody or antigen binding fragment of claim 1, further
comprising the CH1 domain, hinge region, CH2 domain and/or CH3
domain of a human IgG.
8. The antibody or antigen binding fragment of claim 7, wherein the
human IgG is IgG1.
9. The antibody or antigen binding fragment of claim 7, wherein the
human IgG is IgG4.
10. The antibody or antigen binding fragment of claim 9, wherein
the human IgG4 has the substitution S228P in the CH3 domain.
11. The antibody or antigen binding fragment of claim 1, comprising
at least one heavy chain comprising the amino acid sequence of SEQ
ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98% or
99% identical thereto.
12. The antibody or antigen binding fragment of claim 1, comprising
at least one light chain comprising the amino acid sequence of SEQ
ID NO: 17 or an amino acid sequence at least 90%, 95%, 97%, 98% or
99% identical thereto.
13. The antibody or antigen binding fragment of claim 1, wherein
said VH domain and VL domain when tested as a Fab fragment exhibit
an off-rate (k.sub.off) for the complex of GARP and TGF-.beta.1 of
less than 5.times.10 s.sup.-1.
14. The antibody or antigen binding fragment of claim 1, wherein
said VH domain and VL domain when tested as a mAb exhibit a K.sub.D
of less than 1.7.times.10.sup.-9 M.
15. The antibody or antigen binding fragment of claim 1, which
blocks release of active TGF-.beta. from regulatory T cells.
16. An isolated polynucleotide which encodes the heavy chain
variable domain of the antibody or antigen binding fragment of
claim 1.
17. The isolated polynucleotide of claim 16, which comprises the
sequence of SEQ ID NO:18.
18. An isolated polynucleotide which encodes the light chain
variable domain of the antibody or antigen binding fragment of
claim 1.
19. The isolated polynucleotide of claim 18, which comprises the
sequence of SEQ ID NO:19.
20. An isolated polynucleotide which encodes the antibody or
antigen binding fragment of claim 1.
21.-30. (canceled)
Description
RELATED APPLICATION
[0001] This application claims benefit of priority to Great Britain
Provisional Application No. 1707561.5, filed on May 11, 2017, the
entire contents of which are incorporated herein by reference.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on May 10, 2018. Is named 597392_AGX5-035_ST25.txt and is 43,939
bytes in size.
FIELD OF THE INVENTION
[0003] The present invention relates to antibodies and antigen
binding fragments thereof, which bind to a complex of GARP and
TGF-.beta.1, particularly a complex of human GARP and human
TGF-.beta.1. These antibodies and antigen binding fragments exhibit
a combination of advantageous properties including high affinity
antigen binding and the ability to inhibit the release of active
TGF-.beta. from regulatory T cells. The antibodies and antigen
binding fragments of the present invention are improved as compared
with prior art antibodies binding to the complex of GARP and
TGF-.beta.1. In particular, the antibodies and antigen binding
fragments of the present invention are relatively resistant to
deamidation, isomerization and oxidation, such that they display
improved stability as compared with GARP-TGF-.beta.1 antibodies
described in the prior art.
BACKGROUND TO THE INVENTION
[0004] Regulatory T cells (otherwise known as "Tregs" or Foxp3+T
regulatory cells) are an important component of the immune system.
In particular, Tregs play a critical role in immune homeostasis by
suppressing various aspects of the immune response. As a
consequence of their role in coordinating the immune response,
dysregulated Treg activity can lead to the development of various
diseases and conditions. In particular, insufficient Treg function
can result in autoimmune pathology, whereas excessive Treg activity
has been linked to the inhibition of anti-tumour responses in
cancer patients.
[0005] The protein GARP (Glycoprotein A Repetitions Predominant)
has been identified as a highly expressed marker on the surface of
Tregs, particularly activated Tregs. GARP is an 80 kDa
transmembrane protein with an extracellular region comprising 20
leucine-rich repeats. It is also known as LRRC32. GARP serves as
the receptor for TGF-.beta., particularly the latent form of
TGF-.beta., and is required for the expression of latent TGF-.beta.
on Treg cells (E M Shevach. Expert Opin Ther Targets (2016) 21(2),
191-200).
[0006] TGF-.beta. is a cytokine known to play a role in multiple
processes including cell proliferation and differentiation, tissue
morphogenesis, inflammation and apoptosis. It has also been
identified as an important growth factor implicated in cancer
development, and rather unusually, has been identified as a
cytokine with tumour promoting and tumour suppressive
properties.
[0007] The production and activation of TGF-.beta. is a multi-step
process, which is regulated at different levels. TGF-.beta. is
synthesised as a pro-TGF-.beta. dimeric precursor, each polypeptide
chain consisting of a latency-associated peptide (LAP) and a mature
TGF-.beta. region. Pro-TGF-.beta. undergoes cleavage by the enzyme
furin to form "latent TGF-.beta.," an inactive form in which the
LAP remains non-covalently associated with the mature TGF-.beta.
region of each polypeptide chain (see FIG. 1). Membrane-localised
GARP serves to transport and anchor latent TGF-.beta. to the cell
surface of Tregs, and it is from this membrane-bound GARP-latent
TGF-.beta. complex that the active form of TGF-.beta. is released.
A variety of mechanisms have been proposed to explain how active
TGF-.beta. is released from the GARP-latent TGF-.beta. complex on
the surface of Tregs. However, integrins, particularly
.alpha.v.beta.6 and .alpha.v.beta.8, are now thought to play an
important role in driving the shear forces needed for release of
the mature TGF-.beta. dimer.
[0008] Once released, the active TGF-.beta. dimer can act as an
autocrine or paracrine mediator of downstream signalling pathways.
In the context of the immune system, TGF-.beta. release from Treg
cells is thought to influence the activity of various T effector
cells and also Tregs themselves (see FIG. 1). Since Tregs play an
important role in suppressing immunity, it is thought that
TGF-.beta. released from Tregs and acting in an autocrine fashion
may be involved in mediating Treg suppression. In particular,
Treg-derived TGF-.beta.1 is thought to play a significant role in
Treg-mediated suppression of tumour immunity.
[0009] Given the role of Treg-derived TGF-.beta. in suppressing the
immune response in the tumour microenvironment, there has been
interest in targeting this pathway as an alternative approach to
cancer immunotherapy. For example, therapeutic agents capable of
dampening this pathway may serve as useful tools to improve the
efficacy of cancer vaccines or other cancer immunotherapy
strategies designed to harness the power of the body's immune
system to treat cancer.
[0010] Cuende et al. (Sci Transl Med. 2015 Apr. 22; 7(284):284ra56)
describes the production and characterisation of two monoclonal
antibodies (MHG-8 and LHG10), which bind to the GARP-TGF-.beta.
complex on Tregs and inhibit TGF-.beta. production. These two
antibodies are also described and characterised in International
patent applications WO2015/015003 and WO2016/125017. These
antibodies were shown to be capable of inhibiting the
immunosuppressive activity of human Treg in a xenogeneic
graft-versus-host disease mouse model. This work serves to validate
the GARP-TGF-.beta. complex as a therapeutic target of interest for
the purposes of modulating Treg function and consequently treating
diseases such as cancer and autoimmune disease where the level of
Treg activity plays an important role. There remains a need
however, for improved GARP-TGF-.beta. antibodies capable of
inhibiting TGF-.beta. release and thereby modifying Treg activity.
The present invention addresses this problem as described
herein.
SUMMARY OF INVENTION
[0011] The present invention improves upon the state of the art by
providing new antibodies and antigen binding fragments thereof,
which bind to the human GARP-TGF-.beta.1 complex. The antibodies
and antigen binding fragments of the present invention are derived
from the GARP-TGF-.beta.1 antibody "LHG-10", described in
International patent applications WO2015/015003 and WO2016/125017.
The heavy chain and light chain variable domain sequences of LHG-10
are shown in SEQ ID NOs: 1 and 2, respectively, and the light chain
variable domain of a chain-shuffled variant, LHG-10.6 (also
described in WO2015/015003 and WO2016/125017), is shown in SEQ ID
NO: 3. The antibodies of the present invention differ particularly
with respect to certain CDR sequences as compared with LHG-10 and
LHG-10.6, specifically with respect to the CDR2 and CDR3 sequences
of the heavy chain variable domain. The LHG-10 and LHG-10.6
GARP-TGF-.beta. antibodies possess the heavy chain CDR2 sequence:
RIDPEDGGTKYAQKFQG (SEQ ID NO: 5); and the heavy chain CDR3
sequence: NEWETVVVGDLMYEYEY (SEQ ID NO: 6), whereas the antibodies
of the present invention comprise the heavy chain CDR2 sequence:
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12); and the heavy chain CDR3
sequence: YEWETVVVGDLMYEYEY (SEQ ID NO: 13).
[0012] The differences in the heavy chain CDR2 and CDR3 sequences
reported herein result in antibodies that are improved as compared
with the prior art antibodies by virtue of their improved
stability. More specifically, the antibodies of the present
invention are relatively resistant to deamidation, isomerization
and oxidation, such that they exhibit enhanced stability.
Surprisingly, these specific substitutions in the heavy chain CDR2
and CDR3 regions that lead to improved stability do not
significantly decrease the binding affinity of the antibodies for
the GARP-TGF-.beta.1 complex. The improved stability combined with
high affinity target binding renders the antibodies of the present
invention particularly suitable for clinical development as
therapeutic agents, for example as cancer therapeutic agents.
[0013] In a first aspect, the present invention provides an
antibody or antigen binding fragment thereof, which binds to a
complex of human GARP-TGF-.beta.1, wherein the antibody or antigen
binding fragment thereof comprises a heavy chain variable domain
(VH) wherein:
the VH CDR3 comprises the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 comprises the amino acid sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), and the VH CDR1 comprises the
amino acid sequence SYYID (SEQ ID NO: 4).
[0014] In certain embodiments, the present invention provides an
antibody or antigen binding fragment thereof, which binds to a
complex of human GARP-TGF-.beta.1, wherein the antibody or antigen
binding fragment thereof comprises a heavy chain variable domain
(VH) wherein:
the VH CDR3 consists of the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 consists of the amino acid sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), and the VH CDR1 consists of the
amino acid sequence SYYID (SEQ ID NO: 4).
[0015] The antibody or antigen binding fragment may additionally
comprise a light chain variable domain (VL) wherein:
the VL CDR3 comprises the amino acid sequence QQYASVPVT (SEQ ID NO:
11), the VL CDR2 comprises the amino acid sequence GASRLKT (SEQ ID
NO: 10), and the VL CDR1 comprises the amino acid sequence
QASQSISSYLA (SEQ ID NO: 9).
[0016] In certain embodiments, the antibody or antigen binding
fragment may additionally comprise a light chain variable domain
(VL) wherein:
the VL CDR3 consists of the amino acid sequence QQYASVPVT (SEQ ID
NO: 11), the VL CDR2 consists of the amino acid sequence GASRLKT
(SEQ ID NO: 10), and the VL CDR1 consists of the amino acid
sequence QASQSISSYLA (SEQ ID NO: 9).
[0017] In certain embodiments, the antibody or antigen binding
fragment thereof comprises
[0018] a heavy chain variable domain (VH), wherein:
the VH CDR3 comprises the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 comprises the amino acid sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), and the VH CDR1 comprises the
amino acid sequence SYYID (SEQ ID NO: 4); and
[0019] a light chain variable domain (VL), wherein:
the VL CDR3 comprises the amino acid sequence QQYASVPVT (SEQ ID NO:
11), the VL CDR2 comprises the amino acid sequence GASRLKT (SEQ ID
NO: 10), and the VL CDR1 comprises the amino acid sequence
QASQSISSYLA (SEQ ID NO: 9).
[0020] In certain embodiments, the antibody or antigen binding
fragment thereof comprises
[0021] a heavy chain variable domain (VH), wherein:
the VH CDR3 consists of the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 consists of the amino acid sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), and the VH CDR1 consists of the
amino acid sequence SYYID (SEQ ID NO: 4); and
[0022] a light chain variable domain (VL), wherein:
the VL CDR3 consists of the amino acid sequence QQYASVPVT (SEQ ID
NO: 11), the VL CDR2 consists of the amino acid sequence GASRLKT
(SEQ ID NO: 10), and the VL CDR1 consists of the amino acid
sequence QASQSISSYLA (SEQ ID NO: 9).
[0023] In certain embodiments, the antibodies or antigen binding
fragments include at least one heavy chain variable domain (VH)
and/or at least one light chain variable domain (VL) that is a
humanised, germlined or affinity variant of a camelid-derived VH or
VL domain.
[0024] In certain embodiments, provided herein are antibodies or
antigen binding fragments thereof, which bind to the complex of
human GARP and human TGF-.beta.1, wherein the antibodies or antigen
binding fragments comprise a heavy chain variable domain selected
from the following: [0025] (i) a VH comprising or consisting of the
amino acid sequence of SEQ ID NO: 14; or [0026] (ii) a VH
comprising or consisting of an amino acid sequence having at least
90%, at least 95%, at least 97%, at least 98%, or at least 99%
identity to SEQ ID NO:14.
[0027] Alternatively or in addition, the antibodies or antigen
binding fragments may comprise a light chain variable domain (VL)
selected from the following: [0028] (i) a VL comprising or
consisting of the amino acid sequence of SEQ ID NO: 15; or [0029]
(ii) a VL comprising or consisting of an amino acid sequence having
at least 90%, at least 95%, at least 97%, at least 98%, or at least
99% identity to SEQ ID NO: 15.
[0030] For embodiments wherein the domains of the antibodies or
antigen binding fragments are defined by a particular percentage
sequence identity to a reference sequence, the VH and/or VL domains
may retain identical CDR sequences to those present in the
reference sequence such that the variation is present only within
the framework regions.
[0031] In a particular embodiment, provided herein are antibodies
or antigen binding fragments thereof, wherein the heavy chain
variable domain (VH) comprises or consists of the amino acid
sequence of SEQ ID NO: 14 and the light chain variable domain (VL)
comprises or consists of the amino acid sequence of SEQ ID NO:
15.
[0032] In certain embodiments, the antibodies of the invention
include the CH1 domain, hinge region, CH2 domain and CH3 domain of
a human antibody, in particular human IgG1, IgG2, IgG3 or IgG4. In
certain embodiments, the antibody includes the CH3 region of a
human IgG4 and includes the substitution S228P in the CH3
domain.
[0033] The antibodies which bind the GARP-TGF-.beta.1 complex may
comprise at least one full-length immunoglobulin heavy chain and/or
at least one full-length lambda or kappa light chain. In certain
embodiments, the antibodies comprise a heavy chain comprising the
amino acid sequence of SEQ ID NO: 16 and a light chain comprising
the amino acid sequence of SEQ ID NO: 17. In certain embodiments,
provided herein are monoclonal antibodies comprising a heavy chain
with at least 90%, at least 95%, at least 97%, at least 98%, or at
least 99% sequence identity to the amino acid sequence shown as SEQ
ID NO: 16. In certain embodiments, provided herein are monoclonal
antibodies comprising a light chain with at least 90%, at least
95%, at least 97%, at least 98%, or at least 99% sequence identity
to the amino acid sequence shown as SEQ ID NO: 17. In certain
embodiments, provided herein are monoclonal antibodies comprising a
heavy chain with at least 90%, at least 95%, at least 97%, at least
98%, or at least 99% sequence identity to the amino acid sequence
shown as SEQ ID NO: 16, and a light chain with at least 90%, at
least 95%, at least 97%, at least 98%, or at least 99% sequence
identity to the amino acid sequence shown as SEQ ID NO: 17.
[0034] For embodiments wherein the heavy and/or light chains of the
antibodies are defined by a particular percentage sequence identity
to a reference sequence, the heavy chain and/or light chain may
retain identical CDR sequences to those present in the reference
sequence such that the variation is present only outside the CDR
regions.
[0035] Unless otherwise stated in the present application, %
sequence identity between two amino acid sequences may be
determined by comparing these two sequences aligned in an optimum
manner and in which the amino acid sequence to be compared can
comprise additions or deletions with respect to the reference
sequence for an optimum alignment between these two sequences. The
percentage of identity is calculated by determining the number of
identical positions for which the amino acid residue is identical
between the two sequences, by dividing this number of identical
positions by the total number of positions in the comparison window
and by multiplying the result obtained by 100 in order to obtain
the percentage of identity between these two sequences. For
example, it is possible to use the BLAST program, "BLAST 2
sequences" (Tatusova et al, "Blast 2 sequences--a new tool for
comparing protein and nucleotide sequences", FEMS Microbiol Lett.
174:247-250), the parameters used being those given by default (in
particular for the parameters "open gap penalty": 5, and "extension
gap penalty": 2; the matrix chosen being, for example, the matrix
"BLOSUM 62" proposed by the program), the percentage of identity
between the two sequences to be compared being calculated directly
by the program.
[0036] The GARP-TGF-.beta.1 antibodies or antigen binding fragments
thereof provided herein may each exhibit one or more of the
following properties/features: [0037] the antibody or antigen
binding fragment may cross-react with the GARP-TGF-.beta. complex
of Cynomolgus origin; [0038] the antibody or antigen binding
fragment may bind to human GARP-TGF-.beta.1 with high affinity;
[0039] the antibody or antigen binding fragment may include a VH
domain and VL domain that when tested as a Fab fragment exhibit an
off-rate (K.sub.off) for the complex of human GARP and TGF-.beta.1
of less than 5.times.10.sup.-4 s.sup.-1; [0040] the antibody or
antigen binding fragment may include a VH domain and VL domain that
when tested as a Fab fragment exhibit an off-rate (K.sub.off) for
the complex of human GARP and TGF-.beta.1 in the range
1.times.10.sup.-6 s.sup.-1 to 5.times.10.sup.-4 s.sup.-1; [0041]
the antibody or antigen binding fragment may include a VH domain
and VL domain that when tested as a mAb exhibit a K.sub.D of less
than 1.7.times.10.sup.-9 M; [0042] the antibody or antigen binding
fragment may block release of active TGF-.beta.1 from regulatory T
cells.
[0043] In further aspects, the invention also provides
polynucleotide molecules which encode the above-listed antibodies
and antigen binding fragments, in addition to expression vectors
comprising the polynucleotides, host cells containing the vectors,
and methods of recombinant expression/production of the antibodies
described herein.
[0044] In a still further aspect, the invention provides a
pharmaceutical composition comprising any one of the
GARP-TGF-.beta.1 antibodies or antigen binding fragments thereof
described herein, and a pharmaceutically acceptable carrier or
excipient.
[0045] A still further aspect of the invention concerns methods of
medical treatment using the above-listed GARP-TGF-.beta.1
antibodies or antigen binding fragments thereof, particularly in
the prophylaxis and/or treatment of TGF-.beta.-related disorders.
In certain embodiments, the invention relates to methods of
treatment using the GARP-TGF-.beta.1 antibodies or antigen binding
fragments thereof, wherein the disease or condition to be treated
is selected from the group consisting of inflammatory diseases,
chronic infection, cancer, fibrosis, cardiovascular disease,
cerebrovascular disease and neurodegenerative disease. In certain
embodiments, the GARP-TGF-.beta.1 antibodies or antigen binding
fragments thereof are administered in combination with another
treatment as part of a combination therapy. For example, the
GARP-TGF-.beta.1 antibodies or antigen binding fragments thereof
may be administered in combination with an immunotherapeutic agent,
optionally an immunostimulatory antibody or a tumour vaccine.
[0046] These and other embodiments of the invention will be better
appreciated and understood when considered in conjunction with the
following description and the accompanying drawings. It should be
understood, however, that the following description, while
indicating various embodiments of the invention and numerous
specific details thereof, is given by way of illustration and not
of limitation. Many substitutions, modifications, additions and/or
rearrangements may be made within the scope of the invention
without departing from the spirit thereof, and the invention
includes all such substitutions, modifications, additions and/or
rearrangements.
BRIEF DESCRIPTION OF THE DRAWINGS
[0047] FIG. 1 is a schematic showing the binding of latent
TGF-.beta. to GARP on the surface of regulatory T cells. TGF-.beta.
is produced as a precursor, "pro-TGF-.beta." and undergoes cleavage
to produce "latent-TGF-.beta.", a form in which the mature
TGF-.beta. dimer remains non-covalently associated with the latency
associated peptide (LAP) region of each polypeptide. It is this
latent form that binds to GARP on the surface of Treg cells.
Integrins .alpha.v.beta.66 and .alpha.v.beta.8 are thought to be
responsible for mediating the release of mature or "active
TGF-.beta." from the cell surface. This active form can act in a
paracrine fashion to bring about effects in a variety of target
cells, or can act as an autocrine mediator by binding to the
TGF-.beta. receptor on Treg cells.
[0048] FIG. 2 shows target binding activity as measured by surface
plasmon resonance (SPR) for antibodies 39B6 IgG1.sup.N297Q and 39B6
IgG4.sup.s228P over a 56-day period for samples stored at
-20.degree. C., 5.degree. C. and 37.degree. C. in PBS or PBSTween
(PBSTw). The reference sample (-20.degree. C.) was set as 100%
binding activity at each time point.
[0049] FIGS. 3A and 3B show the results of testing the 39B6-A
antibody variants in an assay designed to monitor SMAD2
phosphorylation downstream of TGF-.beta. receptor activation. SMAD2
phosphorylation serves as a marker of activation of the TGF-.beta.
signalling pathway, following TGF-.beta. binding to its receptor.
If SMAD2 phosphorylation is reduced, TGF-.beta. activity is
inhibited. FIG. 3A: Western blots showing decreases in SMAD2
phosphorylation in the presence of different concentrations of the
GARP-TGF-.beta. antibodies 39B6-A, 39B6-AVE, 39B6-AEE, 39B6-AYE,
39B6-ANR and 39B6-ANK. FIG. 3B: Graphical representation of the
data in (A) showing the percentage inhibition of SMAD2
phosphorylation at different antibody concentrations.
[0050] FIG. 4 shows the results of testing the 39B6-A antibody
variants in an assay designed to measure TGF-.beta. activity via a
luciferase reporter gene conjugated to a SMAD promoter. Graphs show
percentage inhibition of luminescence signal in the presence of
different concentrations of the GARP-TGF-.beta. antibodies LHG-10,
3966-A, 39B6-AVE, 39B6-AEE, 39B6-AYE, 39B6-ANR and 39B6-ANK.
[0051] FIG. 5 shows the percentage aggregate formation over a
56-day period with antibodies 39B6-AVE, 39B6-AYE, 39B6-ANK and
39B6-ANR stored at 5.degree. C. and 37.degree. C. Aggregate
formation was monitored by size exclusion chromatography
(SE-HPLC).
[0052] FIG. 6 shows the percentage fragment formation over a 56-day
period with antibodies 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR
stored at 37.degree. C. Fragment formation was monitored by size
exclusion chromatography (SE-HPLC).
[0053] FIG. 7 shows the percentage monomer area over a 56-day
period with antibodies 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR
stored at 5.degree. C. and 37.degree. C. Monomer area was monitored
by size exclusion chromatography (SE-HPLC).
[0054] FIGS. 8A-8D show the results of SDS-PAGE analysis of
antibody samples stored for 56 days at a reference temperature
(-20.degree. C.), at 5.degree. C. and at 37.degree. C. FIG. 8A:
39B6-AVE. FIG. 8B: 39B6-AYE. FIG. 8C: 39B6-ANK. FIG. 8D: 39B6-ANR.
Markers appear at the centre of each gel. To the left of the
markers, the 3 samples are (i) Ref; (ii) 5.degree. C.; and (iii)
37.degree. C. samples tested under non-reducing conditions and to
the right of the markers, the 3 samples are (i) Ref; (ii) 5.degree.
C.; and (iii) 37.degree. C. samples tested under reducing
conditions.
[0055] FIG. 9 shows target binding activity as measured by SPR for
antibodies 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR over a 56-day
period for samples stored at -20.degree. C., 5.degree. C. and
37.degree. C. The reference sample (-20.degree. C.) was set as 100%
binding activity at each time point.
[0056] FIG. 10 shows the protein concentration (mg/ml) for samples
of antibodies 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR over a
56-day period for samples stored at -20.degree. C. (ref), 5.degree.
C. and 37.degree. C.
[0057] FIG. 11 shows the results of SDS-PAGE analysis of antibody
samples after 10 freeze-thaw cycles. Markers appear at the centre
of the gel. To the left of the markers, the 4 samples are the
samples analysed under non-reducing conditions: (i) Ref for
39B6-AVE; (ii) Freeze-thaw sample for 39B6-AVE; (iii) Ref for
39B6-AYE; and (iv) Freeze-thaw sample for 39B6-AYE. To the right of
the markers, the 4 samples are the samples analysed under reducing
conditions: (i) Ref for 39B6-AVE; (ii) Freeze-thaw sample for
39B6-AVE; (iii) Ref for 39B6-AYE; and (iv) Freeze-thaw sample for
39B6-AYE.
[0058] FIG. 12 shows target binding activity as measured by SPR
following 10 freeze-thaw cycles for antibodies 39B6-AVE and
39B6-AYE. The reference sample (-20.degree. C.) was set as 100%
binding activity at each time point.
[0059] FIG. 13 shows the protein concentration (mg/ml) for samples
of antibodies 39B6-AVE and 39B6-AYE following 10 freeze-thaw
cycles.
[0060] FIG. 14 shows target binding activity as measured by SPR
following thermal stability testing at temperatures ranging from
54.6.degree. C. through 71.4.degree. C. for antibodies 39B6-AVE,
39B6-AYE, 39B6-ANK and 39B6-ANR. The reference sample was set as
100% binding activity.
[0061] FIG. 15 shows the results of SDS-PAGE analysis of antibody
samples after 96 hours of rotation. Markers appear at the centre of
the gel. To the left of the markers, the 4 samples are the samples
analysed under non-reducing conditions: (i) Ref for 39B6-AVE; (ii)
Rotated sample for 39B6-AVE; (iii) Ref for 39B6-AYE; and (iv)
Rotated sample for 39B6-AYE. To the right of the markers, the 4
samples are the samples analysed under reducing conditions: (i) Ref
for 39B6-AVE; (ii) Rotated sample for 39B6-AVE; (iii) Ref for
39B6-AYE; and (iv) Rotated sample for 39B6-AYE.
[0062] FIG. 16 shows target binding activity as measured by SPR
following rotational stability testing for mAbs 39B6-AVE and
39B6-AYE. The reference sample was set as 100% binding
activity.
[0063] FIG. 17 shows the protein concentration (mg/ml) for samples
of mAbs 39B6-AVE and 39B6-AYE following rotational stability
testing.
[0064] FIG. 18 shows the relative amount of deamidation and
isomerization of position N95 in the antibodies 39B6-ANE, 39B6-ANR
and 39B6-ANK over a 56-day period. Antibodies 39B6-AVE and 39B6-AYE
are not included because these antibodies have had residue "N95"
removed from CDR3. Also shown is the relative binding activity for
mAbs 39B6-ANE, 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR over the
56 d time course, for samples stored at 37.degree. C.
[0065] FIG. 19 shows the requirement for mature TGF-43 in the
binding of 39B6-AYE (ARGX-115) to the GARP-TGF-.beta. complex.
ELISA plates were coated with either GARP or the anti-GARP Ab
ARGX-115. For ELISA plates coated with GARP, a complex with either
full-length latent TGF-.beta. (including both the LAP and mature
TGF-.beta. regions) or a complex with recombinant LAP was allowed
to form by the addition of the relevant recombinant protein. For
ELISA plates coated with ARGX-115, GARP was added and then either
full-length latent TGF-.beta. or LAP was added. ARGX-115 was only
able to bind GARP in the presence of full-length TGF-.beta..
Binding of ARGX-115 to the GARP-LAP complex did not occur. In
contrast, an anti-LAP antibody was able to bind to the GARP-LAP
complex. This demonstrates the requirement for mature TGF-.beta.
for binding of ARGX-115 to the GARP-TGF-.beta. complex.
[0066] FIG. 20 shows the ability of antibodies to neutralize
TGF-.beta. activation by the GARP-TGF-.beta. complex with various
mutant forms of TGF-.beta.. Neutralizing activity of ARGX-115 was
abrogated by mutation of R58 in LAP and K338 in mature
TGF-.beta..
DETAILED DESCRIPTION
A. Definitions
[0067] "GARP"--GARP (Glycoprotein A Repetitions Predominant) is a
member of the leucine-rich repeat family of proteins. It is also
called Leucine Rich Repeat Containing 32 (LRRC32). GARP is an 80
kDa transmembrane protein with an extracellular region composed
primarily of 20 leucine-rich repeats. The complete amino acid
sequence of the human GARP protein transcript variant 2 (GenBank
Accession No. NP_001122394) is:
TABLE-US-00001 (SEQ ID NO: 33)
MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDT
ETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHL
SLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHT
LSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNL
SRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKL
LHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPS
GNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEAR
RLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFAN
LASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLR
AGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDL
PCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLET
SLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSH
VRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA.
"TGF-.beta."--TGF-.beta. is a cytokine belonging to a superfamily
of growth factors. There are three distinct isoforms of TGF-.beta.
(TGF-.beta.1, TGF-.beta.2 and TGF-.beta.3) encoded by three
distinct genes, but the overall structures of the TGF-.beta.
isoforms are highly similar, with homologies in the order of
70-80%. The term TGF-.beta., as used herein, is typically used to
encompass all three different isoforms of the TGF-.beta. cytokine,
unless the context indicates otherwise.
[0068] All three TGF-.beta. isoforms are encoded as large protein
precursors; TGF-.beta.1 (GenBank Accession No: NM_000660) contains
390 amino acids, and TGF-.beta.2 (Gen Bank Accession Nos:
NM_001135599 and NM_003238) and TGF-.beta.3 (GenBank Accession No:
XM_005268028) each contain 412 amino acids. They each have an
N-terminal signal peptide of 20-30 amino acids that is required for
secretion from a cell, a pro-region (named latency associated
peptide or LAP), and a 112-114 amino acid C-terminal region that
becomes the mature TGF-.beta. molecule following its release from
the pro-region by proteolytic cleavage. After proteolytic cleavage,
LAP and mature TGF-.beta. remain non-covalently associated and form
the "latent TGF-.beta." molecule. In this latent form, mature
TGF-.beta. is prevented from binding to the TGF-.beta. receptor by
LAP. To exert a signal, mature TGF-.beta. must be released from
LAP. Mature TGF-.beta. that is not associated to LAP is called
active TGF-.beta., as it can bind to the TGF-.beta. receptor and
transduce a signal.
[0069] Full length TGF-.beta.1 has the following amino acid
sequence:
TABLE-US-00002 (SEQ ID NO: 34)
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRG
QILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEAD
YYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRA
ELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVV
RQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNR
PFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDL
GWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCV
PQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS.
[0070] LAP has the following amino acid sequence:
TABLE-US-00003 (SEQ ID NO: 35)
LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLAL
YNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSI
YMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYL
SNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQ
VDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRR.
[0071] Mature TGF-.beta.1 has the following amino acid
sequence:
TABLE-US-00004 (SEQ ID NO: 36)
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYI
WSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLS NMIVRSCKCS.
[0072] "GARP-TGF-.beta. complex"--As used herein, the
GARP-TGF-.beta. complex means the native complex that forms when
latent TGF-.beta. binds to GARP, particularly GARP located on the
surface of Treg cells. Although not specified throughout, the
"GARP-TGF-.beta. complex," or simply "GARP-TGF-.beta.," as used
herein, is intended to mean the complex between GARP and latent
TGF-.beta.. The binding of GARP to TGF-.mu., more specifically
latent TGF-.beta., has been characterised at the molecular level,
for example as reported in Wang et al. Mol Biol Cell. 2012 March;
23(6):1129-39. GARP forms a disulphide linkage to the Cys4 of
latent TGF-.beta. and also associates with latent TGF-.beta.
through non-covalent interactions. There are 15 Cys residues in the
extracellular domain of GARP, and GARP uses Cys-192 and Cys-331 to
form disulphide linkages to the two Cys4 residues of latent
TGF-.beta.. It follows that one GARP protein associates with one
latent TGF-.beta. dimer.
[0073] "Antibody" or "Immunoglobulin"--As used herein, the term
"immunoglobulin" includes a polypeptide having a combination of two
heavy and two light chains whether or not it possesses any relevant
specific immunoreactivity. "Antibodies" refer to such assemblies
which have significant specific immunoreactive activity to an
antigen of interest (e.g. the complex of GARP and TGF-.beta.). The
term "GARP-TGF-.beta. antibodies" is used herein to refer to
antibodies which exhibit immunological specificity for the complex
of GARP and TGF-.beta.1, particularly the human GARP-TGF-.beta.1
complex and in some cases species homologues thereof. Antibodies
and immunoglobulins comprise light and heavy chains, with or
without an interchain covalent linkage between them. Basic
immunoglobulin structures in vertebrate systems are relatively well
understood.
[0074] The generic term "immunoglobulin" comprises five distinct
classes of antibody (IgG, IgM, IgA, IgD or IgE) that can be
distinguished biochemically. All five classes of antibodies are
within the scope of the present invention. The following discussion
will generally be directed to the IgG class of immunoglobulin
molecules. With regard to IgG, immunoglobulins typically comprise
two identical light polypeptide chains of molecular weight
approximately 23,000 Daltons, and two identical heavy chains of
molecular weight 53,000-70,000. The four chains are joined by
disulfide bonds in a "Y" configuration wherein the light chains
bracket the heavy chains starting at the mouth of the "Y" and
continuing through the variable region.
[0075] The light chains of an antibody are classified as either
kappa (.kappa.) or lambda (.lamda.). Each heavy chain class may be
bound with either a kappa or lambda light chain. In general, the
light and heavy chains are covalently bonded to each other, and the
"tail" portions of the two heavy chains are bonded to each other by
covalent disulfide linkages or non-covalent linkages when the
immunoglobulins are generated either by hybridomas, B cells or
genetically engineered host cells. In the heavy chain, the amino
acid sequences run from an N-terminus at the forked ends of the Y
configuration to the C-terminus at the bottom of each chain. Those
skilled in the art will appreciate that heavy chains are classified
as gamma, mu, alpha, delta, or epsilon, (.gamma., .mu., .alpha.,
.delta., .epsilon.) with some subclasses among them (e.g.,
.gamma.1-.gamma.4). It is the nature of this chain that determines
the "class" of the antibody as IgG, IgM, IgA, IgD or IgE,
respectively. The immunoglobulin subclasses (isotypes) e.g., IgG1,
IgG2, IgG3, IgG4, IgA1, etc. are well characterized and are known
to confer functional specialization. Modified versions of each of
these classes and isotypes are readily discernible to the skilled
artisan in view of the instant disclosure and, accordingly, are
within the scope of the instant invention.
[0076] As indicated above, the variable region of an antibody
allows the antibody to selectively recognize and specifically bind
epitopes on antigens. That is, the VL domain and VH domain of an
antibody combine to form the variable region that defines a three
dimensional antigen binding site. This quaternary antibody
structure forms the antigen binding site present at the end of each
arm of the Y. More specifically, the antigen binding site is
defined by three complementary determining regions (CDRs) on each
of the VH and VL chains.
[0077] "Binding Site"--As used herein, the term "binding site"
comprises a region of a polypeptide which is responsible for
selectively binding to a target antigen of interest. Binding
domains comprise at least one binding site. Exemplary binding
domains include an antibody variable domain. The antibody molecules
of the invention may comprise a single binding site or multiple
(e.g., two, three or four) binding sites.
[0078] "Variable region" or "variable domain"--The terms "variable
region" and "variable domain" are used herein interchangeably and
are intended to have equivalent meaning. The term "variable" refers
to the fact that certain portions of the variable domains VH and VL
differ extensively in sequence among antibodies and are used in the
binding and specificity of each particular antibody for its target
antigen. However, the variability is not evenly distributed
throughout the variable domains of antibodies. It is concentrated
in three segments called "hypervariable loops" in each of the VL
domain and the VH domain which form part of the antigen binding
site. The first, second and third hypervariable loops of the
VLambda light chain domain are referred to herein as L1(.lamda.),
L2(.lamda.) and L3(.lamda.) and may be defined as comprising
residues 24-33 (L1(.lamda.), consisting of 9, 10 or 11 amino acid
residues), 49-53 (L2(.lamda.), consisting of 3 residues) and 90-96
(L3(.lamda.), consisting of 5 residues) in the VL domain (Morea et
al., Methods 20:267-279 (2000)). The first, second and third
hypervariable loops of the VKappa light chain domain are referred
to herein as L1(.kappa.), L2(.kappa.) and L3(.kappa.) and may be
defined as comprising residues 25-33 (L1 (.kappa.), consisting of
6, 7, 8, 11, 12 or 13 residues), 49-53 (L2(.kappa.), consisting of
3 residues) and 90-97 (L3(.kappa.), consisting of 6 residues) in
the VL domain (Morea et al., Methods 20:267-279 (2000)). The first,
second and third hypervariable loops of the VH domain are referred
to herein as H1, H2 and H3 and may be defined as comprising
residues 25-33 (H1, consisting of 7, 8 or 9 residues), 52-56 (H2,
consisting of 3 or 4 residues) and 91-105 (H3, highly variable in
length) in the VH domain (Morea et al., Methods 20:267-279
(2000)).
[0079] Unless otherwise indicated, the terms L1, L2 and L3
respectively refer to the first, second and third hypervariable
loops of a VL domain, and encompass hypervariable loops obtained
from both Vkappa and Vlambda isotypes. The terms H1, H2 and H3
respectively refer to the first, second and third hypervariable
loops of the VH domain, and encompass hypervariable loops obtained
from any of the known heavy chain isotypes, including .gamma.,
.epsilon., .delta., .alpha. or .mu..
[0080] The hypervariable loops L1, L2, L3, H1, H2 and H3 may each
comprise part of a "complementarity determining region" or "CDR",
as defined below. The terms "hypervariable loop" and
"complementarity determining region" are not strictly synonymous,
since the hypervariable loops (HVs) are defined on the basis of
structure, whereas complementarity determining regions (CDRs) are
defined based on sequence variability (Kabat et al., Sequences of
Proteins of Immunological Interest, 5th Ed. Public Health Service,
National Institutes of Health, Bethesda, Md., 1983) and the limits
of the HVs and the CDRs may be different in some VH and VL
domains.
[0081] The CDRs of the VL and VH domains can typically be defined
as comprising the following amino acids: residues 24-34 (LCDR1),
50-56 (LCDR2) and 89-97 (LCDR3) in the light chain variable domain,
and residues 31-35 or 31-35b (HCDR1), 50-65 (HCDR2) and 95-102
(HCDR3) in the heavy chain variable domain; (Kabat et al.,
Sequences of Proteins of Immunological Interest, 5th Ed. Public
Health Service, National Institutes of Health, Bethesda, Md.
(1991)). Thus, the HVs may be comprised within the corresponding
CDRs and references herein to the "hypervariable loops" of VH and
VL domains should be interpreted as also encompassing the
corresponding CDRs, and vice versa, unless otherwise indicated.
[0082] The more highly conserved portions of variable domains are
called the framework region (FR), as defined below. The variable
domains of native heavy and light chains each comprise four FRs
(FR1, FR2, FR3 and FR4, respectively), largely adopting a
.beta.-sheet configuration, connected by the three hypervariable
loops. The hypervariable loops in each chain are held together in
close proximity by the FRs and, with the hypervariable loops from
the other chain, contribute to the formation of the antigen-binding
site of antibodies. Structural analysis of antibodies revealed the
relationship between the sequence and the shape of the binding site
formed by the complementarity determining regions (Chothia et al.,
J. Mol. Biol. 227: 799-817 (1992)); Tramontano et al., J. Mol.
Biol, 215:175-182 (1990)). Despite their high sequence variability,
five of the six loops adopt just a small repertoire of main-chain
conformations, called "canonical structures". These conformations
are first of all determined by the length of the loops and secondly
by the presence of key residues at certain positions in the loops
and in the framework regions that determine the conformation
through their packing, hydrogen bonding or the ability to assume
unusual main-chain conformations.
[0083] "CDR"--As used herein, the term "CDR" or "complementarity
determining region" means the non-contiguous antigen combining
sites found within the variable region of both heavy and light
chain polypeptides. These particular regions have been described by
Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et
al., Sequences of protein of immunological interest. (1991), and by
Chothia et al., J. Mol. Biol. 196:901-917 (1987) and by MacCallum
et al., J. Mol. Biol. 262:732-745 (1996) where the definitions
include overlapping or subsets of amino acid residues when compared
against each other. The amino acid residues which encompass the
CDRs as defined by each of the above cited references are set forth
for comparison. Preferably, the term "CDR" is a CDR as defined by
Kabat based on sequence comparisons.
TABLE-US-00005 TABLE 1 CDR definitions CDR Definitions Kabat.sup.1
Chothia.sup.2 MacCallum.sup.3 V.sub.H CDR1 31-35 26-32 30-35
V.sub.H CDR2 50-65 53-55 47-58 V.sub.H CDR3 95-102 96-101 93-101
V.sub.L CDR1 24-34 26-32 30-36 V.sub.L CDR2 50-56 50-52 46-55
V.sub.L CDR3 89-97 91-96 89-96 .sup.1Residue numbering follows the
nomenclature of Kabat et al., supra .sup.2Residue numbering follows
the nomenclature of Chothia et al., supra .sup.3Residue numbering
follows the nomenclature of MacCallum et al., supra
[0084] "Framework region"--The term "framework region" or "FR
region" as used herein, includes the amino acid residues that are
part of the variable region, but are not part of the CDRs (e.g.,
using the Kabat definition of CDRs). Therefore, a variable region
framework is between about 100-120 amino acids in length but
includes only those amino acids outside of the CDRs. For the
specific example of a heavy chain variable domain and for the CDRs
as defined by Kabat et al., framework region 1 corresponds to the
domain of the variable region encompassing amino acids 1-30;
framework region 2 corresponds to the domain of the variable region
encompassing amino acids 36-49; framework region 3 corresponds to
the domain of the variable region encompassing amino acids 66-94,
and framework region 4 corresponds to the domain of the variable
region from amino acids 103 to the end of the variable region. The
framework regions for the light chain are similarly separated by
each of the light chain variable region CDRs. Similarly, using the
definition of CDRs by Chothia et al. or McCallum et al. the
framework region boundaries are separated by the respective CDR
termini as described above. In preferred embodiments the CDRs are
as defined by Kabat.
[0085] In naturally occurring antibodies, the six CDRs present on
each monomeric antibody are short, non-contiguous sequences of
amino acids that are specifically positioned to form the antigen
binding site as the antibody assumes its three dimensional
configuration in an aqueous environment. The remainder of the heavy
and light variable domains show less inter-molecular variability in
amino acid sequence and are termed the framework regions. The
framework regions largely adopt a .beta.-sheet conformation and the
CDRs form loops which connect, and in some cases form part of, the
.beta.-sheet structure. Thus, these framework regions act to form a
scaffold that provides for positioning the six CDRs in correct
orientation by inter-chain, non-covalent interactions. The antigen
binding site formed by the positioned CDRs defines a surface
complementary to the epitope on the immunoreactive antigen. This
complementary surface promotes the non-covalent binding of the
antibody to the immunoreactive antigen epitope. The position of
CDRs can be readily identified by one of ordinary skill in the
art.
[0086] "Constant region"--As used herein, the term "constant
region" refers to the portion of the antibody molecule outside of
the variable domains or variable regions. Immunoglobulin light
chains have a single domain "constant region", typically referred
to as the "CL or CL1 domain". This domain lies C terminal to the VL
domain. Immunoglobulin heavy chains differ in their constant region
depending on the class of immunoglobulin (.gamma., .mu., .alpha.,
.delta., .epsilon.). Heavy chains .gamma., .alpha. and .delta. have
a constant region consisting of three immunoglobulin domains
(referred to as CH1, CH2 and CH3) with a flexible hinge region
separating the CH1 and CH2 domains. Heavy chains .mu. and c have a
constant region consisting of four domains (CH1-CH4). The constant
domains of the heavy chain are positioned C terminal to the VH
domain.
[0087] The numbering of the amino acids in the heavy and light
immunoglobulin chains run from the N-terminus at the forked ends of
the Y configuration to the C-terminus at the bottom of each chain.
Different numbering schemes are used to define the constant domains
of the immunoglobulin heavy and light chains. In accordance with
the EU numbering scheme, the heavy chain constant domains of an IgG
molecule are identified as follows: CH1--amino acid residues
118-215; CH2--amino acid residues 231-340; CH3--amino acid residues
341-446. In accordance with the Kabat numbering scheme, the heavy
chain constant domains of an IgG molecule are identified as
follows: CH1--amino acid residues 114-223; CH2--amino acid residues
244-360; CH3--amino acid residues 361-477. The "hinge region"
includes the portion of a heavy chain molecule that joins the CH1
domain to the CH2 domain. This hinge region comprises approximately
25 residues and is flexible, thus allowing the two N-terminal
antigen binding regions to move independently. Hinge regions can be
subdivided into three distinct domains: upper, middle, and lower
hinge domains (Roux K. H. et al. J. Immunol. 161:4083-90 1998).
Antibodies of the invention comprising a "fully human" hinge region
may contain one of the hinge region sequences shown in Table 2
below.
TABLE-US-00006 TABLE 2 Human hinge sequences IgG Upper hinge Middle
hinge Lower hinge IgG1 EPKSCDKTHT CPPCP APELLGGP (SEQ ID NO: 37)
(SEQ ID NO: 38) (SEQ ID NO: 39) IgG3 ELKTPLGDTTHT CPRCP
(EPKSCDTPPPCPRCP).sub.3 APELLGGP (SEQ ID NO: 40) (SEQ ID NO: 41)
(SEQ ID NO: 42) IgG4 ESKYGPP CPSCP APEFLGGP (SEQ ID NO: 43) (SEQ ID
NO: 44) (SEQ ID NO: 45) IgG2 ERK CCVECPPPCP APPVAGP (SEQ ID NO: 46)
(SEQ ID NO: 47) (SEQ ID NO: 48)
[0088] "Fragment"--The term "fragment", as used in the context of
antibodies of the invention, refers to a part or portion of an
antibody or antibody chain comprising fewer amino acid residues
than an intact or complete antibody or antibody chain. The term
"antigen-binding fragment" refers to a polypeptide fragment of an
immunoglobulin or antibody that binds antigen or competes with
intact antibody (i.e., with the intact antibody from which they
were derived) for antigen binding (i.e., specific binding to the
GARP-TGF-.beta. complex). As used herein, the term "fragment" of an
antibody molecule includes antigen-binding fragments of antibodies,
for example, an antibody light chain variable domain (VL), an
antibody heavy chain variable domain (VH), a single chain antibody
(scFv), a F(ab')2 fragment, a Fab fragment, an Fd fragment, an Fv
fragment, a one-armed (monovalent) antibody, diabodies, triabodies,
tetrabodies or any antigen-binding molecule formed by combination,
assembly or conjugation of such antigen binding fragments. The term
"antigen binding fragment" as used herein is further intended to
encompass antibody fragments selected from the group consisting of
unibodies, domain antibodies and nanobodies. Fragments can be
obtained, e.g., via chemical or enzymatic treatment of an intact or
complete antibody or antibody chain or by recombinant means.
[0089] "Conservative amino acid substitution"--A "conservative
amino acid substitution" is one in which the amino acid residue is
replaced with an amino acid residue having a similar side chain.
Families of amino acid residues having similar side chains have
been defined in the art, including basic side chains (e.g., lysine,
arginine, histidine), acidic side chains (e.g., aspartic acid,
glutamic acid), uncharged polar side chains (e.g., glycine,
asparagine, glutamine, serine, threonine, tyrosine, cysteine),
nonpolar side chains (e.g., alanine, valine, leucine, isoleucine,
proline, phenylalanine, methionine, tryptophan), beta-branched side
chains (e.g., threonine, valine, isoleucine) and aromatic side
chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
Thus, a nonessential amino acid residue in an immunoglobulin
polypeptide may be replaced with another amino acid residue from
the same side chain family. In another embodiment, a string of
amino acids can be replaced with a structurally similar string that
differs in order and/or composition of side chain family
members.
[0090] "Chimeric"--A "chimeric" protein comprises a first amino
acid sequence linked to a second amino acid sequence with which it
is not naturally linked in nature. The amino acid sequences may
normally exist in separate proteins that are brought together in
the fusion polypeptide or they may normally exist in the same
protein but are placed in a new arrangement in the fusion
polypeptide. A chimeric protein may be created, for example, by
chemical synthesis, or by creating and translating a polynucleotide
in which the peptide regions are encoded in the desired
relationship. Exemplary chimeric antibodies of the invention
include fusion proteins comprising camelid-derived VH and VL
domains, or humanised variants thereof, fused to the constant
domains of a human antibody, e.g. human IgG1, IgG2, IgG3 or
IgG4.
[0091] "Valency"--As used herein the term "valency" refers to the
number of potential target binding sites in a polypeptide. Each
target binding site specifically binds one target molecule or
specific site on a target molecule. When a polypeptide comprises
more than one target binding site, each target binding site may
specifically bind the same or different molecules (e.g., may bind
to different ligands or different antigens, or different epitopes
on the same antigen).
[0092] "Specificity"--The term "specificity" refers to the ability
to bind (e.g., immunoreact with) a given target, e.g., a complex of
GARP-TGF-.beta.1. A polypeptide may be monospecific and contain one
or more binding sites which specifically bind a target or a
polypeptide may be multispecific and contain two or more binding
sites which specifically bind the same or different targets.
[0093] "Synthetic"--As used herein the term "synthetic" with
respect to polypeptides includes polypeptides which comprise an
amino acid sequence that is not naturally occurring. For example,
non-naturally occurring polypeptides which are modified forms of
naturally occurring polypeptides (e.g., comprising a mutation such
as an addition, substitution or deletion) or which comprise a first
amino acid sequence (which may or may not be naturally occurring)
that is linked in a linear sequence of amino acids to a second
amino acid sequence (which may or may not be naturally occurring)
to which it is not naturally linked in nature.
[0094] "Engineered"--As used herein the term "engineered" includes
manipulation of nucleic acid or polypeptide molecules by synthetic
means (e.g. by recombinant techniques, in vitro peptide synthesis,
by enzymatic or chemical coupling of peptides or some combination
of these techniques). Preferably, the antibodies of the invention
are engineered, including for example, humanized and/or chimeric
antibodies, and antibodies which have been engineered to improve
one or more properties, such as antigen binding,
stability/half-life or effector function.
[0095] "Humanising substitutions"--As used herein, the term
"humanising substitutions" refers to amino acid substitutions in
which the amino acid residue present at a particular position in
the VH or VL domain of an antibody (for example a camelid-derived
GARP-TGF-.beta.1 antibody) is replaced with an amino acid residue
which occurs at an equivalent position in a reference human VH or
VL domain. The reference human VH or VL domain may be a VH or VL
domain encoded by the human germline. Humanising substitutions may
be made in the framework regions and/or the CDRs of the antibodies,
defined herein.
[0096] "Humanised variants"--As used herein the term "humanised
variant" refers to a variant antibody which contains one or more
"humanising substitutions" compared to a reference antibody,
wherein a portion of the reference antibody (e.g. the VH domain
and/or the VL domain or parts thereof containing at least one CDR)
has an amino acid derived from a non-human species, and the
"humanising substitutions" occur within the amino acid sequence
derived from a non-human species.
[0097] "Germlined variants"--The term "germlined variant" is used
herein to refer specifically to "humanised variants" in which the
"humanising substitutions" result in replacement of one or more
amino acid residues present at a particular position (s) in the VH
or VL domain of an antibody (for example a camelid-derived
GARP-TGF-.beta.1 antibody) with an amino acid residue which occurs
at an equivalent position in a reference human VH or VL domain
encoded by the human germline. It is typical that for any given
"germlined variant", the replacement amino acid residues
substituted into the germlined variant are taken exclusively, or
predominantly, from a single human germline-encoded VH or VL
domain. The terms "humanised variant" and "germlined variant" are
often used interchangeably herein. Introduction of one or more
"humanising substitutions" into a camelid-derived (e.g. llama
derived) VH or VL domain results in production of a "humanised
variant" of the camelid (llama)-derived VH or VL domain. If the
amino acid residues substituted in are derived predominantly or
exclusively from a single human germline-encoded VH or VL domain
sequence, then the result may be a "human germlined variant" of the
camelid (llama)-derived VH or VL domain.
[0098] "Affinity variants"--As used herein, the term "affinity
variant" refers to a variant antibody which exhibits one or more
changes in amino acid sequence compared to a reference antibody,
wherein the affinity variant exhibits an altered affinity for the
target antigen in comparison to the reference antibody. For
example, affinity variants will exhibit a changed affinity for
GARP-TGF-.beta., as compared to the reference GARP-TGF-.beta.
antibody. Preferably the affinity variant will exhibit improved
affinity for the target antigen, as compared to the reference
antibody. Affinity variants typically exhibit one or more changes
in amino acid sequence in the CDRs, as compared to the reference
antibody. Such substitutions may result in replacement of the
original amino acid present at a given position in the CDRs with a
different amino acid residue, which may be a naturally occurring
amino acid residue or a non-naturally occurring amino acid residue.
The amino acid substitutions may be conservative or
non-conservative.
B. GARP-TGF-.beta.1 Antibodies
[0099] The present invention relates to antibodies and antigen
binding fragments thereof, which specifically bind to the complex
of GARP and TGF-.beta.1, particularly the complex of human GARP and
human TGF-.beta.1. The antibodies and antigen binding fragments of
the present invention may be defined with respect to structural and
functional characteristics as described herein.
[0100] Importantly, the GARP-TGF-.beta.1 antibodies of the
invention are improved as compared with the GARP-TGF-.beta.1
antibodies described previously, for the reason that they display
improved stability. In particular, the stability of the
GARP-TGF-.beta.1 antibodies described herein is improved as
compared with antibodies having the heavy chain and light chain CDR
sequences of the GARP-TGF-.beta.1 reference antibodies LHG-10 and
LHG-10.6, described in WO2015/015003 and WO2016/125017. This
improvement in stability is achieved without a significant decrease
in the binding affinity of the antibodies for the GARP-TGF-.beta.1
complex, as compared with the reference LHG10 and LHG10.6
antibodies.
[0101] The antibodies of the present invention differ from the
LHG-10 and LHG-10.6 GARP-TGF-.beta.1 reference antibodies described
previously particularly with respect to the sequences of the heavy
chain CDR2 and CDR3 sequences. More specifically, the LHG-10 and
LHG-10.6 GARP-TGF-.beta.1 antibodies possess the heavy chain CDR2
sequence: RIDPEDGGTKYAQKFQG (SEQ ID NO: 5) and the heavy chain CDR3
sequence: NEWETVVVGDLMYEYEY (SEQ ID NO: 6), whereas the antibodies
of the present invention comprise the heavy chain CDR2 sequence:
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12) and the heavy chain CDR3
sequence: YEWETVVVGDLMYEYEY (SEQ ID NO:13). As described and
exemplified herein, the G55A and N95Y amino acid substitutions in
the heavy chain CDR2 and CDR3 sequences, respectively, were found
to improve antibody stability by reducing deamidation,
isomerization and oxidation, whilst achieving a binding affinity
for the GARP-TGF-.beta.1 complex approximately equivalent to that
of the reference antibodies.
[0102] In a first aspect, the present invention provides antibodies
or antigen binding fragments thereof, which bind to a complex of
GARP and TGF-.beta.1, and comprise a heavy chain variable domain
(VH) wherein:
the VH CDR3 comprises or consists of the amino acid sequence
YEWETVVVGDLMYEYEY (SEQ ID NO: 13), the VH CDR2 comprises or
consists of the amino acid sequence RIDPEDAGTKYAQKFQG (SEQ ID NO:
12), and the VH CDR1 comprises or consists of the amino acid
sequence SYYID (SEQ ID NO: 4).
[0103] In certain embodiments, the antibodies or antigen binding
fragments thereof additionally comprise a light chain variable
domain (VL), wherein:
the VL CDR3 comprises or consists of the amino acid sequence
QQYASVPVT (SEQ ID NO: 11), the VL CDR2 comprises or consists of the
amino acid sequence GASRLKT (SEQ ID NO: 10), and the VL CDR1
comprises or consists of the amino acid sequence QASQSISSYLA (SEQ
ID NO: 9).
[0104] In certain embodiments, provided herein are antibodies or
antigen binding fragments thereof, which specifically bind the
GARP-TGF-.beta.1 complex, wherein the antibodies or antigen binding
fragments thereof comprise at least one heavy chain variable domain
(VH) and at least one light chain variable domain (VL),
wherein:
the VH CDR3 comprises or consists of the amino acid sequence
YEWETVVVGDLMYEYEY (SEQ ID NO: 13), the VH CDR2 comprises or
consists of the amino acid sequence RIDPEDAGTKYAQKFQG (SEQ ID NO:
12), the VH CDR1 comprises or consists of the amino acid sequence
SYYID (SEQ ID NO: 4), the VL CDR3 comprises or consists of the
amino acid sequence QQYASVPVT (SEQ ID NO: 11), the VL CDR2
comprises or consists of the amino acid sequence GASRLKT (SEQ ID
NO: 10), and the VL CDR1 comprises or consists of the amino acid
sequence QASQSISSYLA (SEQ ID NO: 9).
[0105] In certain embodiments, provided herein are antibodies or
antigen binding fragments thereof, which specifically bind the
GARP-TGF-.beta.1 complex, wherein the antibodies or antigen binding
fragments thereof comprise at least one heavy chain variable domain
(VH) and at least one light chain variable domain (VL),
wherein:
the VH CDR3 consists of the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 consists of the amino acid sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), the VH CDR1 consists of the
amino acid sequence SYYID (SEQ ID NO: 4), the VL CDR3 consists of
the amino acid sequence QQYASVPVT (SEQ ID NO: 11), the VL CDR2
consists of the amino acid sequence GASRLKT (SEQ ID NO: 10), and
the VL CDR1 consists of the amino acid sequence QASQSISSYLA (SEQ ID
NO: 9).
[0106] In certain embodiments, the antibodies and antigen binding
fragments are recombinant. In certain embodiments, the antibodies
and antigen binding fragments are monoclonal.
[0107] The term "antibody" herein is used in the broadest sense and
encompasses, but is not limited to, monoclonal antibodies
(including full length monoclonal antibodies), polyclonal
antibodies, and multispecific antibodies (e.g., bispecific
antibodies), so long as they exhibit the appropriate immunological
specificity for the GARP-TGF-.beta.1 complex. The term "monoclonal
antibody" as used herein refers to an antibody obtained from a
population of substantially homogeneous antibodies, i.e., the
individual antibodies comprising the population are identical
except for possible naturally occurring mutations that may be
present in minor amounts. Monoclonal antibodies are highly
specific, being directed against a single antigenic site.
Furthermore, in contrast to conventional (polyclonal) antibody
preparations which typically include different antibodies directed
against different determinants (epitopes) on the antigen, each
monoclonal antibody is directed against a single determinant or
epitope on the antigen.
[0108] The present invention also encompasses "antigen binding
fragments" of antibodies, and such fragments are defined elsewhere
herein. Antibody fragments typically comprise a portion of a full
length antibody, generally the antigen binding or variable domain
thereof. Examples of antibody fragments include Fab, Fab', F(ab')2,
bi-specific Fab's, and Fv fragments, linear antibodies,
single-chain antibody molecules, a single chain variable fragment
(scFv) and multispecific antibodies formed from antibody fragments
(see Holliger and Hudson, Nature Biotechnol. 23:1126-36
(2005)).
[0109] The antibodies and antigen binding fragments of the present
invention may exhibit high human homology. The level of homology
with human sequence may be assessed across the length of the heavy
chain variable domain (VH) and/or across the length of the light
chain variable domain (VL). In the context of the present
invention, an antibody comprising a heavy chain variable domain
(VH) and a light chain variable domain (VL) may be considered as
having high human homology if the VH domains and the VL domains,
taken together, exhibit at least 90%, at least 92%, at least 94%,
or at least 96% amino acid sequence identity to the closest
matching human germline VH and VL sequences. In one embodiment the
VH domain of the antibody with high human homology may exhibit an
amino acid sequence identity or sequence homology of at least 90%,
at least 92%, at least 94%, or at least 96% with one or more human
VH domains across the framework regions FR1, FR2, FR3 and FR4. In
one embodiment the VH domain of the antibody with high human
homology may contain one or more (e.g. 1 to 10) amino acid sequence
mis-matches across the framework regions FR1, FR2, FR3 and FR4, in
comparison to the closest matched human VH sequence.
[0110] In another embodiment the VL domain of the antibody with
high human homology may exhibit a sequence identity or sequence
homology of at least 90%, at least 92%, at least 94%, or at least
96% with one or more human VL domains across the framework regions
FR1, FR2, FR3 and FR4. In one embodiment the VL domain of the
antibody with high human homology may contain one or more (e.g. 1
to 10) amino acid sequence mis-matches across the framework regions
FR1, FR2, FR3 and FR4, in comparison to the closest matched human
VL sequence.
[0111] Antibodies and antigen binding fragments of the present
having high human homology may include antibodies comprising VH and
VL domains of native non-human antibodies which exhibit
sufficiently high % sequence identity to human germline sequences.
In certain embodiments, the antibodies and antigen binding
fragments of the invention are humanised or germlined variants of
non-human antibodies, for example antibodies comprising VH and VL
domains of camelid conventional antibodies engineered so as to be
humanised, or germlined variants of the original antibodies.
[0112] The antibodies or antigen binding fragments thereof may
comprise a heavy chain variable domain (VH) comprising or
consisting of the amino acid sequence of SEQ ID NO: 14 and
optionally a light chain variable domain (VL) comprising or
consisting of the amino acid sequence of SEQ ID NO: 15.
[0113] In certain embodiments, the antibodies or antigen binding
fragments thereof may comprise a heavy chain variable domain (VH)
comprising the amino acid sequence of SEQ ID NO: 14. In certain
embodiments, the antibodies or antigen binding fragments thereof
may comprise a light chain variable domain (VL) comprising the
amino acid sequence of SEQ ID NO: 15.
[0114] In certain embodiments, the antibodies or antigen binding
fragments thereof may comprise a heavy chain variable domain (VH)
consisting of the amino acid sequence of SEQ ID NO: 14. In certain
embodiments, the antibodies or antigen binding fragments thereof
may comprise a light chain variable domain (VL) consisting of the
amino acid sequence of SEQ ID NO: 15.
[0115] In certain embodiments, the antibodies or antigen binding
fragments thereof may comprise a heavy chain variable domain (VH)
comprising the amino acid sequence of SEQ ID NO: 14 and a light
chain variable domain (VL) comprising the amino acid sequence of
SEQ ID NO: 15.
[0116] In certain embodiments, the antibodies or antigen binding
fragments thereof may comprise a heavy chain variable domain (VH)
consisting of the amino acid sequence of SEQ ID NO: 14 and a light
chain variable domain (VL) consisting of the amino acid sequence of
SEQ ID NO: 15.
[0117] In certain embodiments, provided herein are monoclonal
antibodies or antigen binding fragments thereof, comprising a heavy
chain variable domain and a light chain variable domain, the heavy
chain variable domain comprising a VH sequence with at least 90%,
at least 95%, at least 97%, at least 98%, or at least 99% sequence
identity to the amino acid sequence shown as SEQ ID NO: 14 and/or
the light chain variable domain comprising a VL with at least 90%,
at least 95%, at least 97%, at least 98%, or at least 99% sequence
identity to the amino acid sequence shown as SEQ ID NO: 15.
[0118] For embodiments wherein the domains of the antibodies or
antigen binding fragments are defined by a particular percentage
sequence identity to a reference sequence, the VH and/or VL domains
may retain identical CDR sequences to those present in the
reference sequence such that the variation is present only within
the framework regions. In certain embodiments, the antibodies or
antigen binding fragments comprising heavy chain variable domains
and/or light chain variable domains defined as having a particular
percentage identity to SEQ ID NOs: 14 and 15, respectively, will
have the following CDR sequences:
a VH CDR3 comprising or consisting of the amino acid sequence
YEWETVVVGDLMYEYEY (SEQ ID NO: 13), a VH CDR2 comprising or
consisting of the amino acid sequence RIDPEDAGTKYAQKFQG (SEQ ID NO:
12), a VH CDR1 comprising or consisting of the amino acid sequence
SYYID (SEQ ID NO: 4), a VL CDR3 comprising or consisting of the
amino acid sequence QQYASVPVT (SEQ ID NO: 11), a VL CDR2 comprising
or consisting of the amino acid sequence GASRLKT (SEQ ID NO: 10),
and a VL CDR1 comprising or consisting of the amino acid sequence
QASQSISSYLA (SEQ ID NO: 9).
[0119] In non-limiting embodiments, the antibodies of the present
invention may comprise CH1 domains and/or CL domains (from the
heavy chain and light chain, respectively), the amino acid sequence
of which is fully or substantially human. Where the antibody or
antigen binding fragment of the invention is an antibody intended
for human therapeutic use, it is typical for the entire constant
region of the antibody, or at least a part thereof, to have fully
or substantially human amino acid sequence. Therefore, one or more
or any combination of the CH1 domain, hinge region, CH2 domain, CH3
domain and CL domain (and CH4 domain if present) may be fully or
substantially human with respect to its amino acid sequence.
[0120] Advantageously, the CH1 domain, hinge region, CH2 domain,
CH3 domain and CL domain (and CH4 domain if present) may all have
fully or substantially human amino acid sequence. In the context of
the constant region of a humanised or chimeric antibody, or an
antibody fragment, the term "substantially human" refers to an
amino acid sequence identity of at least 90%, or at least 92%, or
at least 95%, or at least 97%, or at least 99% with a human
constant region. The term "human amino acid sequence" in this
context refers to an amino acid sequence which is encoded by a
human immunoglobulin gene, which includes germline, rearranged and
somatically mutated genes. The invention also contemplates
polypeptides comprising constant domains of "human" sequence which
have been altered, by one or more amino acid additions, deletions
or substitutions with respect to the human sequence, excepting
those embodiments where the presence of a "fully human" hinge
region is expressly required.
[0121] The presence of a "fully human" hinge region in the
GARP-TGF-.beta.1 antibodies of the invention may be beneficial both
to minimise immunogenicity and to optimise stability of the
antibody.
[0122] As discussed elsewhere herein, it is contemplated that one
or more amino acid substitutions, insertions or deletions may be
made within the constant region of the heavy and/or the light
chain, particularly within the Fc region. Amino acid substitutions
may result in replacement of the substituted amino acid with a
different naturally occurring amino acid, or with a non-natural or
modified amino acid. Other structural modifications are also
permitted, such as for example changes in glycosylation pattern
(e.g. by addition or deletion of N- or O-linked glycosylation
sites).
[0123] The GARP-TGF-.beta.1 antibodies may be modified within the
Fc region to increase binding affinity for the neonatal receptor
FcRn. The increased binding affinity may be measurable at acidic pH
(for example from about approximately pH 5.5 to approximately pH
6.0). The increased binding affinity may also be measurable at
neutral pH (for example from approximately pH 6.9 to approximately
pH 7.4). By "increased binding affinity" is meant increased binding
affinity to FcRn relative to the unmodified Fc region. Typically
the unmodified Fc region will possess the wild-type amino acid
sequence of human IgG1, IgG2, IgG3 or IgG4. In such embodiments,
the increased FcRn binding affinity of the antibody molecule having
the modified Fc region will be measured relative to the binding
affinity of wild-type IgG1, IgG2, IgG3 or IgG4 for FcRn.
[0124] In certain embodiments, one or more amino acid residues
within the Fc region may be substituted with a different amino acid
so as to increase binding to FcRn. Several Fc substitutions have
been reported that increase FcRn binding and thereby improve
antibody pharmacokinetics. Such substitutions are reported in, for
example, Zalevsky et al. (2010) Nat. Biotechnol. 28(2):157-9;
Hinton et al. (2006) J Immunol. 176:346-356; Yeung et al. (2009) J
Immunol. 182:7663-7671; Presta L G. (2008) Curr. Op. Immunol.
20:460-470; and Vaccaro et al. (2005) Nat. Biotechnol.
23(10):1283-88, the contents of which are incorporated herein in
their entirety.
[0125] In certain embodiments, the GARP-TGF-.beta.1 antibodies
comprise a modified human IgG Fc domain comprising or consisting of
the amino acid substitutions H433K and N434F, wherein the Fc domain
numbering is in accordance with EU numbering. In a further
embodiment, the GARP-TGF-.beta.1 antibodies described herein
comprise a modified human IgG Fc domain comprising or consisting of
the amino acid substitutions M252Y, S254T, T256E, H433K and N434F,
wherein the Fc domain numbering is in accordance with EU
numbering.
[0126] In certain embodiments, the GARP-TGF-.beta.1 antibodies
comprise a modified human IgG Fc domain consisting of up to 2, up
to 3, up to 4, up to 5, up to 6, up to 7, up to 8, up to 9, up to
10, up to 12, up to 15, up to 20 substitutions relative to the
corresponding wild-type IgG sequence.
[0127] Depending on the intended use of the antibody, it may be
desirable to modify the antibody of the invention with respect to
its binding properties to Fc receptors, for example to modulate
effector function. For example cysteine residue(s) may be
introduced in the Fc region, thereby allowing interchain disulfide
bond formation in this region. The homodimeric antibody thus
generated may have improved internalization capability and/or
increased complement-mediated cell killing and antibody-dependent
cellular cytotoxicity (ADCC). See Caron et al., J. Exp. Med.
176:1191-1195 (1992) and Shopes, B. J. Immunol. 148:2918-2922
(1992). The invention also contemplates immunoconjugates comprising
an antibody as described herein conjugated to a cytotoxic agent
such as a chemotherapeutic agent, toxin (e.g., an enzymatically
active toxin of bacterial, fungal, plant or animal origin, or
fragments thereof), or a radioactive isotope (i.e., a
radioconjugate). Fc regions may also be engineered for half-life
extension, as described by Chan and Carter, Nature Reviews:
Immunology, Vol. 10, pp 301-316, 2010, incorporated herein by
reference.
[0128] In yet another embodiment, the Fc region is modified to
increase the ability of the antibody to mediate antibody dependent
cellular cytotoxicity (ADCC) and/or to increase the affinity of the
antibody for an Fc.gamma. receptor by modifying one or more amino
acids.
[0129] In particular embodiments, the Fc region may be engineered
such that there is no effector function. A GARP-TGF-.beta.1
antibody having no Fc effector function may be particularly useful
as a receptor blocking agent. In certain embodiments, the
antibodies of the invention may have an Fc region derived from
naturally-occurring IgG isotypes having reduced effector function,
for example IgG4. Fc regions derived from IgG4 may be further
modified to increase therapeutic utility, for example by the
introduction of modifications that minimise the exchange of arms
between IgG4 molecules in vivo. Fc regions derived from IgG4 may be
modified to include the S228P substitution.
[0130] In still another embodiment, the glycosylation of an
antibody is modified. For example, an aglycosylated antibody can be
made (i.e., the antibody lacks glycosylation). Glycosylation can be
altered to, for example, increase the affinity of the antibody for
the target antigen. Such carbohydrate modifications can be
accomplished by, for example, altering one or more sites of
glycosylation within the antibody sequence. For example, one or
more amino acid substitutions can be made that result in
elimination of one or more variable region framework glycosylation
sites to thereby eliminate glycosylation at that site. Such
aglycosylation may increase the affinity of the antibody for
antigen.
[0131] Also envisaged are variant GARP-TGF-.beta.1 antibodies
having an altered type of glycosylation, such as a hypofucosylated
antibody having reduced amounts of fucosyl residues or a fully or
partially de-fucosylated antibody (as described by Natsume et al.,
Drug Design Development and Therapy, Vol. 3, pp 7-16, 2009) or an
antibody having increased bisecting GlcNac structures. Such altered
glycosylation patterns have been demonstrated to increase the ADCC
activity of antibodies, producing typically 10-fold enhancement of
ADCC relative to an equivalent antibody comprising a "native" human
Fc domain. Such carbohydrate modifications can be accomplished by,
for example, expressing the antibody in a host cell with altered
glycosylation enzymatic machinery (as described by Yamane-Ohnuki
and Satoh, mAbs 1:3, 230-236, 2009). Examples of non-fucosylated
antibodies with enhanced ADCC function are those produced using the
Potelligent.RTM. technology of BioWa Inc.
[0132] Antibodies intended for human therapeutic use will typically
be of the IgG, IgM, IgA, IgD, or IgE type, often of the IgG type,
in which case they can belong to any of the four sub-classes IgG1,
IgG2a and b, IgG3 or IgG4. Within each of these sub-classes it is
permitted to make one or more amino acid substitutions, insertions
or deletions within the Fc portion, or to make other structural
modifications, for example to enhance or reduce Fc-dependent
functionalities.
[0133] In certain embodiments, the antibodies which specifically
bind GARP-TGF-.beta.1 comprise at least one full-length
immunoglobulin heavy chain and/or at least one full-length lambda
or kappa light chain, wherein the heavy chain comprises or consists
of the amino acid sequence of SEQ ID NO:16 and the light chain
comprises or consists of the amino acid sequence of SEQ ID
NO:17.
[0134] In certain embodiments, the antibodies which specifically
bind GARP-TGF-.beta.1 comprise at least one full-length
immunoglobulin heavy chain and/or at least one full-length lambda
or kappa light chain, wherein the heavy chain comprises the amino
acid sequence of SEQ ID NO:16 and the light chain comprises the
amino acid sequence of SEQ ID NO:17.
[0135] In certain embodiments, the antibodies which specifically
bind GARP-TGF-.beta.1 comprise at least one full-length
immunoglobulin heavy chain and/or at least one full-length lambda
or kappa light chain, wherein the heavy chain consists of the amino
acid sequence of SEQ ID NO:16 and the light chain consists of the
amino acid sequence of SEQ ID NO:17.
[0136] In certain embodiments, provided herein are monoclonal
antibodies comprising a heavy chain with at least 90%, at least
95%, at least 97%, at least 98%, or at least 99% sequence identity
to the amino acid sequence shown as SEQ ID NO:16, and/or a light
chain with at least 90%, at least 95%, at least 97%, at least 98%,
or at least 99% sequence identity to the amino acid sequence shown
as SEQ ID NO:17.
[0137] In certain embodiments, provided herein are monoclonal
antibodies comprising a heavy chain with at least 90%, at least
95%, at least 97%, at least 98%, or at least 99% sequence identity
to the amino acid sequence shown as SEQ ID NO:16. In certain
embodiments, provided herein are monoclonal antibodies comprising a
light chain with at least 90%, at least 95%, at least 97%, at least
98%, or at least 99% sequence identity to the amino acid sequence
shown as SEQ ID NO:17. In certain embodiments, provided herein are
monoclonal antibodies comprising a heavy chain with at least 90%,
at least 95%, at least 97%, at least 98%, or at least 99% sequence
identity to the amino acid sequence shown as SEQ ID NO:16, and a
light chain with at least 90%, at least 95%, at least 97%, at least
98%, or at least 99% sequence identity to the amino acid sequence
shown as SEQ ID NO:17.
[0138] For embodiments wherein the chains of the antibodies are
defined by a particular percentage sequence identity to a reference
sequence, the heavy chain and/or light chain may retain identical
CDR sequences to those present in the reference sequence such that
the variation is present only outside the CDR regions. In
particular, the antibodies or antigen binding fragments comprising
heavy chains and/or light chains defined as having a particular
percentage identity to SEQ ID NOs: 16 and 17, respectively, may
have the following CDR sequences:
a VH CDR3 comprising or consisting of the amino acid sequence
YEWETVVVGDLMYEYEY (SEQ ID NO: 13), a VH CDR2 comprising or
consisting of the amino acid sequence RIDPEDAGTKYAQKFQG (SEQ ID NO:
12), a VH CDR1 comprising or consisting of the amino acid sequence
SYYID (SEQ ID NO: 4), a VL CDR3 comprising or consisting of the
amino acid sequence QQYASVPVT (SEQ ID NO: 11), and a VL CDR2
sequence comprising or consisting of SEQ ID NO: 10 [GASRLKT] and a
VL CDR1 comprising or consisting of the amino acid sequence
QASQSISSYLA (SEQ ID NO: 9).
Binding to GARP-TGF-.beta.1
[0139] The antibodies and antigen binding fragments of the present
invention bind to a complex of GARP and TGF-.beta.1, particularly a
complex of human GARP and human TGF-.beta.1. As explained elsewhere
herein, GARP is a transmembrane protein expressed on the surface of
regulatory T cells and acts as the receptor for the latent form of
TGF-.beta.. FIG. 1 includes a schematic representation of the
complex that forms between GARP and latent TGF-.beta. at the cell
surface of regulatory T cells.
[0140] The GARP-TGF-.beta.1 complex to which the antibodies and
antigen binding fragments of the present invention bind is the
native GARP-TGF-.beta.1 complex that forms at the cell surface
between GARP and TGF-.beta.1.
[0141] The antibodies and antigen binding fragments of the present
invention are characterised in that they bind to the complex of
GARP-TGF-.beta.1 but do not bind to GARP in the absence of
TGF-.beta.1 or latent TGF-.beta.. The antibodies and antigen
binding fragments bind to GARP only in the presence of TGF-.beta.1.
In particular, the antibodies and antigen binding fragments bind to
GARP only in the presence of latent TGF-.beta.1.
[0142] Since the target antigen for the antibodies and antigen
binding fragments thereof of the present invention is a complex
comprising two separate proteins, the epitope to which the
antibodies and antigen binding fragments bind is a conformational,
as opposed to a linear, epitope. The conformational epitope
comprises at least one residue from GARP and at least one residue
from latent TGF-.beta.1. In preferred embodiments, the
conformational epitope comprises at least one residue from GARP, at
least one residue from the latency associated peptide (LAP) of
latent TGF-.beta.1 and at least one residue from mature
TGF-.beta.1.
[0143] The antibodies and antigen binding fragments of the present
invention may bind to an epitope of a complex formed by human GARP
and human TGF-.beta.1 wherein the epitope comprises at least one
residue from GARP selected from Y137, S138, G139, T162 and R163
(with reference to SEQ ID NO: 33), and at least one residue from
TGF-.beta.1. In preferred embodiments, the epitope comprises at
least residues Y137, S138, G139, T162 and R163 of GARP (with
reference to SEQ ID NO:33).
[0144] The epitope may comprise at least one residue from the
TGF-.beta.1 polypeptide (SEQ ID NO: 34), optionally wherein the at
least one residue is K338. The epitope may comprise at least one
residue from the latency associated peptide (LAP) of TGF-.beta.1
and at least one residue from mature TGF-.beta.1. The epitope may
comprise R58 of LAP and K338 of mature TGF-.beta.1 (with reference
to SEQ ID NO: 34).
[0145] The antibodies and antigen binding fragments of the present
invention bind to a complex of GARP and TGF-.beta.1. The antibodies
and antigen binding fragments of the present invention may
additionally bind to a complex of human GARP and human TGF-.beta.2
and/or a complex of human GARP and human TGF-.beta.3.
[0146] In certain embodiments, antibodies and antigen binding
fragments of the invention bind to the complex of GARP and
TGF-.beta.1 with high affinity. As used herein, the term "affinity"
or "binding affinity" should be understood based on the usual
meaning in the art in the context of antibody binding, and reflects
the strength and/or stability of binding between an antigen and a
binding site on an antibody or antigen binding fragment
thereof.
[0147] The binding affinity of an antibody or antigen binding
fragment thereof for its respective antigen can be determined
experimentally using techniques known in the art. For example, SPR
instruments such as Biacore.TM. measure affinity based on the
immobilization of a target protein or antigen on a biosensor chip
while the antibody or antibody fragment is passed over the
immobilized target under specific flow conditions. These
experiments yield k.sub.on and k.sub.off measurements, which can be
translated into K.sub.D values, wherein K.sub.D is the equilibrium
constant for the dissociation of an antigen with an antibody or
fragment thereof. The smaller the K.sub.D value, the stronger the
binding interaction between an antibody and its target antigen.
[0148] As noted above, the affinity of an antibody may be
determined by SPR, for example using the protocol described
elsewhere herein. The affinity of the antibody or antigen binding
fragment for the GARP-TGF-.beta.1 complex, as measured by SPR, may
be determined using recombinantly expressed GARP-TGF-.beta.1
complex, as described for example, in Example 2.
[0149] The GARP-TGF-.beta.1 antibodies or antigen binding fragments
thereof of the invention may exhibit an off-rate (k.sub.off) for
the GARP-TGF-.beta.1 complex of less than 7.times.10.sup.-4
s.sup.-1, less than 5.times.10.sup.-4 s.sup.-1, less than
3.times.10.sup.-4 s.sup.-1, less than 1.5.times.10.sup.-4 s.sup.-1
when tested as a Fab. The GARP-TGF-.beta. antibodies or antigen
binding fragments thereof of the invention may exhibit an off-rate
(k.sub.off) for the complex of GARP-TGF-.beta.1 in the range from
1.times.10.sup.-6 s.sup.-1 to 5.times.10.sup.-4 s.sup.-1,
preferably in the range from 1.times.10.sup.-6 s.sup.-1 to
3.times.10.sup.-4 s.sup.-1, more preferably in the range from
1.times.10.sup.-5 s.sup.-1 to 1.5.times.10.sup.-4 s.sup.-1.
[0150] The GARP-TGF-.beta.1 antibodies of the invention may exhibit
a K.sub.D value less than 5.times.10.sup.-9 M, less than
2.times.10.sup.-9 M. In preferred embodiments, the GARP-TGF-.beta.1
antibodies of the invention exhibit a K.sub.D value less than
1.7.times.10.sup.-9 M.
[0151] In certain embodiments, the antibodies or antigen binding
fragments described herein that bind to the complex of GARP and
TGF-.beta.1 may cross-react with one or more species homologs of
GARP and TGF-.beta., for example GARP and TGF-.beta. homologs of
non-human primate origin.
[0152] In certain embodiments, the antibodies or antigen binding
fragments of the present invention do not cross-react with the
complex of GARP and TGF-.beta. of murine origin. Alternatively or
in addition, the antibodies or antigen binding fragments may bind
to the GARP-TGF-.beta. complex of non-human primate origin,
particularly the GARP-TGF-.beta. complex of cynomolgus origin. The
cross-reactivity with other species homologs can be particularly
advantageous in the development and testing of therapeutic
antibodies. For example, pre-clinical toxicology testing of
therapeutic antibodies is frequently carried out in primate species
including but not limited to cynomolgus monkeys. Cross-reactivity
with these species homologs can therefore be particularly
advantageous for the development of antibodies as clinical
candidates.
Improved Stability
[0153] The GARP-TGF-.beta.1 antibodies of the invention are
improved as compared with GARP-TGF-.beta.1 antibodies described
previously, for the reason that they display improved stability. In
particular, the stability of the GARP-TGF-.beta.1 antibodies is
improved as compared with antibodies having the heavy chain and
light chain CDR sequences of the GARP-TGF-.beta.1 reference
antibody LHG10.6, described in WO2015/015003 and WO2016/125017.
[0154] The GARP-TGF-.beta. antibody LHG10.6 possesses the following
combination of heavy chain variable domain and light chain variable
domain CDR sequences:
heavy chain CDR3 consisting of NEWETVVVGDLMYEYEY (SEQ ID NO: 6),
heavy chain CDR2 consisting of RIDPEDGGTKYAQKFQG (SEQ ID NO: 5),
heavy chain CDR1 consisting of SYYID (SEQ ID NO: 4), light chain
CDR3 consisting of QQYASVPVT (SEQ ID NO: 11), light chain CDR2
consisting of GASRLKT (SEQ ID NO: 10), and light chain CDR1
consisting of QASQSISSYLA (SEQ ID NO: 9).
[0155] As reported elsewhere herein, it has been found that
GARP-TGF-.beta.1 antibodies having the heavy chain and light chain
CDR sequences of LHG10.6 lack stability. In particular, germlined
monoclonal antibody variants of LHG10.6 (referred to elsewhere
herein as mAb 39B6 IgG4 and 39B6 IgG1) were found to exhibit a
trend towards lower target binding activity when stored at
37.degree. C. in both PBS and PBS/Tween (see for example, FIG. 2).
This instability was attributed at least in part to the
isomerization and deamidation at position N95 of HCDR3, i.e. the
first residue of heavy chain CDR3.
[0156] The GARP-TGF-.beta.1 antibodies and antigen binding
fragments of the present invention differ with respect to their CDR
sequences, particularly their heavy chain CDR sequences, such that
their stability is improved. In particular, the heavy chain CDR2
(HCDR2 or VH CDR2) sequence is modified to include a G55A
substitution, such that the HCDR2 sequence of the antibodies of the
invention comprises the HCDR2 represented by RIDPEDAGTKYAQKFQG (SEQ
ID NO: 12). In addition, the heavy chain CDR3 (HCDR3 or VH CDR3)
sequence is modified to include a N95Y substitution, such that the
HCDR3 sequence of the antibodies of the invention comprises the
HCDR3 represented by YEWETVVVGDLMYEYEY (SEQ ID NO: 13). The
antibodies of the present invention do not undergo deamidation or
isomerization. In addition, it has surprisingly been found that the
GARP-TGF-.beta.1 antibodies of the present invention are relatively
resistant to oxidation. This resistance to deamidation,
isomerization and oxidation correlates with improved stability of
the antibodies of the invention, particularly improved stability as
measured at a temperature of 37.degree. C.
[0157] Furthermore, the antibodies and antigen binding fragments of
the invention are surprisingly advantageous because the
modifications to the heavy chain CDR2 and CDR3 sequences, as
compared with the reference antibody LHG10.6, do not significantly
decrease target binding activity. As exemplified herein, the
GARP-TGF-.beta.1 antibodies of the present invention are relatively
stable at 37.degree. C. and do not exhibit a significant reduction
in binding affinity for the GARP-TGF-.beta.1 complex as compared
with the reference antibody LHG10.6 or a germlined variant thereof
(3966). As described elsewhere, in preferred embodiments, the
GARP-TGF-.beta.1 antibodies of the invention exhibit a K.sub.D
value less than 1.7.times.10.sup.-9 M.
[0158] As reported herein, not all substitutions at position N95 of
HCDR3 that remove the Asn (N) residue are capable of improving
antibody stability whilst also retaining binding affinity for the
GARP-TGF-.beta.1 complex. A germlined monoclonal antibody variant
having an N95V substitution (referred to herein as 39B6-AVE) was
found to be resistant to deamidation and isomerization, but
underwent significant oxidation upon storage for 28 days at
37.degree. C. The binding activity of this N95V antibody variant
was also found to decrease significantly over a 56-day period of
storage at 37.degree. C. The inventors also found that bulky
substitutions at adjacent position 96 in the heavy chain (i.e. the
second residue of HCDR3) were incapable of improving stability and
retaining high affinity antigen binding activity. As exemplified
herein, the inventors tested two germlined monoclonal antibody
variants including the substitutions E96K and E96R in the HCDR3
domain. The E96K variant (referred to herein as 39B6-ANK) did not
undergo oxidation, but was subject to deamidation and isomerization
over a 28-day period at 37.degree. C. and underwent a significant
decrease in binding activity over a 56-day period. The E96R variant
(referred to herein as 39B6-ANR) underwent significant oxidation
and deamidation over a 28-day period at 37.degree. C. and underwent
a decrease in binding activity over a 56-day period.
[0159] In preferred embodiments of the invention, the antibodies
which specifically bind the GARP-TGF-81 complex and exhibit
improved stability comprise at least one heavy chain variable
domain (VH) and at least one light chain variable domain (VL),
wherein
the VH CDR3 comprises or consists of the amino acid sequence
YEWETVVVGDLMYEYEY (SEQ ID NO: 13), the VH CDR2 comprises or
consists of the amino sequence RIDPEDAGTKYAQKFQG (SEQ ID NO: 12),
the VH CDR1 comprises or consists of the amino acid sequence SYYID
(SEQ ID NO: 4), the VL CDR3 comprises or consists of the amino acid
sequence QQYASVPVT (SEQ ID NO: 11), the VL CDR2 comprises or
consists of the amino sequence GASRLKT (SEQ ID NO: 10), and the VL
CDR1 comprises or consists of the amino acid sequence QASQSISSYLA
(SEQ ID NO: 9).
[0160] In certain preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise at least one heavy chain
variable domain (VH) and at least one light chain variable domain
(VL), wherein
the VH CDR3 comprises the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 comprises the amino sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), the VH CDR1 comprises the amino
acid sequence SYYID (SEQ ID NO: 4), the VL CDR3 comprises the amino
acid sequence QQYASVPVT (SEQ ID NO: 11), the VL CDR2 comprises the
amino sequence GASRLKT (SEQ ID NO: 10), and the VL CDR1 comprises
the amino acid sequence QASQSISSYLA (SEQ ID NO: 9).
[0161] In certain preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise at least one heavy chain
variable domain (VH) and at least one light chain variable domain
(VL), wherein
the VH CDR3 consists of the amino acid sequence YEWETVVVGDLMYEYEY
(SEQ ID NO: 13), the VH CDR2 consists of the amino sequence
RIDPEDAGTKYAQKFQG (SEQ ID NO: 12), the VH CDR1 consists of the
amino acid sequence SYYID (SEQ ID NO: 4), the VL CDR3 consists of
the amino acid sequence QQYASVPVT (SEQ ID NO: 11), the VL CDR2
consists of the amino sequence GASRLKT (SEQ ID NO: 10), and the VL
CDR1 consists of the amino acid sequence QASQSISSYLA (SEQ ID NO:
9).
[0162] These antibodies preferably exhibit a K.sub.D value less
than 1.7.times.10.sup.-9 M.
[0163] In particularly preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise a heavy chain variable domain
(VH) comprising or consisting of the amino acid sequence of SEQ ID
NO: 14 and optionally a light chain variable domain (VL) comprising
or consisting of the amino acid sequence of SEQ ID NO: 15.
[0164] In particularly preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise a heavy chain variable domain
(VH) comprising the amino acid sequence of SEQ ID NO: 14 and a
light chain variable domain (VL) comprising the amino acid sequence
of SEQ ID NO: 15.
[0165] In particularly preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise a heavy chain variable domain
(VH) consisting of the amino acid sequence of SEQ ID NO: 14 and a
light chain variable domain (VL) consisting of the amino acid
sequence of SEQ ID NO: 15.
[0166] In further preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise a heavy chain comprising or
consisting of the amino acid sequence of SEQ ID NO: 16 and
optionally a light chain comprising or consisting of the amino acid
sequence of SEQ ID NO: 17.
[0167] In further preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise a heavy chain comprising the
amino acid sequence of SEQ ID NO: 16 and a light chain comprising
the amino acid sequence of SEQ ID NO: 17.
[0168] In further preferred embodiments of the invention, the
antibodies which specifically bind the GARP-TGF-.beta.1 complex and
exhibit improved stability comprise a heavy chain consisting of the
amino acid sequence of SEQ ID NO: 16 and a light chain consisting
of the amino acid sequence of SEQ ID NO: 17.
Polynucleotides Encoding GARP-TGF-.beta. Antibodies
[0169] The invention also provides polynucleotide molecules
comprising one or more nucleotide sequences encoding the
GARP-TGF-.beta.1 antibodies or antigen binding fragments of the
invention, expression vectors containing said nucleotide sequences
of the invention operably linked to regulatory sequences which
permit expression of the antibodies or fragments thereof in a host
cell or cell-free expression system, and host cells or cell-free
expression systems containing said expression vectors.
[0170] In certain embodiments, the heavy chain variable domain
and/or the light chain variable domain of the GARP-TGF-.beta.1
antibodies or antigen-binding fragments according to the present
invention are encoded by first and second polynucleotide sequences,
wherein the first and second polynucleotide sequences comprise the
amino acid sequences of SEQ ID NOs: 18 and 19, respectively. In
certain embodiments, the polynucleotides encoding the
GARP-TGF-.beta.1 antibodies of the invention may comprise variant
sequences which encode functional VH or VL domains of a
GARP-TGF-.beta.1 antibody. The variant sequences encoding VH
domains may exhibit at least 80%, 85%, 90%, 95%, 97% or 99%
sequence identity when optimally aligned to SEQ ID NO: 18, and the
variant sequences encoding VL domains may exhibit at least 80%,
85%, 90%, 95%, 97% or 99% sequence identity when optimally aligned
to SEQ ID NO: 19.
[0171] In certain embodiments, the heavy chain and/or the light
chain of the GARP-TGF-.beta.1 antibodies or antigen-binding
fragments according to the present invention are encoded by first
and second polynucleotide sequences, wherein the first and second
polynucleotide sequences comprise the amino acid sequences of SEQ
ID NOs: 20 and 21, respectively. In certain embodiments, the
polynucleotides encoding the GARP-TGF-.beta.1 antibodies of the
invention may comprise variant sequences which encode heavy chains
or light chains of a GARP-TGF-.beta.1 antibody. The variant
sequences encoding heavy chains may exhibit at least 80%, 85%, 90%,
95%, 97% or 99% sequence identity when optimally aligned to SEQ ID
NO: 20, and the variant sequences encoding light chains may exhibit
at least 80%, 85%, 90%, 95%, 97% or 99% sequence identity when
optimally aligned to SEQ ID NO: 21.
[0172] In this context, % sequence identity between two
polynucleotide sequences may be determined by comparing these two
sequences aligned in an optimum manner and in which the
polynucleotide sequence to be compared can comprise additions or
deletions with respect to the reference sequence for an optimum
alignment between these two sequences. The percentage of identity
is calculated by determining the number of identical positions for
which the nucleotide residue is identical between the two
sequences, by dividing this number of identical positions by the
total number of positions in the comparison window and by
multiplying the result obtained by 100 in order to obtain the
percentage of identity between these two sequences. For example, it
is possible to use the BLAST program, "BLAST 2 sequences" (Tatusova
et al, "Blast 2 sequences--a new tool for comparing protein and
nucleotide sequences", FEMS Microbiol Lett. 174:247-250) available
at ncbi.nlm.nih.gov/gorf/bl2, the parameters used being those given
by default (in particular for the parameters "open gap penalty": 5,
and "extension gap penalty": 2; the matrix chosen being, for
example, the matrix "BLOSUM 62" proposed by the program), the
percentage of identity between the two sequences to be compared
being calculated directly by the program.
[0173] Polynucleotide molecules encoding the antibodies of the
invention include, for example, recombinant DNA molecules. The
terms "nucleic acid", "polynucleotide" or "polynucleotide molecule"
as used interchangeably herein refer to any DNA or RNA molecule,
either single- or double-stranded and, if single-stranded, the
molecule of its complementary sequence. In discussing nucleic acid
molecules, a sequence or structure of a particular nucleic acid
molecule may be described herein according to the normal convention
of providing the sequence in the 5' to 3' direction. In some
embodiments of the invention, nucleic acids or polynucleotides are
"isolated." This term, when applied to a nucleic acid molecule,
refers to a nucleic acid molecule that is separated from sequences
with which it is immediately contiguous in the naturally occurring
genome of the organism in which it originated. For example, an
"isolated nucleic acid" may comprise a DNA molecule inserted into a
vector, such as a plasmid or virus vector, or integrated into the
genomic DNA of a prokaryotic or eukaryotic cell or non-human host
organism. When applied to RNA, the term "isolated polynucleotide"
refers primarily to an RNA molecule encoded by an isolated DNA
molecule as defined above. Alternatively, the term may refer to an
RNA molecule that has been purified/separated from other nucleic
acids with which it would be associated in its natural state (i.e.,
in cells or tissues). An isolated polynucleotide (either DNA or
RNA) may further represent a molecule produced directly by
biological or synthetic means and separated from other components
present during its production.
[0174] For recombinant production of an antibody according to the
invention, a recombinant polynucleotide encoding it may be prepared
(using standard molecular biology techniques) and inserted into a
replicable vector for expression in a chosen host cell or a
cell-free expression system. Suitable host cells may be prokaryote,
yeast, or higher eukaryote cells, specifically mammalian cells.
Examples of useful mammalian host cell lines are monkey kidney CV1
line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic
kidney line (293 or 293 cells subcloned for growth in suspension
culture, Graham et al., J. Gen. Virol. 36:59 (1977)); baby hamster
kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR
(CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980));
mouse sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980));
mouse myeloma cells SP2/0-AG14 (ATCC CRL 1581; ATCC CRL 8287) or
NS0 (HPA culture collections no. 85110503); monkey kidney cells
(CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC
CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2);
canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells
(BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75);
human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT
060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad.
Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human
hepatoma line (Hep G2), as well as DSM's PERC-6 cell line.
Expression vectors suitable for use in each of these host cells are
also generally known in the art.
[0175] It should be noted that the term "host cell" generally
refers to a cultured cell line. Whole human beings into which an
expression vector encoding an antibody or antigen binding fragment
according to the invention has been introduced are explicitly
excluded from the definition of a "host cell".
Antibody Production
[0176] In a further aspect, the invention also provides a method of
producing antibodies of the invention which comprises culturing a
host cell (or cell-free expression system) containing one or more
polynucleotides (e.g., an expression vector) encoding the antibody
under conditions which permit expression of the antibody, and
recovering the expressed antibody. This recombinant expression
process can be used for large scale production of antibodies,
including
[0177] GARP-TGF-.beta.1 antibodies according to the invention,
including monoclonal antibodies intended for human therapeutic use.
Suitable vectors, cell lines and production processes for large
scale manufacture of recombinant antibodies suitable for in vivo
therapeutic use are generally available in the art and will be well
known to the skilled person.
Pharmaceutical Compositions
[0178] The scope of the invention includes pharmaceutical
compositions containing one or a combination of GARP-TGF-.beta.1
antibodies of the invention, or antigen-binding fragments thereof,
formulated with one or more pharmaceutically acceptable carriers or
excipients. Such compositions may include one or a combination of
(e.g., two or more different) GARP-TGF-.beta.1 antibodies.
Techniques for formulating monoclonal antibodies for human
therapeutic use are well known in the art and are reviewed, for
example, in Wang et al., Journal of Pharmaceutical Sciences, Vol.
96, pp 1-26, 2007, the contents of which are incorporated herein in
their entirety.
[0179] In certain embodiments, the pharmaceutical compositions are
formulated for administration to a subject via any suitable route
of administration including but not limited to intravenous,
intramuscular, intradermal, intraperitoneal, subcutaneous,
epidural, nasal, oral, rectal, topical, inhalational, buccal (e.g.,
sublingual), and transdermal administration.
[0180] Pharmaceutically acceptable excipients that may be used in
these compositions include, but are not limited to, ion exchangers,
alumina, aluminum stearate, lecithin, serum proteins, such as human
serum albumin, buffer substances such as phosphates, glycine,
sorbic acid, potassium sorbate, partial glyceride mixtures of
saturated vegetable fatty acids, water, salts or electrolytes, such
as protamine sulfate, disodium hydrogen phosphate, potassium
hydrogen phosphate, sodium chloride, zinc salts, colloidal silica,
magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based
substances (for example sodium carboxymethylcellulose),
polyethylene glycol, polyacrylates, waxes,
polyethylene-polyoxypropylene-block polymers, polyethylene glycol
and wool fat.
Therapeutic Utility of GARP-TGF-.beta.1 Antibodies
[0181] The antibodies and antigen binding fragments of the present
invention may be used in methods of treatment, wherein a subject in
need thereof is administered a therapeutically effective amount of
a GARP-TGF-.beta.1 antibody or antigen binding fragment thereof. In
certain embodiments, the antibodies and antigen binding fragments
of the present invention may be used in methods of treatment,
wherein a human subject in need thereof is administered a
therapeutically effective amount of a GARP-TGF-.beta.1 antibody or
antigen binding fragment thereof. Provided herein are antibodies or
antigen binding fragments thereof, which bind to the complex of
human GARP and TGF-.beta.1, for use as medicaments.
[0182] The antibodies and antigen binding fragments of the
invention bind to the GARP-TGF-.beta. complex on regulatory T cells
and can block active TGF-.beta. production or release. Therefore,
in a further aspect of the invention, provided herein are methods
for treating subjects having or suspected of having
TGF-.beta.-related disorders. Such methods involve administering to
a subject in need thereof a therapeutically effective amount of a
GARP-TGF-.beta.1 antibody of the invention.
[0183] Exemplary TGF-.beta.-related disorders include, but are not
limited to, inflammatory diseases, chronic infection, cancer,
fibrosis, cardiovascular diseases, cerebrovascular disease (e.g.
ischemic stroke), and neurodegenerative diseases. In certain
embodiments, a TGF-.beta.-related disorder is chronic infection. In
certain embodiments, a TGF-.beta.-related disorder is cancer.
[0184] For use in administration to a subject, the antibodies and
antigen binding fragments of the invention may be formulated as
pharmaceutical compositions. The compositions may be administered
orally, parenterally, by inhalation spray, topically, rectally,
nasally, buccally, vaginally or via an implanted reservoir. The
term "administration" as used herein includes without limitation
subcutaneous, intravenous, intraperitoneal, intramuscular,
intra-articular, intra-synovial, intrasternal, intrathecal,
intrahepatic, intralesional, intratumoral, and intracranial
injection or infusion techniques.
[0185] Sterile injectable forms of the compositions may be aqueous
or an oleaginous suspension. These suspensions may be formulated
according to techniques known in the art using suitable dispersing
or wetting agents and suspending agents. The sterile injectable
preparation may also be a sterile injectable solution or suspension
in a non-toxic parenterally acceptable diluent or solvent. Among
the acceptable vehicles and solvents that may be employed are
water, Ringer's solution and isotonic sodium chloride solution. In
addition, sterile, fixed oils are conventionally employed as a
solvent or suspending medium. For this purpose, any bland fixed oil
may be employed including synthetic mono- or diglycerides. Fatty
acids, such as oleic acid and its glyceride derivatives are useful
in the preparation of injectables, as are natural pharmaceutically
acceptable oils, such as olive oil or castor oil, especially in
their polyoxyethylated versions. These oil solutions or suspensions
may also contain a long-chain alcohol diluent or dispersant, such
as carboxymethyl cellulose or similar dispersing agents that are
commonly used in the formulation of pharmaceutically acceptable
dosage forms including emulsions and suspensions. Other commonly
used surfactants, such as Tweens, Spans and other emulsifying
agents or bioavailability enhancers which are commonly used in the
manufacture of pharmaceutically acceptable solid, liquid, or other
dosage forms may also be used for the purposes of formulation.
[0186] Schedules and dosages for administration of the antibody or
antigen binding fragment thereof in the pharmaceutical compositions
can be determined in accordance with known methods for these types
of products. For example, an antibody present in a pharmaceutical
composition of this invention can be supplied at a concentration of
10 mg/mL in either 100 mg (10 mL) or 500 mg (50 mL) single-use
vials. The product is formulated for intravenous (IV)
administration in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium
citrate dihydrate, 0.7 in g/mL polysorbate 80, and Sterile Water
for Injection. The pH is adjusted to 6.5.
[0187] For clinical use, the antibody or antigen binding fragment
can be administered to a subject in one or more doses. For
parenteral routes of administration, a single dose of the antibody
or antigen binding fragment can be, for example, about 0.01 to
about 100 mg/kg body weight. In an embodiment, a single dose of the
antibody or antigen binding fragment can be, for example, about 0.1
to about 50 mg/kg body weight. In an embodiment, a single dose of
the antibody or antigen binding fragment can be, for example, about
1 to about 20 mg/kg body weight. For repeated dosing, individual
doses can be administered by the same or different routes of
administration. Also for repeated dosing, individual doses can be
the same or different. For example, a first or loading dose may be
more than a subsequent dose. Also for repeated dosing, individual
doses can be administered on a fixed schedule or on an adjustable
or variable schedule based, for example, on a subject's clinical
condition or clinical response. Also for repeated dosing,
individual doses typically can be administered once daily, once
every other day, once every 3, 4, 5, 6, or 7 days, once weekly,
once biweekly, once every three or four weeks, or once every other
month. Other schedules are also contemplated by the invention.
[0188] It will be appreciated that these doses and schedules are
exemplary and that an optimal schedule and regimen can be
determined by taking into account such factors as the particular
antibody or antigen binding fragment to be administered, the
disease or disorder to be treated, the size, age and condition of
the subject to be treated, the route of administration, other
therapies being administered to the subject, and the affinity and
tolerability of the particular antibody. Such factors and dosing
considerations can be determined in one or more clinical
trials.
[0189] The present invention also provides methods for boosting the
immune system in a subject in need thereof, comprising
administering to a subject a therapeutically effective amount of an
antibody or antigen binding fragment of the invention. The present
invention also provides methods for inhibiting the immune
suppressive function of human Tregs in a subject in need thereof,
comprising administering to the subject a therapeutically effective
amount of an antibody or antigen binding fragment of the
invention.
[0190] The present invention also provides methods for the
treatment of cancer using GARP-TGF-.beta.1 antibodies and antigen
binding fragments of the invention. Such methods may involve
reducing immunosuppression in the tumor environment in a subject in
need thereof.
[0191] For embodiments wherein the GARP-TGF-.beta.1 antibodies or
antigen binding fragments thereof are for use in methods of
treating cancer, the antibodies or antigen binding fragments
thereof may be administered in combination with one or more
additional treatments for cancer, for example one or more
immunotherapeutic agent(s).
[0192] For embodiments wherein the GARP-TGF-.beta.1 antibodies are
administered in combination with an immunotherapeutic agent, said
immunotherapeutic agent may be a tumor vaccine. Alternatively, the
immunotherapeutic agent may be an immunostimulatory antibody.
Without wishing to be bound by theory, the antibodies of the
invention will likely improve the efficacy of the immunotherapeutic
agent by preventing or alleviating any immunosuppression. In
certain embodiments, the combination with an immunotherapeutic
agent may exhibit a synergistic effect.
[0193] Various cancers can be treated in accordance with the
methods described herein including but not limited to
adrenocortical carcinoma, anal cancer, bladder cancer, brain tumor,
glioma, breast carcinoma, carcinoid tumor, cervical cancer, colon
carcinoma, endometrial cancer, esophageal cancer, extrahepatic bile
duct cancer, Ewing's tumor, extracranial germ cell tumor, eye
cancer, gall bladder cancer, gastric cancer, germ cell tumor,
gestational trophoblastic tumor, head and neck cancer,
hypopharyngeal cancer, islet cell carcinoma, kidney cancer,
laryngeal cancer, leukemia, lip and oral cavity cancer, liver
cancer, lung cancer, lymphoma, melanoma, mesothelioma, Merkel cell
carcinoma, metastatic squamous head and neck cancer, myeloma,
neoplasm, nasopharyngeal cancer, neuroblastoma, oral cancer,
oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic
cancer, sinus and nasal cancer, parathyroid cancer, penile cancer,
pheochromocytoma, pituitary cancer, plasma cell neoplasm, prostate
cancer, rhabdomyosarcoma, rectal cancer, renal cell carcinoma,
salivary gland cancer, skin cancer,
[0194] Kaposi's sarcoma, T-cell lymphoma, soft tissue sarcoma,
stomach cancer, testicular cancer, thymoma, thyroid cancer,
urethral cancer, uterine cancer, vaginal cancer, vulvar cancer, or
Wilms' tumor.
[0195] Suitable tumor antigens for use as tumor vaccines known in
the art include for example: (a) cancer-testis antigens such as
NY-ESO-1, SSX2, SCP1 as well as RAGE, BAGE, GAGE and MAGE family
polypeptides, for example, GAGE-1, GAGE-2, MAGE-1, MAGE-2, MAGE-3,
MAGE-4, MAGE-5, MAGE-6, and MAGE-12 (which can be used, for
example, to address melanoma, lung, head and neck, NSCLC, breast,
gastrointestinal, and bladder tumors), (b) mutated antigens, for
example, p53 (associated with various solid tumors, e.g.,
colorectal, lung, head and neck cancer), p21/Ras (associated with,
e.g., melanoma, pancreatic cancer and colorectal cancer), CD 4
(associated with, e.g., melanoma), MUM 1 (associated with, e.g.,
melanoma), caspase-8 (associated with, e.g., head and neck cancer),
CIA 0205 (associated with, e.g., bladder cancer), HLA-A2-R1701,
beta catenin (associated with, e.g., melanoma), TCR (associated
with, e.g., T-cell non-Hodgkins lymphoma), BCR-abl (associated
with, e.g., chronic myelogenous leukemia), triosephosphate
isomerase, IA 0205, CDC-27, and LDLR-FUT, (c) over-expressed
antigens, for example, Galectin 4 (associated with, e.g.,
colorectal cancer), Galectin 9 (associated with, e.g., Hodgkin's
disease), proteinase 3 (associated with, e.g., chronic myelogenous
leukemia), WT 1 (associated with, e.g., various leukemias),
carbonic anhydrase (associated with, e.g., renal cancer), aldolase
A (associated with, e.g., lung cancer), PRAME (associated with,
e.g., melanoma), HER-2/neu (associated with, e.g., breast, colon,
lung and ovarian cancer), alpha-fetoprotein (associated with, e.g.,
hepatoma), SA (associated with, e.g., colorectal cancer), gastrin
(associated with, e.g., pancreatic and gastric cancer), telomerase
catalytic protein, MUC-1 (associated with, e.g., breast and ovarian
cancer), G-250 (associated with, e.g., renal cell carcinoma), and
carcinoembryonic antigen (associated with, e.g., breast cancer,
lung cancer, and cancers of the gastrointestinal tract such as
colorectal cancer), (d) shared antigens, for example,
melanoma-melanocyte differentiation antigens such as MART-I/Melan
A, gp100, MCI R, melanocyte-stimulating hormone receptor,
tyrosinase, tyrosinase related protein-1/TRPI and tyrosinase
related protein-2/TRP2 (associated with, e.g., melanoma), (e)
prostate associated antigens such as PAP, PSA, PSMA, PSH-P1,
PSM-P1, PSM-P2, associated with e.g., prostate cancer, (f)
immunoglobulin idiotypes (associated with myeloma and B cell
lymphomas, for example), and (g) other tumor antigens, such as
polypeptide- and saccharide-containing antigens including (i)
glycoproteins such as sialyl Tn and sialyl Le<x> (associated
with, e.g., breast and colorectal cancer) as well as various
mucins; glycoproteins may be coupled to a carrier protein (e.g.,
MUC-1 may be coupled to LH); (ii) lipopolypeptides (e.g., MUC-1
linked to a lipid moiety); (iii) polysaccharides (e.g., Globo H
synthetic hexasaccharide), which may be coupled to a carrier
proteins (e.g., to KLH), (iv) gangliosides such as GM2, GM12, GD2,
GD3 (associated with, e.g., brain, lung cancer, melanoma), which
also may be coupled to carrier proteins (e.g., KLH). Other tumor
antigens include pi 5, Hom/Mel-40, H-Ras, E2A-PRL, H4-RET, IGH-IGK,
MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus
(HPV) antigens, including E6 and E7, hepatitis B and C virus
antigens, human T-cell lymphotropic virus antigens, TSP-180,
pl85erbB2, pl80erbB-3, c-met, mn-23H I, TAG-72-4, CA 19-9, CA 72-4,
CAM 17.1, NuMa, K-ras, p 16, TAGE, PSCA, CT7, 43-9F, 514, 791
Tgp72, beta-HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA
195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, Ga733 (EpCAM),
HTgp-175, M344, MA-50, MG7-Ag, MOV 18, NB/70K, NY-CO-1, RCAS1,
SDCCAG16, TA-90 (Mac-2 binding protein/cyclophilin C-associated
protein), TAAL6, TAG72, TLP, TPS, and the like. Suitable
immunostimulatory antibodies include, but are not limited to:
anti-CTLA-4, anti-PD1, anti-PDL1 and anti-KIR antibodies.
[0196] In certain embodiments, the methods for treating cancer
described herein, comprise administering to the subject the
antibody or antigen binding fragment of the invention prior to,
concurrent to and/or after the administration of another
anti-cancer agent or cancer treatment, such as chemotherapy
treatment.
[0197] The present invention also includes methods for preventing
infectious diseases by administering antibodies or antigen binding
fragments of the invention so as to improve the efficacy of
vaccination strategies. For example, the methods of the invention
may include the prevention of infectious diseases such as HIV,
malaria, or Ebola by combined administration of antibodies or
antigen binding fragments as described herein together with
vaccines particular to these diseases.
Kits
[0198] In a further aspect, the present invention provides a kit
comprising at least one GARP-TGF-.beta.1 antibody or antigen
binding fragment of the invention.
[0199] The term "kit" is intended to mean any manufacture (e.g., a
package or a container) comprising at least one reagent, e.g., an
antibody or antigen binding fragment of the invention, for
specifically binding the GARP-TGF-.beta.1 complex. The kit may be
promoted, distributed, or sold as a unit for performing the methods
of the present invention. Furthermore, any or all of the kit
reagents may be provided within containers that protect them from
the external environment, such as in sealed containers. The kits
may also contain a package insert describing the kit and methods
for its use.
Examples
[0200] The invention will be further understood with reference to
the following non-limiting examples.
Example 1: Germlining Antibody LHG-10.6
[0201] The production and characterisation of antibody "LHG-10" is
described in International patent applications WO2015/015003 and
WO2016/125017, the contents of which are incorporated herein in
their entirety. Antibody LHG-10 was raised by immunising llamas
with HEK293E cells overexpressing the human GARP-TGF-.beta.1
complex, and was identified by selecting and screening for
GARP-TGF-.beta.1 Fabs. A light chain shuffling approach (as
described for example, in International patent application
WO2014/033252) was used to improve the affinity of the monoclonal
antibody LHG-10, and a variant "LHG-10.6" (also referred to herein
as 17H5) was identified as having improved binding characteristics.
The VH and VL sequences of LHG-10 and the V.kappa. shuffled variant
LHG-10.6 are shown in Table 3.
TABLE-US-00007 TABLE 3 SEQ ID NO: VH
EVQLVQPGAELRNSGASVKVSCKASGYRFTSY 1 domain of
YIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKF LHG-10
QGRVTFTADTSTSTAYVELSSLRSEDTAVYYC and ARNEWETVVVGDLMYEYEYWGQGTQVTVSS
LHG10.6 VL DIQMTQSPSSLSASLGDRVTITCQASQSISSY 2 domain of
LAWYQQKPGQAPKLLIYGASRLQTGVPSRFSG LHG-10
SGSGTSFTLTISGLEAEDAGTYYCQQYDSLPV TFGQGTKVELK VL
DIQMTQSPSSLSASLGDRVTITCQASQSISSY 3 domain of
LAWYQQKPGQAPNILIYGASRLKTGVPSRFSG LHG10.6
SGSGTSFTLTISGLEAEDAGTYYCQQYASVPV TFGQGTKVELK
[0202] The 17H5 antibody was found to have 88.5% identity with the
closest human germline sequence (X92343|IGHV1-46*01) across the VH
domain and 86.2% identity with the closest human germline sequence
(X59315|IGKV1-39*01) across the VL domain. This antibody was
subjected to germlining according to a 3-step method: [0203]
1--Assembly of a gene library by using overlapping oligonucleotides
to synthetically generate the variable light (VL) and variable
heavy (VH) chain encoding genes via PCR. [0204] 2--Cloning of this
gene library into a vector (pCB13) containing the human constant
heavy (CH1) and constant light kappa (CK) chain encoding genes
(library construction). [0205] 3--Selection of the functional Fabs
using phage display and affinity selection.
1. Library Construction
[0206] The VH of 17H5 was compared with the closest human germline
sequence and framework residues deviating from the human germline
were identified. These framework residues were allowed to mutate to
the residue present in the human V-region, whilst also maintaining
in the library the original residue. The 12 VH residues that were
allowed to mutate to their human counterparts are shown in the
table below. In addition to these germlining mutations, an
isomerization site within CDR2 (D54; D55) and an oxidation site in
CDR3 (M100f) were allowed to mutate. These sites are also shown in
the table below.
TABLE-US-00008 TABLE 4 Targeted residues in the 17H5 VH domain
Position Camelid aa Mutated aa Probability Clones 1 E Q 0.5 2 7 P S
0.5 2 11 L V 0.5 2 12 R K 0.5 2 13 N K 0.5 2 14 S P 0.5 2 28 R T
0.5 2 54 (HCDR2) D E 0.5 2 55 (HCDR2) G A 0.5 2 69 F M 0.5 2 71 A R
0.5 2 78 A V 0.5 2 80 V M 0.5 2 100f (HCDR3) M L/T 0.33 3 108 Q L
0.5 2
[0207] For the Vk of 17H5, a comparison between the closest human
germline sequence and the framework sequences led to the
identification of 11 residues to be targeted. These sites are shown
in the table below.
TABLE-US-00009 TABLE 5 Targeted residues in the 17H5 VL domain
Position Camelid aa Mutated aa Probability Clones 11 L V 0.5 2 42 Q
K 0.5 2 45 N K 0.5 2 46 I L 0.5 2 70 S D 0.5 2 77 G S 0.5 2 79 E Q
0.5 2 80 A P 0.5 2 83 A F 0.5 2 84 G A 0.5 2 106 L I 0.5 2
[0208] The theoretical sizes of the 17H5 germlined library are
shown in Table 6.
TABLE-US-00010 TABLE 6 17H5 size of the VH library 5 .times.
10.sup.4 size of the VL library 2 .times. 10.sup.3 size of the
final library 1 .times. 10.sup.8
2. Construction of the Gene Library
[0209] The germlined libraries were created by gene assembly.
Synthetic genes for VH and VL (two sets) based on this design were
generated by PCR based assembly (Stemmer et al., Gene (1995) 164:
49-530). Overlapping oligonucleotides with specific mutations on
certain positions were assembled by PCR. The nucleotides were
degenerated to encode the human and the llama amino acid. This was
done to prevent complete loss of binding in case the llama residues
were critical for stability, folding or high affinity binding.
[0210] The synthetic genes of the 17H5 VK and VH libraries were
first cloned in pCB13-CK1, a phagemid vector with the human Ck and
CH1 domains, respectively. After construction of these VkCk and
VHCH1 sub-libraries, the final libraries were made by ligation of
the heavy chain insert into the light chain library. A colony PCR
was carried out to determine the insert percentage and clones were
sent for sequencing to ensure that all desired mutations were
present in the library. The characteristics of the different
libraries are described in the table below.
TABLE-US-00011 TABLE 7 Characteristics of the 17H5 germlined
libraries 17H5 size of the VH library 1E5 size of the VL library
1E3 size of the final library 1E8 % insert 85%
[0211] The germlining libraries were found to be of good quality
and could be used for selections.
3. Selection of Fabs with High Human Identity
[0212] Phage display was used to select for Fabs with high affinity
for the human GARP-TGF-.beta.1 complex, as described previously in
WO2015/015003, the contents of which are incorporated herein in
their entirety. In short, a microtiter plate was coated O/N at
4.degree. C. with the GARP-TGF-.beta.1 complex and the day after,
Fab expressing phages were incubated for 2 hours in wells coated
with different concentrations of complex. Plates were washed and
specific phage were eluted with trypsin and used for infection of
TG1 cells. Details of the selection conditions are listed in Table
8.
TABLE-US-00012 TABLE 8 Details of the selection rounds for the
germlined library of 17H5 Phage huGARP-TGF-.beta.1 Washing Washing
Round input (.mu.l) [ng/well] time antigen 1 10 1000-100-10 -- -- 2
1 1000-100-10 -- -- 3 1 1000-100-10 2 hours 20 .times. huGT 4 1
1000-100-10 24 hours 20 .times. huGT 5 1 1000-100-10 72 hours 20
.times. huGT 6 1 1000-100-10 1 week 100 .times. huGT
[0213] After the first round of selection, enrichment was only
observed over a coating of an irrelevant protein at 10 .mu.g/ml. In
round 2, the enrichment was 10-fold higher, while the amount of
input phage was 10-fold lower. Starting from round 3, the
stringency was increased by increasing the duration of the washing
and by adding an excess of target in solution. A large excess of
soluble target is solution was added to prevent rebinding of the
dissociated phage. Even after the 6.sup.th round, with a 1-week
off-rate washing and a 100-fold excess of soluble target,
enrichment was still observed.
4. Screening of Fabs with High Human Identity
[0214] Masterplates were picked from selection round 2, 3, 4, 5 and
6 (48 clones for each round). Periplasmic extracts were prepared
and off-rates were determined by SPR. All clones were DNA-sequenced
and amino acid sequences were deduced thereof. Clones with an
identity to human germline Ig V-region above 92% are summarized in
Table 9. The off-rates of these clones were measured as periplasmic
extracts on SPR, and compared to the off-rate of Fab 17H5.
TABLE-US-00013 TABLE 9 Binding affinity of clones with more than
92% total human identity Risk % % % Isomerisation oxidation
Off-rate Identity Identity Overall site D54; G55 M100f Fab
(10.sup.-4 s.sup.-1) VH VK Identity (HCDR2) (HCDR3) 17H5 2.01 88.5
86.2 87.4 wt (D54; G55) wt (M100f) *39A12 6.06 95.4 96.2 95.8 E54;
G55 T100f *39A5 1.9 94.2 96.2 95.2 wt wt 39H6 4.4 93.1 96.2 94.7 wt
wt 40H3 2.47 94.2 95.0 94.6 wt wt 39A10 1.77 94.2 95.0 94.6 wt wt
*39B6 1.05 95.4 93.7 94.6 wt wt 39E6 8.61 96.5 92.5 94.5 wt wt 40G4
2.07 93.1 95.0 94.1 wt wt 38C3 2.32 95.4 92.5 94.0 wt wt 39G3 6.62
95.4 92.5 94.0 E54; G55 T100f 39G9 9.47 95.4 92.5 94.0 E54; G55
T100f 38F3 2.03 91.9 95.0 93.5 D54; A55 wt *38F2 4.08 94.2 92.5
93.4 D54; A55 T100f *39B10 2.36 95.4 91.2 93.3 E54; G55 wt 39C6
7.89 95.4 91.2 93.3 E54; G55 T100f 39G6 7.79 94.2 91.2 92.7 wt
L100f 38C5 1.69 90.8 93.7 92.3 E54; G55 wt 38B2 2.86 93.1 91.2 92.2
wt T100f *5 Fabs that were reformatted as full IgG1
[0215] The 5 clones showing an overall human identity of >93%
and an off-rate comparable to that of the parental 17H5 Fab were
recloned as full human IgG1 antibodies. The CDR, VH and VL
sequences of these antibodies are shown in Tables 10, 11 and
12.
TABLE-US-00014 TABLE 10 VH CDR sequences for GARP-TGF-.beta.1 Abs
CDR1 SEQ ID NO: CDR2 SEQ ID NO: CDR3 SEQ ID NO: 39B6 SYYID 4
RIDPEDGGTKYAQKFQG 5 NEWETVVVGDLMYEYEY 6 39A12 SYYID 4
RIDPEEGGTKYAQKFQG 7 NEWETVVVGDLTYEYEY 32 39A5 SYYID 4
RIDPEDGGTKYAQKFQG 5 NEWETVVVGDLMYEYEY 6 38F2 SYYID 4
RIDPEDAGTKYACKFQG 8 NEWETVVVGDLTYEYEY 32 39B10 SYYID 4
RIDPEEGGTKYAQKFQG 5 NEWETVVVGDLMYEYEY 6
TABLE-US-00015 TABLE 11 VL CDR sequences for GARP-TGF-.beta.1 Abs
CDR1 SEQ ID NO: CDR2 SEQ ID NO: CDR3 SEQ ID NO: 39B6 QASQSISSYLA 9
GASRLKT 10 QQYASVPVT 11 39Al2 QASQSISSYLA 9 GASRLKT 10 QQYASVPVT 11
39A5 QASQSISSYLA 9 GASRLKT 10 QQYASVPVT 11 38F2 QASQSISSYLA 9
GASRLKT 10 QQYASVPVT 11 39B10 QASQSISSYLA 9 GASRLKT 10 QQYASVPVT
11
TABLE-US-00016 TABLE 12 Variable domain sequences for
GARP-TGF-.beta.1 Abs SEQ ID SEQ ID Clone VH NO: VL NO: 39B6
QVQLVQPGAEVRKPGASVKVSCKASGYRFTSYYI 22
DIQMTQSPSSLSASVGDRVTITCQASQSISSYL 23
DWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQG AWYQQKPGQAPKILIYGASRLKTGVPSRFSGS
RVTMTADTSTSTVYVELSSLRSEDTAVYYCARNE
GSGTSFTLTISSLEPEDAATYYCQQYASVPVTF WETVVVGDLMYEYEYWGQGTLVTVSS
GQGTKVEIK 39A12 EVQLVQPGAEVKKPGASVKVSCKASGYRFTSYYID 24
DIQMTQSPSSLSASVGDRVTITCQASQSISSYL 25
WVRQAPGQGLEWMGRIDPEEGGTKYAQKFQGRV AWYQQKPGQAPKILIYGASRLKTGVPSRFSGS
TFTADTSTSTVYVELSSLRSEDTAVYYCARNEWET
GSGTDFTLTISSLQAEDFATYYCQQYASVPVT VVVGDLTYEYEYVVGQGTLVTVSS
FGQGTKVEIK 39A5 QVQLVQPGAELRNPGASVKVSCKASGYRFTSYYI 26
DIQMTQSPSSLSASLGDRVTITCQASQSISSYL 27
DWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQG AWYQQKPGQAPKLLIYGASRLKTGVPSRFSG
RVTFTRDTSTSTVYMELSSLRSEDTAVYYCARNE SGSGTDFTLTISSLQPEDAATYYCQQYASVPV
WETVVVGDLMYEYEYWGQGTLVTVSS TFGQGTKVEIK 38F2
QVQLVQPGAELKKPGASVKVSCKASGYRFTSYYID 28
DIQMTQSPSSLSASVGDRVTITCQASQSISSYL 29
WVRQAPGQGLEWMGRIDPEDAGTKYAQKFQGRV AWYQQKPGKAPNLLIYGASRLKTEVPSRFSGS
TFTADTSTSTVYVELSSLRSEDTAVYYCARNEWET
GSGTDFTLISGLEPEDAGTYYCQQYASVPVTF VVVGDLTYEYEYVVGQGTLVTVSS GQGTKVEIK
39B10 EVQLVQSGAELKKPGASVKVSCKASGYRFTSYYID 30
DIQMTQSPSSLSASLGDRVTITCQASQSISSYL 31
WVRQAPGQGLEWMGRIDPEEGGTKYAQKFQGRV AWYQQKPGQAPNILIYGASRLKTGVPSRFSGS
TMTADTSTSTAYMELSSLRSEDTAVYYCARNEWE GSGTDFTLTISGLEAEDFATYYCQQYASVPVT
TVVVGDLMYEYEYWGQGTLVTVSS FGQGTKVEIK
5. In Vitro Characterisation of mAbs with High Human Framework
Residue Identity
[0216] The five germlined clones reformatted to human IgG1 were
produced by transient transfection in HEK 293E cells. All the
antibodies were tested for binding to the human GARP-TGF-.beta.1
complex by SPR and showed binding affinity similar to the
non-germlined parental clone (KD 2-5 times lower than 17H5).
Changing residue M100f in the CDR3 to a threonine decreased the
K.sub.D.apprxeq.5-fold. Binding properties and characteristics of
the germlined 17H5 Abs are listed in Table 13.
TABLE-US-00017 TABLE 13 Binding properties and characteristics of
the germlined 17H5 Abs risk % % % fold isomerisation oxidation
Identity Identity Identity mAb K.sub.D (M) difference site D54; G55
M100f VH VK overall 17H5 1.00E-10 1.0 wt (DG) wt (M) 88.5 86.2 87.3
39B6 1.67E-10 1.7 wt (DG) wt (M) 95.4 93.7 94.5 39B10 2.62E-10 2.6
EG wt (M) 95.4 91.2 93.3 39A5 2.98E-10 3.0 wt (DG) wt (M) 94.2 96.2
95.2 38F2 4.80E-10 4.8 DA T 94.2 92.5 93.3 39A12_T 5.05E-10 5.1 EG
T 95.4 96.2 95.8
6. Stability of Germlined mAb 39B6
[0217] Clone 39B6 was selected as the lead germlined clone based on
its binding characteristics. This antibody was produced in two
effector function deficient formats, hlgG1.sup.N297Q and
hlgG4.sup.S228P, and stability tests were carried out. Prior to the
stability testing, the affinity of the effector deficient 39B6
antibodies for GARP-TGF-.beta.1 was tested by BiacoreT200 using a
CM5 chip coated with GARP-TGF-.beta.1 complex at 750RU (Table 14)
or coated with the antibodies at 1000RU (Table 15).
TABLE-US-00018 TABLE 14 mAb Format K.sub.D (M) Fold-difference
LHG10.6 IgG1-N297Q 8.19E-10 1 39B6 IgG1-N297Q 8.63E-11 0.1 39B6
IgG1-N297Q 3.13E-10 0.4
TABLE-US-00019 TABLE 15 mAb Format K.sub.D (M) Fold-difference
LHG10.6 IgG1-N297Q 5.34E-10 1 39B6 IgG1-N297Q 1.23E-09 2.3 39B6
IgG1-N297Q 1.02E-09 1.9
[0218] The thermo-tolerance of the 39B6 antibodies was tested using
the following set-up. [0219] mAb sample preparation: 1 ml of the
mAbs (39B6-IgG1 and 39B6-IgG4), fresh prepared stock solution (5
mg/ml), were put in 2 ml glass screw cap glass vials and stored at
5.degree. C. and 37.degree. C. Vials were checked immediately for
absence of particles. [0220] PBS negative control: aliquots of 1 ml
filtered Dulbecco's PBS were prepared in 2 ml glass vials as the
PBST negative control. Vials were checked immediately for absence
of particles. [0221] PBSTw negative control: aliquots of 1 ml
filtered Dulbecco's PBS containing 0.02% Tween80 (Sigma) were
prepared in 2 ml glass vials as the PBSTw negative control. Vials
were checked immediately for absence of particles. [0222]
High-aggregation control: 1 ml aliquots of an in-house antibody
were prepared with abundant visible aggregation in 2 ml glass
vials. [0223] Reference sample: for each antibody, 60 .mu.l mAb
aliquots were prepared in 500 .mu.l sterile, PCR tubes, labeled and
stored at -20.degree. C.
[0224] The stability of the antibodies stored at different
temperatures and under different conditions (PBS versus PBSTw) was
monitored over a 56-day time course. The effect of storage on
target binding activity as measured by SPR (Biacore.TM.) is shown
in FIG. 2. As can be seen from the results presented, the 39B6
antibody (in both effector deficient formats) exhibited a trend
towards lower target binding activity in both PBS and PBS/Tween
when stored at 37.degree. C. In contrast, the samples stored at
5.degree. C. did not display a significant loss in target binding
activity over the time-course.
Example 2: Development of GARP-TGF-.beta.1 Antibodies with Improved
Stability
2.1 Production of 39B6 Variants
[0225] The decrease in target binding activity noted above for
antibody 39B6 was found to be linked to deamidation occurring at
positions 95-96 of VH CDR3. As such, further work was carried out
to improve the stability of 3966.
[0226] First, this clone was subjected to modification of the VH
chain in the CDR2 region to introduce a G55A substitution (39B6-A).
The VH and VL regions of 39B6-A were recloned into the human
IgG4.sup.S228P backbone i.e. the effector function deficient human
antibody format.
[0227] In an attempt to improve the stability of antibody 39B6-A
IgG4.sup.S228P, five variants were generated having mutations at
positions 95 or 96 of CDR3 of the VH domain. These variants are
shown below. All variants were produced in the effector function
deficient format IgG4.sup.S228P.
TABLE-US-00020 TABLE 16 39B6-A Variants Variant Position 95
Position 96 39B6-AVE V E* 39B6-AYE Y E* 39B6-ANK N* K 39B6-ANR N* R
39B6-AEE E E* *residue already present in 39B6-A
[0228] The antibodies were filtered and concentrated to 5 mg/ml and
stored in Dulbecco's PBS with 0.02% Tween80 (Sigma). The Tween80
was needed to stabilize the antibody formulations.
[0229] The affinity of all antibodies (including 39B6-A) for
GARP-TGF-.beta.1 was tested by BiacoreT200 using a CM5 chip coated
with GARP-TGF-.beta.1 complex at 150RU (Table 17) or coated with
the antibodies at 200RU (Table 17)
TABLE-US-00021 TABLE 17 mAb K.sub.D (M) Fold-difference 39B6-A
9.91E-10 1.0 39B6-AVE 8.94E-10 0.9 39B6-AYE 7.63E-10 0.8 39B6-AEE
5.79E-09 5.8 39B6-ANK 8.80E-10 0.9 39B6-ANR 8.84E-10 0.9 LHG10.6
5.17E-10 0.5
TABLE-US-00022 TABLE 18 mAb K.sub.D (M) Fold-difference 39B6-A
1.33E-09 1.0 39B6-AVE 1.29E-09 1.0 39B6-AYE 1.62E-09 1.2 39B6-AEE
1.02E-07 76.7 39B6-ANK 2.02E-09 1.5 39B6-ANR 1.94E-09 1.5
[0230] The potency to block the release of active TGF-.beta. by
human Tregs was analyzed with all variants by determining the level
of SMAD2 phosphorylation of CD3/CD28 stimulated human Tregs in the
presence of the mAbs. As shown in FIG. 3, antibodies 39B6-AYE,
39B6-ANK and 39B6-ANR had a similar potency in the SMAD2
phosphorylation assay compared to the original 39B6-A. The variants
39B6-AEE and 39B6-AVE showed a clear loss in potency.
[0231] Similar results were obtained using the GAGA-luc assay where
293T-hGARP cells were transiently transfected with a reporter
plasmid in which Firefly luciferase is under the control of a SMAD
responding promotor (GAGA-luc). Antibodies 39B6-AYE, 39B6-ANK and
39B6-ANR had a similar potency in the luciferase assay compared to
the original 39B6-A. The variants 39B6-AEE and 39B6-AVE showed a
clear loss in potency (see FIG. 4).
2.2 Stability Studies
[0232] With the exception of 39B6-AEE, the variants were tested for
stability using different approaches as described below.
[0233] For each of the different stability studies, the antibodies
were tested using one or more of the following techniques: [0234]
Visual inspection [0235] Size Exclusion-HPLC [0236] SDS-PAGE
(reducing and non-reducing) [0237] Target binding affinity on SPR
[0238] Protein concentration The protocols for these techniques are
described below.
Protocol for Visual Inspection
[0239] Samples were blinded and scored for the presence of visible
particles by visual inspection of the vials by three analysts.
Samples were allowed to reach room temperature for 30 minutes
before inspection. The following scoring system was used for the
assessment:
A: sample is clear, no particles visible B: very few particles C:
moderate presence of particles D: abundant particles observed f:
fibers
Protocol for Size-Exclusion Chromatography (SE-HPLC)
System, Column and Sample Preparation
[0240] The column used throughout the study was an Xbridge Protein
BEH SEC 200A (3.5 .mu.m, 7.8*30 mm, Waters) which is routinely
stored in 20% EtOH. An Xbridge Protein BEH 200A pre-guard column
was coupled to the analytical column (3.5 .mu.m, 7.8*3 mm; Waters).
Before each utilization, the column was equilibrated with
Dulbecco's PBS for 5CV at least, and before being removed from the
system, it was cleaned with 5CV of LC-grade water. All solvents
were filtered and degassed before utilization.
[0241] The chromatographic system used was an Agilent 1260
Infinity, equipped with a quaternary pump, automatic injector,
on-line degasser and a DAD detector. The column was not kept in a
thermostated compartment and samples were analyzed at room
temperature. The detector was set to wavelengths 280 and 214 nm
simultaneously (reference wavelength at 360 nm with a cut-off of
100 nm). Aggregation monitoring was followed on channel 214 nm.
Data acquisition was done with the Chemstation software
(Agilent).
[0242] Sample analysis was done by transferring 25 .mu.l of all
original samples directly from the 5 mg/ml concentration under
aseptic conditions. They were spun down at 2000 rcf for 1 min and
20 .mu.l was carefully transferred into screw-cap, amber, glass
vials. The injection volume for each condition was 5 .mu.l (25
.mu.g), at a flow rate of 0.7 ml PBS/min for 25 min. Each injection
was accompanied with a needle wash with LC-grade water and seal
washing took place at the end of each sample.
[0243] Every time point sequence was initiated with 2.times. PBS
injections (blank; 5 .mu.l injection volume), followed by 2 .mu.l
BEH 200 Standard Protein mixture injection (Waters) and a
known-aggregation mAb sample. Every twelve samples analyzed, a
blank injection was done. Each analytical sequence was terminated
as initiated but in the reverse order (known-aggregation control
mAb, BEH standard protein mixture and 2.times. blank).
Method Used for Determination of % Aggregation and % Monomer
Area
[0244] The following protocol was used: [0245] Integrate all
chromatograms with the method ARGX-115 (basic technical parameters:
tangent skim standard mode, slope sensitivity 2.0, height reject
1.7, area reject 1.0, peak width: 0.02) [0246] Verify that all
peaks are integrated in a way that coincides with the previous
analyses obtained [0247] Export the integration results in a PDF
and Excel file [0248] Calculate the % total aggregation as the
summary of areas of all peaks eluting before the monomer peak
divided by the total area of the injection and multiply by 100
[0249] Also calculate the % monomer area by dividing the monomer
area by the total area and multiply by 100. This % monomer area
reflects if there are insoluble aggregates present in the sample
[0250] Keep detailed records to monitor the performance, efficiency
and resolution of the analytical column (i.e. peak symmetry,
monomer area, total area, reproducibility of retention times
etc.)
Protocol for SDS-PAGE
Sample Preparation
[0251] Sample analysis was done by transferring 25 .mu.l of all
original samples at 5 mg/ml in 100 .mu.l PBS/0.02% Tween80
(abbreviated as PBSTw throughout this study) under aseptic
conditions in order to generate an intermediate concentration at 1
mg/ml, for SDS-PAGE (reducing and non-reducing), binding affinity
on SPR and protein concentration assessment. 4-20% tris glycine,
mini-protean, stain-free, pre-cast gels were used for SDS-PAGE
analysis of the samples (Biorad). A batch of 4.times.-concentrated
loading dye, with or without reducing agent DTT, was prepared and
aliquoted to -20.degree. C. Routinely, 5 .mu.l was taken from the
intermediate dilution at 1 mg/ml and then, 5 .mu.l of 4.times.
concentrated loading dye (+/- DDT) was added together with 10 .mu.l
of mQ. The final quantity for each condition was 5 .mu.g. Samples
were boiled for 10 min at 95.degree. C. and then loaded (20 .mu.l)
to the pre-cast gels. Electrophoresis took place for 35 min in a
tris-glycine buffer system under a constant voltage of 200 V. Blue
staining (Gentaur) followed for 1 h. All gels were de-stained with
mQ water for at least 1 h.
Determination of % Full Length Ab
[0252] The intensity of the different bands was determined on the
Odyssey v3.0 Li-Cor system by scanning the protein gels to
one-channel detection (700 nm) under the settings: focus offset 0.5
mm and "high" quality. The brightness and contrast for each
analysis were set to 50% with a linear manual parameter of 5.
[0253] The method was as follows: [0254] Scan the gel and verify
that all bands on gel are surrounded by tight rectangles [0255]
Choose "export" in the settings in order to obtain the raw
intensity of all bands in an Excel format [0256] Calculate the %
raw intensity of each band present in a lane as the raw intensity
of the band divided by the total raw intensity of the lane and
multiply by 100 [0257] For the non-reducing conditions, the % full
length Ab is defined as the % raw intensity of the band which
corresponds to the .about.100 kD band [0258] For the reducing
conditions, the % full length Ab is defined as the summary of the %
raw intensity of the bands which correspond to the .about.25-35 kD
and .about.55 kD bands
Protocol for Target Binding Activity Measurement in Biacore
3000
Sample Preparation
[0259] From the intermediate concentration of all samples at 1
mg/ml described above, an extra 1/250 dilution was done for SPR
analysis to yield a final concentration of 4 .mu.g/ml. This 1/250
dilution took place for all conditions in two steps: a) 5 .mu.l (1
mg/ml)+120 .mu.l HBS-EP (SPR buffer) and b) an extra 10.times.
dilution (15 .mu.l+135 .mu.l HBS-EP). For each antibody and each
time point, a separate standard curve was prepared, starting from a
-80.degree. C. frozen sample. This was analyzed together with the
stability samples to determine the slope of each curve after
general fitting of the standards. These slopes were used to
calculate the percent activity of the stability samples by setting
the reference sample at 100%.
Determination of % Activity on Biacore
[0260] To determine the target binding activity in Biacore, a CM5
chip was coated with .about.4000 RU human GARP-TGF-.beta. complex.
Flow was set to 30 .mu.l/min with a "kinject" injection mode and
two regeneration injections (1 mM NaCl, 2.5 mM glycine pH 1.5) with
a 5 min interval.
[0261] The method was carried out as follows: [0262] Open the
curves in the BIAEVAL program and select value `2-1` (1: blank, 2
hGARP-TGF-.beta.1) [0263] Select one curve at the time for plot
overlay [0264] Delete the regeneration part of the curve [0265]
Select the baseline just before the injection and transform the
Y-axis for `zero at median of selection` [0266] Select `General
Fit`, starting from 120 sec after injecting and ending at 155 sec
[0267] Plot the standards in Excel and determine the slope of the
curve for each antibody [0268] These values are converted to a
percent activity by setting the reference (sample stored at
-20.degree. C.) at 100%
Protocol for Protein Concentration
[0269] For the determination of the protein content of each
condition, the NanoDrop system was used by measuring the absorbance
at 280 nm of each sample (2 .mu.l). The system was blanked with PBS
and the protein determination was done by measuring in triplicates
the absorbance at 280 nm of each sample (intermediate dilution at 1
mg/ml). All values obtained at 280 nm were divided by the factor
1.51. A PBS blank measurement was done after each different
condition. All data were reported as average value of the three
measurements for each condition.
0.2.1 Temperature Stability Study
[0270] To monitor the stability of the antibodies under different
temperature storage conditions, the following set-up was followed:
[0271] mAb sample preparation: 1 ml of the mAbs (39B6-AVE,
39B6-AYE, 39B6-ANK and 39B6-ANR), fresh prepared stock solution (5
mg/ml), were put in 2 ml glass screw cap glass vials and stored at
5.degree. C. and 37.degree. C. Vials were checked immediately for
absence of particles. [0272] PBSTw negative control: aliquots of 1
ml filtered Dulbecco's PBS containing 0.02%
[0273] Tween80 (Sigma) were prepared in 2 ml glass vials as the
PBSTw negative control. Vials were checked immediately for absence
of particles. [0274] High-aggregation control: 1 ml aliquots of an
in-house antibody were prepared with abundant visible aggregation
in 2 ml glass vials. [0275] Reference sample: for each antibody, 60
.mu.l mAb aliquots were prepared in 500 .mu.l sterile, PCR tubes,
labeled and stored at -20.degree. C.
[0276] At different time points, samples of the mAbs were taken
from the storage conditions and tested for: [0277] Visual
inspection [0278] SE-HPLC [0279] SDS-PAGE (reducing and
non-reducing) [0280] target binding affinity on SPR [0281] protein
concentration
Visual Inspection
[0282] The results for visual inspection are shown in Table 19
below. All mAbs were in PBSTw, which should give a stabilizing
effect.
TABLE-US-00023 TABLE 19 Results of visual inspection of mAb samples
of 39B6- AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR over a 56-day period
under storage conditions of 5.degree. C. and 37.degree. C. Sample 0
d 1 d 7 d 14 d 28 d 56 d Storing conditions: 5.degree. C. 39B6-AVE
A-B-B A-B-B Af-B-B Af-B-B Af-B-A B-Bf-Af 39B6-AYE A-A-A A-A-A A-A-B
Af-A-B Af-Af-B Af-Bf-A 39B6-ANK A-A-A A-A-B Af-B-B Af-A-B B-A-C
B-A-B 39B6-ANR B-A-A B-B-B B-Bf-Bf C-Bf-Bf C-Bf-Cf C-Bf-C High
C-C-C C-C-C C-D-D D-D-D D-D-D D-D-D aggregation control PBSTw
Af-A-A Af-A-A A-B-B Af-A-B Af-A-A Af-A-A Storing conditions:
37.degree. C. 39B6-AVE A-A-A A-B-B Af-Bf-B Af-Bf-B Af-Bf-B Af-Bf-Af
39B6-AYE A-A-A A-B-B Af-A-B Af-B-B B-B-B B-Af-Bf 39B6-ANK A-A-A
A-A-B A-B-B B-A-B C-B-B D-Bf-Bf 39B6-ANR B-A-A B-A-B Af-Af-Bf
Af-Af-Bf B-Af-Bf C-Af-Bf High C-C-C C-C-C C-D-C D-D-C D-D-D D-D-D
aggregation control PBSTw Af-B-B Af-Bf-B Af-Af-Bf Af-Bf-B Af-Bf-Bf
Af-A-Af
[0283] For the 5.degree. C. condition, the average scores for the
mAbs after 56 days were as follows:
39B6-AYE: `sample is clear, no particles visible` 39B6-AVE and
39B6-ANK: `very few particles` 39B6-ANR: `moderate presence of
particles`. The PBSTw buffer is scored `sample is clear, no
particles visible` at 5.degree. C. so this indicates that the
observed particles are protein-related.
[0284] For the 37.degree. C. storage condition, the average scores
for the mAbs after 56 days were as follows:
39B6-AYE, 39B6-ANK and 39B6-ANR: `very few particles` 39B6-AVE:
`sample is clear, no particles visible`. The PBSTw buffer is scored
`sample is clear, no particles visible` at 37.degree. C. so this
indicates that the observed particles are protein-related.
Analysis by SE-HPLC
[0285] Protein aggregation and fragmentation were measured by
SE-HPLC.
[0286] The protein aggregation results for the mAbs 39B6-AVE,
39B6-AYE, 39B6-ANK and 39B6-ANR, as measured by SE-HPLC, are
summarized in Table 20 below and shown in FIG. 5.
TABLE-US-00024 TABLE 20 % Aggregate formation monitored by SE-HPLC
for mAbs 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR t (days) Ref
5.degree. C. 37.degree. C. 39B6-AVE - Percent aggregation (%) upon
SE-HPLC analysis 0 1.0 1.0 1.0 7 1.0 1.1 1.2 14 1.0 1.0 2.2 28 0.9
0.9 3.0 56 1.1 1.1 4.4 39B6-AYE - Percent aggregation (%) upon
SE-HPLC analysis 0 1.2 1.0 1.0 7 1.0 1.0 1.0 14 1.0 1.0 1.1 28 0.9
0.9 1.4 56 1.1 1.0 0.5 39B6-ANK - Percent aggregation (%) upon
SE-HPLC analysis 0 1.0 1.0 1.0 28 0.9 0.9 1.1 56 0.9 0.9 0.7
39B6-ANR - Percent aggregation (%) upon SE-HPLC analysis 0 1.0 1.1
1.1 28 1.0 1.0 1.3 56 1.0 1.4 1.5
[0287] When stored at 5.degree. C., no change in % aggregate levels
was observed for mAbs 39B6-AYE, 39B6-AVE and 39B6-ANK over the 56 d
time period. Observed % aggregate levels were low
[0288] between 0.9% and 1.1%. A minor increase in aggregate levels
was observed for mAb 39B6-ANR from 1.1% to 1.4%.
[0289] At 37.degree. C., no change in % aggregate levels was
observed for mAbs 39B6-AYE and 39B6-ANK. For 39B6-ANR a minor
increase from 1.1% at Od to 1.5% at 56 d was observed. For 39B6-AVE
an increase in % aggregate was observed from 1.0% at Od to 4.4% at
56 d.
[0290] The presence of fragment peaks for the mAbs 39B6-AVE,
39B6-AYE, 39B6-ANK and 39B6-ANR, as measured by SE-HPLC, is shown
in Table 21 and FIG. 6. As fragmentation peaks were only observed
at 37.degree. C. after 56 days, only these results are
presented.
TABLE-US-00025 TABLE 21 % Fragment formation monitored by
size-exclusion chromatography for mAbs 39B6-AVE, 39B6-AYE, 39B6-ANK
and 39B6-ANR at 56 days t (days) Ref 5.degree. C. 37.degree. C.
39B6-AVE - Percent fragmentation (%) upon SE-HPLC analysis 56 0 0
0.3 39B6-AYE - Percent fragmentation (%) upon SE-HPLC analysis 56 0
0 5.7 39B6-ANK - Percent fragmentation (%) upon SE-HPLC analysis 56
0 0 0.2 39B6-ANR - Percent fragmentation (%) upon SE-HPLC analysis
56 0 0 0.3
[0291] For mAbs 39B6-AVE, 39B6-ANK and 39B6-ANR the percentage of
fragment peaks is between 0.2% and 0.3% after 56 days whilst for
mAb 39B6-AYE the percentage of fragment peaks is 5.7%.
[0292] The results of the % monomer peak for all mAbs are
summarized in Table 22.
TABLE-US-00026 TABLE 22 Monomer area (%) monitored by
size-exclusion chromatography for mAbs 39B6-AVE, 39B6-AYE, 39B6-ANK
and 39B6-ANR t (days) Ref 5.degree. C. 37.degree. C. 39B6-AVE -
Percent monomer area (%) upon SE-HPLC analysis 0 99.0 99.0 99.0 7
99.0 98.9 98.8 14 99.0 99.0 97.8 28 99.1 99.1 97.0 56 98.9 98.9
95.3 39B6-AYE - Percent monomer area (%) upon SE-HPLC analysis 0
98.8 99.0 99.0 7 99.0 99.0 99.0 14 99.0 99.0 98.9 28 99.1 99.1 98.6
56 98.9 99.0 93.8 39B6-ANK - Percent monomer area (%) upon SE-HPLC
analysis 0 99.0 99.0 99.0 28 99.1 99.0 98.9 56 99.1 99.1 99.1
39B6-ANR - Percent monomer area (%) upon SE-HPLC analysis 0 99.0
98.9 98.9 28 99.0 99.0 98.7 56 99.0 98.6 98.2
SDS-PAGE
[0293] The SDS-PAGE results for analysis of all antibodies are
shown in Table 23 and FIG. 8.
TABLE-US-00027 TABLE 23 Total percentage of full length Ab/heavy
chain estimated by SDS-PAGE analysis and Odyssey scanning for mAbs
39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR Non-reducing conditions
Reducing conditions t (days) Ref 5.degree. C. 37.degree. C. Ref
5.degree. C. 37.degree. C. % full-length 39B6-AVE 0 77.2 74.4 96.7
96.6 7 76.0 78.0 79.8 97.9 98.0 97.8 14 80.3 81.9 79.8 98.4 97.5
97.1 28 82.8 81.9 74.5 96.2 96.1 85.6 56 79.2 80.7 70.7 95.1 94.8
78.6 % full-length 39B6-AYE 0 74.2 74.6 96.4 97.2 7 76.5 79.6 77.8
98.4 97.8 98.0 14 77.1 77.9 76.9 97.1 96.5 90.8 28 75.6 77.3 73.6
97.0 98.3 90.3 56 73.4 73.4 59.8 96.4 94.7 88.0 % full-length
39B6-ANK 0 74.7 71.3 96.7 96.6 28 70.8 70.7 74.2 97.0 96.9 89.5 56
79.3 78.5 73.6 96.8 96.7 88.1 % full-length 39B6-ANR 0 76.2 76.5
97.1 96.9 28 78.1 78.7 73.5 96.9 96.1 84.9 56 74.1 75.7 70.6 95.5
95.6 79.0
[0294] No trend towards degradation was observed for any of the
mAbs for the 5.degree. C. temperature condition for both the
reducing and non-reducing conditions.
[0295] At 37.degree. C., all mAbs showed a similar rate of
degradation for the non-reducing condition except for mAb 39B6-AYE.
This mAb shows a similar degradation rate up to 28 days but
demonstrates a faster degradation rate between day 28 and day 56
compared to the other mAbs. For the reducing condition, all mAbs
show a similar rate of degradation.
Target Binding Affinity on Biacore
[0296] Samples were tested for their target binding activity in
Biacore by measuring the slope at each time point. The reference
sample was set as 100% of the activity. The results for all mAbs
are summarized in Table 24 and FIG. 9.
TABLE-US-00028 TABLE 24 Percentage activity on Biacore for mAbs
39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR t (days) Ref 5.degree. C.
37.degree. C. 39B6-AVE - Activity on Biacore (%) 0 100.0% 99.5%
99.5% 7 100.0% 111.7% 113.9% 14 100.0% 93.8% 90.2% 28 100.0% 99.0%
68.0% 56 100.0% 96.9% 31.3% 39B6-AYE - Activity on Biacore (%) 0
100.0% 93.5% 93.5% 7 100.0% 103.1% 101.5% 14 100.0% 97.5% 97.5% 28
100.0% 96.7% 96.1% 56 100.0% 103.5% 104.2% 39B6-ANK - Activity on
Biacore (%) 0 100.0% 130.1% 130.1% 28 100.0% 101.1% 77.8% 56 100.0%
100.6% 62.4% 39B6-ANR - Activity on Biacore (%) 0 100.0% 100.9%
100.9% 28 100.0% 129.1% 85.4% 56 100.0% 85.4% 46.3%
[0297] For the mAb samples stored at 37.degree. C., only antibody
39B6-AYE retained target binding activity over the full 56-day
period. All of the other antibodies displayed a significant
decrease in target binding activity over the 56-day period when
stored at 37.degree. C.
Protein Concentration
[0298] The protein concentration of all samples was measured for
each condition on NanoDrop. In Table 25 and FIG. 10, the measured
protein concentration for all mAbs is shown.
TABLE-US-00029 TABLE 25 Protein concentration (mg/ml) for mAbs
39B6- AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR t (days) Ref 5.degree.
C. 37.degree. C. 39B6-AVE - Protein concentration (mg/ml) 0 1.1 1.0
1.0 7 1.0 1.0 1.1 14 1.0 1.0 1.1 28 1.0 1.0 1.0 56 1.0 1.0 1.1
39B6-AYE - Protein concentration (mg/ml) 0 1.0 1.0 1.0 7 1.0 1.0
1.0 14 1.0 1.0 1.0 28 1.0 1.0 1.0 56 1.0 1.0 1.0 39B6-ANK - Protein
concentration (mg/ml) 0 1.1 1.1 1.1 28 1.0 1.0 1.1 56 1.1 1.1 1.1
39B6-ANR - Protein concentration (mg/ml) 0 1.0 1.0 1.0 28 1.0 1.0
1.0 56 1.0 1.0 1.0
Summary and Conclusion for the Temperature Stability Study
[0299] The temperature stability study revealed some significant
differences between the four mAbs tested: an aggregation of 4.4%
was observed on SE-HPLC for mAb 39B6-AVE after 56 days at
37.degree. C. and a fragmentation of 5.7% for mAb 39B6-AYE.
However, this fragmentation for mAb 39B6-AYE did not affect the
target binding activity at 37.degree. C. on Biacore; after 56 days
this was still as good as the reference sample. Meanwhile, lower
target binding activity for mAbs 39B6-AVE, 39B6-ANK and 39B6-ANR
was clearly seen at 37.degree. C. after 56 days.
2.2.2 Freeze-Thaw Stability Study
[0300] To monitor the stability of the antibodies under freeze-thaw
conditions, the set-up was as follows. A 1 ml aliquot of the mAbs
(at 5 mg/ml) was frozen for at least 6 hours at -20.degree. C. and
thawed for 1 hour at RT. This cycle was repeated 9.times. (10
freeze-thaw cycles in total). Samples were analyzed by visual
inspection, SE-HPLC, SDS-PAGE, target binding activity on Biacore
and protein concentration. Reference samples stored at -20.degree.
C. were used for all analyses in parallel. As the mAbs 39B6-ANR and
39B6-ANK have a possible deamidation site, they were only subjected
to analysis by visual inspection.
Visual Inspection
[0301] The results for visual inspection in the freeze-thaw
stability study are shown in Table 26. All mAbs were in PBSTw,
which should give a stabilizing effect.
TABLE-US-00030 TABLE 26 Visual Inspection freeze-thaw stability for
mAbs 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR Sample 10x FT
39B6-AVE B-B-B 39B6-AYE B-Af-B 39B6-ANK A-Bf-Bf 39B6-ANR A-A-B High
aggregation control C-D-D PBSTw B-Af-Bf
[0302] The average scores for the mAbs were as follows:
39B6-AVE, 39B6-AYE and 39B-ANK: `very few particles`; and 39B6-ANR:
`sample is clear, no particles visible`.
[0303] The PBSTw buffer was scored by two people as `very few
particles` and therefore, the particles seen in the 39B6-AVE,
39B6-AYE and 39B-ANK samples may not be protein-related. It can be
concluded that all mAbs remain unchanged after 10 freeze-thaw
cycles.
Analysis by SE-HPLC
[0304] Protein aggregation and fragmentation were measured by
SE-HPLC.
[0305] The protein aggregation results for the freeze-thaw
stability study for the mAbs 39B6-AVE and 39B6-AYE are summarized
in Table 27.
TABLE-US-00031 TABLE 27 % Aggregate formation monitored by
size-exclusion chromatography in freeze-thaw stability for mAbs
39B6-AVE and 39B6-AYE 39B6-AVE 39B6-AYE Sample Ref 10x FT Ref 10x
FT 1.0 1.0 1.0 0.9
[0306] No change in percentage aggregate levels was observed for
either mAb following 10 freeze-thaw cycles as compared to the
reference samples.
[0307] The areas of the monomeric peak for all different injections
were also examined. The % monomer area results for the mAbs
39B6-AVE and 39B6-AYE are summarized in Table 28.
TABLE-US-00032 TABLE 28 % Monomer area monitored by size-exclusion
chromatography in freeze-thaw stability for mAbs 39B6-AVE and
39B6-AYE. 39B6-AVE 39B6-AYE Sample Ref 10x FT Ref 10x FT 99.0 99.0
99.0 99.1
[0308] No change in % monomer area was observed for both mAbs
following 10 freeze-thaw cycles compared to the reference
samples.
Analysis by SDS-PAGE
[0309] Freeze-thaw samples were analyzed for their integrity by
SDS-PAGE under non-reducing and reducing conditions. The results
are shown in Table 29 and FIG. 11 for mAbs 39B6-AVE and
39B6-AYE.
TABLE-US-00033 TABLE 29 Total percentage of full length Ab/heavy
chain estimated by SDS-PAGE analysis and Odyssey scanning in
freeze- thaw stability study for mAbs 39B6-AVE and 39B6-AYE
Non-reducing conditions Reducing conditions Sample Ref 10x FT Ref
10x FT % full-length 39B6-AVE 78.1 79.3 95.9 96.1 % full-length
39B6-AYE 78.8 78.7 96.3 97.0
No changes were observed for both mAbs after 10 freeze-thaw
cycles.
Analysis of Target Binding by Biacore
[0310] Samples were tested for their target binding activity in
Biacore by measuring the slope after 10 freeze-thaw cycles. The
reference sample was set as 100% of the activity. The results for
both mAbs 39B6-AVE and 39B6-AYE are shown in FIG. 12.
[0311] The results demonstrate that after 10 freeze-thaw cycles no
change in target binding activity is observed.
Analysis of Protein Concentration
[0312] The protein concentration of the freeze-thaw samples was
measured on NanoDrop. In Table 30, the measured protein
concentration for mAbs 39B6-AVE and 39B6-AYE after 10 freeze-thaw
cycles is shown. Also, FIG. 13 shows these results for both
mAbs.
TABLE-US-00034 TABLE 30 Protein concentration (mg/ml) in
freeze-thaw stability for mAbs 39B6-AVE and 39B6-AYE 39B6-AVE
39B6-AYE Sample Ref 10x FT Ref 10x FT 1.0 1.1 1.0 1.0
Conclusion
[0313] The freeze-thaw stability study did not reveal any
significant differences for the tested mAbs 39B6-AVE and
39B6-AYE.
2.2.3 Thermal Stability Study
[0314] To analyse the melting curves, mAbs were heated according to
the scheme below. Following completion of the thermal cycle in the
PCR device, samples were tested for affinity on Biacore.
[0315] The protocol used was as follows: [0316] 1) Aliquots of 1 ml
for each mAb were stored in glass vials at -20.degree. C. in the
beginning of the study [0317] 2) After one week of storage, they
were defrosted once [0318] 3) The mAbs were diluted at 1 mg/ml as
usual and then further diluted at 100 .mu.g/ml (10.times. dilution:
200 .mu.l+1800 .mu.l PBSTw) [0319] 4) The diluted mAbs were
aliquoted in a PCR plate (50 .mu.l/well) [0320] 5) Keep sufficient
sample and also sample at 5.degree. C. as reference to be analyzed
in parallel [0321] 6) 1 h in PCR device exposed at the temperatures
given below [0322] 7) 2 h in PCR device at 25.degree. C. [0323] 8)
At 4.degree. C. in PCR device [0324] 9) Prepare the samples and the
references for analysis at 4 .mu.g/ml (25.times. dilution: 168
.mu.l Biacore buffer+7 .mu.l sample)
[0325] Run following program in a gradient PCR device:
Protocol for Biacore Analysis:
[0326] The same CM5 chip, coated with .about.4000 RU human
GARP-TGF-.beta. complex was used [0327] Open the curves in the
BIAEvaluation program and select value `2-1` (1: blank, 2
hGARP-TGF-.beta.) [0328] Select one curve at the time for plot
overlay [0329] Delete the regeneration part of the curve [0330]
Select the baseline just before the injection and transform the
Y-axis for `zero at median of selection` [0331] Select `General
Fit`, starting from 120 sec after injecting and ending at 155 sec
[0332] For calculation of the IC50: The slope for 5.degree. C.
references is levelled at 100%. The percentage (Y-axis) of the
other temperatures (X-axis) can be calculated Thermo-tolerance of
the four mAbs was measured and the results are summarized in FIG.
14. The melting temperature was calculated as the temperature at
which 50% of the antibody is still functional. The reference
samples which were kept at 5.degree. C. were set as 100% of the
activity. The melting temperatures are shown in Table 31.
TABLE-US-00035 [0332] TABLE 31 Melting temperatures in thermal
stability study mAb Melting temperature 39B6-AVE 67.0.degree. C.
39B6-AYE 66.5.degree. C. 39B6-ANK 69.1.degree. C. 39B6-ANR
68.6.degree. C.
[0333] The mAbs 39B6-ANK and 39B6-ANR displayed the highest melting
temperatures: 69.13.degree. C. and 68.55.degree. C., respectively.
The mAbs 39B6-AVE and 39B6-AYE also gave good melting temperatures,
66.99.degree. C. and 66.53.degree. C., respectively. All melting
temperatures for all mAbs can be considered high.
Conclusion of the Thermal Stability Study
[0334] The four mAbs demonstrated good thermo-tolerance. The
melting temperatures were comparable to the original 39B6-A mAb in
the previous stability study, 66.8.degree. C.
2.2.4 Rotational Stability Study
[0335] For the rotational stability study, the set-up was as
follows. Aliquots of 1 ml for each mAb were stored in glass vials
at -20.degree. C. at the beginning of the study. After one week of
storage the aliquots were defrosted once and rotated head over head
at 15 rpm at room temperature.
[0336] Samples were scored for presence of particles at the
indicated time points: [0337] Hours: 0, 3, 6, 24, 30, 48, 54, 72
and 96 Samples were also analyzed after 96 hours by SE-HPLC,
SDS-PAGE, target binding activity on Biacore and protein
concentration. Reference samples stored at -20.degree. C. were used
for all analyses in parallel. As the mAbs 39B6-ANR and 39B6-ANK
still have a possible deamidation site, they were only assessed by
visual inspection.
Visual Inspection
[0338] The results for visual inspection in the rotational
stability study are shown in Table 32. All mAbs are in PBSTw, which
should give a stabilizing effect.
TABLE-US-00036 TABLE 32 Visual Inspection rotational stability
study for mAbs 39B6-AVE, 39B6-AYE, 39B6-ANK and 39B6-ANR Sample 0 h
3 h 6 h 24 h 30 h 48 h 54 h 72 h 96 h 39B6-AVE Af-B-Bf Af-B-Bf
Af-B-Bf Af-Cf-Cf Af-Bf-Cf Af-B-Bf B-B-Bf B-B-Bf B-B-Bf 39B6-AYE
Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf
B-Bf-Bf B-Bf-Bf 39B6-ANK Af-Bf-C Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf
Af-Bf-Bf Af-Bf-Bf B-Bf-Cf B-Bf-Cf B-Bf-Cf 39B6-ANR Af-Bf-Bf
Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf Af-Bf-Bf
Af-Bf-Bf High C-B-C C-Df-D C-Df-D C-Df-Df C-Df-Df C-Df-Df C-Df-Df
D-Df-Df D-Df-Df aggregation control PBSTw A-A-A A-A-A A-A-A A-A-A
A-A-A A-A-A A-A-A A-A-A A-A-A
[0339] All mAbs were found to have an average score of `very few
particles` so they remain relatively unaffected after 96 hours of
rotation. The PBSTw buffer did not contain any particles in any
experimental condition tested. This indicates that the observed
`very few particles` are protein-related in the antibody
samples.
Analysis by SE-HPLC
[0340] Protein aggregation and fragmentation were measured by
SE-HPLC. The protein aggregation results for the rotational
stability study for the mAbs 39B6-AVE and 39B6-AYE are shown in
Table 33.
TABLE-US-00037 TABLE 33 % Aggregate formation monitored by
size-exclusion chromatography in rotational stability study for
mAbs 39B6-AVE and 39B6-AYE. 39B6-AVE 39B6-AYE Sample Ref 96 h Ref
96 h 1.1 1.0 1.0 1.0
[0341] No change in % aggregate levels were observed for the mAbs
following rotational stress as compared to the reference
samples.
[0342] The areas of the monomeric peak for all different injections
were also examined. The % monomer area results for the mAbs
39B6-AVE and 39B6-AYE are shown in Table 34.
TABLE-US-00038 TABLE 34 % Monomer area monitored by size-exclusion
chromatography in rotational stability study for mAbs 39B6-AVE and
39B6-AYE 39B6-AVE 39B6-AYE Sample Ref 96 h Ref 96 h 98.9 99.0 99.0
99.0
[0343] No change in % monomer area was observed for either mAb
after 96 hours of rotation as compared to the reference
samples.
[0344] For both antibodies, no change in SE-HPLC profile was
observed after 96 hours of rotation as compared to the reference
samples.
Analysis by SDS-PAGE
[0345] Rotation samples were analyzed for their integrity by
SDS-PAGE under non-reducing and reducing conditions. The results
are summarized in Table 35 for mAbs 39B6-AVE and 39B6-AYE.
TABLE-US-00039 TABLE 35 Total percentage of full length Ab/heavy
chain estimated by SDS-PAGE analysis and Odyssey scanning in
rotational stability study for mAbs 39B6-AVE and 39B6-AYE
Non-reducing conditions Reducing conditions Sample Ref 96 hours Ref
96 hours % full-length 39B6-AVE 81.3 76.6 91.0 90.7 % full-length
39B6-AYE 76.2 79.0 91.5 92.6
[0346] The SDS-PAGE gel for both mAbs after 96 hours of rotation
can be seen in FIG. 15. No changes were observed for either
antibody after 96 hours of rotation.
Analysis for Target Binding in Biacore
[0347] Samples were tested for their target binding activity in
Biacore by measuring the slope after 96 hours of rotation. The
reference sample was set as 100% of the activity. The results for
both mAbs 39B6-AVE and 39B6-AYE are shown in FIG. 16.
Analysis for Protein Concentration
[0348] The protein concentration of the rotational samples was
measured on NanoDrop.
[0349] In Table 36, the measured protein concentration for mAbs
39B6-AVE and 39B6-AYE after 96 hours of rotation is shown. Also,
FIG. 17 shows these results for both mAbs.
TABLE-US-00040 TABLE 36 Protein concentration (mg/ml) in rotational
stability for mAbs 39B6-AVE and 39B6-AYE 39B6-AVE 39B6-AYE Sample
Ref 96 h Ref 96 h 1.0 1.1 1.0 1.1
[0350] No protein loss was observed for both mAbs after 96 hours of
rotation.
Conclusion of the Rotational Stability Study
[0351] The rotational stability study did not reveal any difference
between the tested mAbs 39B6-AVE and 39B6-AYE.
2.2.5 Primary Sequence Analysis by Peptide Mapping
[0352] Samples from the temperature, freeze-thaw and rotational
stability study were analyzed using Tryptic peptide mapping
RP-HPLC-UV-MS methodology to identify modifications (deamidation,
isomerization and oxidation) at the protein (peptide) level.
[0353] Deamidation in the CDR3 of the heavy chain at the positions
95-96 (amino acids NE) was engineered out in mAbs 39B6-AVE and
39B6-AYE by mutation of position N95. This deamidation site is
still present in mAbs 39B6-ANK and 39B6-ANR and significant
deamidation/isomerization was detected after 28 days at both
5.degree. C. and 37.degree. C. in the temperature stability study
and also in the freeze-thaw and rotational stability study. It was
concluded that deamidation could not be prevented by the
introduction of bulky positively charged residues downstream of
N95.
[0354] At position 100f of the CDR3 of the heavy chain there is a
methionine that is essential for high binding affinity.
Temperature, freeze-thaw and rotational stability studies have
demonstrated that oxidation of M100f does not occur in mAbs
39B6-AYE and 39B6-ANK, while oxidation is still observed for mAbs
39B6-AVE and 39B6-ANR. This demonstrates that the amino acids at
positions 95 and 96 influence the sensitivity towards oxidation of
the downstream methionine. Table 37 shows an overview of the levels
of oxidation and deamidation of peptides covering the heavy chain
CDR3, which were generated by tryptic digestion.
TABLE-US-00041 TABLE 37 Extent of oxidation and deamidation of
peptides within the heavy chain CDR3 Oxidation (%) Deamidation (%)
5 .degree.C. 37 .degree.C. Rotational Freeze 5 .degree.C. 37
.degree.C. Rotational Freeze day 28 day 28 (96 h) thaw (10x) day 28
day 28 (96 h) thaw (10x) 39B6-AVE 1.08 10.51 1.58 3.47 0 0 0 0
39B6-AYE Below the limit of quantitation (LOQ) 0 0 0 0 39B6-ANK
Below the limit of quantitation (LOQ) 4.72 11.15 3.5 4.75 39B6-ANR
9.20 20.98 19.37 12.47 12.85 34.38 12.79 12.77 * Below the limit of
quantitation (LOQ) = intensity of oxidized form is close to
background
[0355] The relative amount of deamidation and isomerization of N95,
and the relative binding activity of the variants stored at
37.degree. C. are depicted in FIG. 18. Also the original 39B6-A is
displayed in the figure (labelled 39B6-ANE). Because N95 has been
mutated in mAbs 39B6-AVE and 39B6-AYE, deamidation and
isomerization levels are zero and therefore not included. The
correlation between deamidation of N95 and lower target binding
activity observed for mAbs 39B6-ANK and 39B6-ANR suggests that N95
deamidation negatively affects the binding of the mAb to its
target.
Conclusion
[0356] The GARP-TGF-.beta.1 antibody variant 39B6-AYE is a
particularly good GARP-TGF-.beta.1 antibody to take forward for
clinical development because it: [0357] Retains high affinity
binding to its target, the GARP-TGF-.beta.1 complex; [0358]
Displays good potency in the SMAD2 phosphorylation assay; [0359]
Does not undergo deamidation or isomerization in CDR3 [0360] Does
not undergo oxidation in CDR3 [0361] Displays high human homology
(95%) [0362] Displays improved stability as compared with 39B6-A,
as measured by different stability assays.
[0363] The CDR and variable domain sequences for 39B6-AYE are shown
in Tables 38 and 39 below. The full-length heavy chain and light
chain sequences are shown in Table 40. The polynucleotide sequences
encoding the VH and VL domains and the full-length heavy and light
chains are shown in Table 41.
TABLE-US-00042 TABLE 38 VH and VL CDR sequences for 39B6-AYE
39B6-AYE SEQ ID NO: VH CDR1 SYYID 4 CDR2 RIDPEDAGTKYAQKFQG 12 CDR3
YEWETVVVGDLMYEYEY 13 VL CDR1 QASQSISSYLA 9 CDR2 GASRLKT 10 CDR3
QQYASVPVT 11
TABLE-US-00043 TABLE 39 VH and VL domain sequences for 39B6-AYE SEQ
39B6- ID AYE NO: VH QVQLVQPGAEVRKPGASVKVSCKASGYRFTSYYIDWV 14
RQAPGQGLEWMGRIDPEDAGTKYAQKFQGRVTMTAD
TSTSTVYVELSSLRSEDTAVYYCARYEWETVVVGDLM YEYEYWGQGTLVTVSS VL
DIQMTQSPSSLSASVGDRVTITCQASQSISSYLAWYQQ 15
KPGQAPKILIYGASRLKTGVPSRFSGSGSGTSFTLTISS
LEPEDAATYYCQQYASVPVTFGQGTKVEIK
TABLE-US-00044 TABLE 40 Heavy chain and light chain sequences for
39B6-AYE SEQ 39B6- ID AYE NO: Heavy
QVQLVQPGAEVRKPGASVKVSCKASGYRFTSYYIDWV 16 chain
RQAPGQGLEWMGRIDPEDAGTKYAQKFQGRVTMTAD
TSTSTVYVELSSLRSEDTAVYYCARYEWETVVVGDLM
YEYEYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSES
TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDK
RVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMIS
RTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG
LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQK SLSLSLG Light
DIQMTQSPSSLSASVGDRVTITCQASQSISSYLAWYQQ 17 chain
KPGQAPKILIYGASRLKTGVPSRFSGSGSGTSFTLTIS
SLEPEDAATYYCQQYASVPVTFGQGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN
ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC
TABLE-US-00045 TABLE 41 Polynucleotide sequences encoding 39B6-AYE
SEQ ID NO: VH CAAGTCCAACTTGTCCAACCGGGGGCGGAAGTGCG 18
GAAGCCGGGGGCGAGCGTGAAAGTCTCGTGCAAGG
CATCGGGATACCGATTCACATCATATTACATCGACTG
GGTCAGGCAAGCGCCGGGGCAAGGGCTGGAATGG
ATGGGGCGGATCGACCCGGAGGATGCCGGGACGAA
ATATGCGCAAAAATTCCAAGGGCGCGTCACGATGAC
GGCCGACACATCGACGAGCACGGTATACGTGGAGC
TGAGCTCGCTGAGGAGCGAGGACACCGCGGTATAC
TACTGCGCGCGATACGAATGGGAGACCGTCGTCGT
CGGGGACCTGATGTACGAATACGAATACTGGGGGC AAGGGACGCTTGTCACGGTCTCGAGC VL
GACATCCAGATGACTCAGAGCCCTTCCAGCCTGAGC 19
GCCTCTGTGGGAGATAGAGTCACCATCACATGCCAG
GCTAGTCAGTCAATTTCTAGTTACCTGGCATGGTATC
AGCAGAAGCCTGGCCAGGCACCTAAAATCCTGATCT
ACGGAGCCAGTAGGCTGAAGACAGGGGTGCCATCT
CGGTTCTCCGGCAGCGGATCTGGGACATCCTTTACT
CTGACCATCTCATCCCTGGAGCCAGAAGACGCCGCT
ACATACTATTGTCAGCAGTATGCTTCCGTGCCCGTC
ACATTCGGTCAGGGCACTAAGGTCGAGATCAAG Heavy
CAAGTCCAACTTGTCCAACCGGGGGCGGAAGTGCG 20 chain
GAAGCCGGGGGCGAGCGTGAAAGTCTCGTGCAAGG
CATCGGGATACCGATTCACATCATATTACATCGACTG
GGTCAGGCAAGCGCCGGGGCAAGGGCTGGAATGG
ATGGGGCGGATCGACCCGGAGGATGCCGGGACGAA
ATATGCGCAAAAATTCCAAGGGCGCGTCACGATGAC
GGCCGACACATCGACGAGCACGGTATACGTGGAGC
TGAGCTCGCTGAGGAGCGAGGACACCGCGGTATAC
TACTGCGCGCGATACGAATGGGAGACCGTCGTCGT
CGGGGACCTGATGTACGAATACGAATACTGGGGGC
AAGGGACGCTTGTCACGGTCTCGAGCGCTAGCACC
AAGGGCCCCTCCGTGTTCCCCCTGGCCCCTTGCTC
CCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCT
GCCTGGTGAAAGACTACTTCCCCGAGCCTGTGACCG
TGAGCTGGAACTCTGGCGCCCTGACCTCCGGCGTG
CACACCTTCCCTGCCGTGCTGCAATCCTCCGGCCTG
TACTCCCTGTCCTCCGTGGTGACAGTGCCCTCCTCC
AGCCTGGGCACCAAGACCTACACCTGTAACGTGGAC
CACAAGCCCTCCAACACCAAGGTGGACAAGCGGGT
GGAATCTAAATACGGCCCTCCCTGCCCCCCCTGCCC
TGCCCCTGAATTTCTGGGCGGACCTTCCGTGTTTCT
GTTCCCCCCAAAGCCCAAGGACACCCTGATGATCTC
CCGGACCCCCGAAGTGACCTGCGTGGTGGTGGACG
TGTCCCAGGAAGATCCAGAGGTGCAGTTCAACTGGT
ATGTTGACGGCGTGGAAGTGCACAACGCCAAGACC
AAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGG
GTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTG
GCTGAACGGCAAAGAGTACAAGTGCAAGGTGTCCAA
CAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTC
CAAGGCCAAGGGCCAGCCCCGCGAGCCCCAGGTGT
ACACCCTGCCCCCTAGCCAGGAAGAGATGACCAAG
AACCAGGTGTCCCTGACCTGTCTGGTGAAAGGCTTC
TACCCCTCCGACATTGCCGTGGAATGGGAGTCCAAC
GGCCAGCCCGAGAACAACTACAAGACCACCCCCCC
TGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTC
TCGGCTGACAGTGGATAAGTCCCGGTGGCAGGAAG
GCAACGTGTTCTCCTGCAGCGTGATGCACGAGGCC
CTGCACAACCACTATACCCAGAAGTCCCTGTCCCTG AGCCTGGGC Light
GACATCCAGATGACTCAGAGCCCTTCCAGCCTGAGC 21 chain
GCCTCTGTGGGAGATAGAGTCACCATCACATGCCAG
GCTAGTCAGTCAATTTCTAGTTACCTGGCATGGTATC
AGCAGAAGCCTGGCCAGGCACCTAAAATCCTGATCT
ACGGAGCCAGTAGGCTGAAGACAGGGGTGCCATCT
CGGTTCTCCGGCAGCGGATCTGGGACATCCTTTACT
CTGACCATCTCATCCCTGGAGCCAGAAGACGCCGCT
ACATACTATTGTCAGCAGTATGCTTCCGTGCCCGTC
ACATTCGGTCAGGGCACTAAGGTCGAGATCAAGCGT
ACGGTCGCGGCGCCTTCTGTGTTCATTTTCCCCCCA
TCTGATGAACAGCTGAAATCTGGCACTGCTTCTGTG
GTCTGTCTGCTGAACAACTTCTACCCTAGAGAGGCC
AAAGTCCAGTGGAAAGTGGACAATGCTCTGCAGAGT
GGGAATTCCCAGGAATCTGTCACTGAGCAGGACTCT
AAGGATAGCACATACTCCCTGTCCTCTACTCTGACA
CTGAGCAAGGCTGATTACGAGAAACACAAAGTGTAC
GCCTGTGAAGTCACACATCAGGGGCTGTCTAGTCCT
GTGACCAAATCCTTCAATAGGGGAGAGTGC
Example 3. Batch Testing of 39B6-AYE (ARGX-115)
[0364] The pilot drug substance batch of ARGX-115 was tested for
stability over a three-month period. Test samples of the pilot drug
substance batch were stored at the intended storage condition of
-70.degree. C., at the accelerated storage condition of +5.degree.
C. and the stressed storage condition of +25.degree. C. The pilot
drug substance was presented in the formulation: 10 mM
Histidine/Histidine Hydrochloride, 200 mM Sucrose, 40 mM Arginine,
0.03% (w/v) polysorbate 80 at pH 6.0 and a protein concentration of
20.0.+-.2.0 mg/ml.
[0365] ARGX-115 pilot drug substance batch was confirmed to be
stable for three months when stored at the intended storage
condition of -70.degree. C. The SPR binding activity was also
determined as a measure of the stability. The binding activity was
expressed as a percentage of the binding activity of the reference
sample that was kept at -70.degree. C.
[0366] The results are shown in Table 42 below.
TABLE-US-00046 TABLE 42 Method Samples Results ARGX115 Biacore T3M
+ 5.degree. C. 101% T3M - 70.degree. C. 106% T3M + 25.degree. C.
107%
[0367] These results confirm that ARGX-115 is stable over a
prolonged storage period.
Example 4. Characterisation of ARGX-115 Binding to the
GARP-TGF-.beta. Complex
4.1 Mature TGF-.beta. is Essential for ARGX-115 Binding
[0368] In nature, the GARP-TGF-.beta. complex (GARP in complex with
latent TGF-.beta.) is formed in the endoplasmic reticulum with
covalent cysteine interactions (disulphide bridges) between GARP
and latent TGF.mu.. This complex is then displayed on the cell
surface. In vitro, the GARP-TGF-.mu. complex can be formed from
recombinant human GARP and recombinant human latent TGF-.beta.
(C33S)-3.times.strep-tag. The C33S mutant form of latent TGF-.beta.
does not form the covalent interactions with GARP (or any of the
Latent TGF-.beta. Binding Proteins (LTBPs)) like are present in the
native complex.
[0369] To demonstrate ARGX-115 binding to the in vitro-formed
complex of recombinant GARP and recombinant latent TGF.beta.
(C33S), recombinant GARP was coated to an ELISA plate (1 .mu.g/mL
human GARP O/N at 4.degree. C.), blocked with blocking agent
(casein-PBS), and latent TGF-.mu. (5 .mu.g/mL 1 h RT) was captured
by the coated GARP. ARGX-115 and an isotype control antibody (1
.mu.g/mL 1 h at RT) were allowed to bind to the complex, and were
detected with a HRP-conjugated anti-human IgG. As shown in FIG. 19,
ARGX-115 bound to the GARP-latent TGF-.mu. (C33S) complex, whereas
the isotype control did not.
[0370] The assay was also found to work the other way around. The
ELISA plate was coated with ARGX-115, or an isotype control
antibody (1 .mu.g/mL ON at 4.degree. C.) and blocked with blocking
agent (casein-PBS). Recombinant GARP (5 .mu.g/mL) was captured by
the coated ARGX-115 antibody, the plate was washed, and recombinant
latent TGF-.mu. (C33S)-3.times.strep-tag (5 .mu.g/mL) was captured
and detected with streptavidin-HRP. HRP activity was detected only
in the presence of ARGX-115 and not in wells of the plate coated
with the isotype control.
[0371] To test the binding of ARGX-115 to a complex of GARP and the
latency associated peptide (LAP) of TGF-.mu., a complex between
recombinant GARP and recombinant LAP was formed. An ELISA plate was
coated with recombinant GARP (1 .mu.g/mL O/N 4.degree. C.), blocked
with blocking agent (casein-PBS), and LAP (5 .mu.g/mL) was captured
on the coated recombinant GARP. LAP binding was detected with
anti-LAP-HRP. The binding of the anti-LAP-HRP demonstrates that the
GARP-LAP complex does form in vitro. ARGX-115, however, did not
show any binding to the GARP-LAP complex. Moreover, when the ELISA
plate was coated with ARGX-115 (1 .mu.g/mL ON 4.degree. C.),
recombinant GARP (5 .mu.g/mL) was added followed by LAP (5
.mu.g/mL), no binding of anti-LAP-HRP was measured. These results
confirm that mature TGF-.beta. is required for ARGX-115 binding to
the GARP-TGF-.beta. complex.
4.2 Impact of Mutations in hTGF-f3 in Complex with GARP on the
Neutralizing Activity of ARGX-115
[0372] 293T cells stably expressing integrin .alpha.v.mu.6
(293Tcl.ITGB6) were transiently transfected with a mix of 3
plasmids (plasmid mix): (i) CAGA-luc reporter plasmid; (ii) human
GARP (pEF-BOS-puro-hGARP); and (iii) either WT human TGF-.beta. or
mutant TGF-.beta. (pDisplay). Integrin .alpha.v.mu.6 is one of the
two TGF-.mu.-activation integrins. 293Tcl.ITGB6 cells were detached
and harvested from semi-confluent 75 cm.sup.2 flasks, counted and
diluted to 1E+06 cells/mL, and distributed 1 mL per eppendorf tube.
250 .mu.l plasmid mix was added to each tube for transfection.
Directly after transfection, the transfected cells were distributed
in a 96-well optical plate, at 50 .mu.l (4E+04 cells) per well,
containing different test mAbs (ARGX-115, LHG10.6, 1 D11 and MHG-8
at 100 .mu.l/mL). 1 D11 is a mAb against the active from of
TGF-.beta. isoform-1, -2 and -3. MHG-8 and LHG10.6 are described in
WO2015/015003 and WO2016/125017. After incubation for 24 h at
37.degree. C., the luciferase activity was measured. The value
obtained with the transfection of mutant TGF-.beta. was expressed
as a percentage of the value obtained for WT-TGF-.mu.. The results
are shown in FIG. 20. As can be seen from the figure, the
neutralizing activity of ARGX-115 measured against the TGF-.beta.
mutant including the R58A substitution and the TGF-.beta. mutant
including the K338E substitution was significantly reduced. This
indicates that these two residues in the GARP-TGF-.beta. complex
are particularly important for the neutralizing activity of
ARGX-115.
Sequence CWU 1
1
481126PRTArtificial sequenceSynthetic polypeptide 1Glu Val Gln Leu
Val Gln Pro Gly Ala Glu Leu Arg Asn Ser Gly Ala1 5 10 15Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Arg Phe Thr Ser Tyr 20 25 30Tyr Ile
Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly
Arg Ile Asp Pro Glu Asp Gly Gly Thr Lys Tyr Ala Gln Lys Phe 50 55
60Gln Gly Arg Val Thr Phe Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65
70 75 80Val Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Asn Glu Trp Glu Thr Val Val Val Gly Asp Leu Met
Tyr Glu 100 105 110Tyr Glu Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
Ser Ser 115 120 1252107PRTArtificial sequenceSynthetic polypeptide
2Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5
10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Ser Ile Ser Ser
Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Gly Ala Ser Arg Leu Gln Thr Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Ser Phe Thr Leu Thr Ile Ser
Gly Leu Glu Ala65 70 75 80Glu Asp Ala Gly Thr Tyr Tyr Cys Gln Gln
Tyr Asp Ser Leu Pro Val 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu
Leu Lys 100 1053107PRTArtificial sequenceSynthetic polypeptide 3Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10
15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr
20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Asn Ile Leu
Ile 35 40 45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60Ser Gly Ser Gly Thr Ser Phe Thr Leu Thr Ile Ser Gly
Leu Glu Ala65 70 75 80Glu Asp Ala Gly Thr Tyr Tyr Cys Gln Gln Tyr
Ala Ser Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Leu
Lys 100 10545PRTArtificial sequenceSynthetic peptide 4Ser Tyr Tyr
Ile Asp1 5517PRTArtificial sequenceSynthetic peptide 5Arg Ile Asp
Pro Glu Asp Gly Gly Thr Lys Tyr Ala Gln Lys Phe Gln1 5 10
15Gly617PRTArtificial sequenceSynthetic peptide 6Asn Glu Trp Glu
Thr Val Val Val Gly Asp Leu Met Tyr Glu Tyr Glu1 5 10
15Tyr717PRTArtificial sequenceSynthetic peptide 7Arg Ile Asp Pro
Glu Glu Gly Gly Thr Lys Tyr Ala Gln Lys Phe Gln1 5 10
15Gly817PRTArtificial sequenceSynthetic peptide 8Arg Ile Asp Pro
Glu Asp Ala Gly Thr Lys Tyr Ala Gln Lys Phe Gln1 5 10
15Gly911PRTArtificial sequenceSynthetic peptide 9Gln Ala Ser Gln
Ser Ile Ser Ser Tyr Leu Ala1 5 10107PRTArtificial sequenceSynthetic
peptide 10Gly Ala Ser Arg Leu Lys Thr1 5119PRTArtificial
sequenceSynthetic peptide 11Gln Gln Tyr Ala Ser Val Pro Val Thr1
51217PRTArtificial sequenceSynthetic peptide 12Arg Ile Asp Pro Glu
Asp Ala Gly Thr Lys Tyr Ala Gln Lys Phe Gln1 5 10
15Gly1317PRTArtificial sequenceSynthetic peptide 13Tyr Glu Trp Glu
Thr Val Val Val Gly Asp Leu Met Tyr Glu Tyr Glu1 5 10
15Tyr14126PRTArtificial sequenceSynthetic polypeptide 14Gln Val Gln
Leu Val Gln Pro Gly Ala Glu Val Arg Lys Pro Gly Ala1 5 10 15Ser Val
Lys Val Ser Cys Lys Ala Ser Gly Tyr Arg Phe Thr Ser Tyr 20 25 30Tyr
Ile Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Arg Ile Asp Pro Glu Asp Ala Gly Thr Lys Tyr Ala Gln Lys Phe
50 55 60Gln Gly Arg Val Thr Met Thr Ala Asp Thr Ser Thr Ser Thr Val
Tyr65 70 75 80Val Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Arg Tyr Glu Trp Glu Thr Val Val Val Gly Asp
Leu Met Tyr Glu 100 105 110Tyr Glu Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 12515107PRTArtificial sequenceSynthetic
polypeptide 15Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Ser
Ile Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala
Pro Lys Ile Leu Ile 35 40 45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val
Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Ser Phe Thr Leu
Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Ala Ala Thr Tyr Tyr
Cys Gln Gln Tyr Ala Ser Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys 100 10516452PRTArtificial sequenceSynthetic
polypeptide 16Gln Val Gln Leu Val Gln Pro Gly Ala Glu Val Arg Lys
Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Arg
Phe Thr Ser Tyr 20 25 30Tyr Ile Asp Trp Val Arg Gln Ala Pro Gly Gln
Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asp Pro Glu Asp Ala Gly Thr
Lys Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Ala Asp
Thr Ser Thr Ser Thr Val Tyr65 70 75 80Val Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Tyr Glu Trp Glu
Thr Val Val Val Gly Asp Leu Met Tyr Glu 100 105 110Tyr Glu Tyr Trp
Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser 115 120 125Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr 130 135
140Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe
Pro145 150 155 160Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu
Thr Ser Gly Val 165 170 175His Thr Phe Pro Ala Val Leu Gln Ser Ser
Gly Leu Tyr Ser Leu Ser 180 185 190Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly Thr Lys Thr Tyr Thr 195 200 205Cys Asn Val Asp His Lys
Pro Ser Asn Thr Lys Val Asp Lys Arg Val 210 215 220Glu Ser Lys Tyr
Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro Glu Phe225 230 235 240Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 245 250
255Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
260 265 270Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp
Gly Val 275 280 285Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Phe Asn Ser 290 295 300Thr Tyr Arg Val Val Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu305 310 315 320Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Gly Leu Pro Ser 325 330 335Ser Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 340 345 350Gln Val Tyr
Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys Asn Gln 355 360 365Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 370 375
380Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr385 390 395 400Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Arg Leu 405 410 415Thr Val Asp Lys Ser Arg Trp Gln Glu Gly
Asn Val Phe Ser Cys Ser 420 425 430Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser 435 440 445Leu Ser Leu Gly
45017214PRTArtificial sequenceSynthetic polypeptide 17Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg
Val Thr Ile Thr Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30Leu
Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Lys Ile Leu Ile 35 40
45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val Pro Ser Arg Phe Ser Gly
50 55 60Ser Gly Ser Gly Thr Ser Phe Thr Leu Thr Ile Ser Ser Leu Glu
Pro65 70 75 80Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Tyr Ala Ser
Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg
Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp
Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu
Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val
Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val
Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser
Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185
190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser
195 200 205Phe Asn Arg Gly Glu Cys 21018378DNAArtificial
sequenceSynthetic polynucleotide 18caagtccaac ttgtccaacc gggggcggaa
gtgcggaagc cgggggcgag cgtgaaagtc 60tcgtgcaagg catcgggata ccgattcaca
tcatattaca tcgactgggt caggcaagcg 120ccggggcaag ggctggaatg
gatggggcgg atcgacccgg aggatgccgg gacgaaatat 180gcgcaaaaat
tccaagggcg cgtcacgatg acggccgaca catcgacgag cacggtatac
240gtggagctga gctcgctgag gagcgaggac accgcggtat actactgcgc
gcgatacgaa 300tgggagaccg tcgtcgtcgg ggacctgatg tacgaatacg
aatactgggg gcaagggacg 360cttgtcacgg tctcgagc 37819321DNAArtificial
sequenceSynthetic polynucleotide 19gacatccaga tgactcagag cccttccagc
ctgagcgcct ctgtgggaga tagagtcacc 60atcacatgcc aggctagtca gtcaatttct
agttacctgg catggtatca gcagaagcct 120ggccaggcac ctaaaatcct
gatctacgga gccagtaggc tgaagacagg ggtgccatct 180cggttctccg
gcagcggatc tgggacatcc tttactctga ccatctcatc cctggagcca
240gaagacgccg ctacatacta ttgtcagcag tatgcttccg tgcccgtcac
attcggtcag 300ggcactaagg tcgagatcaa g 321201356DNAArtificial
sequenceSynthetic polynucleotide 20caagtccaac ttgtccaacc gggggcggaa
gtgcggaagc cgggggcgag cgtgaaagtc 60tcgtgcaagg catcgggata ccgattcaca
tcatattaca tcgactgggt caggcaagcg 120ccggggcaag ggctggaatg
gatggggcgg atcgacccgg aggatgccgg gacgaaatat 180gcgcaaaaat
tccaagggcg cgtcacgatg acggccgaca catcgacgag cacggtatac
240gtggagctga gctcgctgag gagcgaggac accgcggtat actactgcgc
gcgatacgaa 300tgggagaccg tcgtcgtcgg ggacctgatg tacgaatacg
aatactgggg gcaagggacg 360cttgtcacgg tctcgagcgc tagcaccaag
ggcccctccg tgttccccct ggccccttgc 420tcccggtcca cctccgagtc
taccgccgct ctgggctgcc tggtgaaaga ctacttcccc 480gagcctgtga
ccgtgagctg gaactctggc gccctgacct ccggcgtgca caccttccct
540gccgtgctgc aatcctccgg cctgtactcc ctgtcctccg tggtgacagt
gccctcctcc 600agcctgggca ccaagaccta cacctgtaac gtggaccaca
agccctccaa caccaaggtg 660gacaagcggg tggaatctaa atacggccct
ccctgccccc cctgccctgc ccctgaattt 720ctgggcggac cttccgtgtt
tctgttcccc ccaaagccca aggacaccct gatgatctcc 780cggacccccg
aagtgacctg cgtggtggtg gacgtgtccc aggaagatcc agaggtgcag
840ttcaactggt atgttgacgg cgtggaagtg cacaacgcca agaccaagcc
cagagaggaa 900cagttcaact ccacctaccg ggtggtgtcc gtgctgaccg
tgctgcacca ggactggctg 960aacggcaaag agtacaagtg caaggtgtcc
aacaagggcc tgccctccag catcgaaaag 1020accatctcca aggccaaggg
ccagccccgc gagccccagg tgtacaccct gccccctagc 1080caggaagaga
tgaccaagaa ccaggtgtcc ctgacctgtc tggtgaaagg cttctacccc
1140tccgacattg ccgtggaatg ggagtccaac ggccagcccg agaacaacta
caagaccacc 1200ccccctgtgc tggactccga cggctccttc ttcctgtact
ctcggctgac agtggataag 1260tcccggtggc aggaaggcaa cgtgttctcc
tgcagcgtga tgcacgaggc cctgcacaac 1320cactataccc agaagtccct
gtccctgagc ctgggc 135621642DNAArtificial sequenceSynthetic
polynucleotide 21gacatccaga tgactcagag cccttccagc ctgagcgcct
ctgtgggaga tagagtcacc 60atcacatgcc aggctagtca gtcaatttct agttacctgg
catggtatca gcagaagcct 120ggccaggcac ctaaaatcct gatctacgga
gccagtaggc tgaagacagg ggtgccatct 180cggttctccg gcagcggatc
tgggacatcc tttactctga ccatctcatc cctggagcca 240gaagacgccg
ctacatacta ttgtcagcag tatgcttccg tgcccgtcac attcggtcag
300ggcactaagg tcgagatcaa gcgtacggtc gcggcgcctt ctgtgttcat
tttcccccca 360tctgatgaac agctgaaatc tggcactgct tctgtggtct
gtctgctgaa caacttctac 420cctagagagg ccaaagtcca gtggaaagtg
gacaatgctc tgcagagtgg gaattcccag 480gaatctgtca ctgagcagga
ctctaaggat agcacatact ccctgtcctc tactctgaca 540ctgagcaagg
ctgattacga gaaacacaaa gtgtacgcct gtgaagtcac acatcagggg
600ctgtctagtc ctgtgaccaa atccttcaat aggggagagt gc
64222126PRTArtificial sequenceSynthetic polypeptide 22Gln Val Gln
Leu Val Gln Pro Gly Ala Glu Val Arg Lys Pro Gly Ala1 5 10 15Ser Val
Lys Val Ser Cys Lys Ala Ser Gly Tyr Arg Phe Thr Ser Tyr 20 25 30Tyr
Ile Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Arg Ile Asp Pro Glu Asp Gly Gly Thr Lys Tyr Ala Gln Lys Phe
50 55 60Gln Gly Arg Val Thr Met Thr Ala Asp Thr Ser Thr Ser Thr Val
Tyr65 70 75 80Val Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Arg Asn Glu Trp Glu Thr Val Val Val Gly Asp
Leu Met Tyr Glu 100 105 110Tyr Glu Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 12523107PRTArtificial sequenceSynthetic
polypeptide 23Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Ser
Ile Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala
Pro Lys Ile Leu Ile 35 40 45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val
Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Ser Phe Thr Leu
Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Ala Ala Thr Tyr Tyr
Cys Gln Gln Tyr Ala Ser Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys 100 10524126PRTArtificial sequenceSynthetic
polypeptide 24Glu Val Gln Leu Val Gln Pro Gly Ala Glu Val Lys Lys
Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Arg
Phe Thr Ser Tyr 20 25 30Tyr Ile Asp Trp Val Arg Gln Ala Pro Gly Gln
Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asp Pro Glu Glu Gly Gly Thr
Lys Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Phe Thr Ala Asp
Thr Ser Thr Ser Thr Val Tyr65 70 75 80Val Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asn Glu Trp Glu
Thr Val Val Val Gly Asp Leu Thr Tyr Glu 100 105 110Tyr Glu Tyr Trp
Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12525107PRTArtificial sequenceSynthetic polypeptide 25Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg
Val Thr Ile Thr Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30Leu
Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Lys Ile Leu Ile 35 40
45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val Pro Ser Arg Phe Ser Gly
50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Ala65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Ala Ser
Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100
10526123PRTArtificial sequenceSynthetic polypeptide 26Gln Val Gln
Leu Val
Gln Pro Gly Ala Glu Leu Arg Asn Pro Gly Ala1 5 10 15Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Arg Phe Thr Ser Tyr 20 25 30Tyr Ile Asp
Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Arg
Ile Asp Pro Glu Asp Gly Gly Thr Lys Tyr Ala Gln Lys Phe 50 55 60Gln
Gly Arg Val Thr Phe Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Asn Glu Trp Glu Thr Val Val Val Gly Asp Leu Met Tyr
Glu 100 105 110Tyr Glu Tyr Trp Gly Gln Gly Thr Leu Val Thr 115
12027107PRTArtificial sequenceSynthetic polypeptide 27Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Asp Arg
Val Thr Ile Thr Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30Leu
Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Lys Leu Leu Ile 35 40
45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val Pro Ser Arg Phe Ser Gly
50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Tyr Ala Ser
Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100
10528126PRTArtificial sequenceSynthetic polypeptide 28Gln Val Gln
Leu Val Gln Pro Gly Ala Glu Leu Lys Lys Pro Gly Ala1 5 10 15Ser Val
Lys Val Ser Cys Lys Ala Ser Gly Tyr Arg Phe Thr Ser Tyr 20 25 30Tyr
Ile Asp Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Arg Ile Asp Pro Glu Asp Ala Gly Thr Lys Tyr Ala Gln Lys Phe
50 55 60Gln Gly Arg Val Thr Phe Thr Ala Asp Thr Ser Thr Ser Thr Val
Tyr65 70 75 80Val Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Arg Asn Glu Trp Glu Thr Val Val Val Gly Asp
Leu Thr Tyr Glu 100 105 110Tyr Glu Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 115 120 12529106PRTArtificial sequenceSynthetic
polypeptide 29Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala
Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Gln Ala Ser Gln Ser
Ile Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala
Pro Asn Leu Leu Ile 35 40 45Tyr Gly Ala Ser Arg Leu Lys Thr Glu Val
Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu
Ile Ser Gly Leu Glu Pro Glu65 70 75 80Asp Ala Gly Thr Tyr Tyr Cys
Gln Gln Tyr Ala Ser Val Pro Val Thr 85 90 95Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys 100 10530126PRTArtificial sequenceSynthetic
polypeptide 30Glu Val Gln Leu Val Gln Ser Gly Ala Glu Leu Lys Lys
Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Arg
Phe Thr Ser Tyr 20 25 30Tyr Ile Asp Trp Val Arg Gln Ala Pro Gly Gln
Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asp Pro Glu Glu Gly Gly Thr
Lys Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr Ala Asp
Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg
Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asn Glu Trp Glu
Thr Val Val Val Gly Asp Leu Met Tyr Glu 100 105 110Tyr Glu Tyr Trp
Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
12531107PRTArtificial sequenceSynthetic polypeptide 31Asp Ile Gln
Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Asp Arg
Val Thr Ile Thr Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30Leu
Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Asn Ile Leu Ile 35 40
45Tyr Gly Ala Ser Arg Leu Lys Thr Gly Val Pro Ser Arg Phe Ser Gly
50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Gly Leu Glu
Ala65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Ala Ser
Val Pro Val 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100
1053217PRTArtificial sequenceSynthetic polypeptide 32Asn Glu Trp
Glu Thr Val Val Val Gly Asp Leu Thr Tyr Glu Tyr Glu1 5 10
15Tyr33662PRTHomo sapiens 33Met Arg Pro Gln Ile Leu Leu Leu Leu Ala
Leu Leu Thr Leu Gly Leu1 5 10 15Ala Ala Gln His Gln Asp Lys Val Pro
Cys Lys Met Val Asp Lys Lys 20 25 30Val Ser Cys Gln Val Leu Gly Leu
Leu Gln Val Pro Ser Val Leu Pro 35 40 45Pro Asp Thr Glu Thr Leu Asp
Leu Ser Gly Asn Gln Leu Arg Ser Ile 50 55 60Leu Ala Ser Pro Leu Gly
Phe Tyr Thr Ala Leu Arg His Leu Asp Leu65 70 75 80Ser Thr Asn Glu
Ile Ser Phe Leu Gln Pro Gly Ala Phe Gln Ala Leu 85 90 95Thr His Leu
Glu His Leu Ser Leu Ala His Asn Arg Leu Ala Met Ala 100 105 110Thr
Ala Leu Ser Ala Gly Gly Leu Gly Pro Leu Pro Arg Val Thr Ser 115 120
125Leu Asp Leu Ser Gly Asn Ser Leu Tyr Ser Gly Leu Leu Glu Arg Leu
130 135 140Leu Gly Glu Ala Pro Ser Leu His Thr Leu Ser Leu Ala Glu
Asn Ser145 150 155 160Leu Thr Arg Leu Thr Arg His Thr Phe Arg Asp
Met Pro Ala Leu Glu 165 170 175Gln Leu Asp Leu His Ser Asn Val Leu
Met Asp Ile Glu Asp Gly Ala 180 185 190Phe Glu Gly Leu Pro Arg Leu
Thr His Leu Asn Leu Ser Arg Asn Ser 195 200 205Leu Thr Cys Ile Ser
Asp Phe Ser Leu Gln Gln Leu Arg Val Leu Asp 210 215 220Leu Ser Cys
Asn Ser Ile Glu Ala Phe Gln Thr Ala Ser Gln Pro Gln225 230 235
240Ala Glu Phe Gln Leu Thr Trp Leu Asp Leu Arg Glu Asn Lys Leu Leu
245 250 255His Phe Pro Asp Leu Ala Ala Leu Pro Arg Leu Ile Tyr Leu
Asn Leu 260 265 270Ser Asn Asn Leu Ile Arg Leu Pro Thr Gly Pro Pro
Gln Asp Ser Lys 275 280 285Gly Ile His Ala Pro Ser Glu Gly Trp Ser
Ala Leu Pro Leu Ser Ala 290 295 300Pro Ser Gly Asn Ala Ser Gly Arg
Pro Leu Ser Gln Leu Leu Asn Leu305 310 315 320Asp Leu Ser Tyr Asn
Glu Ile Glu Leu Ile Pro Asp Ser Phe Leu Glu 325 330 335His Leu Thr
Ser Leu Cys Phe Leu Asn Leu Ser Arg Asn Cys Leu Arg 340 345 350Thr
Phe Glu Ala Arg Arg Leu Gly Ser Leu Pro Cys Leu Met Leu Leu 355 360
365Asp Leu Ser His Asn Ala Leu Glu Thr Leu Glu Leu Gly Ala Arg Ala
370 375 380Leu Gly Ser Leu Arg Thr Leu Leu Leu Gln Gly Asn Ala Leu
Arg Asp385 390 395 400Leu Pro Pro Tyr Thr Phe Ala Asn Leu Ala Ser
Leu Gln Arg Leu Asn 405 410 415Leu Gln Gly Asn Arg Val Ser Pro Cys
Gly Gly Pro Asp Glu Pro Gly 420 425 430Pro Ser Gly Cys Val Ala Phe
Ser Gly Ile Thr Ser Leu Arg Ser Leu 435 440 445Ser Leu Val Asp Asn
Glu Ile Glu Leu Leu Arg Ala Gly Ala Phe Leu 450 455 460His Thr Pro
Leu Thr Glu Leu Asp Leu Ser Ser Asn Pro Gly Leu Glu465 470 475
480Val Ala Thr Gly Ala Leu Gly Gly Leu Glu Ala Ser Leu Glu Val Leu
485 490 495Ala Leu Gln Gly Asn Gly Leu Met Val Leu Gln Val Asp Leu
Pro Cys 500 505 510Phe Ile Cys Leu Lys Arg Leu Asn Leu Ala Glu Asn
Arg Leu Ser His 515 520 525Leu Pro Ala Trp Thr Gln Ala Val Ser Leu
Glu Val Leu Asp Leu Arg 530 535 540Asn Asn Ser Phe Ser Leu Leu Pro
Gly Ser Ala Met Gly Gly Leu Glu545 550 555 560Thr Ser Leu Arg Arg
Leu Tyr Leu Gln Gly Asn Pro Leu Ser Cys Cys 565 570 575Gly Asn Gly
Trp Leu Ala Ala Gln Leu His Gln Gly Arg Val Asp Val 580 585 590Asp
Ala Thr Gln Asp Leu Ile Cys Arg Phe Ser Ser Gln Glu Glu Val 595 600
605Ser Leu Ser His Val Arg Pro Glu Asp Cys Glu Lys Gly Gly Leu Lys
610 615 620Asn Ile Asn Leu Ile Ile Ile Leu Thr Phe Ile Leu Val Ser
Ala Ile625 630 635 640Leu Leu Thr Thr Leu Ala Ala Cys Cys Cys Val
Arg Arg Gln Lys Phe 645 650 655Asn Gln Gln Tyr Lys Ala
66034390PRTHomo sapiens 34Met Pro Pro Ser Gly Leu Arg Leu Leu Pro
Leu Leu Leu Pro Leu Leu1 5 10 15Trp Leu Leu Val Leu Thr Pro Gly Arg
Pro Ala Ala Gly Leu Ser Thr 20 25 30Cys Lys Thr Ile Asp Met Glu Leu
Val Lys Arg Lys Arg Ile Glu Ala 35 40 45Ile Arg Gly Gln Ile Leu Ser
Lys Leu Arg Leu Ala Ser Pro Pro Ser 50 55 60Gln Gly Glu Val Pro Pro
Gly Pro Leu Pro Glu Ala Val Leu Ala Leu65 70 75 80Tyr Asn Ser Thr
Arg Asp Arg Val Ala Gly Glu Ser Ala Glu Pro Glu 85 90 95Pro Glu Pro
Glu Ala Asp Tyr Tyr Ala Lys Glu Val Thr Arg Val Leu 100 105 110Met
Val Glu Thr His Asn Glu Ile Tyr Asp Lys Phe Lys Gln Ser Thr 115 120
125His Ser Ile Tyr Met Phe Phe Asn Thr Ser Glu Leu Arg Glu Ala Val
130 135 140Pro Glu Pro Val Leu Leu Ser Arg Ala Glu Leu Arg Leu Leu
Arg Leu145 150 155 160Lys Leu Lys Val Glu Gln His Val Glu Leu Tyr
Gln Lys Tyr Ser Asn 165 170 175Asn Ser Trp Arg Tyr Leu Ser Asn Arg
Leu Leu Ala Pro Ser Asp Ser 180 185 190Pro Glu Trp Leu Ser Phe Asp
Val Thr Gly Val Val Arg Gln Trp Leu 195 200 205Ser Arg Gly Gly Glu
Ile Glu Gly Phe Arg Leu Ser Ala His Cys Ser 210 215 220Cys Asp Ser
Arg Asp Asn Thr Leu Gln Val Asp Ile Asn Gly Phe Thr225 230 235
240Thr Gly Arg Arg Gly Asp Leu Ala Thr Ile His Gly Met Asn Arg Pro
245 250 255Phe Leu Leu Leu Met Ala Thr Pro Leu Glu Arg Ala Gln His
Leu Gln 260 265 270Ser Ser Arg His Arg Arg Ala Leu Asp Thr Asn Tyr
Cys Phe Ser Ser 275 280 285Thr Glu Lys Asn Cys Cys Val Arg Gln Leu
Tyr Ile Asp Phe Arg Lys 290 295 300Asp Leu Gly Trp Lys Trp Ile His
Glu Pro Lys Gly Tyr His Ala Asn305 310 315 320Phe Cys Leu Gly Pro
Cys Pro Tyr Ile Trp Ser Leu Asp Thr Gln Tyr 325 330 335Ser Lys Val
Leu Ala Leu Tyr Asn Gln His Asn Pro Gly Ala Ser Ala 340 345 350Ala
Pro Cys Cys Val Pro Gln Ala Leu Glu Pro Leu Pro Ile Val Tyr 355 360
365Tyr Val Gly Arg Lys Pro Lys Val Glu Gln Leu Ser Asn Met Ile Val
370 375 380Arg Ser Cys Lys Cys Ser385 39035249PRTHomo sapiens 35Leu
Ser Thr Cys Lys Thr Ile Asp Met Glu Leu Val Lys Arg Lys Arg1 5 10
15Ile Glu Ala Ile Arg Gly Gln Ile Leu Ser Lys Leu Arg Leu Ala Ser
20 25 30Pro Pro Ser Gln Gly Glu Val Pro Pro Gly Pro Leu Pro Glu Ala
Val 35 40 45Leu Ala Leu Tyr Asn Ser Thr Arg Asp Arg Val Ala Gly Glu
Ser Ala 50 55 60Glu Pro Glu Pro Glu Pro Glu Ala Asp Tyr Tyr Ala Lys
Glu Val Thr65 70 75 80Arg Val Leu Met Val Glu Thr His Asn Glu Ile
Tyr Asp Lys Phe Lys 85 90 95Gln Ser Thr His Ser Ile Tyr Met Phe Phe
Asn Thr Ser Glu Leu Arg 100 105 110Glu Ala Val Pro Glu Pro Val Leu
Leu Ser Arg Ala Glu Leu Arg Leu 115 120 125Leu Arg Leu Lys Leu Lys
Val Glu Gln His Val Glu Leu Tyr Gln Lys 130 135 140Tyr Ser Asn Asn
Ser Trp Arg Tyr Leu Ser Asn Arg Leu Leu Ala Pro145 150 155 160Ser
Asp Ser Pro Glu Trp Leu Ser Phe Asp Val Thr Gly Val Val Arg 165 170
175Gln Trp Leu Ser Arg Gly Gly Glu Ile Glu Gly Phe Arg Leu Ser Ala
180 185 190His Cys Ser Cys Asp Ser Arg Asp Asn Thr Leu Gln Val Asp
Ile Asn 195 200 205Gly Phe Thr Thr Gly Arg Arg Gly Asp Leu Ala Thr
Ile His Gly Met 210 215 220Asn Arg Pro Phe Leu Leu Leu Met Ala Thr
Pro Leu Glu Arg Ala Gln225 230 235 240His Leu Gln Ser Ser Arg His
Arg Arg 24536112PRTHomo sapiens 36Ala Leu Asp Thr Asn Tyr Cys Phe
Ser Ser Thr Glu Lys Asn Cys Cys1 5 10 15Val Arg Gln Leu Tyr Ile Asp
Phe Arg Lys Asp Leu Gly Trp Lys Trp 20 25 30Ile His Glu Pro Lys Gly
Tyr His Ala Asn Phe Cys Leu Gly Pro Cys 35 40 45Pro Tyr Ile Trp Ser
Leu Asp Thr Gln Tyr Ser Lys Val Leu Ala Leu 50 55 60Tyr Asn Gln His
Asn Pro Gly Ala Ser Ala Ala Pro Cys Cys Val Pro65 70 75 80Gln Ala
Leu Glu Pro Leu Pro Ile Val Tyr Tyr Val Gly Arg Lys Pro 85 90 95Lys
Val Glu Gln Leu Ser Asn Met Ile Val Arg Ser Cys Lys Cys Ser 100 105
1103710PRTHomo sapiens 37Glu Pro Lys Ser Cys Asp Lys Thr His Thr1 5
10385PRTHomo sapiens 38Cys Pro Pro Cys Pro1 5398PRTHomo sapiens
39Ala Pro Glu Leu Leu Gly Gly Pro1 54012PRTHomo sapiens 40Glu Leu
Lys Thr Pro Leu Gly Asp Thr Thr His Thr1 5 104150PRTHomo sapiens
41Cys Pro Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys1
5 10 15Pro Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys
Pro 20 25 30Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys
Pro Arg 35 40 45Cys Pro 50428PRTHomo sapiens 42Ala Pro Glu Leu Leu
Gly Gly Pro1 5437PRTHomo sapiens 43Glu Ser Lys Tyr Gly Pro Pro1
5445PRTHomo sapiens 44Cys Pro Ser Cys Pro1 5458PRTHomo sapiens
45Ala Pro Glu Phe Leu Gly Gly Pro1 5463PRTHomo sapiens 46Glu Arg
Lys14710PRTHomo sapiens 47Cys Cys Val Glu Cys Pro Pro Pro Cys Pro1
5 10487PRTHomo sapiens 48Ala Pro Pro Val Ala Gly Pro1 5
* * * * *