U.S. patent application number 17/163618 was filed with the patent office on 2021-09-09 for immunoglobulin constant region fc receptor binding agents.
The applicant listed for this patent is Gliknik Inc., University of Maryland, Baltimore. Invention is credited to David S. BLOCK, Henrik OLSEN, Dan H. SCHULZE, Scott E. STROME.
Application Number | 20210277091 17/163618 |
Document ID | / |
Family ID | 1000005611803 |
Filed Date | 2021-09-09 |
United States Patent
Application |
20210277091 |
Kind Code |
A1 |
STROME; Scott E. ; et
al. |
September 9, 2021 |
IMMUNOGLOBULIN CONSTANT REGION FC RECEPTOR BINDING AGENTS
Abstract
IVIG replacement compounds are derived from recombinant and/or
biochemical creation of immunologically active biomimetic(s). These
replacement compounds are then screened in vitro to assess each
replacement compound's efficiency at modulating immune function.
Particular replacement compounds are selected for further in vivo
validation and dosage/administration optimization. Finally, the
replacement compounds are used to treat a wide range of diseases,
including inflammatory and autoimmune diseases.
Inventors: |
STROME; Scott E.;
(Baltimore, MD) ; SCHULZE; Dan H.; (Baltimore,
MD) ; BLOCK; David S.; (Baltimore, MD) ;
OLSEN; Henrik; (Baltimore, MD) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
University of Maryland, Baltimore
Gliknik Inc. |
Baltimore
Baltimore |
MD
MD |
US
US |
|
|
Family ID: |
1000005611803 |
Appl. No.: |
17/163618 |
Filed: |
February 1, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16226964 |
Dec 20, 2018 |
10941191 |
|
|
17163618 |
|
|
|
|
15900211 |
Feb 20, 2018 |
10208105 |
|
|
16226964 |
|
|
|
|
15483873 |
Apr 10, 2017 |
9926362 |
|
|
15900211 |
|
|
|
|
15370675 |
Dec 6, 2016 |
|
|
|
15483873 |
|
|
|
|
15177061 |
Jun 8, 2016 |
|
|
|
15370675 |
|
|
|
|
14221148 |
Mar 20, 2014 |
9512210 |
|
|
15177061 |
|
|
|
|
12602609 |
Jun 4, 2010 |
8680237 |
|
|
PCT/US2008/065428 |
May 30, 2008 |
|
|
|
14221148 |
|
|
|
|
61015547 |
Dec 20, 2007 |
|
|
|
61015127 |
Dec 19, 2007 |
|
|
|
60941644 |
Jun 1, 2007 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/528 20130101;
C07K 2317/72 20130101; Y02A 50/30 20180101; C07K 16/2863 20130101;
C07K 2317/55 20130101; C07K 2318/00 20130101; C07K 2319/30
20130101; C07K 16/065 20130101; C07K 16/00 20130101; C07K 2317/92
20130101; C07K 2317/73 20130101; C07K 16/32 20130101; C07K 2317/35
20130101; C07K 2317/41 20130101; C07K 2319/00 20130101; C07K
2317/50 20130101; A61K 2039/57 20130101; G01N 33/5047 20130101;
C07K 2317/71 20130101; A61K 2039/505 20130101; C07K 2317/53
20130101; C07K 16/28 20130101; C07K 2317/526 20130101; C07K 16/18
20130101; C07K 2317/52 20130101; C07K 16/283 20130101; G01N 2500/10
20130101; C07K 2317/524 20130101; A61K 2039/54 20130101 |
International
Class: |
C07K 16/00 20060101
C07K016/00; C07K 16/06 20060101 C07K016/06; C07K 16/32 20060101
C07K016/32; C07K 16/28 20060101 C07K016/28; C07K 16/18 20060101
C07K016/18; G01N 33/50 20060101 G01N033/50 |
Claims
1.-20. (canceled)
21. A method of treating an autoimmune or inflammatory disease
comprising administering to a subject in need thereof a composition
comprising a cluster stradomer comprising at least two multimerized
cluster stradomer units, wherein each of said cluster stradomer
units comprises at least one multimerizing region selected from an
IgG2 hinge or an isoleucine zipper and at least one Fc domain
comprising a CH2 domain and a CH3 domain from IgG1 or IgG3 or a
combination thereof, wherein the multimerizing region(s) of the at
least two cluster stradomer units multimerize to form the cluster
stradomer, and wherein the cluster stradomer is capable of
specifically binding to at least two Fc receptors.
22. The method of claim 21, wherein the cluster stradomer comprises
two multimerized cluster stradomer units.
23. The method of claim 21, wherein the cluster stradomer comprises
at least three multimerized cluster stradomer units.
24. The method of claim 21, wherein the cluster stradomer comprises
at least four multimerized cluster stradomer units.
25. The method of claim 21, wherein the cluster stradomer comprises
at least five multimerized cluster stradomer units.
26. The method of claim 21, wherein the at least one Fc domain
comprises an IgG1 hinge, an IgG1 CH2 domain, and an IgG1 CH3
domain.
27. The method of claim 21, wherein the at least one Fe domain
comprises an IgG3 hinge, an IgG3 CH2 domain, and an IgG3 CH3
domain.
28. The method of claim 21, wherein at least one of the cluster
stradomer units comprises two or more Fc domains.
29. The method of claim 21, wherein each of the cluster stradomer
units is capable of specifically binding to at least one FcR.
30. The method of claim 29, wherein the at least one FcR is human
Fc.gamma. receptor I, human Fc.gamma. receptor II, human Fc.gamma.
receptor III, or human Fc.gamma. receptor IV.
31. The method of claim 30, wherein the human Fc.gamma. receptor
III is human Fc.gamma. receptor IIIa.
32. The method of claim 21, wherein the at least one multimerizing
region is an IgG2 hinge.
33. The method of claim 21, wherein the cluster stradomer is
administered intravenously, subcutaneously, orally, intranasally,
rectally, intraperitoneally, sublingually, buccally, transdermally,
by subdermal implant, or intramuscularly.
34. The method of claim 21, wherein the subject in need thereof
suffers from an autoimmune or inflammatory disease that can be
treated by IVIG.
35. The method of claim 21, wherein the inflammatory disease is
idiopathic thrombocytopenic purpura.
36. The method of claim 21, wherein the autoimmune disease is
systemic lupus erythematosus, rheumatoid arthritis, multiple
sclerosis, myasthenia gravis, chronic inflammatory demyelinating
polyradiculoneuropathy or type 1 diabetes.
37. A method of treating an autoimmune or inflammatory disease
comprising administering to a subject in need thereof a composition
comprising a cluster stradomer comprising at least two multimerized
cluster stradomer units, wherein each of said cluster stradomer
units comprises an IgG2 hinge multimerizing region and an IgG1 Fc
domain comprising a CH2 and CH3 domain, wherein the IgG2 hinge
multimerizing region of the at least two cluster stradomer units
multimerize to form the cluster stradomer, and wherein the cluster
stradomer is capable of specifically binding to at least two
Fc.gamma. receptors.
38. A method of treating an autoimmune or inflammatory disease
comprising administering to a subject in need thereof a composition
comprising a cluster stradomer comprising at least two multimerized
cluster stradomer units, wherein each of said cluster stradomer
units comprises an IgG2 hinge multimerizing region and an IgG3 Fc
domain comprising a CH2 and CH3 domain, wherein the IgG2 hinge
multimerizing region of each of the at least two cluster stradomer
units multimerize to form the cluster stradomer, and wherein the
cluster stradomer is capable of specifically binding to at least
two Fc.gamma. receptors.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a a continuation of U.S. patent
application Ser. No. 16/226,964, filed Dec. 20, 2018, which is a
continuation of U.S. patent application Ser. No. 15/900,211, filed
Feb. 20, 2018 (now U.S. Pat. No. 10,208,105, issued Feb. 19, 2019),
which is a continuation of U.S. patent application Ser. No.
15/483,873, filed on Apr. 10, 2017 (now U.S. Pat. No. 9,926,362,
issued Mar. 27, 2018), which is a continuation of U.S. patent
application Ser. No. 15/370,675, filed Dec. 6, 2016 (now
abandoned), which is a continuation of U.S. patent application Ser.
No. 15/177,061, filed on Jun. 8, 2016 (now abandoned), which is a
continuation of U.S. patent application Ser. No. 14/221,148, filed
on Mar. 20, 2014 (now U.S. Pat. No. 9,512,210, issued Dec. 6,
2016), which is a continuation of U.S. patent application Ser. No.
12/602,609 filed Jun. 4, 2010 (now U.S. Pat. No. 8,680,237, issued
Mar. 25, 2014), which is a National Stage filing of
PCT/US2008/065428, filed May 30, 2008, under 35 U.S.C. .sctn. 371
which claims the benefit of priority to U.S. Provisional
Application Nos. 61/015,547, filed Dec. 20, 2007; 61/015,127, filed
Dec. 19, 2007; and 60/941,644, filed Jun. 1, 2007, each of which
are incorporated by reference herein in their entireties.
DESCRIPTION OF THE TEXT FILE SUBMITTED ELECTRONICALLY
[0002] The contents of the text file submitted electronically
herewith are incorporated herein by reference in their entirety. A
computer readable format copy of the Sequence Listing (filename:
GLIK_002_16US_SeqList_ST25.txt, date recorded: Jan. 26, 2021, file
size 312 kilobytes)
BACKGROUND OF THE INVENTION
Field of the Invention
[0003] This invention relates generally to the fields of
immunology, inflammation, and tumor immunology. More specifically,
the present invention relates to biologically active biomimetic
molecules comprising immunoglobulin Fc domains, compositions
comprising such biomimetics, and methods of using such
biomimetics.
[0004] The invention also relates to the treatment and prophylaxis
of pathological conditions mediated by monocyte-derived cells, and
more particularly to the use of stabilized functional portions of
IgG Fc fragments for such treatment and prophylaxis.
Description of the Background Art
[0005] Immune globulin products from human plasma have been used
since the early 1950's to treat immune deficiency disorders and
more recently, and more commonly, for autoimmune and inflammatory
diseases.
[0006] Initially, immune globulin products were administered by
intramuscular injection. More recently, intravenous immune globulin
(IVIG) has been used and was initially shown to be effective in
treatment of the autoimmune disease idiopathic thrombocytopenic
purpura (ITP) (Imbach P, Barandun S, d'Apuzzo V, et al: High-dose
intravenous gammaglobulin for idiopathic thrombocytopenic purpura
in childhood. Lancet 1981 Jun. 6; 1(8232): 1228-31). Human IVIG
(referred to herein as "hIVIG") is a formulation of sterile,
purified immunoglobulin G (IgG) products manufactured from pooled
human plasma that typically contains more than 95% unmodified IgG,
with only small and variable amounts of immunoglobulin A (IgA) or
immunoglobulin M (IgM) (see, for example, Rutter A, Luger T A:
High-dose intravenous immunoglobulins: an approach to treat severe
immune-mediated and autoimmune diseases of the skin. J Am Acad
Dermatol 2001 June; 44(6): 1010-24). Today the single most common
clinical use of hIVIG is in the treatment of ITP.
[0007] While hIVIG has been an effective clinical treatment, there
are several shortcomings to hIVIG formulations, including the
potential for inadequate sterility, the presence of impurities,
lack of availability, and lot-to-lot variation. In particular hIVIG
preparations can vary greatly in their immunoglobulin A (IgA)
content which can be of concern because IgA can cause allergic and
anaphylactic reactions in IgA-deficient recipients.
[0008] In view of the negative aspects of hIVIG, there exists a
need for an improved means of treating autoimmune and inflammatory
diseases.
[0009] In addition, multiple pathological conditions of a wide
variety of types are mediated by cells derived from monocytes. A
simple therapeutic and/or prophylactic agent for use in many, if
not all, such conditions would be invaluable.
SUMMARY OF THE INVENTION
[0010] The immuno-regulatory properties of IVIG reside in the Fe
domain of IgG molecules. For example, in murine models of ITP, both
unmodified IVIG and the Fc fragment alone demonstrate therapeutic
efficacy in restoring platelet counts, while isolated IVIG Fab
fragments are not therapeutic (Samuelsson, A., Towers, T. L. &
Ravetch, J. V. Anti-inflammatory Activity of IVIG Mediated Through
the Inhibitory Fc Receptor. Science 291, 484-486 (2001)). Moreover
Fc, but not Fab fragments of IVIG, is also therapeutically
effective in the treatment of both childhood and adult idiopathic
thrombocytopenic purpura (Follea, G. et al. Intravenous
plasmin-treated gammaglobulin therapy in idiopathic
thrombocytopenic purpura. Nouv Rev Fr Hematol 27, 5-10 (1985);
Solal-Celigny, P., Bernard, J., Herrera, A. & Biovin, P.
Treatment of adult autoimmune thrombocytopenic purpura with
high-dose intravenous plasmin-cleaved gammaglobulins. Scand J
Haematol 31, 39-44 (1983); Debre, M. & Bonnet, M.-C. Infusion
of Gcgamma fragments for treatment of children with acute immune
thrombocytopenic purpura. Lancet 342, 945-49 (1993); Burdach, S.
E., Evers, K. & Geurson, R. Treatment of acute idiopathic
thrombocytopenic purpura of childhood with intravenous
immunoglobulin G: Comparative efficacy of 7S and 5S preparations. J
Pediatr 109, 770-775 (1986)).
[0011] The therapeutic effect of IVIG is initially mediated through
the Fc gamma receptor (Fc.gamma.R) and relies on Dendritic Cell
(DC)-macrophage cross-talk for its long term tolerogenic effects.
Fc.gamma.RIIIa plays a requisite role in the initiator phase and
Fc.gamma.RIIb is required for the effector phase in murine models
of ITP (Samuelsson, A., Towers, T. L. & Ravetch, J. V.
Anti-inflammatory Activity of IVIG Mediated Through the Inhibitory
Fc Receptor. Science 291, 484-486 (2001); Siragam, V. et al.
Intravenous immunoglobulin ameliorates ITP via activating Fc.gamma.
receptors on dendritic cells. Nat Med 12, 688 (2006)). Similarly,
human studies demonstrate that anti-Fc.gamma. receptor antibodies
are effective in the treatment of refractory ITP (Clarkson, S. et
al. Treatment of refractory immune thrombocytopenic purpura with an
anti-Fc gamma-receptor antibody. N Engl J Med 314, 1236-1239
(1986)). Importantly, long term tolerogenic effects are mediated by
cell-cell interactions, as adoptive transfer of IVIG-treated DCs is
effective in treating murine models of ITP (Siragam, V. et al.
Intravenous immunoglobulin ameliorates ITP via activating Fc.gamma.
receptors on dendritic cells. Nat Med 12, 688 (2006)).
[0012] The immunomodulatory effects of IVIG require aggregation of
the Fc.gamma.R. Aggregation of Fc.gamma.R is mediated by IgG dimers
present in IVIG (5-15% of the total IVIG) (Bleeker, W. K. et al.
Vasoactive side effects of intravenous immunoglobulin preparations
in a rat model and their treatment with recombinant
platelet-activating factor acetylhydrolase. Blood 95, 1856-1861
(2000)). For example, in a murine model of ITP, treatment with IVIG
with a high content of "dimers" (dimers of whole immunoglobulin
molecules) enhanced platelet counts while IVIG "monomers" (whole
immunoglobulin molecules) were not effective (Teeling, J. L. et al.
Therapeutic efficacy of intravenous immunoglobulin preparations
depends on the immunoglobulin G dimers: studies in experimental
immune thrombocytopenia. Blood 98, 1095-1099 (2001)). Furthermore,
despite the fact that ion exchange resin and polyethylene glycol
fractionation are routinely used in the manufacture of IVIG to
remove IgG aggregates, the clinical efficacy of IVIG correlates
with the presence of dimers in the patient's sera (Augener, W.,
Friedman, B. & Brittinger, G. Are aggregates of IgG the
effective part of high-dose immunoglobulin therapy in adult
idiopathic thrombocytopenic purpura (ITP)? Blut 50, 249-252
(1985)). Importantly, the percentage of dimers also correlates with
vasoactive side effects, which are treatable with acetylhydrolase
(Bleeker, W. K. et al. Vasoactive side effects of intravenous
immunoglobulin preparations in a rat model and their treatment with
recombinant platelet-activating factor acetylhydrolase. Blood 95,
1856-1861 (2000)).
[0013] The present invention relates to biologically active
biomimetic molecules, compositions comprising the same, and methods
of using the same. These biomimetics have broad application for
treating immunological and inflammatory disorders including but not
limited to autoimmune diseases, and they have utility as
bioimmunotherapy agents for cancer. Further, certain of these
biomimetics also have utility as reagents, such as for use in
immunological assays for testing immune cell function and in the
diagnosis of disease. Moreover, the biomimetics and compositions of
the present invention have the advantage of overcoming the
above-listed limitations of hIVIG. The invention also relates to
the treatment and prophylaxis of pathological conditions mediated
by monocyte-derived cells, and more particularly to the use of
stabilized functional portions of IgG Fc fragments for such
treatment and prophylaxis.
[0014] In a first embodiment the present invention is directed to
isolated serial stradomers comprising two or more associated
stradomer monomers, wherein each of the stradomer monomers
comprises two or more Fc domain monomers, wherein the association
of the two or more stradomer monomers forms two or more Fc domains,
and wherein the serial stradomer specifically binds to a first
Fc.gamma. receptor through a first of the two or more Fc domains
and to a second Fc.gamma. receptor through a second of the two or
more Fc domains. In a preferred embodiment, the two or more
stradomer monomers are associated through a covalent bond, a
disulfide bond or chemical cross-linking.
[0015] In a preferred embodiment of the isolated serial stradomers
of the present invention, the isolated serial stradomers are
comprised of two associated stradomer monomers. In an equally
preferred embodiment, the isolated serial stradomers are comprised
of two associated stradomer monomers wherein both of the stradomer
monomers comprise two Fc domain monomers, and wherein the
association of the two stradomer monomers forms two Fc domains. In
a first particular example of these embodiments directed to
isolated serial stradomers, at least one of the two Fc domains
comprises an IgG hinge and an IgG CH2 domain. In a second
particular example each of the two Fc domains independently
comprises an IgG hinge and an IgG CH2 domain. In a third particular
example at least one of the two Fc domains comprises an IgG hinge,
an IgG CH2 domain and an IgG CH3 domain. In a fourth particular
example each of the two Fc domains independently comprises an IgG
hinge, an IgG CH2 domain and an IgG CH3 domain. In a fifth
particular example at least one of the two Fc domains comprises an
IgG1 hinge or an IgG3 hinge, an IgG1 CH2 domain or an IgG3 CH2
domain, and an IgG1 CH3 domain or an IgG3 CH3 domain. In a sixth
particular example at least one of the two Fc domains comprises an
IgG1 hinge or an IgG3 hinge, and an IgG1 CH2 domain or an IgG3 CH2
domain. In a seventh particular example each of the two Fc domains
independently comprises an IgG1 hinge or an IgG3 hinge, an IgG1 CH2
domain or an IgG3 CH2 domain, and an IgG1 CH3 domain or an IgG3 CH3
domain. In an eighth particular example each of the two Fc domains
independently comprises an IgG1 hinge, an IgG1 CH2 domain, and an
IgG1 CH3 domain. In a ninth particular example each of the two Fc
domains independently comprises an IgG3 hinge, an IgG3 CH2 domain,
and an IgG3 CH3 domain. In a tenth particular example each of the
two Fc domains independently comprises an IgG1 hinge, an IgG1 CH2
domain, and an IgG3 CH3 domain.
[0016] Also in this first embodiment, the two or more Fe domains
are each of a same immunoglobulin Fc class, and the immunoglobulin
Fc class is selected from the group consisting of IgG1, IgG2, IgG3,
and IgG4. Alternatively, the two or more Fc domains are each of a
different immunoglobulin Fc class, and said immunoglobulin Fc class
is selected from the group consisting of IgG1, IgG2, IgG3 and
IgG4.
[0017] Further in this first embodiment, the first and second
Fc.gamma. receptors are each independently an Fc.gamma. receptor I,
an Fc.gamma. receptor II, an Fc.gamma. receptor III or an Fc.gamma.
receptor IV. Preferably the first and second Fc.gamma. receptors
are each Fc.gamma. receptor IIIa.
[0018] In a second embodiment the present invention is directed to
isolated serial stradomers comprising two associated stradomer
monomers, wherein each of the stradomer monomers comprises two Fc
domain monomers, wherein the association of the two stradomer
monomers forms two Fc domains, wherein each of said two Fc domains
independently comprises an IgG hinge, an IgG CH2 domain and an IgG
CH3 domain, and wherein the serial stradomer specifically binds to
a first Fc.gamma. receptor through a first of the two Fc domains
and to a second Fc.gamma. receptor through a second of the two Fc
domains. In a preferred embodiment, the two or more stradomer
monomers are associated through a covalent bond, a disulfide bond
or chemical cross-linking.
[0019] In a first particular example of this second embodiment the
two Fc domains are each of a same immunoglobulin Fc class, and the
immunoglobulin Fc class is selected from the group consisting of
IgG1, IgG2, IgG3, and IgG4. In a second particular example the two
Fc domains are each of a different immunoglobulin Fc class, and
said immunoglobulin Fc class is selected from the group consisting
of IgG1, IgG2, IgG3 and IgG4. In a third particular example at
least one of the Fc domains comprises an IgG hinge and an IgG CH2
domain. In a fourth particular example each of the Fc domains
independently comprises an IgG hinge and an IgG CH2 domain. In a
fifth particular example at least one of the Fc domains comprises
an IgG hinge, an IgG CH2 domain and an IgG CH3 domain. In a sixth
particular example each of the Fc domains independently comprises
an IgG hinge, an IgG CH2 domain and an IgG CH3 domain. In a seventh
particular example at least one of the Fc domains comprises an IgG1
hinge or an IgG3 hinge, an IgG1 CH2 domain or an IgG3 CH2 domain,
and an IgG1 CH3 domain or an IgG3 CH3 domain. In an eighth
particular example each of the Fc domains independently comprises
an IgG1 hinge or an IgG3 hinge, an IgG1 CH2 domain or an IgG3 CH2
domain, and an IgG1 CH3 domain or an IgG3 CH3 domain. In a ninth
particular example each of the Fc domains independently comprises
an IgG1 hinge, an IgG1 CH2 domain, and an IgG1 CH3 domain. In a
tenth particular example each of the Fc domains independently
comprises an IgG3 hinge, an IgG3 CH2 domain, and an IgG3 CH3
domain. In an eleventh particular example each of the Fc domains
independently comprises an IgG1 hinge, an IgG1 CH2 domain, and an
IgG3 CH3 domain.
[0020] In a third embodiment the present invention is directed to
isolated serial stradomers further comprising a Fab domain, wherein
each of the stradomer monomers comprises an Fab fragment heavy
chain and two Fc domain monomers, wherein the Fab fragment heavy
chain is in a position amino terminal or carboxy terminal to the
two Fc domain monomers, wherein an Fab fragment light chain is
independently associated with each Fab fragment heavy chain, and
wherein the Fab domain has antigen-binding activity. In a preferred
embodiment, each of the stradomer monomers further comprises an
immunoglobulin hinge monomer, and wherein the immunoglobulin hinge
monomer is in a position between the Fab fragment heavy chain and
the two Fc domain monomers.
[0021] In a fourth embodiment the present invention is directed to
core stradomers comprising a core moiety linked to two or more core
stradomer units, wherein each of the two or more core stradomer
units comprises at least one Fc domain, and wherein each of the
core stradomer units is independently selected from the group
consisting of.
[0022] (a) an Fc fragment, wherein said Fc fragment comprises two
associated Fc fragment monomers, wherein each of said Fc fragment
monomers comprises an Fc domain monomer, and wherein the
association of the two Fc fragment monomers forms an Fc domain,
[0023] (b) an Fc partial fragment, wherein said Fc partial fragment
comprises two associated Fc partial fragment monomers, wherein each
of said Fc partial fragment monomers comprises an Fc domain
monomer, and wherein the association of the two Fc partial fragment
monomers forms an Fe domain,
[0024] (c) an Fc domain, wherein said Fc domain comprises two
associated Fc domain monomers, and wherein the association of the
two Fc domain monomers forms an Fc domain,
[0025] (d) a serial stradomer, wherein said serial stradomer
comprises two or more associated stradomer monomers, wherein each
of said stradomer monomers comprises two or more Fe domain
monomers, and wherein the association of the two or more stradomer
monomers forms two or more Fc domains, and
[0026] (e) a cluster stradomer, wherein said cluster stradomer
comprises two or more multimerized cluster stradomer units, wherein
each of said cluster stradomer units comprises a multimerizing
region and at least one Fc domain, wherein each of said cluster
stradomer units comprises two associated cluster stradomer unit
monomers, wherein each of said cluster stradomer unit monomers
comprises a multimerizing region monomer and at least one Fc domain
monomer, wherein the association of the two cluster stradomer unit
monomers forms a multimerizing region and at least one Fc domain,
and wherein the multimerizing regions of the two or more cluster
stradomer units multimerize to form the cluster stradomer, and
wherein the core stradomer specifically binds to a first Fc.gamma.
receptor through a first of the two or more core stradomer units
and to a second Fc.gamma. receptor through a second of the two or
more core stradomer units.
[0027] Preferably in this fourth embodiment, the core moiety is
selected from the group consisting of an immunoglobulin J chain,
albumin, liposome, bead, peptide and polyethylene glycol.
[0028] In preferred embodiments directed to core stradomers the two
or more core stradomer units are each independently an Fc fragment.
Alternatively, the two or more core stradomer units are each
independently a serial stradomer.
[0029] In a further preferred embodiment directed to core
stradomers the core stradomer comprises two core stradomer units,
wherein each of the two core stradomer units is each independently
a serial stradomer, wherein the serial stradomer comprises two
associated stradomer monomers, wherein both of said stradomer
monomers comprises two Fc domain monomers, and wherein the
association of the two stradomer monomers forms two Fc domains. In
a first particular example of this embodiment, at least one of the
Fc domains of the two or more core stradomer units comprises an
IgG1 hinge or an IgG3 hinge, an IgG1 CH2 domain or an IgG3 CH2
domain, and an IgG1 CH3 domain or an IgG3 CH3 domain. In a second
particular example at least one of the Fc domains of the two or
more two core stradomer units comprises an IgG1 hinge or an IgG3
hinge, and an IgG1 CH2 domain. In a third particular example each
of the Fe domains of the two or more two core stradomer units
independently comprises an IgG1 hinge, an IgG1 CH2 domain, and an
IgG1 CH3 domain. In a fourth particular example at least one of the
Fe domains of the two or more two core stradomer units comprises an
IgG hinge and an IgG CH2 domain. In a fifth particular example each
of the Fc domains of the two or more two core stradomer units
independently comprises an IgG hinge and an IgG CH2 domain. In a
sixth particular example each of the Fc domains of the two or more
two core stradomer units independently comprises an IgG3 hinge, an
IgG3 CH2 domain, and an IgG3 CH3 domain. In a seventh particular
example each of the Fc domains of the two or more two core
stradomer units independently comprises an IgG1 hinge, an IgG1 CH2
domain, and an IgG3 CH3 domain.
[0030] In this embodiment, the first and second Fc.gamma. receptors
are each independently an Fc.gamma. receptor I, an Fc.gamma.
receptor II, an Fc.gamma. receptor III or an Fc.gamma. receptor IV.
Preferably, the first and second Fc.gamma. receptors are each
Fc.gamma. receptor IIIa.
[0031] In a fifth embodiment the present invention is directed to
cluster stradomers comprising two or more multimerized cluster
stradomer units, wherein each of the cluster stradomer units
comprises a multimerizing region and at least one Fc domain,
wherein each of the cluster stradomer units comprises two
associated cluster stradomer unit monomers, wherein each of the
cluster stradomer unit monomers comprises a multimerizing region
monomer and at least one Fc domain monomer, wherein the association
of the two cluster stradomer unit monomers forms a multimerizing
region and at least one Fc domain, wherein the multimerizing
regions of the two or more cluster stradomer units multimerize to
form the cluster stradomer, and wherein the cluster stradomer
specifically binds to a first Fc.gamma. receptor through a first Fc
domain and to a second Fc.gamma. receptor through a second Fc
domain.
[0032] In preferred embodiments, the multimerizing region is
selected from the group consisting of an IgG2 hinge, an IgE CH2
domain, a leucine, an isoleucine zipper and a zinc finger.
[0033] In further preferred embodiment, the cluster stradomers
comprising two, three, four or five multimerized cluster stradomer
units.
[0034] In a first particular example of this fifth embodiment at
least one of the Fc domains comprises an IgG1 hinge or an IgG3
hinge, an IgG1 CH2 domain or an IgG3 CH2 domain, and an IgG1 CH3
domain or an IgG3 CH3 domain. In a second particular example each
of the Fc domains independently comprises an IgG1 hinge, an IgG1
CH2 domain, and an IgG1 CH3 domain. In a third particular example
at least one of the Fc domains comprises an IgG hinge and an IgG
CH2 domain. In a fourth particular example each of the Fc domains
independently comprises an IgG hinge and an IgG CH2 domain. In a
fifth particular example each of the Fc domains independently
comprises an IgG3 hinge, an IgG3 CH2 domain, and an IgG3 CH3
domain. In a sixth particular example each of the Fc domains
independently comprises an IgG1 hinge, an IgG1 CH2 domain, and an
IgG3 CH3 domain. In a seventh particular example each of the Fc
domains independently comprises an IgG hinge, an IgG CH2 domain and
an IgG CH3 domain. In an eighth particular example at least one of
the cluster stradomer units comprises two or more Fc domains. In a
ninth particular example each of the cluster stradomer units
comprises two or more Fc domains.
[0035] In this embodiment, the first and second Fc.gamma. receptors
are each independently an Fc.gamma. receptor I, an Fc.gamma.
receptor II, an Fc.gamma. receptor III or an Fc.gamma. receptor IV.
Preferably, the first and second Fc.gamma. receptors are each
Fc.gamma. receptor IIIa.
[0036] In a sixth embodiment the present invention is directed to
stradobodies comprising two or more associated stradomer monomers
and an Fab domain, wherein each of the stradomer monomers comprises
an Fab fragment heavy chain and two or more Fc domain monomers,
wherein the Fab fragment heavy chain is in a position amino
terminal or carboxy terminal to the two or more Fc domain monomers,
wherein the association of the two or more stradomer monomers forms
two or more Fc domains, wherein an Fab fragment light chain is
independently associated with the Fab fragment heavy chain of each
stradomer monomer, wherein the Fab domain has antigen-binding
activity, and wherein the stradobody specifically binds to a first
Fc.gamma. receptor through a first of the two or more Fc domains
and to a second Fc.gamma. receptor through a second of the two or
more Fc domains.
[0037] In preferred embodiments the two or more stradomer monomers
are associated through a covalent bond, a disulfide bond or
chemical cross-linking.
[0038] In a further preferred embodiment, each of said stradomer
monomers of the stradobodies further comprises an immunoglobulin
hinge monomer, and wherein the immunoglobulin hinge monomer is in a
position between the Fab fragment heavy chain and the two Fe domain
monomers.
[0039] In a particular embodiment the stradobody comprises two
associated stradomer monomers, wherein each of said stradomer
monomers comprises an Fab fragment heavy chain and two Fc domain
monomers, and wherein the association of the two stradomer monomers
forms two Fc domains. In a first particular example of this
embodiment, at least one of the two Fc domains comprises an IgG
hinge, an IgG CH2 domain and an IgG CH3 domain. In a second
particular example each of the two Fc domains independently
comprises an IgG hinge, an IgG CH2 domain and an IgG CH3 domain. In
a third particular example at least one of the two Fc domains
comprises an IgG hinge and an IgG CH3 domain. In a fourth
particular example each of the Fc two domains independently
comprises an IgG hinge and an IgG CH3 domain. In a fifth particular
example at least one of the two Fc domains comprises an IgG1 hinge
or an IgG3 hinge, an IgG1 CH2 domain or an IgG3 CH2 domain, and an
IgG1 CH3 domain or an IgG3 CH3 domain. In a sixth particular
example each of the two Fc domains independently comprises an IgG1
hinge or an IgG3 hinge, an IgG1 CH2 domain or an IgG3 CH2 domain,
and an IgG1 CH3 domain or an IgG3 CH3 domain. In a seventh
particular example each of the two Fc domains independently
comprises an IgG1 hinge, an IgG1 CH2 domain, and an IgG1 CH3
domain. In an eighth particular example each of the two Fc domains
independently comprises an IgG3 hinge, an IgG3 CH2 domain, and an
IgG3 CH3 domain. In a ninth particular example each of the two Fc
domains independently comprises an IgG1 hinge, an IgG1 CH2 domain,
and an IgG3 CH3 domain. In a tenth particular example at least one
of the two Fc domains comprises an IgG1 hinge or an IgG3 hinge, and
an IgG1 CH2 domain or an IgG3 CH2 domain. In an eleventh particular
example at least one of the two Fe domains comprises an IgG1 hinge
or an IgG3 hinge, and an IgG1 CH2 domain.
[0040] In this embodiment, the first and second Fc.gamma. receptors
are each independently an Fc.gamma. receptor I, an Fc.gamma.
receptor II, an Fc.gamma. receptor III or an Fc.gamma. receptor IV.
Preferably, the first and second Fc.gamma. receptors are each
Fc.gamma. receptor IIIa.
[0041] In a seventh embodiment the present invention is directed to
methods of altering an immune response in a subject comprising
administering to a subject in need thereof a pharmaceutical
composition comprising a therapeutically effective amount of a
serial stradomer and a carrier or diluent. In a preferred
embodiment, the pharmaceutical composition comprises a
therapeutically effective amount of a heterogeneous mixture of
serial stradomers and a carrier or diluent.
[0042] In an eighth embodiment the present invention is directed to
methods of altering an immune response in a subject comprising
administering to a subject in need thereof a pharmaceutical
composition comprising a therapeutically effective amount of a core
stradomer and a carrier or diluent. In a preferred embodiment, the
pharmaceutical composition comprises a therapeutically effective
amount of a heterogeneous mixture of core stradomers and a carrier
or diluent.
[0043] In a ninth embodiment the present invention is directed to
methods of altering an immune response in a subject comprising
administering to a subject in need thereof a pharmaceutical
composition comprising a therapeutically effective amount of a
cluster stradomer and a carrier or diluent. In a preferred
embodiment, the pharmaceutical composition comprises a
therapeutically effective amount of a heterogeneous mixture of
cluster stradomers and a carrier or diluent.
[0044] In a tenth embodiment the present invention is directed to
methods of altering an immune response in a subject comprising
administering to a subject in need thereof a pharmaceutical
composition comprising a therapeutically effective amount of a
stradobody and a carrier or diluent. In a preferred embodiment, the
pharmaceutical composition comprises a therapeutically effective
amount of a heterogeneous mixture of stradobodies and a carrier or
diluent.
[0045] In an eleventh embodiment the present invention is directed
to methods of screening an antibody for a specific activity on a
cell of the immune system, comprising: (a) contacting a homogenous
population of cells of the immune system with a candidate antibody,
(b) measuring an activity of the population of cells of (a), (c)
contacting a homogenous population of cells of the same cell type
as in (a) with a serial stradomer of claim 1, (d) measuring an
activity of the population of cells of (c), and (e) comparing the
activity measured in (b) with the activity measured in (d), thereby
screening an antibody for a specific activity on a cell of the
immune system. In a preferred embodiment, the candidate antibody
and the serial stradomer are species-matched and isotype-matched.
In a further preferred embodiment, the comparison in (e) is a ratio
of activity measured in (d) versus the activity measured in
(b).
[0046] In a twelfth embodiment the present invention is directed
methods of inhibiting the activity of a monocyte-derived cell
(MDC). The method involves contacting the cell with a composition
containing a substrate with an Fc reagent bound to it. The
contacting can be in vitro, in vivo, or ex vivo. The cell can be in
an animal, e.g., an animal that has or is at risk of developing a
monocyte derived cell mediated condition (MDCMC). The cell can be,
for example, a dendritic cell, a macrophage, a monocyte, or an
osteoclast.
[0047] In a thirteenth embodiment the present invention is directed
methods of treatment that includes administering to an animal a
composition comprising a substrate having an Fc reagent bound
thereto, the animal having or being at risk of developing a
monocyte-derived cell mediated condition (MDCMC).
[0048] The following are embodiments common to both these two
methods (the twelfth and thirteenth embodiments).
[0049] The animal can be, for example, a human.
[0050] The Fc reagent can contain or be a functional portion of a
human Fc fragment, e.g., a human IgG1 Fc fragment, a human IgG3 Fc
fragment, a human IgG2, or a human IgG4 Fc fragment. Moreover it
can include or be an IgG molecule. The Fc reagent can also be or
include a functional portion of a non-human Fc fragment.
[0051] The substrate can be or include a synthetic polymer, e.g.,
nylon, teflon, dacron, polyvinyl chloride, PEU (poly (ester
urethane)), PTFE (polytetrafluoroethylene), or PMMA (methyl
methacrylate). The substrate can include or be a metal or a metal
alloy, e.g., stainless steel, platinum, iridium, titanium,
tantalum, a nickel-titanium alloy, or a cobalt-chromium alloy. The
substrate can contain or be animal tissue or an animal tissue
product, e.g., a tissue or organ graft, bone (e.g., osteogenic
bone), or cartilage. The substrate can contain or be a protein,
e.g., collagen or keratin. The substrate can also be or contain a
polysaccharide, e.g., agarose. Moreover, the substrate can contain
or be a tissue matrix, e.g., an acellular tissue matrix. The
substrate can contain or be an animal cell (e.g., a tissue repair
cell such as a fibroblasts or a mesenchymal stem cell). The
substrate can contain or be a salt, e.g., calcium sulfate.
Furthermore the substrate can be or contain a gel or cream. It can
also contain or be silicon or silastic. It can also contain be a
natural fiber, e.g., silk, cotton, or wool.
[0052] The substrate can be a hair transplant plug or an
implantable medical device such as a stent (e.g., a vascular stent
such as a coronary artery stent; an airway stent such as an
endotracheal or nasal stent; a gastrointestinal stent such a
biliary or pancreatic stent; or a urinary stent such as a ureteral
stent). It can also be a surgical suture (e.g., a braid silk,
chromic gut, nylon, plastic, or metal suture or a surgical clip
(e.g., an aneurism clip)). In addition, the substrate can be an
artificial hip, an artificial hip joint, an artificial knee, an
artificial knee joint, an artificial shoulder, an artificial
shoulder joint, an artificial finger or toe joint, a bone plate, a
bone dowel, a bone non-union implant, an intervertebral disk
implant, bone cement, or a bone cement spacer. It can be an
arterial-venous shunt, an implantable wire, a pacemaker, an
artificial heart, a heart assist device, a cochlear implant, an
implantable defibrillator, a spinal cord stimulator, a central
nervous system stimulator, a peripheral nerve implant, a dental
prosthesis, or a dental crown. Furthermore, the substrate can be a
large vessel embolic filtering device or cage, a percutaneous
device, a dermal or sub-mucosal patch, or an implantable drug
delivery device.
[0053] The substrate can also be a large blood vessel graft,
wherein the blood vessel is, for example, a carotid artery, a
femoral artery, or an aorta. It can also be a sub-dermal implant, a
corneal implant, an intraocular lens, or a contact lens.
[0054] The substrate can be in the form of, e.g., a sheet, a bead,
a mesh, a powder particle, a thread, a bead, or a fiber. The
substrate can contain or be a solid, a semi-solid, or a gelatinous
substance. Thus, a substrate includes substances that are
substantially insoluble in aqueous solvents, e.g., a fat-soluble
lipid such as a liposome.
[0055] The MDCMC can be an inflammatory condition, an autoimmune
disease, a cancer, a disorder of bone density, an acute infection,
or a chronic infection.
[0056] It can be a hematoimmunological process, e.g., Idiopathic
Thrombocytopenic Purpura, alloimmune/autoimmune thrombocytopenia,
Acquired immune thrombocytopenia, Autoimmune neutropenia,
Autoimmune hemolytic anemia, Parvovirus B 19-associated red cell
aplasia, Acquired antifactor VIII autoimmunity, acquired von
Willebrand disease, Multiple Myeloma and Monoclonal Gammopathy of
Unknown Significance, Sepsis, Aplastic anemia, pure red cell
aplasia, Diamond-Blackfan anemia, hemolytic disease of the newborn,
Immune-mediated neutropenia, refractoriness to platelet
transfusion, neonatal post-transfusion purpura, hemolytic uremic
syndrome, systemic Vasculitis, Thrombotic thrombocytopenic purpura,
or Evan's syndrome.
[0057] Alternatively, the MDCMC can be a neuroimmunological
process, e.g., Guillain-Barre syndrome, Chronic Inflammatory
Demyelinating Polyradiculoneuropathy, Paraproteinemic IgM
demyelinating Polyneuropathy, Lambert-Eaton myasthenic syndrome,
Myasthenia gravis, Multifocal Motor Neuropathy, Lower Motor Neuron
Syndrome associated with anti-GM1 antibodies, Demyelination,
Multiple Sclerosis and optic neuritis, Stiff Man Syndrome,
Paraneoplastic cerebellar degeneration with anti-Yo antibodies,
paraneoplastic encephalomyelitis, sensory neuropathy with anti-Hu
antibodies, epilepsy, Encephalitis, Myelitis, Myelopathy especially
associated with Human T-cell lymphotropic virus-1, Autoimmune
Diabetic Neuropathy, or Acute Idiopathic Dysautonomic
Neuropathy.
[0058] The MDCMC can be a Rheumatic disease process, e.g.,
Kawasaki's disease, Rheumatoid arthritis, Felty's syndrome,
ANCA-positive Vasculitis, Spontaneous Polymyositis,
Dermatomyositis, Antiphospholipid syndromes, Recurrent spontaneous
abortions, Systemic Lupus Erythematosus, Juvenile idiopathic
arthritis, Raynaud's, CREST syndrome, or Uveitis.
[0059] Moreover, the MDCMC can be a dermatoimmunological disease
process, e.g., Epidermal Necrolysis, Gangrene, Granuloma,
Autoimmune skin blistering diseases including Pemphigus vulgaris,
Bullous Pemphigoid, and Pemphigus foliaceus, Vitiligo,
Streptococcal toxic shock syndrome, Scleroderma, systemic sclerosis
including diffuse and limited cutaneous systemic sclerosis, Atopic
dermatitis, or steroid dependent Atopic dermatitis.
[0060] In addition, the MDCMC can be a musculoskeletal
immunological disease, e.g., Inclusion Body Myositis, Necrotizing
fasciitis, Inflammatory Myopathies, Myositis, Anti-Decorin (BJ
antigen) Myopathy, Paraneoplastic Necrotic Myopathy, X-linked
Vacuolated Myopathy, Penacillamine-induced Polymyositis,
Atherosclerosis, Coronary Artery Disease, or Cardiomyopathy.
[0061] The MDCMC can also be a gastrointestinal immunological
disease process, e.g., pernicious anemia, autoimmune chronic active
hepatitis, primary biliary cirrhosis, Celiac disease, dermatitis
herpetiformis, cryptogenic cirrhosis, Reactive arthritis, Crohn's
disease, Whipple's disease, ulcerative colitis, or sclerosing
cholangitis.
[0062] The MDCMC can be, for example, Graft Versus Host Disease,
Antibody-mediated rejection of the graft, Post-bone marrow
transplant rejection, Post-infectious disease inflammation,
Lymphoma, Leukemia, Neoplasia, Asthma, Type 1 Diabetes mellitus
with anti-beta cell antibodies, Sjogren's syndrome, Mixed
Connective Tissue Disease, Addison's disease, Vogt-Koyanagi-Harada
Syndrome, Membranoproliferative glomerulonephritis, Goodpasture's
syndrome, Graves' disease, Hashimoto's thyroiditis, Wegener's
granulomatosis, micropolyarterits, Churg-Strauss syndrome,
Polyarteritis nodosa or Multisystem organ failure.
[0063] Where the MDCMC is a cancer, it can be fibrosarcoma,
myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma,
chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma,
lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's
tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma,
pancreatic cancer, breast cancer, ovarian cancer, prostate cancer,
squamous cell carcinoma, basal cell carcinoma, adenocarcinoma,
sweat gland carcinoma, sebaceous gland carcinoma, papillary
carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary
carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma,
bile duct carcinoma, choriocarcinoma, seminoma, embryonal
carcinoma, Wilms' tumor, cervical cancer, testicular tumor, lung
carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial
carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma,
ependymoma, pinealoma, hemangioblastoma, acoustic neuroma,
oligodendroglioma, meningioma, melanoma, neuroblastoma,
retinoblastoma, leukemia, lymphoma, multiple myeloma, Waldenstrom's
macroglobulinemia, myelodysplastic disease, heavy chain disease,
neuroendocrine tumors, or Schwanoma.
[0064] Where the MDCMC is a disorder of bone density, it can be
osteoporosis, osteopenia, osteopetrosis, idiopathic
hypogonadotropic hypogonadism, anorexia nervosa, non-healing
fracture, post-menopausal osteoporosis, Vitamin D deficiency or
excess, primary or secondary hyperparathyroidism, thyroid disease,
or bisphosphonate toxicity.
[0065] Where the MDCMC is an acute infection, it can be: a fungal
disorder including Candidiasis, Candidemia, or Aspergillosis; a
bacterial disorder, including Staphylococcus including Methicillin
Resistant Staph aureus, streptococcal skin and oropharyngeal
conditions, or gram negative sepsis; a mycobacterial infection
including tuberculosis; a viral infection including mononucleosis,
Respiratory Syntitial virus infection, or Herpes zoster infection;
a parasitic infection including malaria, schistosomiasis, or
trypanosomiasis.
[0066] Where the MDCMC is a chronic infection, it can be
onchyomycosis; a bacterial disorder including Helicobacter pylori;
a mycobacterial infection including tuberculosis; a viral infection
including Epstein Barr virus infection, Human Papilloma Virus
infection, or Herpes Simplex Virus infection; or a parasitic
infection including malaria or schistosomiasis.
[0067] In a fourteenth embodiment the present invention is directed
a composition that contains or is an implantable or attachable
medical device and an Fc reagent bound thereto.
[0068] In a fifteenth embodiment the present invention is directed
a kit that contains an implantable or attachable medical device and
an Fc reagent. In both these embodiments, the implantable or
attachable medical device and the Fc reagent can be any of those
recited herein. The kit can further contain a suitable
container.
[0069] Additional advantages and features of the present invention
will be apparent from the following detailed description, drawings
and examples, which illustrate preferred embodiments of the
invention.
[0070] The foregoing has outlined rather broadly the features and
technical advantages of the present invention in order that the
detailed description of the invention that follows may be better
understood. Additional features and advantages of the invention
will be described hereinafter which form the subject of the claims
of the invention. It should be appreciated by those skilled in the
art that the conception and specific embodiment disclosed may be
readily utilized as a basis for modifying or designing other
structures for carrying out the same purposes of the present
invention. It should also be realized by those skilled in the art
that such equivalent constructions do not depart from the spirit
and scope of the invention as set forth in the appended claims. The
novel features which are believed to be characteristic of the
invention, both as to its organization and method of operation,
together with further objects and advantages will be better
understood from the following description when considered in
connection with the accompanying figures. It is to be expressly
understood, however, that each of the figures is provided for the
purpose of illustration and description only and is not intended as
a definition of the limits of the present invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0071] FIG. 1A shows in schematic form a native Fc fragment monomer
structure from IgG1 having a Hinge domain linked to a CH2 domain
linked to a CH3 domain; FIG. 1B shows a self-aggregated, native
IgG1 Fc fragment formed from two associated Fc fragment
monomers.
[0072] FIG. 1C shows in schematic form a native Fc fragment monomer
structure from IgG3 having a Hinge domain linked to a CH2 domain
linked to a CH3 domain; FIG. 1D shows a self-aggregated, native
IgG3 Fc fragment formed from two associated Fc fragment
monomers.
[0073] FIGS. 2A and 2B show higher order aggregates of the native
Fc fragment structure shown in FIG. 1B. Fc fragments may naturally
multimerize into dimers of dimer (i.e. tetramers) or even higher
order multimer aggregates.
[0074] FIG. 3A shows a schematic of a native IgG1 antibody having a
native Fab fragment linked to the Fc fragment at the hinge of the
Fc fragment; FIG. 3B shows the analogous IgG3 structure.
[0075] FIG. 4A shows a stradomer monomer composed of two IgG1 Fc
domain monomers in series; FIG. 4B shows an alternative stradomer
monomer structure having linked in series IgG1 Fc-IgG3 Fc-IgE
Fc.
[0076] FIG. 5A and FIG. 5B show the stradomer monomers of FIG. 4A
and FIG. 4B autodimerizing into a serial stradomer due to the
intrinsic capacity of the component Fc domain monomers.
[0077] FIG. 6A shows a stradomer monomer containing IgG1 Fc-IgG1
(hinge-CH2);
[0078] FIG. 6B shows a stradomer containing IgG1 (hinge-CH2)-IgG3
(hinge-CH2)-IgE (hinge-CH2) derived sequences.
[0079] FIG. 7A and FIG. 7B show the stradomer monomers of FIG. 6A
and FIG. 6B autodimerizing into a serial stradomer due to the
intrinsic capacity of the component Fc domains.
[0080] FIG. 7C shows a serial stradomer containing IgE(hinge)-IgG1
Fc-IgG1 (hinge-CH2)-IgE (CH3). FIG. 7D shows a serial stradomer
containing an IgG3Fc-IgG1Fc.
[0081] FIG. 8A shows a stradobody construct containing a Fab with a
serial stradomer structure with each stradomer monomer containing
two IgG1 CH2-CH3 derived Fc domain monomers; FIG. 8B shows a
stradobody construct as in FIG. 8A but with a stradomer structure
containing an IgG1 Fc linked to an IgG3 Fc linked to an IgE Fc.
[0082] FIG. 9A shows an IgG1 Fe-IgG1 (hinge-CH2) stradobody; FIG.
9B shows IgG1 (hinge-CH2)-IgG3 (hinge-CH2)-IgE (hinge-CH2)
3-stradobody.
[0083] FIG. 10A shows an IgG1 (hinge-CH2)-IgG3 CH3-IgM CH4
stradomer monomer and a J chain protein; FIG. 10B shows a core
stradomer based on a fivemer of the stradomer of FIG. 10A formed by
association through the IgM CH4 domain to a J chain.
[0084] FIG. 10C shows an IgG1 Fe-IgG1 Fe-IgM CH4 stradomer monomer
and a J chain protein; FIG. 10D shows a core stradomer based on a
fivemer of the stradomer of FIG. 10C formed by association through
the IgM CH4 domain to a J chain.
[0085] FIG. 11A shows an IgG1 Fe-IgG1 (hinge-CH2) stradomer
monomer. FIG. 11B demonstrates how the stradomer monomer in FIG.
11A can autodimerize to form a serial stradomer. FIG. 11C
demonstrates how the same stradomer monomer in FIG. 11A can have
monomer Fe domains align with the same or similar Fe domain
monomers on another stradomer monomer but not as an autodimer,
thereby forming a stradomer composed of the same stradomer monomer
as the autodimer but with a zipper effect structure.
[0086] FIG. 12A shows an IgG3 Fe-IgG1 Fc stradomer monomer. FIG.
12B shows that the addition of a second IgG3 Fc followed by
autodimerization can form a branched structured IgG3 Fe-IgG1
Fe-IgG3 Fc stradomer.
[0087] FIG. 13A shows an IgE CH2-IgG1 Fe-IgG1 (hinge-CH2)-IgE CH4
stradomer monomer. FIG. 13B shows the autodimer of the FIG. 13A
monomer and highlights two Fc.gamma.R binding sites formed.
[0088] FIG. 14A shows a stradomer composed of two IgG1 Fe domains
joined by a linker. FIG. 14B shows a stradomer composed of two
serial stradomers (specifically in each case a 2(IgG1 Fc)
stradomer) joined by a linker.
[0089] FIG. 15A shows the nucleic acid (SEQ ID NO: 1) and amino
acid (SEQ ID NO: 2) sequences of the human IgG1 Fc fragment. FIG.
15B shows the nucleic acid (SEQ ID NO: 3) and amino acid (SEQ ID
NO: 4) sequences of the human IgG2 Fc fragment. FIG. 15C shows the
nucleic acid (SEQ ID NO: 5) and amino acid (SEQ ID NO: 6) sequences
of the human IgG3 Fe fragment. FIG. 15D shows the nucleic acid (SEQ
ID NO: 7) and amino acid (SEQ ID NO: 8) sequences of the human IgG4
Fc fragment.
[0090] FIG. 16A-FIG. 16B shows the nucleic acid (SEQ ID NO: 17) and
amino acid (SEQ ID NO: 18) sequences of a construct comprising {IgK
signal sequence-IgG1 Fc fragment-IgG1 Fc fragment}. The amino acid
sequence of the IgK signal is in bold. The amino acid sequence of
the first IgG1 Fc fragment is single underlined. The amino acid
sequence of the second IgG1 Fc fragment is double underlined. The
serine and lysine marked with an asterisk are those amino acids
that may be mutated to alter Fc.gamma. receptor binding.
[0091] FIG. 17 shows the nucleic acid (SEQ ID NO: 19) and amino
acid (SEQ ID NO: 20) sequences of a construct comprising
{Restriction Enzyme Sites-IgK signal sequence-Restriction Enzyme
Sites-IgG1(Hinge-CH2-CH3)-Restriction Enzyme Sites-epitope tags (V5
and His)-STOP}. The amino acid sequence of the IgK signal is in
bold. The amino acid sequence of the IgG1 Fc fragment is single
underlined. The amino acid sequence of the V5 tag is underlined
with a dashed line. The amino acid sequence of the His tag is
underlined in bold.
[0092] FIG. 18A-FIG. 18B shows the nucleic acid (SEQ ID NO: 21) and
amino acid (SEQ ID NO: 22) sequences of a construct comprising
{Restriction Enzyme Sites-IgK signal-Restriction Enzyme
Sites-IgG1(Hinge-CH2-CH3)-XbaI site-IgG1(Hinge-CH2-CH3)-STOP). The
amino acid sequence of the IgK signal is in bold. The amino acid
sequence of the first IgG1 Fc fragment is single underlined. The
amino acid sequence of the second IgG1 Fc fragment is double
underlined.
[0093] FIG. 19A-FIG. 19B shows the nucleic acid (SEQ ID NO: 23) and
amino acid (SEQ ID NO: 24) sequences of a construct comprising
{Restriction Enzyme Sites-IgK signal-Restriction Enzyme
Sites-IgG1(Hinge-CH2-CH3)-XbaI site-IgG1(Hinge-CH2-CH3)-Restriction
Enzyme Sites-epitope tags (V5 and His)-STOP}. The amino acid
sequence of the IgK signal is in bold. The amino acid sequence of
the first IgG1 Fc fragment is single underlined. The amino acid
sequence of the second IgG1 Fc fragment is double underlined. The
amino acid sequence of the V5 tag is underlined with a dashed line.
The amino acid sequence of the His tag is underlined in bold.
[0094] FIG. 20A shows the nucleic acid (SEQ ID NO: 31) and amino
acid (SEQ ID NO: 32) sequences of the N-terminal signal sequence of
FcRgammaIIIa with the phenylalanine (F) polymorphism shown in bold
and underlined. The variable nucleic acid is also in bold and
underlined. FIG. 20B shows the nucleic acid (SEQ ID NO: 33) and
amino acid (SEQ ID NO: 34) sequences of the N-terminal signal
sequence of FcRgammaIIIa with valine (V) polymorphism shown in bold
and underlined. The variable nucleic acid is also in bold and
underlined. Both constructs contain a C-terminal hexaHis tag for
purification.
[0095] FIG. 21A-FIG. 21B shows the nucleic acid (SEQ ID NO: 25) and
amino acid (SEQ ID NO: 26) sequences of a construct comprising
{Restriction Enzyme Sites-IgK signalEcoRV
Site-IgG3(Hinge-CH2-CH3)-IgG1(Hinge-CH2-CH3)-Restriction Enzyme
Sites-epitope tags(V5 and His)-STOP}. The amino acid sequence of
the IgK signal is in bold. The amino acid sequence of the IgG3 Fc
fragment is single underlined. The amino acid sequence of the IgG1
Fc fragment is double underlined. The amino acid sequence of the V5
tag is underlined with a dashed line. The amino acid sequence of
the His tag is underlined in bold.
[0096] FIG. 22A-FIG. 22C shows the nucleic acid (SEQ ID NO: 27) and
amino acid (SEQ ID NO: 28) sequences of a construct comprising
{Restriction Enzyme Sites-IgK signal-EcoRV Site-IgE(CH2)-IgG1
(Hinge-CH2-CH3)-IgG1 (Hinge-CH2)-IgE(CH4)-STOP}. The amino acid
sequence of the IgK signal is in bold. The amino acid sequence of
the IgE(CH2) domain is single underlined. The amino acid sequence
of the IgG1(Hinge-CH2-CH3) domain is double underlined. The amino
acid sequence of the IgG1(Hinge-CH2) domain is underlined with a
dashed line. The amino acid sequence of the IgE (CH4) domain is
underlined with a wavy line.
[0097] FIG. 23A shows an Fc fragment and demonstrates that such Fc
fragment is composed of two Fc fragment monomers, and further
comprises an Fc domain (dashed circle) and Fc partial domains
(hinge, CH2 and CH3 as indicated). FIG. 23B shows the composition
of a serial stradomer, composed of two stradomer monomers which are
connected by an inter-stradomer monomer linkage. The serial
stradomer comprises at least two Fc domains (indicated as dashed
circles) and may optionally comprise a domain linkage region. FIG.
23C shows the composition of a core stradomer comprising a core
moiety to which are bound core stradomer units that contain at
least one Fc domain each. The core stradomer units may be an Fc
fragment, a serial stradomer or a cluster stradomer unit. FIG. 23D
shows the composition of a cluster stradomer comprising
multimerized cluster stradomer units, each of which has a
multimerizing region and a region containing at least one Fc
domain. The cluster stradomer unit may be an Fc fragment or a
serial stradomer. The multimerizing region, once multimerized,
forms the head of a cluster stradomer. The legs of the cluster
stradomer are formed by the Fc domain regions of the cluster
stradomer units that are spatially less constrained than the
multimerized head of the cluster stradomer.
[0098] FIG. 24A-FIG. 24K shows the amino acid sequences of the
stradomer set forth in Table 3.
[0099] FIG. 25 shows the amino acid sequences for the Fc partial
domains monomers (hinge, CH2 and CH3) of human IgG1, IgG2, IgG3 and
IgG4 (Kabat, E A, Wu, T T, Perry, H M, Gottesman, K S, and Foeller,
C. 1991. Sequences of proteins of immunological interest 5th Ed. US
Public Health Services, NIH, Bethesda).
DETAILED DESCRIPTION OF THE INVENTION
[0100] The approach to rational molecular design for hIVIG
replacement compounds described herein includes recombinant and/or
biochemical creation of immunologically active biomimetic(s). In
preferred methods, these replacement compounds are screened in
vitro to assess each replacement compound's efficiency at binding
to Fc.gamma. receptor and modulating immune function. Particular
replacement compounds are selected for further in vivo validation
and dosage/administration optimization. The replacement compounds
have utility for treating, for example, autoimmune diseases,
inflammatory diseases, osteoporosis, and cancer. Each phase is
described in detail below along with specific exemplary
embodiments.
[0101] As used herein, the use of the word "a" or "an" when used in
conjunction with the term "comprising" in the claims and/or the
specification may mean "one," but it is also consistent with the
meaning of "one or more," "at least one," and "one or more than
one."
[0102] As used herein, the terms "biomimetic", "biomimetic
molecule", "biomimetic compound", and related terms, refer to a
human made compound that imitates the function of another compound,
such as pooled hIVIG, a monoclonal antibody or the Fc fragment of
an antibody. "Biologically active" biomimetics are compounds which
possess biological activities that are the same as or substantially
similar to their naturally occurring counterparts. "Immunologically
active" biomimetics are biomimetics which exhibit immunological
activity the same as or substantially similar to naturally
occurring immunologically active molecules, such as antibodies,
cytokines, interleukins and other immunological molecules known in
the art. In preferred embodiments, the biomimetics of the present
invention are stradomers and stradobodies, as defined herein.
[0103] The immunologically active biomimetics of the present
invention are designed to possess one or more immune modulating
activities of the IgG Fc domain and have at least (i) a first Fc
domain capable of binding an Fc.gamma.R, including Fc.gamma.RI,
Fc.gamma.RII, Fc.gamma.RIII and Fc.gamma.RIV, and (ii) a second Fc
domain capable of binding an Fc.gamma.R, including Fc.gamma.RI,
Fc.gamma.RII, Fc.gamma.RIII and Fc.gamma.RIV.
[0104] The following paragraphs define the building blocks of the
biomimetics of the present invention, both structurally and
functionally, and then define biomimetics themselves. However, it
is first helpful to note that, as indicated above, each of the
biomimetics of the present invention has at least two Fc domains.
At a minimum, an Fc domain is a dimeric polypeptide (or a dimeric
region of a larger polypeptide) that comprises two peptide chains
or arms (monomers) that associate to form a functional Fc.gamma.
receptor binding site. Therefore, the functional form of the
individual fragments and domains discussed herein generally exist
in a dimeric (or multimeric) form. The monomers of the individual
fragments and domains discussed herein are the single chains or
arms that must associate with a second chain or arm to form a
functional dimeric structure.
Fc Fragment
[0105] "Fc fragment" is a term of art that is used to describe the
protein region or protein folded structure that is routinely found
at the carboxy terminus of immunoglobulins (see FIGS. 3A-3B). The
Fc fragment can be isolated from the Fab fragment of a monoclonal
antibody through the use of papain digestion, which is an
incomplete and imperfect process (see Mihaesco C and Seligmann M.
Papain Digestion Fragments Of Human IgM Globulins. Journal of
Experimental Medicine, Vol 127, 431453 (1968)). In conjunction with
the Fab fragment (containing the antibody binding domain) the Fc
fragment constitutes the holo-antibody, meaning here the complete
antibody. The Fc fragment consists of the carboxy terminal portions
of the antibody heavy chains. Each of the chains in an Fc fragment
is between about 220-265 amino acids in length and the chains are
often linked via a disulfide bond. The Fc fragment often contains
one or more independent structural folds or functional subdomains.
In particular, the Fc fragment encompasses an Fe domain, defined
herein as the minimum structure that binds an Fc.gamma. receptor
(see, e.g., FIG. 1B and FIG. 1D). An isolated Fc fragment is
comprised of two Fc fragment monomers (e.g., the two carboxy
terminal portions of the antibody heavy chains; further defined
herein) that are dimerized. When two Fc fragment monomers
associate, the resulting Fc fragment has Fc.gamma. receptor binding
activity.
Fc Partial Fragment
[0106] An "Fe partial fragment" is a domain comprising less than
the entire Fc fragment of an antibody, yet which retains sufficient
structure to have the same activity as the Fc fragment, including
Fc.gamma. receptor binding activity. An Fc partial fragment may
therefore lack part or all of a hinge region, part or all of a CH2
domain, part or all of a CH3 domain, and/or part or all of a CH4
domain, depending on the isotype of the antibody from which the Fc
partial domain is derived. An example of a Fc partial fragment
includes a molecule comprising the upper, core and lower hinge
regions plus the CH2 domain of IgG3 (Tan, L K, Shopes, R J, Oi, V T
and Morrison, S L, Influence of the hinge region on complement
activation, C 1 q binding, and segmental flexibility in chimeric
human immunoglobulins, Proc Natl Acad Sci USA. 1990 January; 87(1):
162-166). Thus, in this example the Fc partial fragment lacks the
CH3 domain present in the Fc fragment of IgG3. Fc partial fragments
are comprised of two Fc partial fragment monomers. As further
defined herein, when two such Fc partial fragment monomers
associate, the resulting Fc partial fragment has Fc.gamma. receptor
binding activity.
Fc Domain
[0107] As used herein, "Fe domain" describes the minimum region (in
the context of a larger polypeptide) or smallest protein folded
structure (in the context of an isolated protein) that can bind to
or be bound by an Fc.gamma. receptor. In both an Fc fragment and an
Fc partial fragment, the Fe domain is the minimum binding region
that allows binding of the molecule to an Fc.gamma. receptor. While
an Fe domain can be limited to a discrete polypeptide that is bound
by an Fc.gamma. receptor, it will also be clear that an Fe domain
can be a part or all of an Fc fragment, as well as part or all of
an Fc partial fragment. When the term "Fe domains" is used in this
invention it will be recognized by a skilled artisan as meaning
more than one Fe domain. An Fe domain is comprised of two Fe domain
monomers. As further defined herein, when two such Fe domain
monomers associate, the resulting Fe domain has Fc receptor binding
activity. Thus an Fc domain is a dimeric structure that
functionally can bind an Fc.gamma. receptor.
Fc Partial Domain
[0108] As used herein, "Fc partial domain" describes a portion of
an Fc domain. Fc partial domains include the individual heavy chain
constant region domains (e.g., CH1, CH2, CH3 and CH4 domains) and
hinge regions of the different immunoglobulin classes and
subclasses. Thus, Fc partial domains of the present invention
include the CH1 domains of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2,
IgD and IgE, the CH2 domains of IgG1, IgG2, IgG3, IgG4, IgM, IgA1,
IgA2, IgD and IgE, the CH3 domains of IgG 1, IgG2, IgG3, IgG4, IgM,
IgA1, IgA2, IgD and IgE, the CH4 domains of IgM and IgE, and the
hinge regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD and
IgE. The Fc partial domain of the present invention may further
comprise a combination of more than one more of these domains and
hinges. However, the individual Fc partial domains of the present
invention and combinations thereof lack the ability to bind an
Fc.gamma.R. Therefore, the Fc partial domains and combinations
thereof comprise less than an Fe domain. Fc partial domains may be
linked together to form a peptide that has Fc receptor binding
activity, thus forming an Fe domain. In the present invention, Fc
partial domains are used with Fe domains as the building blocks to
create the biomimetics of the present invention, as defined herein.
Each Fc partial domain is comprised of two Fc partial domain
monomers. When two such Fc partial domain monomers associate, an Fc
partial domain is formed.
[0109] As indicated above, each of Fc fragments, Fc partial
fragments, Fe domains and Fc partial domains are dimeric proteins
or domains. Thus, each of these molecules is comprised of two
monomers that associate to form the dimeric protein or domain.
While the characteristics and activity of the dimeric forms was
discussed above the monomeric peptides are discussed as
follows.
Fc Fragment Monomer
[0110] As used herein, an "Fe fragment monomer" is a single chain
protein that, when associated with another Fc fragment monomer,
comprises an Fc fragment. The Fc fragment monomer is thus the
carboxy terminal portion of one of the antibody heavy chains that
make up the Fc fragment of a holo-antibody (e.g., the contiguous
portion of the heavy chain that includes the hinge region, CH2
domain and CH3 domain of IgG) (see FIG. 1A and FIG. 1C). In one
embodiment, the Fc fragment monomer comprises, at a minimum, one
chain of a hinge region (a hinge monomer), one chain of a CH2
domain (a CH2 domain monomer) and one chain of a CH3 domain (a CH3
domain monomer), contiguously linked to form a peptide. In another
embodiment, the Fc fragment monomer comprises at least one chain of
a hinge region, one chain of a CH2 domain, one chain of a CH3
domain, and one chain of a CH4 domain (a CH4 domain monomer)
contiguously linked to form a peptide.
Fc Domain Monomer
[0111] As used herein, "Fc domain monomer" describes the single
chain protein that, when associated with another Fc domain monomer,
comprises an Fc domain that can bind to an Fc.gamma. receptor. The
association of two Fc domain monomers creates one Fc domain. An Fc
domain monomer alone, comprising only one side of an Fc domain,
cannot bind an Fc.gamma. receptor.
Fc Partial Domain Monomer
[0112] As used herein, "Fc partial domain monomer" describes the
single chain protein that, when associated with another Fc partial
domain monomer, comprises an Fc partial domain. The amino acid
sequences of the Fc partial domain hinge, CH2 and CH3 monomers for
IgG1, IgG2, IgG3 and IgG4 are shown in FIG. 25. The association of
two Fc partial domain monomers creates one Fc partial domain.
Stradomers
[0113] In particular embodiments, the biomimetics of the present
invention include stradomers. Stradomers are biomimetic compounds
capable of binding two or more Fc.gamma. receptors (see, e.g., FIG.
13B). In a preferred embodiment, the stradomers of the present
invention are used to bind Fc.gamma. receptors on effector cells
such as NK cells and immature dendritic cells and other
monocyte-derived cells. In one embodiment, the Fc.gamma. receptors
are low affinity Fc.gamma. receptors. A stradomer can have four
different physical conformations: serial, cluster, core or Fc
fragment, each of which is discussed in the following paragraphs.
As will be evident, the Fc fragments, Fc partial fragments, Fc
domains and Fc partial domains discussed above are used in the
construction of the various stradomer conformations. Further, it is
the individual Fc domain monomers and Fc partial domain monomers,
also discussed above, that are first produced, and that then
self-associate to form the dimeric structures that are the
stradomers of the present invention.
Serial Stradomer
[0114] A "serial stradomer" is dimeric polypeptide comprised of two
linear stradomer monomers that, when associated, form two or more
Fc domains. The Fc domains of the stradomer are only functional
when the two peptide chains (stradomer monomers) are associated
(i.e., non-functional in the monomeric state). Thus a serial
stradomer is a biomimetic compound capable of binding two or more
Fc.gamma. receptors. In different embodiments, serial stradomer may
have two, three, four, five, six, seven, eight, nine, ten, eleven,
twelve, thirteen, fourteen or more Fc domains, as well as Fc
partial domains. The Fc domains, and Fc partial domains, within a
serial stradomer may be linked by domain linkages, as further
defined herein.
[0115] As used herein, a "stradomer dimer" is a specific form of a
stradomer, composed of only two stradomers. In one embodiment, the
stradomer dimers are molecules formed by self-aggregation of
relevant stradomer monomers. In another embodiment, stradomer
monomers in the stradomer dimers are physically linked through an
inter-stradomer monomer linkage, as defined herein. A "multimeric
stradomer" is comprised of three or more stradomers, formed by
self-aggregation of stradomer monomers, or through an
inter-stradomer monomer linkage, as defined herein in.
Stradomer Monomer
[0116] As used herein, the term "stradomer monomer" refers to a
single, contiguous peptide molecule that, when associated with at
least a second stradomer monomer, forms a polypeptide comprising at
least two Fc domains (see, e.g., FIGS. 6A-6B, FIG. 12A). While in
preferred embodiments serial stradomer are comprised of two
associated stradomer monomers (see, for example, FIGS. 5A-5B and
FIGS. 7A-7D), a serial stradomer may also contain three (see FIG.
11C) or more stradomer monomers. Stradomer monomers may be
associated to form stradomers by inter-stradomer monomer linkages
or they may form stradomers through self-aggregation.
[0117] A stradomer monomer may have an amino acid sequence that
will form one, two, three, four, five, six, seven, eight, nine,
ten, eleven, twelve, thirteen, fourteen or more Fc domains when
associated with another stradomer monomer to form a stradomer. A
stradomer monomer may further have an amino acid sequence that will
form one, two, three, four, five, six, seven, eight, nine, ten,
eleven, twelve, thirteen, fourteen or more Fc partial domains when
associated with another stradomer monomer to form a stradomer.
[0118] The regions of stradomer monomers that will form Fc domains
and Fc partial domains in the context of a stradomer may simply be
arranged from carboxy terminal to amino terminal of successive
regions of the stradomer monomer molecule (see, e.g., FIGS. 4A-4B).
Alternatively, the successive regions of the stradomer monomers may
be linked through a peptide sequence termed a "domain linkage"
herein. The arrangement of the particular Fc domain monomers and Fc
partial domain monomers comprising a stradomer monomer is not
critical. However, the arrangement must permit formation of two
functional Fc domains upon association of two stradomer
monomers.
[0119] In one embodiment of the stradomers of the present
invention, stradomer monomers are produced that contain at the
N-terminus of the peptide an Fc domain monomer or Fc partial domain
monomer that binds strongly to itself, such as a single or two
terminal IgE CH2 domain monomers or a partial IgG3 hinge domain
monomer, to create an Fc domain or an Fc partial domain,
respectively. Each of these stradomer monomers has the requisite
complement of Fc domain monomers and/or partial Fc domain monomers
to bind to two Fc gamma receptors upon formation of a stradomer.
Stradomers that result from association of such stradomer monomers
are biomimetics capable of binding two or more Fc gamma receptors.
In a preferred embodiment the N-terminal Fc domain or Fc partial
domain contains an additional glycosylation site such as that which
exists on the IgE CH2 domain.
[0120] As a clarifying example, the skilled artisan will understand
that the stradomer molecules of the present invention may be
constructed by preparing a polynucleotide molecule that encodes
various combinations of Fc domain monomers and Fc partial domain
monomers, but with a combination that will form a minimum of two Fc
domain monomers. Such a polynucleotide molecule may be inserted
into an expression vector, which can be used to transform a
population of bacteria. Stradomer monomers can then produced by
culturing the transformed bacteria under appropriate culture
conditions. Stradomer monomers can then form functional stradomers
upon either self-aggregation of the stradomer monomers or
association of stradomer monomers using inter-stradomer monomer
linkages. The present invention encompasses both stradomers formed
through the association of stradomer monomers having identical
amino acid sequences, stradomer monomers having substantially
similar amino acid sequences, or stradomer monomers having
dissimilar sequences. In the latter embodiment the amino acid
sequence of the stradomer monomers comprising a stradomer need only
be of such similarity that two or more functional Fc.gamma.
receptor binding sites are formed.
[0121] As indicated above, an Fc domain can be functionally defined
by its ability to bind an Fc.gamma. receptor. As a result, the
particular amino acid sequence of an Fc domain will vary based on
the Fc partial domains that comprise the Fc domain. However, in one
embodiment of the present invention the Fe domain comprises the
hinge region and a CH2 domain of an immunoglobulin molecule. In a
further embodiment the Fc domain comprises the hinge region, a CH2
domain and CH3 domain of an immunoglobulin molecule. In a further
embodiment, the Fc domain comprises the hinge region, a CH2 domain,
CH3 domain and CH4 domain of an immunoglobulin molecule. In yet
another embodiment, the Fc domain comprises the hinge region, a CH2
domain and CH4 domain of an immunoglobulin molecule.
Domain Linkage
[0122] As indicated above, a "domain linkage" is a peptide linkage
between Fc domain monomers and/or Fc partial domain monomers that
comprise each of the individual stradomer monomers of the serial
stradomers or stradobodies of the present invention. The domain
linkage may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20 or more amino acids. A domain linkage does not
occur between Fc partial domain monomers that are in their natural
sequence. That is, where linked naturally contiguous portions of Fc
domain monomers are used, such as the hinge region, CH2 domain and
CH3 domain of IgG, these Fc partial domain monomers comprise a
contiguous sequence and no domain linkage between these elements is
required. In contrast, for example, when two or more Fc domain
monomers or partial Fc domain monomers are linked in a manner that
is not naturally occurring to form an individual stradomer monomer,
domain linkages may be used. An example would be the linkage
between two hinge/CH2/CH3 peptides, creating an individual
stradomer monomer of a stradomer comprising:
hinge/CH2/CH3/L/hinge/CH2/CH3, where "L" is the domain linkage
(see, e.g., FIG. 4A where the domain linkage (not shown) occurs
between the IgG1 CH3 domain and the IgG1 hinge). In the various
cases described, the domain linkage may be one of the naturally
occurring portions of the heavy chain that joins the hinge and CH
domains in the Fc domain monomer of an antibody. Alternatively, the
domain linkage may be any other amino acid sequence that provides
needed spacing and flexibility between the Fc domain monomers and
partial Fc domain monomers of an individual stradomer monomer and
that allows the individual stradomer monomers to pair with other
each other to form the stradomers of the present invention.
[0123] The skilled artisan will understand that the identity of the
domain linkage is not particularly important as long as it permits
two or more individual stradomer monomers to form the biomimetic
compounds of the present invention, and that the resulting
compounds have the ability to cross-link more than one Fc.gamma.R.
It is envisioned that each immunologically active biomimetic
compound will preferably contain at least one domain linkage in
each stradomer monomer of the serial stradomer or stradobody which
will function to maintain the Fc domains of the immunologically
active biomimetic within a restricted spatial region and which will
facilitate Fc.gamma.R activation activity, for example, by
aggregating Fc.gamma.Rs through co-binding to the Fc domains within
the immunologically active biomimetic. Preferably, the domain
linkages will allow the same or a greater degree of conformational
variability as is provided by the hinge domain of IgG molecules.
All the above linkages are well-known in the art.
Inter-Stradomer Monomer Linkage
[0124] A separate linkage found in the biomimetic compounds of the
present invention is the "inter-stradomer monomer linkage" that
occurs between two or more individual stradomer monomers that
comprise the stradomers and stradobodies of the present invention.
While the domain linkages are short amino acid sequences that serve
to link the Fc domain monomers and partial Fc domain monomers that
comprise individual stradomer monomers of the biomimetic compounds
to each other, the inter-stradomer monomer linkages serve to join
two or more individual stradomer monomers that comprise the
biomimetic compounds. The inter-stradomer monomer linkage may be
any linkage capable of stably associating the individual stradomer
monomers. In some embodiments, the inter-stradomer monomer linkage
may be a covalent link between the stradomer monomers.
Alternatively, the inter-stradomer monomer linkage between
stradomer monomers may be by direct chemical crosslinking. In
preferred embodiments, the stradomer monomer structures take
advantage of the natural self-aggregation properties between Fe
domain monomers to create self-aggregating stradomers. In such
embodiments, disulfide bonds form between the individual stradomer
monomers to form the stradomers (see, e.g., FIG. 5A, where
inter-stradomer monomer linkages (not shown) serve to join the two
individual stradomer monomers of the stradomer). The disulfide
bonds form between cysteine residues of the Fc domain monomers that
comprise the biomimetic molecules, using either cysteine residues
occurring in the natural Fc domain monomer sequence or cysteine
residues incorporated into an Fc domain monomer by site-directed
mutagenesis. Such natural self-aggregation properties can also be
used to form the inter-stradomer monomer linkages between
individual stradomer monomers in stradomer multimers. Alternative
embodiments include inter-stradomer monomer linkages where
disulfide bonds form between cysteine residues introduced through
site-directed mutagenesis into the amino acid sequence comprising
the individual stradomer monomers.
[0125] As discussed above, in a preferred embodiment, the
inter-stradomer monomer linkage that forms a stradomer is a linkage
that results from self-aggregation of stradomer monomers. In one
embodiment, the two stradomer monomers that comprise the stradomer
are identical peptides, such that the two individual stradomer
monomers that comprise the stradomer are identical in sequence.
However, the skilled artisan will understand that other embodiments
include stradomers where the stradomer monomers differ from each
other in amino acid sequence.
[0126] Two stradomer monomers can form a stradomer by, for example,
aligning in parallel such that pairing takes place between
identical Fc partial domain monomers in the stradomer monomers
(see, e.g., FIGS. 5A-5B). However, the present invention also
includes embodiments where pairing occurs between non-identical Fc
partial domain monomers, and embodiments (see FIG. 11C) where
pairing occurs between identical Fc partial domain monomers in the
stradomer monomers but where the alignment of the two stradomer
monomers is offset.
[0127] In order to control the production and self-dimerization of
a stradomer monomer, "capping regions" may be used. For example, a
stradomer monomer sequence may comprise the following Fc partial
domains: IgE CH2/IgG1 hinge/IgG1 CH2/IgG1 CH3/IgG1 hinge/IgG1
CH2/IgE CH4, (see FIG. 13A) where the IgE domains serve as a cap to
prevent a "zippering effect." A zippering effect can occur when a
stradomer monomer (see FIG. 11A) can auto-dimerize (see FIG. 111B)
or can align itself not as an auto-dimer but as alternating
monomers in parallel (see FIG. 11C). One of ordinary skill in the
art will understand that a variety of Fc partial domains, such as
the hinge of any immunoglobulin or the CH4 domain of IgM or IgE,
may be used alone or in combination to direct the stradomer to
auto-dimerize and to prohibit the zippering effect when desired.
Other non-series structures may contain branched molecules (see
FIG. 12B), two or more stradomers lined up in parallel joined by
linkers such as a simple covalent bond, peptide linkers, or
non-peptide linkers (see FIG. 14A and FIG. 14B).
Core Stradomer
[0128] A "core stradomer" is comprised of a core moiety to which
are bound two or more core stradomer units, wherein each core
stradomer unit comprises at least one Fc domain, thereby creating a
biomimetic compound capable of binding two or more Fc.gamma.
receptors. An Fc fragment, Fc partial fragment, serial stradomer or
cluster stradomer unit can each independently serve as one or both
(if they comprise two Fc domains) of the core stradomer units in a
core stradomer because each of these molecules contains at least
one Fc domain. Thus, a core stradomer may comprise a core moiety to
which is bound at least one serial stradomer.
[0129] As used herein, the core moiety of a core stradomer is any
physical structure to which the core stradomer units may be linked
or covalently bound. Preferred polypeptides that may serve as the
core moiety include keyhole limpet hemocyanin, bovine serum albumin
and ovalbumin. Chemical crosslinking between such core moieties and
core stradomer units (e.g., Fc fragment, Fc partial fragment, Fc
domain, serial stradomer and cluster stradomer unit) may be
achieved by means of numerous chemicals using well known
techniques. Exemplary chemicals generally suitable for use in the
crosslinking include glutaraldehyde, carbodiimide, succinimide
esters (e.g. MBS, SMCC), benzidine, periodate, isothiocyanate; PEO
(polyethylene)/PEG (polyethylene glycol) spacers such as
Bis(NHS)PEO5, DFDNB (1,5-Difluoro-2,4-dinitrobenzene); and Amine
Reactive homobifunctional cross-linking reagents including
Aldehyde-Activated Dextran, Bis(Sulfosuccinimidyl)suberate,
Bis[2-(succinimidooxycarbonyloxy)ethyl]sulfone, Dimethyl
adipimidate.2 HCl, Dimethyl pimelimidate.2 HCl, Dimethyl
Suberimidate.2 HCl, Disuccinimidyl glutarate,
Dithiobis(succinimidyl) propionate, Disuccinimidyl suberate,
Disuccinimidyl tartrate, Dimethyl 3,3'-dithiobispropionimidate.2
HCl, 3,3'-Dithiobis(sulfosuccinimidylpropionate), Ethylene glycol
bis[succinimidylsuccinate], Ethylene glycol
bis[sulfosuccinimidylsuccinate], .beta.-[Tris(hydroxymethyl)
phosphino] propionic acid and Tris-succinimidyl aminotriacetate.
One of skill in the art will be able to select the appropriate
crosslinking chemical and conditions based upon the particular core
moiety selected and the sequence of the Fc domain-containing
polypeptides being combined to form an immunologically active
biomimetic. See, e.g., Wong, Shan S. Chemistry of protein
conjugation and cross-linking. Boca Raton: CRC Press, c1991 (ISBN
0849358868).
[0130] In another preferred embodiment, a joining (J) chain
polypeptide may be used as the core moiety. When a J chain is used
as the core moiety, cysteine bridges may be used to connect
individual core stradomer units to form a core stradomer (See FIG.
10A-10D). In an embodiment of a core stradomer, serial stradomers
(serving as the core stradomer units) containing a terminal IgM CH4
domain are associated with a J chain to form a core stradomer. The
inclusion of the IgM CH4 domain results in the self-aggregation of
stradomers comprising this Fc partial domain with a J chain to form
a biomimetic capable of binding multiple Fc gamma receptors.
Another exemplary core stradomer is one comprising Fc domains
(serving as the core stradomer units) where the Fc domains have the
structure IgG3 hinge/IgG3 CH2/IgG3 CH3/IgM CH4. The component Fc
domains of this molecule cannot individually bind more than one Fc
gamma receptor, but the entire structure can bind five Fc gamma
receptors when the component Fc domains associate with a J
chain.
[0131] In another embodiment, the core moiety may be a
non-polypeptide entity. A variety of suitable compositions may be
physically associated with the core stradomer units to produce an
immunologically active biomimetic. Non-toxic beads, hyperbranched
polymers and dendrimers, nanoparticles, and various compounds that
are classified by the FDA as Generally Regarded As Safe (e.g.
propylene glycol, sorbitol, liposomes and silicate calcium) may be
used. See, e.g., Nanoparticulates as Drug Carriers by Vladimir P.
Torchilin (Editor), Imperial College Press (September 2006) ISBN:
1860946305/ISBN-13: 9781860946301.
[0132] Preferred core moieties of the present invention include a
bead, albumin, a liposome, a peptide and polyethylene glycol.
Cluster Stradomer
[0133] A "cluster stradomer" is a biomimetic that has an
octopus-like form with a central moiety "head" and two or more
"legs", wherein each leg comprises one or more Fc domain that is
capable of binding at least one Fc gamma receptor, thus creating a
biomimetic capable of binding two or more Fc gamma receptors. Each
cluster stradomer is comprised of more than one dimeric protein,
each called a "cluster stradomer unit." Each cluster stradomer unit
is comprised of a region that multimerizes and a "leg" region that
comprises at least one functional Fc domain. The multimerizing
region creates a cluster stradomer "head" once multimerized with
the multimerizing region of another cluster stradomer unit. The leg
region is capable of binding as many Fc.gamma. receptors as there
are Fc domains in each leg region. Thus a cluster stradomer is a
biomimetic compound capable of binding two or more Fc.gamma.
receptors.
[0134] The multimerizing region may be a peptide sequence that
causes dimeric proteins to further multimerize or alternatively the
multimerizing region may be a glycosylation that enhances the
multimerization of dimeric proteins. Examples of peptide
multimerizing regions include IgG2 hinge, IgE CH2 domain,
isoleucine zipper, and zinc fingers. The influence of glycosylation
on peptide multimerization is well described in the art (e.g., Role
of Carbohydrate in Multimeric Structure of Factor VIII/V on
Willebrand Factor Protein. Harvey R. Gralnick, Sybil B. Williams
and Margaret E. Rick. Proceedings of the National Academy of
Sciences of the United States of America, Vol. 80, No. 9, [Part 1:
Biological Sciences] (May 1, 1983), pp. 2771-2774; Multimerization
and collagen binding of vitronectin is modulated by its
glycosylation. Kimie Asanuma, Fumio Arisaka and Haruko Ogawa.
International Congress Series Volume 1223, December 2001, Pages
97-101).
[0135] A trained artisan will recognize that a cluster stradomer
unit may itself comprise a serial stradomer (containing two or more
Fc domains) along with a multimerizing region. Thus the "legs" of a
cluster stradomer may be comprised of any of the types of serial
stradomers discussed herein and/or one or more of an IgG1 Fc
fragment and/or an IgG3 Fc fragment and/or a single Fc domain. One
trained in the art will recognize that each of the IgG1 Fc
fragments and IgG3 Fc fragment in such biomimetics may be modified
to comprise partial Fc fragments from any immunoglobulin. The
monomers that comprise the cluster stradomer unit (which, as
indicated above, exists as a dimeric association of two peptides)
are "cluster stradomer unit monomers." An exemplary cluster
stradomer that has been made whose cluster stradomer unit would not
bind more than one low affinity Fe gamma receptor prior to
multimerization is: IgE CH2/IgG1 hinge/IgG1 CH2/IgG1 CH3.
[0136] One trained in the art will recognize that when a serial
stradomer is used as the "leg" of a cluster stradomer, each "leg"
will be capable of binding more than one Fc gamma receptor (as at
least two Fc domains are present in a serial stradomer), thus
creating a biomimetic capable of binding more than one Fc gamma
receptor. Fc partial domains, other immunoglobulin sequences, and
non-immunoglobulin sequences may be placed at the termini of
individual cluster stradomer unit monomers comprising the legs to
create a cluster stradomer wherein each leg has preferred spatial
proximity to increase their availability to bind one or more than
one Fc gamma receptor.
[0137] The multimerizing region may be a peptide sequence that
causes peptides to dimerize or multimerize and includes the IgG2
hinge, the IgE CH2 domain, an isoleucine zipper and a zinc finger.
As is known in the art, the hinge region of human IgG2 can form
covalent dimers (Yoo, E. M. et al. J. Immunol. 170, 3134-3138
(2003); Salfeld Nature Biotech. 25, 1369-1372 (2007)). The dimer
formation of IgG2 is potentially mediated through the IgG2 hinge
structure by C--C bonds (Yoo et al 2003), suggesting that the hinge
structure alone can mediate dimer formation. Thus, serial
stradomers having an IgG2 hinge (and thus serving as cluster
stradomer units) will form a cluster stradomer that may comprise
two serial stradomers or even three serial stradomers.
[0138] The amino acid sequence of the human IgG2 hinge monomer is
as follows: ERKCCVECPPCP (SEQ ID NO: 36). The core structure of the
hinge is the CX-X-C portion of the hinge monomer. Thus, stradomer
monomers of the present invention may comprise either the complete
12 amino acid sequence of the IgG2 hinge monomer, or the four amino
acid core, along with Fc domain monomers. While the X-X of the core
structure can be any amino acid, in a preferred embodiment the X-X
sequence is V-E or PP. The skilled artisan will understand that the
IgG2 hinge monomer may be comprised of any portion of the hinge
sequence in addition to the core four amino acid structure,
including all of the IgG2 hinge sequence and some or all of the
IgG2 CH2 and CH3 domain monomer sequences. Specific examples of
possible IgG2 hinge-IgG1 Fc domain serial stradomer constructs are
as follows:
TABLE-US-00001 TABLE 1 N-term H CH2 CH3 H CH2 CH3 H CH2 CH3 C-term
CXXC 1 1 1 CXXC 1 1 1 1 1 1 2 2 2 1 1 1 2 2 2 1 1 1 1 1 1 2 1 1 1 2
1 1 1 1 1 1 2x 2 2 1 1 1 2x 2 2 1 1 1 1 1 1 2x 2 2 1 1 1 1 1 1 IgE
hinge 2x 1 1 1 Nomenclature: H = hinge, CH2 = constant heavy domain
2, CH3 = constant heavy domain 3, 1 = IgG1, 2 = IgG2, X = any amino
acid; 2x = two hinges in consecutive order
[0139] These are only a few of many examples. Any of the IgG1 Fc
domains can, for example, be replaced with an IgG3 Fc domain.
Additional proteins with IgG2 dimerization domains includes
IgG2-IgG1 chimeric proteins with the addition of N and/or C
terminal sequences comprising IgM or IgE domain monomer sequences.
These N and C terminal sequences can be hinge regions, constant
domains, or both.
[0140] As indicated above, leucine and isoleucine zippers may also
be used as the multimerizing region. Leucine and isoleucine zippers
(coiled-coil domains) are known to facilitate formation of protein
dimers, trimers and tetramers (Harbury et al. Science 262:1401-1407
(1993); O'Shea et al. Science 243:538 (1989)). By taking advantage
of the natural tendency of an isoleucine zipper to form a trimer,
cluster stradomers may be produced using serial stradomers
comprising an isoleucine zipper. Association of three or more
serial stradomers (as cluster stradomer units) having isoleucine
zippers results in the formation of cluster stradomers having at
least six Fc gamma receptor binding regions.
[0141] While the skilled artisan will understand that different
types of leucine and isoleucine zippers may be used, in a preferred
embodiment the isoleucine zipper from the GCN4 transcriptional
regulator modified as described (Morris et al., Mol. Immunol.
44:3112-3121 (2007); Harbury et al. Science 262:1401-1407 (1993))
is used: YTQKSLSL
SPGKELLGGGSIKQIEDKIEEILSKIYHIENEIARIKKLIGERGHGGGSNSQVSHRYPRFQSI
KVQFTEYKKEKGFILTS (SEQ ID NO:37) This isoleucine zipper sequence is
only one of several possible sequences that can be used for
multimerization of Fe domain monomers. While the entire sequence
shown in SEQ ID NO:37 may be used, the underlined portion of the
sequence represents the core sequence of the isoleucine zipper that
may be used in the cluster stradomers of the present invention.
Thus, stradomer monomers of the present invention may comprise
either the complete 88 amino acid sequence of the isoleucine zipper
(ILZ), or the 28 amino acid core, along with one or more Fc domain
monomers. The skilled artisan will also understand that the
isoleucine zipper may be comprised of any portion of the zipper in
addition to the core 28 amino acid structure, and thus may be
comprised of more than 28 amino acids, but less than 88 amino acids
of the isoleucine zipper. Specific examples of possible ILZ-IgG1 Fc
domain constructs are shown as follows.
TABLE-US-00002 TABLE 2 H CH2 CH3 H CH2 CH3 ILZ 1 1 1 ILZ 1 1 1 1 1
ILZ 1 1 1 1 1 1 ILZ 1 1 1 3 3 3 Nomenclature: H = hinge, CH2 =
constant heavy domain 2, CH3 = constant heavy domain 3. 1 = IgG1, 3
= IgG3, ILZ = isoleucine zipper domain
[0142] These are only a few of many examples. Any of the IgG1
domains can, for example, be replaced with IgG3 domains. Additional
proteins with ILZ domains include IgG1 chimeric proteins with the
addition of N and/or C terminal sequences from other Ig molecules
like IgM or IgE. These N and C terminal sequences can be hinge
regions, constant domains or both.
Fc Fragment Stradomer
[0143] An "Fc fragment stradomer" is comprised of more than one Fc
fragment. Under certain circumstances attributable to
post-translational modification of the Fc fragment, the Fc fragment
binds with sufficient strength to another Fc fragment to permit the
formation of a molecule that binds to more than one Fc.gamma.
receptor. The post-translational modification that permits such
binding includes glycosylation and methylation. The identity of the
cell line in which the recombinant Fc fragments are produced, and
conditions under which they are produced, govern whether Fc
fragments will form Fc fragment stradomers. For example, a
recombinant Fc fragment produced in a FreestyleMax CHO transient
transfection cell forms multimers that are visible on western
blots, binds according to a bivalent fit on plasmon resonance
binding assay, and demonstrates biological activity in a dendritic
cell assay comparable to IVIG. In contrast, the same recombinant Fc
fragment produced in a stable CHO cell line does not form multimers
of the Fc fragment on western blots, binds according to a univalent
fit on Plasmon resonance binding assay, and does not demonstrate
comparable biological activity. Thus an Fc fragment stradomer is a
biomimetic compound capable of binding two or more Fc.gamma.
receptors.
[0144] As also used herein, the term "Fc dimer" is a dimer of Fc
fragments (see FIG. 2A), the term "Fc trimer" is a trimer of Fc
fragments, and the term "Fc multimer" is a multimer of Fc fragments
(see FIG. 2B).
Stradobody
[0145] The present invention also encompasses stradobodies. As used
herein, "stradobody" refers to a molecule comprising two or more Fc
domains, preferably in the context of a stradomer (including serial
stradomers, core stradomers, cluster stradomers and Fc fragment
stradomers), to which one or more Fab domains is attached (see,
e.g., FIGS. 8A-8B and FIGS. 9A-9B). Thus, by virtue of such Fab
domains, stradobodies have both antigen binding capacity, as well
as stradomer Fc.gamma. receptor binding activity. In some
embodiments, the Fc.gamma. receptor binding activity may be due to
an ability to bind and cross-link Fc.gamma.R equal to or greater
than the Fc portion of a native structure holo-antibody. Preferably
the Fab portion of the stradobody comprises both a heavy and a
light chain. The variable heavy chain and the light chain may be
independently from any compatible immunoglobulin such as IgA1,
IgA2, IgM, IgD, IgE, IgG1, IgG2, IgG3, or IgG4, and may be from the
same or different Ig isotype, but preferably are from the same Ig
isotype. The light chains kappa or lambda may also be from
different Ig isotypes. Stradobodies, like stradomers, can bind two
or more Fc.gamma.Rs and modulate immune function.
[0146] In one embodiment, the stradomers may have a Fab of an
immunoglobulin linked to an Fc hinge (H) domain of a stradomer to
generate a stradobody (e.g. FIG. 8A & FIG. 8B). In another
embodiment, the stradobody may be comprised of IgG1 Fc-IgG1
(hinge-CH2) (e.g., FIG. 9A). In other embodiments, the stradobody
may be comprised of an IgG1 domain and hinge, an IgG3 domain and
hinge and an IgGE domain and hinge (e.g., FIG. 9B). The Fab
comprises both a heavy and a light chain as found in native
immunoglobulin structures (FIGS. 3A-3B).
[0147] Stradobodies will possess the antigen binding properties of
the Fab portion and the above described stradomer properties. Such
a combination will serve to bind, cross-link, and activate
Fc.gamma. receptors on effector cells at a higher rate than can be
accomplished by an Fc backbone of a holo-antibody, particularly in
the environment of low epitope expression (e.g. the 90% of breast
cancer patients whose tumors are not classified as her/2-neu high
expressors), inducing ADCC in a higher percentage of patients. As
indicated above, one or more antigen-binding Fab fragments can be
added to the stradomers to form stradobodies. Preferably,
polypeptides (other than the linkages described herein) added to
stradomers are not all or parts of non-immunoglobulin
polypeptides.
[0148] The Fab may be a chimeric structure comprised of human
constant regions and non-human variable regions such as the
variable region from a mouse, rat, rabbit, monkey, or goat
antibody. One of ordinary skill in the art would be able to make a
variety of Fab chimeric structures for incorporation into
stradobodies using methodologies currently available and described
in the scientific literature for such constructions. Thus,
"humanized" stradobodies may be designed analogous to "humanized
monoclonal antibodies.
Variants and Homologs
[0149] The skilled artisan will understand that the stradomers and
other biomimetics of the present invention can be designed to
include specific immunoglobulin Fc domains, such as two Fc domains
from IgG1 (i.e., IgG1 hinge/IgG1 CH2/IgG1 CH3/IgG1 hinge/IgG1
CH2/IgG1 CH3). Such a stradomer could be constructed by first
preparing a polynucleotide encoding two IgG1 Fc domain monomers
(i.e., IgG1 hinge monomer/IgG1 CH2 monomer/IgG1 CH3 monomer/IgG1
hinge monomer/IgG1 CH2 monomer/IgG1 CH3 monomer), and then
expressing stradomer monomers there from. Upon association of two
such stradomer monomers a serial stradomer having two IgG1 Fc
domains would be produced.
[0150] The stradomers and other biomimetics of the present
invention can also be designed based on the identity of specific
immunoglobulin Fc partial domains that comprise the Fe domains. For
example, a serial stradomer could be produced having two Fc
domains, where the first Fc domain comprises IgG1 hinge/IgG3
CH2/IgG1 CH3 and the second Fc domain comprises IgG3 hinge/IgG1
CH2/IgG3 CH3.
[0151] It is understood that the stradomers and other biomimetic
molecules disclosed herein can be derived from any of a variety of
species. Indeed, Fc domains, or Fc partial domains, in any one
biomimetic molecules of the present invention can be derived from
immunoglobulin from more than one (e.g., from two, three, four,
five, or more) species. However, they will more commonly be derived
from a single species. In addition, it will be appreciated that any
of the methods disclosed herein (e.g., methods of treatment) can be
applied to any species. Generally, the components of a biomimetic
applied to a species of interest will all be derived from that
species. However, biomimetics in which all the components are of a
different species or are from more than one species (including or
not including the species to which the relevant method is applied)
can also be used.
[0152] The specific CH1, CH2, CH3 and CH4 domains and hinge regions
that comprise the Fc domains and Fc partial domains of the
stradomers and other biomimetics of the present invention may be
independently selected, both in terms of the immunoglobulin
subclass, as well as in the organism, from which they are derived.
Accordingly, the stradomers and other biomimetics disclosed herein
may comprise Fc domains and partial Fc domains that independently
come from various immunoglobulin types such as IgG1, Ig02, IgG3,
IgG4, IgA1, IgA2, IgD, IgE, and IgM. Similarly each Fc domain and
partial Fc domain may be derived from various species, preferably a
mammalian species, including non-human primates (e.g., monkeys,
baboons, and chimpanzees), humans, murine, rattus, bovine, equine,
feline, canine, porcine, rabbits, goats, deer, sheep, ferrets,
gerbils, guinea pigs, hamsters, bats, birds (e.g., chickens,
turkeys, and ducks), fish and reptiles to produce species-specific
or chimeric stradomer molecules.
[0153] The individual Fc domains and partial Fc domains may also be
humanized. One of skill in the art will realize that different Fc
domains and partial Fc domains will provide different types of
functionalities. For example, Fc.gamma.Rs bind specifically to IgG
immunoglobulins and not other classes of immunoglobulins. Thus, one
of skill in the art, intending to design a stradomer with multiple
Fc.gamma. receptor binding capacity, would design stradomer Fc
domains that at least incorporate the well characterized Fc
receptor binding sequences of IgG, including those in the IgG hinge
region and the IgG CH2 & CH3 domains. One of ordinary skill in
the art will also understand various deleterious consequences can
be associated with the use of particular Ig domains, such as the
anaphylaxis associated with IgA infusions. The biomimetics
disclosed herein should generally be designed to avoid such
effects, although in particular circumstances such effects may be
desirable.
[0154] The present invention also encompasses stradomers comprising
Fc domains and Fc partial domains having amino acids that differ
from the naturally-occurring amino acid sequence of the Fc domain
or Fe partial domain. Preferred Fc domains for inclusion in the
biomimetic compounds of the present invention have a measurable
specific binding affinity to either a holo-Fc.gamma. receptor or a
soluble extracellular domain portion of an Fc.gamma.R. Primary
amino acid sequences and X-ray crystallography structures of
numerous Fc domains and Fc domain monomers are available in the
art. See, e.g., Woof J M, Burton D R. Human antibody-Fc receptor
interactions illuminated by crystal structures. Nat Rev Immunol.
2004 February; 4(2):89-99. Representative Fc domains with Fc.gamma.
receptor binding capacity include the Fc domains from human
immunoglobulin G isotypes 1-4 (hIgG.sub.1-4) (SEQ ID NOs: 1, 3, 5
and 7 respectively; see also FIGS. 15A-15D). (See FIG. 2 of Robert
L. Shields, et al. High Resolution Mapping of the Binding Site on
Human IgG1 for Fc.gamma.RI, Fc.gamma.RII, Fc.gamma.RIII, and FcRn
and Design of IgG1 Variants with Improved Binding to the
Fc.gamma.R. J. Biol. Chem., February 2001; 276: 6591-6604). These
native sequences have been subjected to extensive
structure-function analysis including site directed mutagenesis
mapping of functional sequences 14. Based on these prior
structure-function studies and the available crystallography data,
one of skill in the art may design functional Fc domain sequence
variants (e.g., of SEQ ID NOs: 1, 3, 5 and 7) while preserving the
Fc domain's Fc.gamma. receptor binding capacity.
[0155] The amino acid changes may be found throughout the sequence
of the Fc domain, or be isolated to particular Fc partial domains
that comprise the Fc domain. The functional variants of the Fc
domain used in the stradomers and other biomimetics of the present
invention will have at least about 50%, 60%, 70%, 80%, 90%, 95%,
96%, 97%, 98% or 99% sequence identity to a native Fc domain.
Similarly, the functional variants of the Fc partial domains used
in the stradomers and other biomimetics of the present invention
will have at least about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%,
98% or 99% sequence identity to a native Fc partial domain.
[0156] The skilled artisan will appreciate that the present
invention further encompasses the use of functional variants of Fc
domain monomers in the construction of Fc fragment monomers, Fc
partial fragment monomers, stradomer monomers and the other
monomers of the present invention. The functional variants of the
Fc domain monomers will have at least about 50%, 60%, 70%, 80%,
90%, 95%, 96%, 97%, 98% or 99% sequence identity to a native Fc
domain monomer sequence.
[0157] Similarly, the present invention also encompasses the use of
functional variants of Fc partial domain monomers in the
construction of Fc fragment monomers, Fc partial fragment monomers,
Fc domains monomers, stradomer monomers and the other monomers of
the present invention. The functional variants of the Fc partial
domain monomers will have at least about 50%, 60%, 70%, 80%, 90%,
95%, 96%, o/0 97%, 98% or 99% sequence identity to a native Fc
partial domain monomer sequence.
[0158] The amino acid changes may decrease, increase, or leave
unaltered the binding affinity of the stradomer to the Fc.gamma.
receptor. Preferably such amino acid changes will be conservative
amino acid substitutions, however, such changes include deletions,
additions and other substitutions. Conservative amino acid
substitutions typically include changes within the following
groups: glycine and alanine; valine, isoleucine, and leucine;
aspartic acid and glutamic acid; asparagine, glutamine, serine and
threonine; lysine, histidine and arginine; and phenylalanine and
tyrosine.
[0159] The term "functional variant" as used herein refers to a
sequence related by homology to a reference sequence which is
capable of mediating the same biological effects as the reference
sequence (when a polypeptide), or which encodes a polypeptide that
is capable of mediating the same biological effects as a
polypeptide encoded by the reference sequence (when a
polynucleotide). For example, a functional variant of any of the
biomimetics herein described would have a specified homology or
identity and would be capable of immune modulation of DCs.
Functional sequence variants include both polynucleotides and
polypeptides. Sequence identity is assessed generally using BLAST
2.0 (Basic Local Alignment Search Tool), operating with the default
parameters: Filter-On, Scoring Matrix--BLOSUM62, Word Size--3, E
value--10, Gap Costs--11,1 and Alignments--50.
[0160] From the above, it will be appreciated that stradomers of
the present invention include stradomers having: (a) only naturally
occurring Fc domains; (b) a mixture of naturally occurring Fc
domains and Fc domains with altered amino acid sequences; and (c)
only Fc domains with altered amino acid sequences. All that is
required is that stradomers containing altered amino acid sequences
have at least 25%; 30%; 40%; 50%; 60%; 70%; 80%; 90%; 95%; 96%;
97%; 98%; 99%; 99.5%; or 100% or even more of the ability of a
corresponding stradomer comprising Fc domains with
naturally-occurring sequences to bind to two or more Fc.gamma.
receptors.
[0161] The aforementioned Fc.gamma. receptor binding sites
occurring in the stradomers and stradobodies of the present
invention may be altered in sequence through genetic engineering to
predictably derive binding sites with altered binding capabilities
and affinities relative to a native sequence. For example, specific
residues may be altered that reduce Fc domain binding of the
biomimetic compounds to Fc.gamma.RII while increasing binding to
Fc.gamma.RIIIa. An example of an extensive mutagenesis based
structure-function analysis for hIgG Fc.gamma. receptor binding
sequences is Robert L. Shields, et al. High Resolution Mapping of
the Binding Site on Human IgG1 for Fc.gamma.RI, Fc.gamma.RII,
Fc.gamma.RIII, and FcRn and Design of IgG1 Variants with Improved
Binding to the Fc.gamma.R. J. Biol. Chem., February 2001; 276:
6591-6604. Similar studies have been performed on murine IgG Fc
(mIgG Fc). Based on the structural and primary sequence homologies
of native IgG Fc domains across species, one of skill in the art
may translate the extensive structure-function knowledge of hIgG Fc
and mIgG Fc to rational mutagenesis of all native Fc.gamma.
receptor binding site sequences in the biomimetic compounds of the
present invention to design binding sites with particular Fc.gamma.
receptor specificities and binding affinities.
[0162] In addition to the amino acid sequence composition of native
Fc domains, the carbohydrate content of the Fc domain is known to
play an important role on Fc domain structure and binding
interactions with Fc.gamma.R. See, e.g., Robert L. Shields, et al.
Lack of Fucose on Human IgG1 N-Linked Oligosaccharide Improves
Binding to Human Fc RIII and Antibody-dependent Cellular Toxicity.
J. Biol. Chem., July 2002; 277: 26733-26740
(doi:10.1074/jbc.M202069200); Ann Wright and Sherie L. Morrison.
Effect of C2-Associated Carbohydrate Structure on Ig Effector
Function: Studies with Chimeric Mouse-Human IgG1 Antibodies in
Glycosylation Mutants of Chinese Hamster Ovary Cells. J. Immunol.,
April 1998; 160: 3393-3402. Carbohydrate content may be controlled
using, for example, particular protein expression systems including
particular cell lines or in vitro enzymatic modification. Thus, the
present invention includes stradomers and stradobodies comprising
Fc domains with the native carbohydrate content of holo-antibody
from which the domains were obtained, as well as those biomimetic
compounds have an altered carbohydrate content.
[0163] The addition to the polypeptide chain of an Fc partial
domain, a multimerization region, or glycosylation changes may
create a conformational change in the Fc domain permitting enhanced
binding of the Fc domain to an Fc.gamma. receptor. Thus, seemingly
minor changes to the polypeptide may also create a stradomer
capable of binding multiple Fc.gamma. receptors.
Partial Domains and Partial Fragments
[0164] The skilled artisan will further recognize that the Fc
domains and Fc partial domains used in the embodiments of the
present invention need not be full-length versions. That is, the
present invention encompasses the use of Fc domain monomers and Fc
partial domain monomers lacking amino acids from the amino
terminus, carboxy terminus or middle of the particular Fc domain
monomers and Fc partial domain monomers that comprise the
stradomers and other biomimetics of the present invention.
[0165] For example, the binding site on human IgG immunoglobulins
for Fc.gamma. receptors has been described (e.g. Radaev, S., Sun,
P., 2001. Recognition of Immunoglobulins by Fc.gamma. Receptors.
Molecular Immunology 38, 1073-1083; Shields, R. L. et al., 2001.
High Resolution Mapping of the Binding Site on Human IgG1 for
Fc.gamma.RI, Fc.gamma.RII, Fc.gamma.RIII, and FcRn and Design of
IgG1 Variants with Improved Binding to the Fc.gamma.R. J. Biol.
Chem. 276 (9), 6591-6604). Based on that knowledge, one may remove
amino acids from the Fc domain of these immunoglobulins and
determine the effects on the binding interaction between the Fc
domain and the receptor. Thus, the present invention encompasses
IgG Fc domains having at least about 90% of the amino acids
encompasses positions 233 through 338 of the lower hinge and CH2 as
defined in Radaev, S., Sun, P., 2001
[0166] Fc partial domains of IgG immunoglobulins of the present
invention include all or part of the hinge region, all or part of
the CH2 domain, and all or part of the CH3 domain.
[0167] The IgG Fc partial domains having only a part of the hinge
region, part of the CH2 domain or part of the CH3 domain are
constructed from Fc partial domain monomers. Thus, the present
invention includes IgG hinge region monomers derived from the
N-terminus of the hinge region or the C-terminus of the hinge
region. They can thus contain, for example, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45,
46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, or
62 (up to 15 for IgG1, up to 12 for IgG2, up to 62 for IgG3, up to
12 for IgG4) amino acids of the hinge region.
[0168] The present invention also includes IgG CH2 domain monomers
derived from the N-terminus of the CH2 domain or the C-terminus of
the CH2 domain. They can thus contain, for example, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26,
27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43,
44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60,
61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77,
78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94,
95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108,
109, or 110 (up to 110 for IgG1 and IgG3, up to 109 for IgG2 and
IgG4) amino acids of the CH2 domain.
[0169] The present invention further includes IgG CH3 domain
monomers derived from the N-terminus of the CH3 domain or the
C-terminus of the CH3 domain. They can thus contain, for example,
5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73,
74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, or 107 (up to 106 for IgG1 and IgG3, up to 107 for IgG2 and
IgG4) amino acids of the CH3 domain.
[0170] Fc partial domains of IgA1, IgA2 and IgD immunoglobulins of
the present invention include all or part of the hinge region, all
or part of the CH2 domain, and all or part of the CH3 domain.
Moreover all or part of the CH1 domain of the IgA1, IgA2, or IgD
immunoglobulin can be used as Fc partial domains.
[0171] The IgA1, IgA2 and IgD partial domains having only a part of
the hinge region, part of the CH1 domain, part of the CH2 domain or
part of the CH3 domain are constructed from Fc partial domain
monomers. Thus, the present invention includes hinge region
monomers derived from the N-terminus of the hinge region or the
C-terminus of the hinge region of IgA1, IgA2 or IgD. They can thus
contain, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,
34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50,
51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, or 64 (up to 26
for IgA1, up to 13 for IgA2, up to 64 for IgD) amino acids of the
hinge region.
[0172] The present invention includes CH2 domain monomers derived
from the N-terminus of the CH2 domain or the C-terminus of the CH2
domains of IgA1, IgA2 or IgD. They can thus contain, for example,
5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73,
74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, or 107 (up to 102 for IgA1, up to 96 for IgA2, up to 107 for
IgD) amino acids of the CH2 domain.
[0173] The present invention includes CH3 domains derived from the
N-terminus of the CH3 domain or the C-terminus of the CH3 domains
of IgA1, IgA2 or IgD. They can thus contain, for example, 5, 6, 7,
8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41,
42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58,
59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75,
76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92,
93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107,
108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120,
121, 122, 123, 124, 125, 126, 127, 128, 129, 130, or 131 (up to 113
for IgA1, up to 131 for IgA2, up to 110 for IgD) amino acids of the
CH3 domain.
[0174] Fc partial domains of IgM and IgE immunoglobulins of the
present invention include all or part of the hinge/CH2 domain, all
or part of the CH3 domain, and all or part of the CH4 domain of
these molecules. Moreover all or part of the CH1 domain of the IgM
and IgE immunoglobulins can be used as Fc partial domains.
[0175] The IgM and IgE partial domains having only a part of the
hinge CH2 domain, part of the CH3 domain, or part of the CH4 domain
are constructed from Fc partial domain monomers. Thus, the present
invention includes hinge/CH2 domain monomers derived from the
N-terminus of the hinge/CH2 domain or the C-terminus of the
hinge/CH2 domain of IgM or IgE. They can thus contain, for example,
5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73,
74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, 107, 108, 109, 110, 111, or 112 (up to 112 for IgM, up to 109
for IgE) amino acids of the hinge/CH2 domain.
[0176] The present invention includes IgM and IgE CH3 domain
monomers derived from the N-terminus of the CH3 domain or the
C-terminus of the CH3 domain of IgM or IgE. They can thus contain,
for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103,
104, 105, or 106 (up to 106 for IgM, up to 105 for IgE) amino acids
of the CH3 domain.
[0177] The present invention includes IgM and IgE CH4 domain
monomers derived from the N-terminus of the CH4 domain or the
C-terminus of the CH4 domain of IgM or IgE. They can thus contain,
for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103,
104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116,
117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or
130 (up to 130 for IgM, up to 105 for IgE) amino acids of the CH4
domain. However, parts of the CH4 domain of IgM or IgE that include
the C-terminal end of the CH4 domain will preferably be more than
18 amino acids in length, and more preferably will be more than 30
amino acids in length, and most preferably will be more than 50
amino acids in length.
[0178] From the above, it will be appreciated that different
embodiments of the present invention include stradomers containing:
(a) full-length Fc domains; (b) a mixture of full-length Fc domains
and Fc partial domains; and (c) Fc partial domains. In each of
these embodiments, the stradomers may further comprise CH1 domains.
As discussed herein, in each embodiment of the stradomers of the
present invention, the stradomers have the ability to bind two or
more Fc.gamma. receptors.
[0179] Preferred Embodiments of Stradomers and Stradomer
Monomers
[0180] The following are examples of stradomer monomers of the
present invention: [0181] 1. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1
hinge-IgG1 CH2-IgG1 CH3 [0182] 2. IgG1 hinge-IgG3 CH2-IgG1 CH3-IgG1
hinge-IgG1 CH2-IgG1 CH3 [0183] 3. IgG1 hinge-IgG1 CH2-IgG3 CH3-IgG1
hinge-IgG1 CH2-IgG1 CH3 [0184] 4. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG3
hinge-IgG1 CH2-IgG1 CH3 [0185] 5. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1
hinge-IgG3 CH2-IgG1 CH3 [0186] 6. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1
hinge-IgG1 CH2-IgG3 CH3 [0187] 7. IgG1 hinge-IgG3 CH2-IgG1 CH3-IgG3
hinge-IgG1 CH2-IgG1 CH3 [0188] 8. IgG3 hinge-IgG1 CH2-IgG1 CH3-IgG1
hinge-IgG1 CH2-IgG1 CH3 [0189] 9. IgG3 hinge-IgG1 CH2-IgG1 CH3-IgG3
hinge-IgG1 CH2-IgG1 CH3 [0190] 10. IgG3 hinge-IgG1 CH2-IgG1
CH3-IgG1 hinge-IgG1 CH2-IgG3 CH3-IgG1 hinge-IgG3 CH2-IgG3 CH3
[0191] 11. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG3 hinge-IgG3 CH2-IgG3
CH3-IgG1 hinge-IgG1 CH2-IgG1 CH3 [0192] 12. IgG1 hinge-IgG1
CH2-IgG1 CH3-IgG3 hinge-IgG1 hinge-IgG3 CH2-IgG3 CH3-IgG1
hinge-IgG1 CH2-IgG1 CH3 [0193] 13. IgG1 hinge-IgG1 CH2-IgG1
CH3-IgG3 hinge-IgG3 CH2-IgG3 CH3-IgG1 hinge-IgG2 CH2-IgG3 CH3.
[0194] 14. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG4 hinge-IgG4 CH2-IgG4
CH3-IgG1 hinge-IgG1 CH2-IgG1 CH3
[0195] In each of these embodiments, and the other embodiments
presented herein, it will be understood that domain linkages may be
used to link the individual Fc partial domain monomers that make up
the stradomer monomers. In one embodiment, the Fc partial domain
monomers shown for each of the stradomer monomers set forth above
are human Fc partial domain monomers.
[0196] The present invention includes stradomers comprising two or
more of the stradomer monomers listed above. In preferred
embodiments, the present invention includes serial stradomers
comprising two identical stradomer monomers provided above.
[0197] As indicated above, the stradomer functionality of binding
more than one Fc.gamma. receptor can also be achieved by
incorporating a J chain as a core moiety in a core stradomer,
similar to a natural IgM or IgA molecule. In native IgA and IgM
immunoglobulins the joining (J) chain is a 15 kDa peptide that
joins the heavy and light chains of IgA and IgM antibodies through
disulfide bridges with an 18 amino acid "secretory tailpiece" of
the Fc portions of the antibodies. Braathen, R., et al., The
Carboxyl-terminal Domains of IgA and IgM Direct Isotype-specific
Polymerization and Interaction with the Polymeric Immunoglobulin
Receptor, J. Bio. Chem. 277(45), 42755-42762 (2002).
[0198] Such core stradomers may be comprised of stradomer monomers
containing a naturally occurring CH4 Fc domain, preferably from IgM
immunoglobulins, thereby permitting association of the stradomers
comprising such stradomer monomers to a J chain (see FIGS.
10A-10D). The following are examples of stradomer monomers which
can self-dimerize to form a stradomer and then be associated with a
J chain to form a core stradomer composed of a plurality (e.g.,
two, three, four, five, six, seven, eight, nine, ten, eleven,
twelve, fifteen, eighteen, twenty, or more) of stradomers: [0199]
1. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1 hinge-IgG1 CH2-IgG1 CH3-IgM
CH4 (see FIGS. 10C-10D) [0200] 2. IgG1 hinge-IgG3 CH2-IgG1 CH3-IgG1
hinge-IgG1 CH2-IgG1 CH3-IgM CH4 [0201] 3. IgG1 hinge-IgG1 CH2-IgG3
CH3-IgG1 hinge-IgG1 CH2-IgG1 CH3-IgM CH4 (see FIGS. 10A-10B) [0202]
4. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG3 hinge-IgG1 CH2-IgG1 CH3-IgM
CH4 [0203] 5. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1 hinge-IgG3 CH2-IgG1
CH3-IgM CH4 [0204] 6. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1 hinge-IgG1
CH2-IgG1 CH3-IgM CH4 [0205] 7. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgG1
hinge-IgG1 CH2-IgG3 CH3-IgM CH4 [0206] 8. IgG1 hinge-IgG3 CH2-IgG1
CH3-IgG3 hinge-IgG1 CH2-IgG1 CH3-IgM CH4 [0207] 9. IgG3 hinge-IgG1
CH2-IgG1 CH3-IgG1 hinge-IgG1 CH2-IgG1 CH3-IgM CH4 [0208] 10. IgG3
hinge-IgG1 CH2-IgG1 CH3-IgG3 hinge-IgG1 CH2-IgG1 CH3-IgM CH4 [0209]
11. IgG3 hinge-IgG1 CH2-IgG1 CH3-IgG1 hinge-IgG1 CH2-IgG1
hinge-IgG3 CH2-IgG3 CH3-IgM CH4
[0210] In each of these embodiments, and the other embodiments
presented herein, it will be understood that domain linkages may be
used to link the individual Fc partial domain monomers that make up
the stradomer monomers. In one embodiment, the Fc partial domain
monomers shown for each of the stradomer monomers set forth above
are human Fc partial domain monomers.
[0211] Core stradomers based on a J chain may be also be comprised
of Fc fragments, Fc partial fragments and/or Fe domains that have a
CH4 Fe domain. In this example, each of the Fc fragments, Fc
partial fragments and Fe domains having a CH4 Fe domain linked to
the core moiety may contain only one Fc receptor binding site but
in the context of such a core stradomer, forms a biologically
active biomimetic containing more than one Fc receptor binding
site. A skilled artisan will recognize that the Fc partial domains
from different native immunoglobulins can be used to generate the
functional Fc fragments, Fc partial fragments and Fe domains of
such a core stradomer. The following are examples of monomers of Fc
fragments, Fc partial fragments and Fe domains which can
self-dimerize and then be associated with a J chain to form a core
stradomer: [0212] 1. IgG1 hinge-IgG1 CH2-IgG1 CH3-IgM CH4 [0213] 2.
IgG3 hinge-IgG1 CH2-IgG1 CH3-IgM CH4 [0214] 3. IgG1 hinge-IgG3
CH2-IgG1 CH3-IgM CH4 [0215] 4. IgG1 hinge-IgG1 CH2-IgG3 CH3-IgM CH4
[0216] 5. IgG1 hinge-IgG3 CH2-IgG3 CH3-IgM CH4 [0217] 6. IgG3
hinge-IgG3 CH2-IgG1 CH3-IgM CH4 [0218] 7. IgG3 hinge-IgG3 CH2-IgG1
CH3-IgM CH4 [0219] 8. IgG1 hinge-IgG3 CH2-IgG2 CH3-IgM CH4 [0220]
9. IgG1 hinge-IgG3 hinge-IgG3 CH2-IgG2 CH3-IgM CH4 [0221] 10. IgG1
hinge-IgG1 CH2-IgG1 CH3-IgE CH4-IgM CH4
[0222] In each of these embodiments, and the other embodiments
presented herein, it will be understood that domain linkages may be
used to link the individual Fc partial domain monomers that make up
the stradomer monomers. In one embodiment, the Fc partial domain
monomers shown for each of the stradomer monomers set forth above
are human Fc partial domain monomers.
[0223] It is clear from the above examples that stradomer monomers
can be of differing lengths and compositions to accomplish the
goal, when associated through self-aggregation or inter-stradomer
monomer linkages to a second stradomer monomer and associated with
a J chain, producing a core stradomer containing more than one Fc
receptor binding site. The examples are in no way limiting and one
skilled in the art will appreciate that multiple other stradomer
configurations in stradomers are possible.
Fc.gamma. Receptors
[0224] The terms "Fc.gamma.R" and "Fc.gamma. receptor" as used
herein includes each member of the Fe gamma receptor family of
proteins expressed on immune cell surfaces as described in
Nimmerjahn F and Ravetch J V. Fcgamma receptors: old friends and
new family members. Immunity. 2006 January; 24(1):19-28, or as may
later be defined. It is intended that the term "Fc.gamma.R" herein
described encompasses all members of the Fe gamma RI, RII, and RIII
families. Fc receptor includes low affinity and high affinity Fc
receptors, including but not limited to Fc.gamma.RI (CD64);
Fc.gamma.RII (CD32) and its isotypes and allotypes Fc.gamma.RIIa
LR, Fc.gamma.RIIa HR, Fc.gamma.RIIb, and Fc.gamma.RIIc;
Fc.gamma.RIII (CD16) and its isotypes Fc.gamma.RIIIa and
Fc.gamma.RIIIb. A skilled artisan will recognize that the present
invention, which includes compounds that bind to Fc.gamma.R, will
apply to future Fc.gamma.Rs and associated isotypes and allotypes
that may not yet have been discovered.
[0225] It has been described that IVIG binds to and fully saturates
the neonatal Fc receptor ("FcRn") and that such competitive
inhibition of FcRn may play an important role in the biological
activity of IVIG (e.g. Mechanisms of Intravenous Immunoglobulin
Action in Immune Thrombocytopenic Purpura. F. Jin, J. Balthasar.
Human Immunology, 2005, Volume 66, Issue 4, Pages 403-410.) Since
immunoglobulins that bind strongly to Fc.gamma. receptors also bind
at least to some degree to FcRn, a skilled artisan will recognize
that stradomers which are capable of binding to more than one
Fc.gamma. receptor will also bind to and may fully saturate the
FcRn.
[0226] "Immunological activity of aggregated native IgG" refers to
the properties of multimerized IgG which impact the functioning of
an immune system upon exposure of the immune system to the IgG
aggregates. Specific properties of native multimerized IgG includes
altered specific binding to Fc.gamma.Rs, cross-linking of
Fc.gamma.Rs on the surfaces of immune cells, or an effector
functionality of multimerized IgG such as antibody dependent
cell-mediated cytotoxicity (ADCC), phagocytosis (ADCP), or
complement fixation (See, e.g., Nimmerjahn F, Ravetch J V. The
anti-inflammatory activity of IgG: the intravenous IgG paradox. J
Exp Med. 2007; 204:11-15; Augener W, Friedman B, Brittinger G. Are
aggregates of IgG the effective part of high-dose immunoglobulin
therapy in adult idiopathic thrombocytopenic purpura (ITP)? Blut.
1985; 50:249-252; Arase N, Arase H, Park S Y, Ohno H, Ra C, Saito
T. Association with FcRgamma is essential for activation signal
through NKR-P1 (CD161) in natural killer (NK) cells and NK1.1+ T
cells. J Exp Med. 1997; 186:1957-1963; Teeling J L, JansenHendriks
T, Kuijpers T W, et al. Therapeutic efficacy of intravenous
immunoglobulin preparations depends on the immunoglobulin G dimers:
studies in experimental immune thrombocytopenia. Blood. 2001;
98:1095-1099; Anderson C F, Mosser D M. Cutting edge: biasing
immune responses by directing antigen to macrophage Fc gamma
receptors. J Immunol. 2002; 168:3697-3701; Jefferis R, Lund J.
Interaction sites on human IgG-Fc for Fc[gamma]R: current models.
Immunology Letters. 2002; 82:57; Banki Z, Kacani L, Mullauer B, et
al. Cross-Linking of CD32 Induces Maturation of Human
MonocyteDerived Dendritic Cells Via NF-{kappa}B Signaling Pathway.
J Immunol. 2003; 170:3963-3970; Siragam V, Brine D, Crow A R, Song
S, Freedman J, Lazarus A H. Can antibodies with specificity for
soluble antigens mimic the therapeutic effects of intravenous IgG
in the treatment of autoimmune disease? J Clin Invest. 2005;
115:155160). These properties are generally evaluated by comparison
to the properties of monomeric IgG.
[0227] "Comparable to or superior to an Fc.gamma. receptor
cross-linking or an effector functionality of a plurality of
naturally-occurring, aggregated IgG immunoglobulins" as used herein
means the stradomer generates an assay value of about 70% or more
of the value achieved using IVIG. In some embodiments, the assay
value is at least within the standard error range of the assay
values achieved using IVIG. In other embodiments, the assay value
is 110% or higher than that of IVIG. Assays for Fc.gamma.R
cross-linking are well known to those of ordinary skill in the art
(see e.g., Falk Nimmerjahn and Jeffrey Ravetch. Fc.gamma. receptors
as regulators of immune responses. Nature Reviews Immunology,
advanced published on line Dec. 7, 2007).
[0228] "Immune modulating activities," "modulating immune
response," "modulating the immune system," and "immune modulation"
mean altering immune systems by changing the activities,
capacities, and relative numbers of one or more immune cells,
including maturation of a cell type within its cell type or into
other cell types. For example, immune modulation of immature
monocytes may lead to greater populations of more mature monocytes,
dendritic cells, macrophages, or osteoclasts, all of which are
derived from immature monocytes. For example, immune cell receptors
may be bound by immunologically active biomimetics and activate
intracellular signaling to induce various immune cell changes,
referred to separately as "activating immune modulation."
Blockading immune cell receptors to prevent receptor activation is
also encompassed within "immune modulation" and may be separately
referred to as "inhibitory immune modulation."
[0229] Modulation of maturation of a monocyte refers to the
differentiation of a monocyte into a mature DC, a macrophage, or an
osteoclast. Differentiation may be modulated to accelerate the rate
of maturation and/or to increase the number of monocytes undergoing
differentiation. Alternatively, differentiation may be reduced in
terms of rate of differentiation and/or number of cells undergoing
differentiation.
[0230] The term "isolated" polypeptide or peptide as used herein
refers to a polypeptide or a peptide which either has no
naturally-occurring counterpart or has been separated or purified
from components which naturally accompany it, e.g., in tissues such
as pancreas, liver, spleen, ovary, testis, muscle, joint tissue,
neural tissue, gastrointestinal tissue, or breast tissue or tumor
tissue (e.g., breast cancer tissue), or body fluids such as blood,
serum, or urine. Typically, the polypeptide or peptide is
considered "isolated" when it is at least 70%, by dry weight, free
from the proteins and other naturally-occurring organic molecules
with which it is naturally associated. Preferably, a preparation of
a polypeptide (or peptide) of the invention is at least 80%, more
preferably at least 90%, and most preferably at least 99%, by dry
weight, the polypeptide (peptide), respectively, of the invention.
Since a polypeptide or peptide that is chemically synthesized is,
by its nature, separated from the components that naturally
accompany it, the synthetic polypeptide or peptide is
"isolated."
[0231] An isolated polypeptide (or peptide) of the invention can be
obtained, for example, by extraction from a natural source (e.g.,
from tissues or bodily fluids); by expression of a recombinant
nucleic acid encoding the polypeptide or peptide; or by chemical
synthesis. A polypeptide or peptide that is produced in a cellular
system different from the source from which it naturally originates
is "isolated," because it will necessarily be free of components
which naturally accompany it. The degree of isolation or purity can
be measured by any appropriate method, e.g., column chromatography,
polyacrylamide gel electrophoresis, or HPLC analysis.
Pharmaceutical Compositions
[0232] Administration of the immunologically active biomimetic
compositions described herein will be via any common route, orally,
parenterally, or topically. Exemplary routes include, but are not
limited to oral, nasal, buccal, rectal, vaginal, ophthalmic,
subcutaneous, intramuscular, intraperitoneal, intravenous,
intraarterial, intratumoral, spinal, intrathecal, intra-articular,
intra-arterial, sub-arachnoid, sublingual, oral mucosal, bronchial,
lymphatic, intra-uterine, subcutaneous, intratumor, integrated on
an implantable device, intradural, intracortical, or dermal. Such
compositions would normally be administered as pharmaceutically
acceptable compositions as described herein. In a preferred
embodiment the isolated immunologically active biomimetic is
administered intravenously.
[0233] The term "pharmaceutically acceptable carrier" as used
herein includes any and all solvents, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents and the like. The use of such media and agents for
pharmaceutically active substances is well known in the art. Except
insofar as any conventional media or agent is incompatible with the
vectors or cells of the present invention, its use in therapeutic
compositions is contemplated. Supplementary active ingredients also
can be incorporated into the compositions.
[0234] The immunologically active biomimetic compositions of the
present invention may be formulated in a neutral or salt form.
Pharmaceutically-acceptable salts include the acid addition salts
(formed with the free amino groups of the protein) and which are
formed with inorganic acids such as, for example, hydrochloric or
phosphoric acids, or such organic acids as acetic, oxalic,
tartaric, mandelic, and the like. Salts formed with the free
carboxyl groups can also be derived from inorganic bases such as,
for example, sodium, potassium, ammonium, calcium, or ferric
hydroxides, and such organic bases as isopropylamine,
trimethylamine, histidine, procaine and the like.
[0235] Sterile injectable solutions are prepared by incorporating
the immunologically active biomimetic in the required amount in the
appropriate solvent with various of the other ingredients
enumerated above, as required, followed by filtered sterilization.
Generally, dispersions are prepared by incorporating the various
sterilized active ingredients into a sterile vehicle which contains
the basic dispersion medium and the required other ingredients from
those enumerated above. In the case of sterile powders for the
preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum-drying and freeze-drying techniques which
yield a powder of the active ingredient plus any additional desired
ingredient from a previously sterile-filtered solution thereof
[0236] Further, one embodiment is an immunologically active
biomimetic composition suitable for oral administration is provided
in a pharmaceutically acceptable carrier with or without an inert
diluent. The carrier should be assimmable or edible and includes
liquid, semi-solid, i.e., pastes, or solid carriers. Except insofar
as any conventional media, agent, diluent or carrier is detrimental
to the recipient or to the therapeutic effectiveness of an
immunologically active biomimetic preparation contained therein,
its use in an orally administrable an immunologically active
biomimetic composition for use in practicing the methods of the
present invention is appropriate. Examples of carriers or diluents
include fats, oils, water, saline solutions, lipids, liposomes,
resins, binders, fillers and the like, or combinations thereof. The
term "oral administration" as used herein includes oral, buccal,
enteral or intragastric administration.
[0237] In one embodiment, the composition is combined with the
carrier in any convenient and practical manner, i.e., by solution,
suspension, emulsification, admixture, encapsulation,
microencapsulation, absorption and the like. Such procedures are
routine for those skilled in the art.
[0238] In a specific embodiment, the immunologically active
biomimetic composition in powder form is combined or mixed
thoroughly with a semi-solid or solid carrier. The mixing can be
carried out in any convenient manner such as grinding. Stabilizing
agents can be also added in the mixing process in order to protect
the composition from loss of therapeutic activity through, i.e.,
denaturation in the stomach. Examples of stabilizers for use in an
orally administrable composition include buffers, antagonists to
the secretion of stomach acids, amino acids such as glycine and
lysine, carbohydrates such as dextrose, mannose, galactose,
fructose, lactose, sucrose, maltose, sorbitol, mannitol, etc.,
proteolytic enzyme inhibitors, and the like. More preferably, for
an orally administered composition, the stabilizer can also include
antagonists to the secretion of stomach acids.
[0239] Further, the immunologically active biomimetic composition
for oral administration which is combined with a semi-solid or
solid carrier can be further formulated into hard or soft shell
gelatin capsules, tablets, or pills. More preferably, gelatin
capsules, tablets, or pills are enterically coated. Enteric
coatings prevent denaturation of the composition in the stomach or
upper bowel where the pH is acidic. See, i.e., U.S. Pat. No.
5,629,001. Upon reaching the small intestines, the basic pH therein
dissolves the coating and permits the composition to be released to
interact with intestinal cells, e.g., Peyer's patch M cells.
[0240] In another embodiment, the immunologically active biomimetic
composition in powder form is combined or mixed thoroughly with
materials that create a nanoparticle encapsulating the
immunologically active biomimetic or to which the immunologically
active biomimetic is attached. Each nanoparticle will have a size
of less than or equal to 100 microns. The nanoparticle may have
mucoadhesive properties that allow for gastrointestinal absorption
of an immunologically active biomimetic that would otherwise not be
orally bioavailable.
[0241] In another embodiment, a powdered composition is combined
with a liquid carrier such as, i.e., water or a saline solution,
with or without a stabilizing agent.
[0242] A specific immunologically active biomimetic formulation
that may be used is a solution of immunologically active biomimetic
protein in a hypotonic phosphate based buffer that is free of
potassium where the composition of the buffer is as follows: 6 mM
sodium phosphate monobasic monohydrate, 9 mM sodium phosphate
dibasic heptahydrate, 50 mM sodium chloride, pH 7.0.+/-0.1. The
concentration of immunologically active biomimetic protein in a
hypotonic buffer may range from 10 microgram/ml to 100
milligram/ml. This formulation may be administered via any route of
administration, for example, but not limited to intravenous
administration.
[0243] Further, an immunologically active biomimetic composition
for topical administration which is combined with a semi-solid
carrier can be further formulated into a cream or gel ointment. A
preferred carrier for the formation of a gel ointment is a gel
polymer. Preferred polymers that are used to manufacture a gel
composition of the present invention include, but are not limited
to carbopol, carboxymethyl-cellulose, and pluronic polymers.
Specifically, a powdered Fc multimer composition is combined with
an aqueous gel containing a polymerization agent such as Carbopol
980 at strengths between 0.5% and 5% wt/volume for application to
the skin for treatment of disease on or beneath the skin. The term
"topical administration" as used herein includes application to a
dermal, epidermal, subcutaneous or mucosal surface.
[0244] Upon formulation, solutions are administered in a manner
compatible with the dosage formulation and in such amount as is
therapeutically effective to result in an improvement or
remediation of the symptoms. The formulations are easily
administered in a variety of dosage forms such as ingestible
solutions, drug release capsules and the like. Some variation in
dosage can occur depending on the condition of the subject being
treated. The person responsible for administration can, in any
event, determine the appropriate dose for the individual subject.
Moreover, for human administration, preparations meet sterility,
general safety and purity standards as required by FDA Office of
Biologics standards.
[0245] The route of administration will vary, naturally, with the
location and nature of the disease being treated, and may include,
for example intradermal, transdermal, parenteral, intravenous,
intramuscular, intranasal, subcutaneous, percutaneous,
intratracheal, intraperitoneal, intratumoral, perfusion, lavage,
direct injection, and oral administration.
[0246] The term "parenteral administration" as used herein includes
any form of administration in which the compound is absorbed into
the subject without involving absorption via the intestines.
Exemplary parenteral administrations that are used in the present
invention include, but are not limited to intramuscular,
intravenous, intraperitoneal, intratumoral, intraocular, or
intraarticular administration.
[0247] Below are specific examples of various pharmaceutical
formulation categories and preferred routes of administration, as
indicated, for specific exemplary diseases:
[0248] Buccal or sub-lingual dissolvable tablet: angina,
polyarteritis nodosa.
[0249] Intravenous: Idiopathic Thrombocytopenic Purpura, Inclusion
Body Myositis, Paraproteinemic IgM demyelinating Polyneuropathy,
Necrotizing fasciitis, Pemphigus, Gangrene, Dermatomyositis,
Granuloma, Lymphoma, Sepsis, Aplastic anemia, Multisystem organ
failure, Multiple Myeloma and Monoclonal Gammopathy of Unknown
Significance, Chronic Inflammatory Demyelinating
Polyradiculoneuropathy, Inflammatory Myopathies, Thrombotic
thrombocytopenic purpura, Myositis, Anemia, Neoplasia, Hemolytic
anemia, Encephalitis, Myelitis, Myelopathy especially associated
with Human T-cell lymphotropic virus-1, Leukemia, Multiple
sclerosis and optic neuritis, Asthma, Epidermal necrolysis,
Lambert-Eaton myasthenic syndrome, Myasthenia gravis, Neuropathy,
Uveitis, Guillain-Barre syndrome, Graft Versus Host Disease, Stiff
Man Syndrome, Paraneoplastic cerebellar degeneration with anti-Yo
antibodies, paraneoplastic encephalomyelitis and sensory neuropathy
with anti-Hu antibodies, systemic vasculitis, Systemic Lupus
Erythematosus, autoimmune diabetic neuropathy, acute idiopathic
dysautonomic neuropathy, Vogt-Koyanagi-Harada Syndrome, Multifocal
Motor Neuropathy, Lower Motor Neuron Syndrome associated with
anti-/GM1, Demyelination, Membranoproliferative glomerulonephritis,
Cardiomyopathy, Kawasaki's disease, Rheumatoid arthritis, and
Evan's syndrome IM--ITP, CIDP, MS, dermatomyositis, mysasthenia
gravis, muscular dystrophy. The term "intravenous administration"
as used herein includes all techniques to deliver a compound or
composition of the present invention to the systemic circulation
via an intravenous injection or infusion.
[0250] Dermal gel, lotion, cream or patch: vitiligo, Herpes zoster,
acne, chelitis.
[0251] Rectal suppository, gel, or infusion: ulcerative colitis,
hemorrhoidal inflammation.
[0252] Oral as pill, troche, encapsulated, or with enteric coating:
Crohn's disease, celiac spree, irritable bowel syndrome,
inflammatory liver disease, Barrett's esophagus.
[0253] Intra-cortical: epilepsy, Alzheimer's, multiple sclerosis,
Parkinson's Disease, Huntingdon's Disease.
[0254] Intra-abdominal infusion or implant: endometriosis.
[0255] Intra-vaginal gel or suppository: bacterial, trichomonal, or
fungal vaginitis.
[0256] Medical devices: coated on coronary artery stent, prosthetic
joints.
[0257] The immunologically active biomimetics described herein may
be administered in dosages from about 0.01 mg per kg to about 300
mg per kg body weight, and especially from 0.01 mg per kg body
weight to about 300 mg per kg body weight, and may be administered
at least once daily, weekly, biweekly or monthly. A biphasic dosage
regimen may be used wherein the first dosage phase comprises about
0.1% to about 10% of the second dosage phase.
Therapeutic Applications of Stradomers and Stradobodies
[0258] Based on rational design and in vitro and in vivo
validations, the immunologically active biomimetics of the present
invention will serve as important biopharmaceuticals for treating
autoimmune diseases and for modulating immune function in a variety
of other contexts such as bioimmunotherapy for cancer and
inflammatory diseases. Medical conditions suitable for treatment
with the immunologically active biomimetics described herein
include those currently routinely treated with hIVIG or in which
hIVIG has been found to be clinically useful such as autoimmune
cytopenias, Guillain-Barre syndrome, myasthenia gravis, anti-Factor
VIII autoimmune disease, dermatomyositis, vasculitis, and uveitis
(See, F. G. van der Meche, P. I. Schmitz, N. Engl. J. Med. 326,
1123 (1992); P. Gajdos et al., Lancet i, 406 (1984); Y. Sultan, M.
D. Kazatchkine, P. Maisonneuve, U. E. Nydegger, Lancet ii, 765
(1984); M. C. Dalakas et al., N. Engl. J. Med. 329, 1993 (1993); D.
R. Jayne, M. J. Davies, C. J. Fox, C. M. Black, C. M. Lockwood,
Lancet 337, 1137 (1991); P. LeHoang, N. Cassoux, F. George, N.
Kullmann, M. D. Kazatchkine, Ocul. Immunol. Inflamm. 8, 49 (2000))
and those cancers or inflammatory disease conditions in which a
monoclonal antibody may be used or is already in clinical use.
Conditions included among those that may be effectively treated by
the compounds that are the subject of this invention include an
inflammatory disease with an imbalance in cytokine networks, an
autoimmune disorder mediated by pathogenic autoantibodies or
autoaggressive T cells, or an acute or chronic phase of a chronic
relapsing autoimmune, inflammatory, or infectious disease or
process.
[0259] In addition, other medical conditions having an inflammatory
component will benefit from treatment with immunologically active
biomimetics such as Amyotrophic Lateral Sclerosis, Huntington's
Disease, Alzheimer's Disease, Parkinson's Disease, Myocardial
Infarction, Stroke, Hepatitis B, Hepatitis C, Human
Immunodeficiency Virus associated inflammation,
adrenoleukodystrophy, and epileptic disorders especially those
believed to be associated with postviral encephalitis including
Rasmussen Syndrome, West Syndrome, and Lennox-Gastaut Syndrome.
[0260] The general approach to therapy using the isolated
immunologically active biomimetics described herein is to
administer to a subject having a disease or condition, a
therapeutically effective amount of the isolated immunologically
active biomimetic to effect a treatment. In some embodiments,
diseases or conditions may be broadly categorized as inflammatory
diseases with an imbalance in cytokine networks, an autoimmune
disorder mediated by pathogenic autoantibodies or autoaggressive T
cells, or an acute or chronic phase of a chronic relapsing disease
or process.
[0261] The term "treating" and "treatment" as used herein refers to
administering to a subject a therapeutically effective amount of a
biomimetic of the present invention so that the subject has an
improvement in a disease or condition, or a symptom of the disease
or condition. The improvement is any improvement or remediation of
the disease or condition, or symptom of the disease or condition.
The improvement is an observable or measurable improvement, or may
be an improvement in the general feeling of well-being of the
subject. Thus, one of skill in the art realizes that a treatment
may improve the disease condition, but may not be a complete cure
for the disease. Specifically, improvements in subjects may include
one or more of: decreased inflammation; decreased inflammatory
laboratory markers such as C-reactive protein; decreased
autoimmunity as evidenced by one or more of: improvements in
autoimmune markers such as autoantibodies or in platelet count,
white cell count, or red cell count, decreased rash or purpura,
decrease in weakness, numbness, or tingling, increased glucose
levels in patients with hyperglycemia, decreased joint pain,
inflammation, swelling, or degradation, decrease in cramping and
diarrhea frequency and volume, decreased angina, decreased tissue
inflammation, or decrease in seizure frequency; decreases in cancer
tumor burden, increased time to tumor progression, decreased cancer
pain, increased survival or improvements in the quality of life; or
delay of progression or improvement of osteoporosis.
[0262] The term "therapeutically effective amount" as used herein
refers to an amount that results in an improvement or remediation
of the symptoms of the disease or condition.
[0263] As used herein, "prophylaxis" can mean complete prevention
of the symptoms of a disease, a delay in onset of the symptoms of a
disease, or a lessening in the severity of subsequently developed
disease symptoms.
[0264] The term "subject" as used herein, is taken to mean any
mammalian subject to which biomimetics of the present invention are
administered according to the methods described herein. In a
specific embodiment, the methods of the present disclosure are
employed to treat a human subject. The methods of the present
disclosure may also be employed to treat non-human primates (e.g.,
monkeys, baboons, and chimpanzees), mice, rats, bovines, horses,
cats, dogs, pigs, rabbits, goats, deer, sheep, ferrets, gerbils,
guinea pigs, hamsters, bats, birds (e.g., chickens, turkeys, and
ducks), fish and reptiles to produce species-specific or chimeric
stradomer molecules.
[0265] In particular, the biomimetics of the present invention may
be used to treat conditions including but not limited to congestive
heart failure (CHF), vasculitis, rosecea, acne, eczema, myocarditis
and other conditions of the myocardium, systemic lupus
erythematosus, diabetes, spondylopathies, synovial fibroblasts, and
bone marrow stroma; bone loss; Paget's disease, osteoclastoma;
multiple myeloma; breast cancer; disuse osteopenia; malnutrition,
periodontal disease, Gaucher's disease, Langerhans' cell
histiocytosis, spinal cord injury, acute septic arthritis,
osteomalacia, Cushing's syndrome, monoostotic fibrous dysplasia,
polyostotic fibrous dysplasia, periodontal reconstruction, and bone
fractures; sarcoidosis; osteolytic bone cancers, lung cancer,
kidney cancer and rectal cancer; bone metastasis, bone pain
management, and humoral malignant hypercalcemia, ankylosing
spondylitisa and other spondyloarthropathies; transplantation
rejection, viral infections, hematologic neoplasisas and
neoplastic-like conditions for example, Hodgkin's lymphoma;
non-Hodgkin's lymphomas (Burkitt's lymphoma, small lymphocytic
lymphoma/chronic lymphocytic leukemia, mycosis fungoides, mantle
cell lymphoma, follicular lymphoma, diffuse large B-cell lymphoma,
marginal zone lymphoma, hairy cell leukemia and lymphoplasmacytic
leukemia), tumors of lymphocyte precursor cells, including B-cell
acute lymphoblastic leukemia/lymphoma, and T-cell acute
lymphoblastic leukemia/lymphoma, thymoma, tumors of the mature T
and NK cells, including peripheral T-cell leukemias, adult T-cell
leukemia/T-cell lymphomas and large granular lymphocytic leukemia,
Langerhans cell histocytosis, myeloid neoplasias such as acute
myelogenous leukemias, including AML with maturation, AML without
differentiation, acute promyelocytic leukemia, acute myelomonocytic
leukemia, and acute monocytic leukemias, myelodysplastic syndromes,
and chronic myeloproliferative disorders, including chronic
myelogenous leukemia, tumors of the central nervous system, e.g.,
brain tumors (glioma, neuroblastoma, astrocytoma, medulloblastoma,
ependymoma, and retinoblastoma), solid tumors (nasopharyngeal
cancer, basal cell carcinoma, pancreatic cancer, cancer of the bile
duct, Kaposi's sarcoma, testicular cancer, uterine, vaginal or
cervical cancers, ovarian cancer, primary liver cancer or
endometrial cancer, tumors of the vascular system (angiosarcoma and
hemagiopericytoma)) or other cancer.
[0266] "Cancer" herein refers to or describes the physiological
condition in mammals that is typically characterized by unregulated
cell growth. Examples of cancer include but are not limited to
carcinoma, lymphoma, blastoma, sarcoma (including liposarcoma,
osteogenic sarcoma, angiosarcoma, endotheliosarcoma,
lymphangiosarcoma, lymphangioendotheliosarcoma, leiomyosarcoma,
rhabdomyosarcoma, fibrosarcoma, myxosarcoma, chondrosarcoma),
neuroendocrine tumors, mesothelioma, chordoma, synovioma,
schwanoma, meningioma, adenocarcinoma, melanoma, and leukemia or
lymphoid malignancies. More particular examples of such cancers
include squamous cell cancer (e.g. epithelial squamous cell
cancer), lung cancer including small-cell lung cancer, non-small
cell lung cancer, adenocarcinoma of the lung and squamous carcinoma
of the lung, small cell lung carcinoma, cancer of the peritoneum,
hepatocellular cancer, gastric or stomach cancer including
gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical
cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma,
breast cancer, colon cancer, rectal cancer, colorectal cancer,
endometrial or uterine carcinoma, salivary gland carcinoma, kidney
or renal cancer, prostate cancer, vulval cancer, thyroid cancer,
hepatic carcinoma, anal carcinoma, penile carcinoma, testicular
cancer, esophageal cancer, tumors of the biliary tract, Ewing's
tumor, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma,
sebaceous gland carcinoma, papillary carcinoma, papillary
adenocarcinomas, cystadenocarcinoma, medullary carcinoma,
bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct
carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms'
tumor, testicular tumor, lung carcinoma, bladder carcinoma,
epithelial carcinoma, glioma, astrocytoma, medulloblastoma,
craniopharyngioma, ependymoma, pinealoma, hemangioblastoma,
acoustic neuroma, oligodendroglioma, meningioma, melanoma,
neuroblastoma, retinoblastoma, leukemia, lymphoma, multiple
myeloma, Waldenstrom's macroglobulinemia, myelodysplastic disease,
heavy chain disease, neuroendocrine tumors, Schwanoma, and other
carcinomas, as well as head and neck cancer.
[0267] The biomimetics of the present invention may be used to
treat autoimmune diseases. The term "autoimmune disease" as used
herein refers to a varied group of more than 80 diseases and
conditions. In all of these diseases and conditions, the underlying
problem is that the body's immune system attacks the body itself.
Autoimmune diseases affect all major body systems including
connective tissue, nerves, muscles, the endocrine system, skin,
blood, and the respiratory and gastrointestinal systems. Autoimmune
diseases include, for example, systemic lupus erythematosus,
rheumatoid arthritis, multiple sclerosis, myasthenia gravis, and
type 1 diabetes.
[0268] The disease or condition treatable using the compositions
and methods of the present invention may be a hematoimmunological
process, including but not limited to Idiopathic Thrombocytopenic
Purpura, alloimmune/autoimmune thrombocytopenia, Acquired immune
thrombocytopenia, Autoimmune neutropenia, Autoimmune hemolytic
anemia, Parvovirus B 19-associated red cell aplasia, Acquired
antifactor VIII autoimmunity, acquired von Willebrand disease,
Multiple Myeloma and Monoclonal Gammopathy of Unknown Significance,
Sepsis, Aplastic anemia, pure red cell aplasia, Diamond-Blackfan
anemia, hemolytic disease of the newborn, Immune-mediated
neutropenia, refractoriness to platelet transfusion, neonatal,
post-transfusion purpura, hemolytic uremic syndrome, systemic
Vasculitis, Thrombotic thrombocytopenic purpura, or Evan's
syndrome.
[0269] The disease or condition may also be a neuroimmunological
process, including but not limited to Guillain-Barre syndrome,
Chronic Inflammatory Demyelinating Polyradiculoneuropathy,
Paraproteinemic IgM demyelinating Polyneuropathy, Lambert-Eaton
myasthenic syndrome, Myasthenia gravis, Multifocal Motor
Neuropathy, Lower Motor Neuron Syndrome associated with anti-/GM1,
Demyelination, Multiple Sclerosis and optic neuritis, Stiff Man
Syndrome, Paraneoplastic cerebellar degeneration with anit-Yo
antibodies, paraneoplastic encephalomyelitis, sensory neuropathy
with anti-Hu antibodies, epilepsy, Encephalitis, Myelitis,
Myelopathy especially associated with Human T-cell lymphotropic
virus-1, Autoimmune Diabetic Neuropathy, or Acute Idiopathic
Dysautonomic Neuropathy.
[0270] The disease or condition may also be a Rheumatic disease
process, including but not limited to Kawasaki's disease,
Rheumatoid arthritis, Felty's syndrome, ANCA-positive Vasculitis,
Spontaneous Polymyositis, Dermatomyositis, Antiphospholipid
syndromes, Recurrent spontaneous abortions, Systemic Lupus
Erythematosus, Juvenile idiopathic arthritis, Raynaud's, CREST
syndrome, or Uveitis.
[0271] The disease or condition may also be a dermatoimmunological
disease process, including but not limited to Toxic Epidermal
Necrolysis, Gangrene, Granuloma, Autoimmune skin blistering
diseases including Pemphigus vulgaris, Bullous Pemphigoid, and
Pemphigus foliaceus, Vitiligo, Streptococcal toxic shock syndrome,
Scleroderma, systemic sclerosis including diffuse and limited
cutaneous systemic sclerosis, or Atopic dermatitis (especially
steroid dependent).
[0272] The disease or condition may also be a musculoskeletal
immunological disease process, including but not limited to
Inclusion Body Myositis, Necrotizing fasciitis, Inflammatory
Myopathies, Myositis, Anti-Decorin (BJ antigen) Myopathy,
Paraneoplastic Necrotic Myopathy, X-linked Vacuolated Myopathy,
Penacillamineinduced Polymyositis, Atherosclerosis, Coronary Artery
Disease, or Cardiomyopathy.
[0273] The disease or condition may also be a gastrointestinal
immunological disease process, including but not limited to
pernicious anemia, autoimmune chronic active hepatitis, primary
biliary cirrhosis, Celiac disease, dermatitis herpetiformis,
cryptogenic cirrhosis, Reactive arthritis, Crohn's disease,
Whipple's disease, ulcerative colitis, or sclerosing
cholangitis.
[0274] The disease or condition may also be Graft Versus Host
Disease, Antibody-mediated rejection of the graft, Post-bone marrow
transplant rejection, Post-infectious disease inflammation,
Lymphoma, Leukemia, Neoplasia, Asthma, Type 1 Diabetes mellitus
with anti-beta cell antibodies, Sjogren's syndrome, Mixed
Connective Tissue Disease, Addison's disease, Vogt-Koyanagi-Harada
Syndrome, Membranoproliferative glomerulonephritis, Goodpasture's
syndrome, Graves' disease, Hashimoto's thyroiditis, Wegener's
granulomatosis, micropolyarterits, Churg-Strauss syndrome,
Polyarteritis nodosa or Multisystem organ failure.
[0275] In another embodiment, the stradomers herein described could
be utilized in a priming system wherein blood is drawn from a
patient and transiently contacted with the stradomer(s) for a
period of time from about one half hour to about three hours prior
to being introduced back into the patient. In this form of cell
therapy, the patient's own effector cells are exposed to stradomer
that is fixed on a matrix ex vivo in order to modulate the effector
cells through exposure of the effector cells to stradomer. The
blood including the modulated effector cells are then infused back
into the patient. Such a priming system could have numerous
clinical and therapeutic applications.
Therapeutic Stradobody Applications in Oncology
[0276] In addition to having clinical utility for treating
immunological disorders, stradobodies have therapeutic use in
cancer and inflammatory disease treatment. The stradobodies may be
used essentially following known protocols for any corresponding
therapeutic antibody. The stradobodies will generally be designed
to enhance the effect demonstrated on an effector cell by a
monoclonal antibody, such as ADCC in cancer or decreased monocyte
and DC maturation with decreased cytokine release in autoimmune
disease, and thereby potentiate the immune response against the
cancer relative to that which would occur using, for example, a
source monoclonal antibody for the Fab portion of the
stradobody.
[0277] Exemplary monoclonal antibody Fab domains from which a
stradobody may be designed includes cetuximab, rituximab,
muromonab-CD3, abciximab, daclizumab, basiliximab, palivizumab,
infliximab, trastuzumab, gemtuzumab ozogamicin, alemtuzumab,
ibritumomab tiuxetan, adalimumab, omalizumab, tositumomab, 1-131
tositumomab, efalizumab, bevacizumab, panitumumab, pertuzumab,
natalizumab, etanercept, IGN101, volociximab, Anti-CD80 mAb,
Anti-CD23 mAb, CAT-3888, CDP791, eraptuzumab, MDX-010, MDX-060,
MDX-070, matuzumab, CP-675,206, CAL, SGN-30, zanolimumab,
adecatumumab, oregovomab, nimotuzumab, ABT-874, denosumab, AM 108,
AMC 714, fontolizumab, daclizumab, golimumab, CNTO 1275,
ocrelizumab, HuMax-CD20, belimumab, epratuzumab, MLN1202,
visilizumab, tocilizumab, ocrerlizumab, certolizumab pegol,
eculizumab, pexelizumab, abciximab, ranibizimumab, mepolizumab, and
TNX-355, MYO-029.
[0278] The stradomers and stradobodies, collectively
immunologically active biomimetics, disclosed herein have a number
of further applications and uses.
Altering Immune Responses
[0279] The immunologically active biomimetics disclosed herein may
also be readily applied to alter immune system responses in a
variety of contexts to affect specific changes in immune response
profiles. Altering or modulating an immune response in a subject
refers to increasing, decreasing or changing the ratio or
components of an immune response. For example, cytokine production
or secretion levels may be increased or decreased as desired by
targeting the appropriate combination of FcRs with a stradomer
designed to interact with those receptors. Antibody production may
also be increased or decreased; the ratio of two or more cytokines
or immune cell receptors may be changed; or additional types of
cytokines or antibodies may be caused to be produced. The immune
response may also be an effector function of an immune cell
expressing a Fc.gamma.R, including increased or decreased
phagocytic potential of monocyte macrophage derived cells,
increased or decreased osteoclast function, increased or decreased
antigen presentation by antigen-presenting cells (e.g. DCs),
increased or decreased NK cell function, increased or decreased
B-cell function, as compared to an immune response which is not
modulated by an immunologically active biomimetic disclosed
herein.
[0280] In a preferred embodiment, a subject with cancer or an
autoimmune or inflammatory disease has their immune response
altered comprising the step of administering a therapeutically
effective amount of an immunologically active biomimetic described
herein to a subject, wherein the therapeutically effective amount
of the immunologically active biomimetic alters the immune response
in the subject. Ideally this intervention treats the disease or
condition in the subject. The altered immune response may be an
increased or a decreased response and may involve altered cytokine
levels including the levels of any of IL-6, IL-10, IL-8, IL-23,
IL-7, IL-4, IL-12, IL-13, IL-17, TNF-alpha and IFN-alpha. The
invention is however not limited by any particular mechanism of
action of the described biomimetics. The altered immune response
may be an altered autoantibody level in the subject. The altered
immune response may be an altered autoaggressive T-cell level in
the subject.
[0281] For example, reducing the amount of TNF-alpha production in
autoimmune diseases can have therapeutic effects. A practical
application of this is antiTNF-alpha antibody therapy (e.g.
REMICADE.RTM.) which is clinically proven to treat Plaque
Psoriasis, Rheumatoid Arthritis, Psoriatic Arthritis, Crohn's
Disease, Ulcerative Colitis and Ankylosing Spondylitis. These
autoimmune diseases have distinct etiologies but share key
immunological components of the disease processes related to
inflammation and immune cell activity. A stradomer designed to
reduce TNF-alpha production will likewise be effective in these and
may other autoimmune diseases. The altered immune response profile
may also be direct or indirect modulation to effect a reduction in
antibody production, for example autoantibodies targeting a
subjects own tissues, or altered autoaggressive T-cell levels in
the subject. For example, Multiple Sclerosis is an autoimmune
disorder involving autoreactive T-cells which may be treated by
interferon beta therapy. See, e.g., Zafranskaya M, et al.,
Interferon-beta therapy reduces CD4+ and CD8+ T-cell reactivity in
multiple sclerosis, Immunology 2007 May; 121(1):29-39-Epub 2006
Dec. 18. A stradomer design to reduce autoreactive T-cell levels
will likewise be effective in Multiple Sclerosis and may other
autoimmune diseases involving autoreactive T-cells.
Applications in Immunological Assays
[0282] The immunologically active biomimetics disclosed herein may
be used to perform immunological assays for testing the immune cell
functions for which the immunologically active biomimetics were
designed to modulate.
[0283] Signaling through low affinity Fc.gamma. receptor pathways
requires receptor aggregation and cross linking on the cell
surface. These aggregation and cross linking parameters are
postulated to be met through Fab binding to an antigen specific
target with subsequent interaction between the Fc region and low
affinity Fc.gamma.Rs on the surface of responding cells. In this
context, antibodies have the potential to evoke cellular responses
through two distinct pathways: 1. Fab interaction/blocking with/of
an epitope specific target and 2. Fc interactions with FcRs.
Despite this knowledge, current controls for the majority of
therapeutic studies using monoclonal antibodies employed in vivo do
not adequately address the potential of Fc: Fc.gamma. receptor
interactions as contributors to observed functional effects.
Multiple strategies are currently employed to eliminate Fc:FcR
interactions as confounding variables. For example, some studies
employ Scv (single chain variable regions) or Fab fragments, which
retain epitope specificity but lack the Fc region. These approaches
are limited by the short half life of these reagents and their
limited potential to induce signaling. Other studies employ fusion
proteins composed of a receptor or ligand fused to an Fc fragment.
While these types of approaches help to differentiate Fab specific
effects from those observed with receptor ligand interactions, they
do not effectively control for Fc mediated effects. Evaluations of
antibody based therapeutics in animal models may also employ
isotype control antibodies with an irrelevant Fab binding site. The
rationale for this choice is based on presumed functional
similarity between antibodies of the same isotype regardless of
their Fab binding specificity or affinity. However, this use of
irrelevant isotype controls has several fundamental flaws: [0284]
1. If the Fab fragments of these antibodies cannot bind a ligand or
antigenic epitope, it is likely that the Fc fragments will not
stimulate signaling through low affinity FcR interactions because
of the absence of Fc.gamma. receptor cross-linking. Therefore,
observed functional differences between experimental and control
antibodies cannot be correctly attributed to Fab interaction with
an epitope specific target lacking a means to cross-link the
Fc.gamma.R. [0285] 2. If these isotypes are produced in cells which
yield different glycoforms or different relative percentages of
individual glycoforms than the parent antibody, binding to both low
and high affinity FcRs will be altered, even if Fab affinity is
identical.
[0286] While there is no perfect control to overcome this problem,
one option is the use of isotype specific stradomers produced in
the same cells as the parent antibodies and given at a dose
proportional to the expression levels of the epitope targeted by
the experimental antibody. For example, the appropriate control for
an epitope-specific antibody produced in rat would be a rat
isotype-specific stradomer capable of aggregating Fc.gamma.
receptor on the surface of effector cells.
[0287] Generally, an immune cell is exposed to an effective amount
of an immunologically active biomimetic to modulate an activity of
an immune cell in a known way and this immune modulation is
compared to a test compound or molecule to determine if the test
compound has similar immune modulating activity.
[0288] In another embodiment, heat aggregated stradomers, and
aggregated immunoglobulins may be used as reagents for laboratory
controls in various immunological assays herein described and known
to those of ordinary skill in the art.
[0289] Immunological assays may be in vitro assays or in vivo
assays and may involve human or non-human immune cells using a
species-matched or species-unmatched immunologically active
biomimetic. In one embodiment an immunological assay is performed
by using an effective amount of the immunologically active
biomimetic to modulate an activity of an immune cell and comparing
the modulation with a modulation of an immune cell by a test
compound. The stradomer or stradobody may serve the function of a
positive control reagent in assays involving the testing of other
compounds for immunological effect. The assay may compare the
effect of the subject monoclonal antibody in comparison to the
stradomer for effector cell Fc.gamma. receptor binding and
functional response as measured by changes in receptor expression
level, cytokine release, and function such as by using a Mixed
Lymphocyte Reaction. In this manner, if a stradomer (which lacks
the Fab) generates a response which is in part similar to the
monoclonal antibody then the monoclonal antibody's effect is, in
some part, not due to specificity of its Fab but to the general
effect of binding and cross-linking more than one Fc.gamma.
receptor on the effector cell. The stradobody which contains both
this same stradomer and the Fab from this same monoclonal antibody
can further help distinguish the specificity of the monoclonal
antibody Fab from the general effect of binding and cross-linking
more than one Fc.gamma. receptor on the effector cell.
[0290] If the biological activity of a species-specific and
isotype-specific antibody is replicated in part or in whole by a
species-specific and isotype-specific stradomer then it is clear
that Fc-Fc.gamma. receptor activity accounts for the portion of
observed biological activity attributable to the species-specific
and isotype-specific stradomer. Thus species-specific and
isotype-specific stradomers are useful in assessing potential
therapeutic antibodies to determine whether and to what degree the
observed biological activity is attributable either to the Fab
portion of the test antibody or to a nonspecific effect of the Fc
portion of the molecule binding to and cross-linking more than one
Fc.gamma. receptor.
[0291] In one embodiment an isolated immunologically active
biomimetic of the present invention comprises at least one
stradomer which comprises at least two Fc domains, or partial
domains thereof, from the same immunoglobulin Fc class, where the
immunoglobulin Fc class is selected from the group consisting of
IgG1, IgG2, IgG3, IgG4 and combinations thereof. Such biomimetics
are further capable of specifically binding to a first
Fc.gamma.Rx.sub.1, wherein x.sub.1 is I, II, III, or IV and to a
second Fc.gamma.Rx.sub.2, wherein x.sub.2 is I, II, III, or IV.
These biomimetics can be further characterized as having an
immunological activity comprising an Fc.gamma. receptor
cross-linking or effector functionality comparable to or superior
to an Fc.gamma. receptor cross-linking or an effector functionality
of a plurality of naturally-occurring, aggregated IgG
immunoglobulins.
[0292] In another embodiment the present invention includes an
isolated immunologically active biomimetic that comprises at least
one stradomer comprising at least two Fc domains from different
immunoglobulin classes, or partial domains thereof, wherein the
biomimetic binds specifically to a first Fc.gamma.Rx.sub.1, wherein
x.sub.1 is I, II, III, or IV and to a second Fc.gamma.Rx.sub.2,
wherein x.sub.2 is I, II, III, or IV. This biomimetic can be
further characterized as having an immunological activity
comprising an Fc.gamma. receptor cross-linking or effector
functionality comparable to or superior to an Fc.gamma. receptor
cross-linking or an effector functionality of a plurality of
naturally-occurring, aggregated IgG immunoglobulins to
Fc.gamma.Rs.
[0293] In a further embodiment the present invention includes an
isolated immunologically active biomimetic that comprises one or
more stradomers that each independently comprises three or more Fc
domains, wherein the three or more Fc domains comprise: a) a first
Fc domain, wherein the first Fc domain comprises a Fc hinge (H) of
a first immunoglobulin, b) a second Fc domain, wherein the second
Fc domain comprises a constant region 2 (CH2) of a second
immunoglobulin, wherein the second Fc domain is capable of binding
specifically to a Fc.gamma.Rx.sub.1, wherein x.sub.1 is I, II, III,
or IV; c) a third Fc domain, wherein the third Fc domain comprises
a constant region 3 (CH3) of a third immunoglobulin, wherein the
third Fc domain is capable of binding specifically to an
Fc.gamma.Rx.sub.2, wherein x.sub.2 is I, II, III, or IV. These
biomimetics may optionally comprise a fourth Fc domain, wherein the
fourth Fc domain comprises of a constant region 4 (CH4) of a fourth
immunoglobulin IgM. With this molecule the Fc hinge may contain at
least one cysteine.
[0294] In yet another embodiment the present invention includes an
isolated immunologically active biomimetic that comprises: a) a
first Fc domain or Fc partial domain thereof, wherein the first Fc
domain comprises a Fc hinge (H) domain from a first immunoglobulin,
wherein the Fc hinge domain comprises at least one cysteine,
wherein the first Fc domain contributes to binding specificity to a
Fc.gamma.Rx, wherein x is I, II, III, or IV; and at least one of:
i) a second Fc domain or partial domain thereof, wherein the second
Fc domain comprises a constant region 2 (CH2) from a second
immunoglobulin which may or may not be the same as the first
immunoglobulin, wherein the second Fc domain contributes to binding
specificity to a Fc.gamma.Rx, wherein x is I, II, or III, IV; and,
optionally, and ii) a third Fc domain or partial domain thereof,
wherein the third Fc domain comprises a constant region 3 (CH3)
from a third immunoglobulin, wherein the third Fe domain
contributes to binding specificity to an Fc.gamma.Rx, wherein x is
I, II, III, or IV; and b), optionally, a fourth Fc domain or
partial domain thereof, wherein the fourth Fc domain specificity a
constant region 4 (CH4) from an IgM immunoglobulin.
[0295] In another embodiment, the isolated immunologically active
biomimetic is a stradomer wherein the immunoglobulin source of the
Fc domains are the same or different and include IgA isotypes, IgG
isotypes, IgD, IgE, and IgM. Another stradomer embodiment is an
isolated immunologically active biomimetic comprising a secretory
signal sequence.
[0296] In one preferred embodiment the therapeutically effective
amount of the isolated immunologically active biomimetics of the
present invention is an amount sufficient to permit binding of the
biomimetics to two or more Fc.gamma.Rx, wherein x is I, II, III, or
IV, on the surface of an immune cell, thereby causing the
Fc.gamma.Rx to aggregate. The immune cell may be any immune
effector cell such as a monocyte, a dendritic cell, a macrophage,
an osteoclast, or an NK cell. The immune effector cell's maturation
may be modulated by the immunologically active biomimetic. The
ratio of Fc.gamma.R IIa to Fc.gamma.RIIb may also become altered on
the immune cell. The immune cell may be located in the plasma, bone
marrow, gut, bone, lymphoid tissue, thymus, brain, a site of
infection or a tumor. The functional activity of a macrophage,
dendritic cell, osteoclast, or NK cell may be modulated.
[0297] The therapeutically effective amount of the isolated
immunologically active biomimetic described herein above may be
administered ex vivo to an immune cell to generate a treated immune
cell followed by the step of infusing the treated immune cell into
the subject. The treated immune cell may be a dendritic cell,
macrophage, osteoclast or a monocyte.
[0298] Additional immunotherapy may be given together with any of
the isolated immunologically active biomimetics described herein in
a therapeutically effective amount to the subject. The additional
immunotherapy may include, for example, one or more of a
co-stimulatory molecule, a monoclonal antibody, a polyclonal
antibody, a fusion protein, a biospecific antibody, a cytokine, an
immunologically recognized antigen, a small molecule anti-cancer
agent or anti-proliferative agent. The additional immunotherapy may
be administered concurrently with or separately from the
administration of the immunologically active biomimetic.
[0299] Cytokine (including those listed above) levels can be
altered by for, example, administering one or more cytokines of
interest, one or more other cytokines that modulate the level of
the one or more cytokines of interest, and/or antibodies (of any of
the types and classes recited herein) specific for one or more of
any of the above two categories of cytokines.
[0300] The immunologically active biomimetics described herein may
be used to modulate expression of co-stimulatory molecules from an
immune cell, including a dendritic cell, a macrophage, an
osteoclast, a monocyte, or an NK cell or to inhibit in these same
immune cells differentiation, maturation, or cytokine secretion,
including interleukin-12 (IL-12), or of increasing cytokine
secretion, including interleukin-10 (IL-10), or interleukin-6
(IL-6). A skilled artisan may also validate the efficacy of an
immunologically active biomimetic by exposing an immune cell to the
immunologically active biomimetic and measuring modulation of the
immune cell function, wherein the immune cell is a dendritic cell,
a macrophage, an osteoclast, or a monocyte. In one embodiment the
immune cell is exposed to the immunologically active biomimetic in
vitro and further comprising the step of determining an amount of a
cell surface receptor or of a cytokine production, wherein a change
in the amount of the cell surface receptor or the cytokine
production indicates a modulation of the immune cell function. In
another embodiment the immune cell is exposed to the
immunologically active biomimetic in vivo in a model animal for an
autoimmune disease further comprising a step of assessing a degree
of improvement in the autoimmune disease.
[0301] "Capable of specifically binding to a Fc.gamma.Rx" as used
herein refers to binding to an Fc.gamma.R, such as Fc.gamma.RIII.
Specific binding is generally defined as the amount of labeled
ligand which is displaceable by a subsequent excess of unlabeled
ligand in a binding assay. However, this does not exclude other
means of assessing specific binding which are well established in
the art (e.g., Mendel C M, Mendel D B, `Non-specific` binding. The
problem, and a solution. Biochem J. 1985 May 15; 228(1):269-72).
Specific binding may be measured in a variety of ways well known in
the art such as surface plasmon resonance (SPR) technology
(commercially available through BIACORE.RTM.) to characterize both
association and dissociation constants of the immunologically
active biomimetics (Asian K, Lakowicz J R, Geddes C. Plasmon light
scattering in biology and medicine: new sensing approaches, visions
and perspectives. Current Opinion in Chemical Biology 2005,
9:538-544).
Methods Employing Fixed Fc
[0302] In order to understand the role of Fc: Fe gamma receptor
(Fc.gamma.R, the Fc receptor for IgG Fc) interactions and the
importance to IVIG function of its Fc being biologically
immobilized within an immunoglobulin, we compared the effects of
IVIG with both a fixed form of a recombinant IgG1 Fc fragment
(rFCF) and a soluble form of a recombinant IgG1 Fc fragment (sFc)
containing the hinge-CH2-CH3 domains on the function of monocytes
during the process of differentiation from monocytes to immature
dendritic cells (iDC).
[0303] Exposure of monocytes cultured in granulocyte-macrophage
colony stimulating factor (GM-CSF) and interleukin-4 (IL-4), to
immobilized rFCF and to immobilized IVIG, but not low dose soluble
IVIG, enhanced CD86 expression, delayed the expression of CD11c,
and suppressed the expression of CD1a on the cells. Furthermore,
these changes are likely not secondary to non-specific protein
immobilization of the rFCF on plastic, as soluble heat aggregated
(sHA) IVIG, sHA rFCF or high dose IVIG (recognized to contain
multimeric Fes), induced changes similar to those observed with
immobilized rFCF.
[0304] Taken in concert, our data indicate that exposure of iDC to
IVIG immobilized on the surface of a solid, semi-solid, or
gelatinous substrate results in a unique population of DC's (high
CD86, low CD1a), capable of orchestrating immune tolerance, and
that immobilized molecules that include the functional portion of
immunoglobulin G (IgG) Fc fragments can be useful as mimetics of
IVIG for the treatment of local and systemic inflammation, as well
as a wide variety of other pathological conditions that are,
directly or indirectly, mediated by monocyte derived cells (MDC)
such as iDC. Moreover, immobilizing the functional portion of IgG
Fe on devices, described herein as "coating devices", that are
implanted into the bodies or attached to the bodies of animals
(e.g., human patients) with molecules containing the functional
portion of IgG Fc fragment can lessen, if not prevent, inflammatory
responses to such devices.
[0305] The invention provides a method of inhibiting the activity
of a monocyte-derived cell (MDC). The method includes contacting
the cell with a composition comprising a substrate with an Fc
reagent bound thereto. The contacting can be in vitro, in vivo, or
ex vivo. Alternatively, the cell can be in an animal. The animal
can be one that has, or is at risk of developing, a monocyte
derived cell mediated condition (MDCMC). The MDC can be, for
example, a dendritic cell, a macrophage, a monocyte, or an
osteoclast.
[0306] The invention also provides a method of treatment or
prophylaxis. The method that includes administering to an animal a
composition containing a substrate having an Fc reagent bound to
it, the animal being one that has or is at risk of developing a
MDCMC.
[0307] As used herein, the term "monocyte-derived cell mediated
condition (MDCMC)" refers to a pathologic condition that is
directly or indirectly, partially or wholly, due to the activity
of, or factors produced by, monocyte-derived cells. Monocytederived
cells include, but are not limited to, monocytes, macrophages,
interdigitating dendritic cells (generally referred to herein as
"dendritic cells" comprising dendritic-like cells and follicular
dendritic-like cells) (mature and immature), osteoclasts,
microglia-like cells, monocyte derived insulin-producing islet-like
cells, monocyte-derived immature mast cells and monocyte-derived
microparticles.
[0308] With respect to methods using fixed Fc, the term "Fc
reagent" refers to any molecule, or molecular complex, that
includes one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 18,
20, or more) functional portions of an immunoglobulin Ig (IgG) Fc
fragment. The Fc fragment of IgG consists of the C-terminal
portions of the two IgG heavy chains of an IgG molecule linked
together and consists of the hinge regions, the CH2 domains, and
the CH3 domains of both heavy chains linked together. The
"functional portion of the IgG Fc fragment" consists of the hinge
regions, the CH2 domains, and optionally, all or some (e.g., 1, 2,
3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, or 49) of the first 50
(from the N-terminus) amino acids of the CH3 domains, of both heavy
chains linked together. In humans, (a) the IgG1 hinge region
contains 15 amino acids, the CH2 domain contains 110 amino acids,
and the CH3 domain contains 106 amino acids; (b) the IgG2 hinge
region contains 12 amino acids, the CH2 domain contains 109 amino
acids, and the CH3 domain contains 107 amino acids; (c) the IgG3
hinge region contains 62 amino acids, the CH2 domain contains 104
amino acids, and the CH3 domain contains 106 amino acids; and (d)
the IgG4 hinge region contains 12 amino acids, the CH2 domain
contains 109 amino acids, and the CH3 domain contains 107 amino
acids.
[0309] As in wild-type IgG molecules, in the above-described Fc
reagents the two polypeptide chains derived from IgG heavy chains
are generally, but not necessarily, identical. Thus, an Fc reagent
can be, without limitation, a whole IgG molecule, a whole IgG
molecule linked to a non-immunoglobulin derived polypeptide, an IgG
Fc fragment, an IgG Fc fragment linked to a non-immunoglobulin
derived polypeptide, a functional portion of an IgG Fc fragment, a
functional portion of an IgG Fc fragment linked to a
nonimmunoglobulin derived polypeptide or multimers (e.g., dimers,
trimers, tetramers, pentamers, hexamers, heptamers, octamers,
nonamers, or decamers) of any of these. Fc reagents can also be the
above-described stradomers and stradobodies provided that they fall
within the definition of a Fc reagent above.
[0310] In the fixed Fc, immunoglobulin heavy chain components of
the Fc reagents can have wild-type amino acid sequences or they can
be wild-type amino acid sequences but with not more than 20 (e.g.,
not more than: 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6,
5, 4, 3, 2, or 1) amino acid substitutions. Such substitutions are
preferably, but not necessarily, conservative substitutions.
Conservative changes typically include changes within the following
groups: glycine and alanine; valine, isoleucine, and leucine;
aspartic acid and glutamic acid; asparagine, glutamine, serine and
threonine; lysine, histidine and arginine; and phenylalanine and
tyrosine.
[0311] An "Fe reagent" of the invention has least 25% (e.g., at
least: 30%; 40%; 50%; 60%; 70%; 80%; 90%; 95%; 98%; 99%; 99.5%; or
100% or even more) of the ability of the IgG molecule from which
the IgG heavy chain components of the Fc reagent were derived (the
reference IgG molecule) to bind to an Fc receptor of interest.
Where an "Fe reagent" has heavy chain components derived from more
than one type of IgG molecule, the reference IgG molecule is the
one that binds with the greatest avidity to the relevant Fc
receptor of interest.
[0312] As used herein "fixed Fc" refers to an Fc reagent that is
bound to a "substrate" as defined below. The terms "fixed Fe,"
"bound Fc" and "stabilized Fc" are synonymous terms. Fixed Fe is
comprised of the functional portion of Fe (including but not
limited to any polypeptide that includes the functional portion of
Fc) attached to a substrate. Fixed Fe includes, for example, direct
binding as well as indirect binding through polymers of Fe to
substrate; incorporation of the full IgG Fe in isolation;
incorporation of only the functional domains of IgG Fc; or
incorporation of the full IgG Fe or functional domains of IgG Fe as
part of a larger polypeptide such as an antibody, a stradomer, or a
stradobody.
[0313] As applied to fixed Fe, the term "substrate" refers to a
solid, semi solid, or gelatinous object. The substrate can be
implanted in, or attached (or adhered) to the surface of, the body
of an animal. The substrates can include, for example, liquid or
gaseous components but at least a portion of the substrate is
solid, semi-solid, or gelatinous. Thus, a substrate can be a
substance that is substantially insoluble in an aqueous solvent but
soluble in a non-aqueous solvent. Such substances include lipids
(e.g., phospholipids), fatty acids, and other fat-soluble, aqueous
solvent-insoluble compounds. From this, it will be clear that
substrates include liposomes. The substrate may be porous or
non-porous. In certain embodiments, the substrate is inert to the
surface and/or body to which it is implanted, attached, or
adhered.
[0314] The substrate can contain or be made of a synthetic polymer,
e.g., nylon, teflon, dacron, polyvinyl chloride, PEU (poly (ester
urethane)), PTFE (polytetrafluoroethylene), PMMA (methyl
methacrylate) PEEK, thermoplastic elastomers, radiopaque polymers,
polyethersulfone, silicons, polycarbonates, polyurethanes,
polyisobutylene and its copolymers, polyesters, polyolefins,
polyisobutylene, ethylenealphaolefin copolymers, acrylic polymers
and copolymers, vinyl halide polymers and copolymers such as
polyvinyl chloride, polyvinyl ethers, polyvinyl methyl ether,
polyvinylidene halides, polyvinylidene fluoride, polyvinylidene
chloride, polyacrylonitrile, polyvinyl ketones, polyvinyl
aromatics, polystyrene, polyvinyl esters, polyvinyl acetate,
copolymers of vinyl monomers, copolymers of vinyl monomers and
olefins, ethylene-methyl methacrylate copolymers,
acrylonitrile-styrene copolymers, ABS resins, ethylene-vinyl
acetate copolymers, polyamides, Nylon 66, polycaprolactone, alkyd
resins, polyoxyethylenes, polyimides, polyethers, epoxy resins,
rayon-triacetate, cellulose, cellulose acetate, cellulose butyrate,
cellulose acetate butyrate, cellophane, cellulose nitrate,
cellulose propionate, cellulose ethers, carboxymethyl cellulose,
collagens, chitin, polylactic acid, polyglycolic acid, polylactic
acid-polyethylene oxide copolymers, polysiloxanes, substituted
polysiloxanes, ethylene vinyl acetate copolymers, polyolefin
elastomers, and EPDM rubbers, and combinations thereof.
[0315] The substrate can also contain or be made of a metal or a
metal alloy, e.g., stainless steel, platinum, iridium, titanium,
tantalum, nickel-titanium alloy, or cobalt chromium alloy.
Moreover, the substrate can include or be an animal tissue or an
animal tissue product, e.g., a tissue or organ graft. The animal
tissue can be, for example, bone (e.g., osteogenic bone) or
cartilage. Furthermore, the substrate can contain a protein, e.g.,
collagen or keratin. The substrate can also be or contain a tissue
matrix, e.g., an acellular tissue matrix. Particulate and
non-particulate acellular matrices are described in detail in, for
example, U.S. Pat. Nos. 5,336,616 and 6,933,326, the disclosures of
which are incorporated herein by reference in their entirety. The
substrate can also be or include an animal cell (e.g., tissue
repair cells such as fibroblasts; mesenchymal stem cells) and it
can be, for example, a hair transplant plug. The substrate can
contain or be a polysaccharide, e.g., agarose. It can also contain
or be a salt, preferably a relatively insoluble salt, e.g., calcium
sulfate. The substrate can be a gel or cream. Moreover, it can
contain silicon or silastic. Substrates can also contain a natural
fiber, e.g., silk, cotton, or wool.
[0316] In addition, the substrate can be an implantable medical
device. It can be, for example, a stent (e.g., a vascular stent
such as a coronary artery stent; an airway stent such as an
endotracheal or nasal stent; a gastrointestinal stent such a
biliary or pancreatic stent; or a urinary stent such as a ureteral
stent) or a surgical suture (e.g., a braid silk, chromic gut,
nylon, plastic, or metal suture) or a surgical clip (e.g., an
aneurism clip). The substrate can be, for example, an artificial
hip, an artificial hip joint, an artificial knee, an artificial
knee joint, an artificial shoulder, an artificial shoulder joint,
an artificial finger or toe joint, a bone plate, a bone dowel, a
bone non-union implant, an intervertebral disk implant, bone
cement, or a bone cement spacer. It can also be an arterial-venous
shunt, an implantable wire, a pacemaker, an artificial heart, a
heart assist device, a cochlear implant, an implantable
defibrillator, a spinal cord stimulator, a central nervous system
stimulator, or a peripheral nerve implant. Other substrates are
dental prostheses or dental crowns.
[0317] In other embodiments, the substrate can be a large vessel
embolic filtering device or cage, a percutaneous device, a dermal
or sub-mucosal patch, or an implantable drug delivery device. The
substrate can also be a large blood vessel graft, wherein the blood
vessel is, for example, a carotid artery, a femoral artery, or an
aorta. Moreover, the substrate can be a sub-dermal implant, a
corneal implant, an intraocular lens, or a contact lens.
[0318] The substrate can be in the form of a sheet, a bead, a mesh,
a powder particle, a thread, a bead, or a fiber. It can also
include or be a solid, a semi-solid or a gelatinous substance.
[0319] Polymers useful in the invention are preferably those that
are biostable, biocompatible, particularly during insertion or
implantation of the device into the body, and avoid irritation to
body tissue.
[0320] Fc reagents can be coated (i.e., fixed or stabilized) onto
substrates in any of a variety of manners. For example, they can be
coated directly on the surface of substrates where they remain
attached by, for example, hydrophobic interactions. Below are
described a few other methodologies ((a)-(e)) involving the use of
polymers:
[0321] (a) The Fc reagent is mixed with a miscible polymer blend
which is then layered on to the surface of the implantable
synthetic material, thereby stabilizing the Fc reagent. Monomers
routinely used in the art to make polymer blends include PLMA
[poly(lauryl methacrylate)]; PEG [polyethylene glycol], PEO
[polyethylene oxide]; the alkyl functionalized methacrylate
polymers PMMA, PEMA. PPMA, and PBMA; itaconates; fumarates; and
styrenics.
[0322] (b) A polymeric undercoat layer or a nanometer dimension
film is adhered to the substrate surface and then the Fc reagent is
adhered to the polymeric undercoat layer or nanometer dimension
film, thereby stabilizing the F reagent.
[0323] (c) A thin film of a polymer monomer is applied to the
implantable substrate surface and the monomer is then caused to
polymerize Such monomers include, for example, Methane,
Tetrafluorethylene, Benzene, Methanol, Ethylene oxide, Tetraglyme,
Acrylic acid, Allylamine, Hydroxyethyl methacrylate, N-vinyl
pyrrolidone, and mercaptoethanol. The Fc reagent is then attached
to the resulting monomer.
[0324] (d) The substrate is coated with a protein such as protein A
or albumin which attaches to the Fc reagent, thereby stabilizing Fc
to the surface of the substrate.
[0325] (e) The Fc reagent can be tagged with a chain of hydrophobic
amino acids that bind to implantable synthetic materials and cause
the stabilized Fc to orient uniformly.
[0326] The methods of the invention can be applied to any animal
species and the IgG molecules from which the IgG-derived portions
of Fc reagents are made can be from any animal species. Naturally,
relevant animal species are those in which IgG or IgG-like
molecules occur. Generally the species to which the methods are
applied and the species from which the IgG-derived portions of the
Fc reagents used in the methods are the same. However, they are not
necessarily the same. Relevant animal species are preferably
mammals and these include, without limitation, humans, non-human
primates (e.g., monkeys, baboons, and chimpanzees), horses, bovine
animals (e.g., bulls, cows, or oxen), pigs, goats, sheep, dogs,
cats, rabbits, gerbils, hamsters, rats, and mice. Non-mammalian
species include, for example, birds (e.g., chickens, turkeys, and
ducks) and fish.
[0327] The terms "treating", "treatment", and "prophylaxis" have
the same meaning using fixed Fe as described above for stradomers
and stradobodies.
[0328] Where the fixed Fe are implantable devices coated with Fc
reagents, they can be implanted in, attached to, or adhered to
relevant internal organs or tissue or body surfaces of relevant
subjects using methods well known in the art. Where they are
formulated as, for example, suspensions, powders, they can be
formulated and administered as described above for stradomers and
stradobodies.
[0329] The fixed Fc reagents of the present invention may be used
to treat or prevent conditions including but not limited to cancer,
congestive heart failure (CHF), vasculitis, rosecea, acne, eczema,
myocarditis and other conditions of the myocardium, systemic lupus
erythematosus, diabetes, spondylopathies, synovial fibroblasts, and
bone marrow stroma; bone loss; Paget's disease, hypertrophic bone
formation; disuse osteopenia; malnutrition, periodontal disease,
Gaucher's disease, Langerhans' cell histiocytosis, spinal cord
injury, acute septic arthritis, osteomalacia, Cushing's syndrome,
monoostotic fibrous dysplasia, polyostotic fibrous dysplasia,
periodontal reconstruction, and bone fractures, bone pain
management, and humoral malignant hypercalcemia, ankylosing
spondylitis and other spondyloarthropathies; transplantation
rejection, and viral infections.
[0330] All autoimmune diseases may be in part or in whole an MDCMD.
The term "autoimmune disease" as used herein refers to a varied
group of more than 80 chronic illnesses. In all of these diseases,
the underlying problem is that the body's immune system attacks the
body itself. Autoimmune diseases affect all major body systems
including connective tissue, nerves, muscles, the endocrine system,
skin, blood, and the respiratory and gastrointestinal systems.
[0331] The autoimmune disease or condition may be a
hematoimmunological process, including but not limited to
Idiopathic Thrombocytopenic Purpura, alloimmune/autoimmune
thrombocytopenia, Acquired immune thrombocytopenia, Autoimmune
neutropenia, Autoimmune hemolytic anemia, Parvovirus B
19-associated red cell aplasia, Acquired antifactor VIII
autoimmunity, acquired von Willebrand disease, Multiple Myeloma and
Monoclonal Gammopathy of Unknown Significance, Sepsis, Aplastic
anemia, pure red cell aplasia, Diamond-Blackfan anemia, hemolytic
disease of the newborn, Immune-mediated neutropenia, refractoriness
to platelet transfusion, neonatal, post-transfusion purpura,
hemolytic uremic syndrome, systemic Vasculitis, Thrombotic
thrombocytopenic purpura, or Evan's syndrome.
[0332] The autoimmune disease or condition may be a
neuroimmunological process, including but not limited to
Guillain-Barre syndrome, Chronic Inflammatory Demyelinating
Polyradiculoneuropathy, Paraproteinemic IgM demyelinating
Polyneuropathy, Lambert-Eaton myasthenic syndrome, Myasthenia
gravis, Multifocal Motor Neuropathy, Lower Motor Neuron Syndrome
associated with anti-/GM1, Demyelination, Multiple Sclerosis and
optic neuritis, Stiff Man Syndrome, Paraneoplastic cerebellar
degeneration with anti-Yo antibodies, paraneoplastic
encephalomyelitis, sensory neuropathy with anti-Hu antibodies,
epilepsy, Encephalitis, Myelitis, Myelopathy especially associated
with Human T-cell lymphotropic virus-1, Autoimmune Diabetic
Neuropathy, or Acute Idiopathic Dysautonomic Neuropathy.
[0333] The autoimmune disease or condition may be a Rheumatic
disease process, including but not limited to Kawasaki's disease,
Rheumatoid arthritis, Felty's syndrome, ANCA-positive Vasculitis,
Spontaneous Polymyositis, Dermatomyositis, Antiphospholipid
syndromes, Recurrent spontaneous abortions, Systemic Lupus
Erythematosus, Juvenile idiopathic arthritis, Raynaud's, CREST
syndrome, or Uveitis.
[0334] The autoimmune disease or condition may be a
dermatoimmunological disease process, including but not limited to
Toxic Epidermal Necrolysis, Gangrene, Granuloma, Autoimmune skin
blistering diseases including Pemphigus vulgaris, Bullous
Pemphigoid, and Pemphigus foliaceus, Vitiligo, Streptococcal toxic
shock syndrome, Scleroderma, systemic sclerosis including diffuse
and limited cutaneous systemic sclerosis, or Atopic dermatitis
(especially steroid dependent).
[0335] The autoimmune disease or condition may be a musculoskeletal
immunological disease process, including but not limited to
Inclusion Body Myositis, Necrotizing fasciitis, Inflammatory
Myopathies, Myositis, Anti-Decorin (BJ antigen) Myopathy,
Paraneoplastic Necrotic Myopathy, X-linked Vacuolated Myopathy,
Penacillamine-induced Polymyositis, Atherosclerosis, Coronary
Artery Disease, or Cardiomyopathy.
[0336] The autoimmune disease or condition may be a
gastrointestinal immunological disease process, including but not
limited to pernicious anemia, autoimmune chronic active hepatitis,
primary biliary cirrhosis, Celiac disease, dermatitis
herpetiformis, cryptogenic cirrhosis, Reactive arthritis, Crohn's
disease, Whipple's disease, ulcerative colitis, or sclerosing
cholangitis.
[0337] The autoimmune disease or condition may be Graft Versus Host
Disease, Antibody-mediated rejection of the graft, Post-bone marrow
transplant rejection, Post-infectious disease inflammation,
Lymphoma, Leukemia, Neoplasia, Asthma, Type 1 Diabetes mellitus
with anti-beta cell antibodies, Sjogren's syndrome, Mixed
Connective Tissue Disease, Addison's disease, Vo gt-Koyanagi-Harada
Syndrome, Membranoproliferative glomerulonephritis, Goodpasture's
syndrome, Graves' disease, Hashimoto's thyroiditis, Wegener's
granulomatosis, micropolyarterits, Churg-Strauss syndrome,
Polyarteritis nodosa or Multisystem organ failure.
[0338] "Cancer" herein refers to or describes the physiological
condition in mammals that is typically characterized by unregulated
cell growth. Examples of cancer include but are not limited to
carcinoma, lymphoma, blastoma, sarcoma (including liposarcoma,
osteogenic sarcoma, angiosarcoma, endotheliosarcoma,
lymphangiosarcoma, lymphangioendo-theliosarcoma, leiomyosarcoma,
rhabdomyosarcoma, fibrosarcoma, myxosarcoma, chondrosarcoma),
osteoclastoma, neuroendocrine tumors, mesothelioma, chordoma,
synovioma, schwanoma, meningioma, adenocarcinoma, melanoma, and
leukemia or lymphoid malignancies. More particular examples of such
cancers include squamous cell cancer (e.g. epithelial squamous cell
cancer), lung cancer including small-cell lung cancer, non-small
cell lung cancer, adenocarcinoma of the lung and squamous carcinoma
of the lung, small cell lung carcinoma, cancer of the peritoneum,
hepatocellular cancer, gastric or stomach cancer including
gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical
cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma,
breast cancer, colon cancer, rectal cancer, colorectal cancer,
endometrial or uterine carcinoma, salivary gland carcinoma, kidney
or renal cancer, prostate cancer, vulval cancer, thyroid cancer,
hepatic carcinoma, anal carcinoma, penile carcinoma, testicular
cancer, esophageal cancer, tumors of the biliary tract, Ewing's
tumor, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma,
sebaceous gland carcinoma, papillary carcinoma, papillary
adenocarcinomas, cystadenocarcinoma, medullary carcinoma,
bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct
carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms'
tumor, testicular tumor, lung carcinoma, bladder carcinoma,
epithelial carcinoma, glioma, astrocytoma, medulloblastoma,
craniopharyngioma, ependymoma, pinealoma, hemangioblastoma,
acoustic neuroma, oligodendroglioma, meningioma, melanoma,
neuroblastoma, retinoblastoma, leukemia, lymphoma, multiple
myeloma, Waldenstrom's macroglobulinemia, myelodysplastic disease,
heavy chain disease, neuroendocrine tumors, Schwanoma, and other
carcinomas, head and neck cancer, myeloid neoplasias such as acute
myelogenous leukemias, including AML with maturation, AML without
differentiation, acute promyelocytic leukemia, acute myelomonocytic
leukemia, and acute monocytic leukemias, myelodysplastic syndromes,
and chronic myeloproliferative disorders, including chronic
myelogenous leukemia, tumors of the central nervous system, e.g.,
brain tumors (glioma, neuroblastoma, astrocytoma, medulloblastoma,
ependymoma, and retinoblastoma), solid tumors (nasopharyngeal
cancer, basal cell carcinoma, pancreatic cancer, cancer of the bile
duct, Kaposi's sarcoma, testicular cancer, uterine, vaginal or
cervical cancers, ovarian cancer, primary liver cancer or
endometrial cancer, tumors of the vascular system (angiosarcoma and
hemagiopericytoma), hematologic neoplasias and neoplastic-like
conditions for example, Hodgkin's lymphoma; non-Hodgkin's lymphomas
(Burkitt's lymphoma, small lymphocytic lymphoma/chronic lymphocytic
leukemia, mycosis fungoides, mantle cell lymphoma, follicular
lymphoma, diffuse large B-cell lymphoma, marginal zone lymphoma,
hairy cell leukemia and lymphoplasmacytic leukemia), tumors of
lymphocyte precursor cells, including B-cell acute lymphoblastic
leukemia/lymphoma, and T-cell acute lymphoblastic
leukemia/lymphoma, thymoma, tumors of the mature T and NK cells,
including peripheral T-cell leukemias, adult T-cell leukemia/T-cell
lymphomas and large granular lymphocytic leukemia, osteolytic bone
cancers, and bone metastasis.
[0339] As used herein, a subject "at risk of developing a
monocyte-derived cell mediated disease (MDCMD)" is a subject that
has a predisposition to develop the MDCMD, i.e., a genetic
predisposition to develop the MDCMD or has been exposed to
conditions that can result in MDCMD. A subject "suspected of having
a MDCMD" is one having one or more symptoms of a MDCMD. From the
above it will be clear that neither subjects "at risk of developing
a MDCMD" nor subjects "suspected of having a MDCMD" are all
individuals within a species of interest.
[0340] In any of the above methods, the MDCMC can be one caused by
the substrate and the Fc reagent serves to prevent or ameliorate
the MDCMC.
Example 1--Construct Design of Immunologically Active
Biomimetics
[0341] A sequence encoding a Fc fragment monomer from human
IgG.sub.1 (SEQ ID NO: 1) has been cloned into an expression vector
(pCDNA 3.1D/V5 His TOPO Invitrogen) comprising selected restriction
enzyme cleavage sites, an IgK signal (further defined below) and
epitope tags to create the IgG1 monomer sequence {RestEnzSites-IgK
signal-RestEnzSites-IgG1 (Hinge-CH2-CH3)-RestEnzSites-epitope tags
(V5 and His)-STOP}, shown in FIG. 17 (SEQ ID NO: 19). The construct
was transfected into CHO cells (CHO-002) for protein production.
Additionally, we have designed several stradomer constructs with
the general structures:
[0342] a) {RestEnzSites-IgK signal-RestEnz
Sites-IgG1(Hinge-CH2-CH3)-XbaI site IgG1(Hinge-CH2-CH3)-STOP} (SEQ
ID NO: 21) (see also FIG. 4A and FIG. 18a-18B);
[0343] b) {RestEnzSites-IgK signal-RestEnz
Sites-IgG1(Hinge-CH2-CH3)-XbaI site IgG1
(Hinge-CH2-CH3)-RestEnzSites-epitope tags (V5 and His)-STOP} (SEQ
ID NO: 23) (see also FIG. 19A-19B);
[0344] c) {RestEnzSites-IgK signal-EcoRV
Site-IgG3(Hinge-CH2-CH3)-IgG1(Hinge CH2-CH3)-RestEnzSites-epitope
tags(V5 and His)-STOP} (SEQ ID NO.: 25) (see also FIG. 21A-21B);
and
[0345] d) {RestEnzSites-IgK signal-EcoRV
Site-IgE(CH2)-IgG1(Hinge-CH2-CH3)-IgG1(Hinge-CH2)-IgE(CH4)-STOP}
(SEQ ID NO: 27) (see also FIG. 22A-22C).
[0346] The IgG.sub.1 stradomer construct a) (SEQ ID NO: 21; FIG.
18A-18B) was engineered using PCR. Primers complementary to the
hinge sequence (at the 5' end) of IgG1 (SEQ ID NO: 29) and to the C
terminus of the IgG.sub.1 (at the 3' end) (SEQ ID NO: 30) were used
to amplify the IgG1 Hinge-Fc region. Restriction sites were added
to the primers to permit in-frame cloning of the second Fc domain
in series with the first, which was cloned into a pcDNA cloning
vector (pCDNA 3.1DN5 His TOPO, Invitrogen). A stop codon was added
before the restriction site of the C terminal primer to prevent
read through of flanking sequences for this construct.
[0347] The stradomer construct b) (SEQ ID NO: 23; FIG. 19A-19B),
was similarly made and contained the IgG.sub.1 Fc-IgG1 Fc as
described above but also contained two epitope tags added to the C
terminus of the construct. These epitope tags are used for
identification or purification of the protein. In this second
construct the two epitope tags, V5 and His tag, are present in
frame prior to the stop codon.
[0348] Proteins that are normally secreted routinely contain a
hydrophobic signal sequence at the N terminus of the protein. For
the stradomer constructs, we used the IgK signal sequence
METDTLLLWVLLLWVPGSTG (SEQ ID NO: 35) which is removed from the
protein as it is secreted by mammalian cells such as Chinese
Hamster Ovary cells. The predicted cleavage site was based on
algorithms for signal site cleavage prediction (SignalP 3.0).
[0349] Additional stradomer constructs, similar to a) and b) above
were made that contained the IgG.sub.1 Fc-IgG.sub.1 Fc structure as
described above (with and without the epitope tag) but using the
IgG3 Hinge domain in the construct: IgG.sub.1 Fc-IgG3
hinge-IgG.sub.1 (CH2-CH3).
Example 2--Design and Testing of Immunologically Active
Biomimetics
Coated IVIG and Coated Fc Stimulate Similar Phenotypic Changes
[0350] IVIG and Fc when coated onto the walls and floor of the
wells of a sterile plate stimulate nearly identical changes in CD1a
and CD86 levels on immature DC and delay the up regulation of
CD11c. Because of the recognized critical role of DC in ITP, these
data provide a rational model for evaluating the function of IVIG
mimetics such as stradomers. We also conclude that the fact that
the phenotypic changes induced by IVIG are completely recapitulated
by recombinant Fc suggest that the effects of IVIG on DC are highly
likely to be Fc mediated.
Stradomer Generation
[0351] We have constructed stradomers of four different classes to
mimic the effects of IVIG on immature DC. The serial stradomers,
cluster stradomer units comprising cluster stradomers, core
stradomer units comprising core stradomers, and Fc fragment
stradomers shown below in Table 3 were each produced except where
noted. To obtain the appropriate sequences for each of the human
constructs shown below, cDNA was synthesized from total RNA
extracted from human PBMC. To obtain those sequences from other
species RNA was purified from tissue of those species. Random
priming was used to produce the cDNA. The cDNA was used to amplify
the desired fragments using PCR to synthesize, clone and
subsequently characterize by sequence analysis the DNA fragments.
The final constructs were produced by either sewing by overlap
extension with PCR (Horton R M, Hunt H D, Ho S N, Pullen, J K and
Pease L R. Engineering hybrid genes without the use of restriction
enzymes: gene splicing by overlap extension. Gene 77:6168, 1989) or
utilized existing compatible restriction sites to fuse the
appropriate fragments.
[0352] For example, in the cloning of G-007, the IgE CH4 domain was
directly fused to the CH2 domain of IgG1 at the 3' end of the
protein. This was accomplished by making primers that contain the
overlapping sequences for IgG1 CH2 (C terminus) with the N terminal
amino acids for IgE CH4. In one case, a hybrid primer was used to
amplify 5' with IgG1 sequences and the complementary primer was
used to amplify with a 3' primer from the C terminus of the IgE
CH4. Products from these two reactions were mixed and the flanking
primers were used to amplify the fusion protein. Sequence analysis
confirmed the construct.
[0353] In many cases, restriction sites were utilized that were
conveniently present at the ends of the molecules to be joined.
When restriction sites are in fusion there are detectable remnant
restriction sequences at the ends of the linked sequences. This
approach was used for most of the constructs shown below in Table
3. The amino acid sequences of the stradomers shown in Table 3 are
provided in FIG. 24A-24K. Some of the sequence are shown with
His-tags, known in the art to be useful in purifying proteins.
TABLE-US-00003 TABLE 3 Serial Stradomers N-term Hin CH2 CH3 Hin CH2
CH3 G-003 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 G-004 IgG1 IgG1 IgG1 IgG1
IgG1 IgG G-007 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1 IgECh4 G-011 IgECh2
IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 G-012 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1
IgG1 IgECh4 G-012 IgECh2 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgECh4 G-014
IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 G-016 IgG3 IgG3 IgG3
IgG1 IgG1 IgG1 G-017 (x-b) RestEnz IgG1 IgG IgGIx-b IgG1 IgG1 IgG1
linker G-023 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 Ig3H 32/62 G-024 IgG3
IgG3 IgG3 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 G-025 107aa IgG1 IgG1 IgG1
G-026 107aa IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 Fc Fragment Stradomer and
Core Stradomer Components N-Term Hin CH2 CH3 Hin CH2 CH3 G-002 IgG1
IgG1 IgG1 G-022 IgG1 IgG1 IgG1 IgG3Hing Cluster Stradomer Units
N-term Hin CH2 CH3 Hin CH2 CH3 G-008 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1
IgM CH3-CH4-TP G-009 IgG1 IgG1 IgG1 IgMCH3-CH4-TP G-010 IgECh2 IgG1
IgG1 IgG1 G-018 IgG2 IgG2 IgG2 IgG1 IgG1 IgG1 G-019 IgG2Hing IgG1
IgG1 IgG G-020 IgG2Hing IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 G-021
IgG2Hing IgG1 IgG1 IgG1 G-027 IgECh2-IgECh2 IgG1 IgG1 IgG1 G-028
ILZ IgG1 IgG1 IgG1 G-029 ILZ-IgECh2 IgG1 IgG1 IgG1 G-030 ILZ IgG2
IgG2 IgG2 IgG1 IgG1 IgG1 G-031 ILZ-IgG2hing IgG1 IgG1 IgG1 G-032
ILZ-ILZ IgG1 IgG1 IgG1 G-033 IgG2Hing-IgECh2 IgG1 IgG1 IgG G-034
IgG2hing-ILZ IgG2 IgG2 IgG2 IgG1 IgG1 IgG1 G-035 IgG2hing-IgG2hing
IgG1 IgG1 IgG1 G-036 IgG2hing-ILZ IgG1 IgG1 IgG1 To Be Made N-term
H CH2 CH3 H CH2 CH3 H CH2 CH3 401 IgG1 IgG1 IgG1 IgG3 IgG3 IgG3 402
IgG3 IgG1 IgG1 IgG3 IgG1 IgG1 403 IgG1 IgG3 IgG1 IgG1 IgG3 IgG1 404
IgG3 IgG3 IgG1 IgG3 IgG3 IgG1 406 IgG1 IgG1 none IgG3 IgG3 none 407
IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 408 IgG1 IgG1 IgG1
IgG3 IgG3 IgG3 IgG1 IgG1 IgG1 409 IgG3 igG3 IgG3 IgG1 IgG1 IgG1
IgG3 IgG3 IgG3 410 IgG3 IgG1 IgG1 IgG3 IgG1 IgG1 IgG3 IgG1 IgG1 411
IgG3 IgG3 IgG1 IgG3 IgG3 IgG1 IgG3 IgG3 IgG1 412 IgG1 IgG1 IgG4CH4
IgG3 IgG3 IgG4CH4 IgG1 IgG1 IgGCH4 413 IgG1 IgG1 IgG3 IgG3 IgG1
IgG1 414 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 IgG1 415 IgG3 IgG3
IgG3 IgG3 IgG3 IgG3 IgG3 IgG3 IgG3
Stradomer Protein Expression
[0354] For protein expression of the stradomers, plasmid DNA
encoding the stradomers described above were transfected into CHO
suspension cells (Freestyle.TM. MAX CHO expression system,
invitrogen CA). Following protein expression the expressed
stradomers were purified from the culture media by affinity column
chromatography using protein A or protein G affinity columns.
Purified stradomers were analyzed by SDS-PAGE (sodium dodecyl
sulfate polyacrylamide gel electrophoresis) under reducing
conditions followed by Coomasie Blue staining to confirm the
presence of monomeric protein bands of expected size as
exemplified: G-002: approximately 35 KD band, G-004 approximately
70 KD band, G-010: approximately 45 KD band, G-011: approximately
80 KD band, G-012: approximately 85 KD band, G-018 approximately 70
KD band, G-019: approximately 35 KD, G-028 approximately 37 KD
band. Plasmid DNA encoding the stradomers described can also be
transfected into other mammalian cells such as HEK 293, BHK cells,
murine NSO, and murine SP2/0 cells.
Multimer Formation
[0355] We observed that these constructs, when transfected,
cultured, and purified may create proteins of the expected size in
non-denatured and denatured protein analysis. In addition, we
observed that certain compounds also exhibited larger bands which
by size criteria are multimers of the expected dimeric protein.
[0356] Formation of higher order compounds by selected stradomers
was analyzed by SDS-PAGE followed by Western blot under
non-reducing conditions (A) and reducing conditions (B). SDS-PAGE
analysis shows formation of high molecular weight compounds of
stradomers G-002, G-010, and G-019 under non-reducing conditions as
compared to reducing conditions: [0357] G-002: an approximately 35
KD band under reducing condition--bands at approximately 70 KD
(dimer) and 135 KD (tetramer) under non-reducing conditions. [0358]
G-010: an approximately 45 KD band under reducing condition--bands
at approximately 90 KD (dimes) and 180 KD (tetramer) under
non-reducing conditions. [0359] G-019: an approximately 35 KD band
under reducing conditions--bands at approximately 70 KD (dimer),
140 KD (tetramer) under non-reducing conditions.
[0360] We anticipate that the tetrameric and other higher order
multimers of the dimerized protein will contribute significantly to
the biological activity of the compound as measured by the immature
Dendritic Cell assay (see below).
Stradomer Monomers, Stradomers, and Higher Order Multimers of
Stradomers Maintain Recognition Sites.
[0361] Each of the proteins in Table 3 are recognized by a rabbit
anti-human IgG (Fc) [Thermo Scientific 31789]. We conclude from
this that each of these proteins maintains the recognition sites
for this antibody.
Plasmon Resonance Imaging
[0362] The ability of the stradomers in Table 3 to bind
Fc.gamma.RIIIa was assessed using surface plasmon resonance (SPR)
technology (commercially available through Biacore). Human
Fc.gamma.RIIIa was directly immobilized via amine coupling to a CM5
Biacore chip by diluting the ligand in Acetate pH5.0 to a
concentration of 5 uglml. Ligands were perfused over specified flow
cell at a rate of Sul/min until an RU of 250 was reached. The flow
cells were then blocked with ethanolamine. Stradomers and IVIG were
diluted to 1000 nM in HBS-EP (0.01M HEPES pH 7.4; 0.15M NaCl; 3 mM
EDTA; 0.005% Surfactant P20) and serially diluted 500 nM, 250 nM,
125 nM and finally 62.5 nM. A baseline sample containing only
buffer (HBS-EP) was also included. A flow rate of 20 ul/min was
used for all samples. A total of 60 uL of sample was injected, for
an injection time of 3 minutes. Regeneration was achieved by
perfusing running buffer over flow cells for an extended period of
time of approximately 10 minutes.
[0363] At 500 nM, the measured Req (equilibrium), relative to
baseline for the stradomer G-010 construct was 24.9 RU when
perfused over human Fc.gamma.RIIIa, and the KD was 1.95e-7 using a
1:1 binding model. IVIG at 500 nM on human Fc.gamma.RIIIa gave a
Req of 63.6 RU and a KD of 1.89e-7 using a 1:1 binding model. G-010
was therefore determined to bind to Fc.gamma.RIIIa. Similar binding
ability has been assessed on other biomimetic compounds. Here are
some further examples:
TABLE-US-00004 1:1 w Mass Transfer Bivalent Fit Rmax Chi2 KD(M)
KA(I/M) Rmax Chi2 Controls: Neg. (mouse IgG2a) 2.05 0.451 4.7e-9
2.1e8 5.21 0.39 Pos. (IVIG) 87.7 6.8 1.9e-7 5.3e6 Biomimetics: 002
6.46 1.12 2.2e-8 4.9e7 16.7 0.82 004 30.2 1.74 4.8e-8 2.5e7 88.2
2.47 011 25.9 0.361 5.5e-6 1.8e7 57.4 0.15
[0364] We conclude that these proteins have varied ability to bind
to recombinant Fc.gamma.RIIIa by plasmon resonance analysis and
that certain compounds such as G-010 have a bivalent curve fit,
consistent with that seen by bivalent antibodies and indicating
that the stradomer may have multi-valent binding to
Fc.gamma.RIIIa.
Stradomers Mimic the Biological Effect of IVIG
[0365] The biological function of these stradomers was assessed. In
order to determine the ability of each of the stradomers in Table 3
to mimic the functional utility of IVIG in individuals with ITP, we
developed an in vitro assay using immature dendritic cells (iDC).
The rationale for choosing iDC as target cells was based on
published data demonstrating that adoptive transfer of DC from mice
treated with IVIG, conferred protection against the development of
ITP to naive animals. (Siragam, V. et al. Intravenous
immunoglobulin ameliorates ITP via activating Fc.gamma. receptors
on dendritic cells. Nat Med 12, 688 (2006)). In our initial
studies, we evaluated the impact of coated, meaning fixed to the
plate, recombinant Fc (rFc) and IVIG on the expression of a variety
of activation, maturation and costimulatory markers on human CD14+
cells, cultured in the presence of IL-4 and GM-CSF. When compared
to cells cultured in cytokines alone, cells exposed to coated IVIG
or coated rFc demonstrated striking enhancement of CD86 expression
and down regulation of CD1a expression as well as a delay in CD11c
upregulation.
[0366] Next, we determined whether the stradomers in Table 3
mimicked the described effect of coated IVIG or coated Fc on iDC.
These compounds when coated to the plate well walls and floors did
mimic the effect: G-002, G-004, G-005, G-014, G-018, and G-019.
These compounds when coated to the plate well walls and floors did
not mimic the effect: G-010, G-011, and G-012
[0367] These compounds when soluble did mimic the effect of coated
IVIG or coated Fc on iDC: G-002, G-010, G-014, G-018, and G-019.
These compounds when soluble did not mimic the effect: G-004,
G-005, G-011, and G-012.
[0368] Whether exposure of iDC to coated IVIG would influence
subsequent responses to pro-inflammatory stimuli can be tested.
[0369] We draw the following conclusions from these data: [0370] i.
that select stradomers, when coated on a tissue culture plate,
mimic the functional ability of coated IVIG to upregulate CD86 and
suppress CD1a expression on immature DC, [0371] ii. that select
stradomers administered at a low dose in a soluble form mimic the
functional ability of coated IVIG to up regulate CD86 and suppress
CD1a expression on iDC, [0372] iii. that certain stradomers can
induce phenotypic change in both a soluble and coated form and that
other stradomers, such as G-010, can induce phenotypic change in a
soluble but not a coated form, [0373] iv. that stradomers of
differing structures can be biologically active as evidenced by the
Fc fragment stradomer formed from G-002 and the cluster stradomer
formed from G-010, [0374] v. that structures larger than expected
by dimerization of stradomer monomers are seen on protein analysis
and that these multimeric structures may correspond with biological
activity in comparison to IVIG, and [0375] vi. that stradomers
formed from dimerized stradomer monomers can demonstrate a bivalent
fit on plasmon resonance consistent with binding of multiple
Fc.gamma. receptors and suggesting the presence of multimeric
tertiary structures of the stradomers.
Example 3--Heat Aggregated Biomimetics are More Potent than
IVIG
[0376] A stradomer is a biologically active mimetic of aggregated
immunoglobulin and especially of the aggregated Fc fragments of
those immunoglobulin. In some instances, heat aggregation of the
biomimetics described herein can increase biological activity. We
conclude that heat-aggregated biomimetics as herein described can
be as potent as IVIG.
Example 4--Fc Fragment Exhibits Several Activities
[0377] The Fc fragment has been used as a positive control in
experiments described above in which the protein is coated and
thereby fixed to plastic thereby exhibiting biological behavior
that mimics coated IVIG. The Fc fragment also can be used as a core
stradomer unit such as when it is attached to core moieties such as
a liposome, a bead, or albumin. Further, we have demonstrated that
the Fc fragment when cultured in certain expression systems and
certain cell types, such as the Invitrogen FreestyleMax transient
transfection system using CHO-S cells, can form higher order
multimers on protein analysis, exhibit bivalent binding pattern on
plasmon resonance imaging, and exhibit profound biological activity
in soluble form comparable to coated IVIG in the immature DC assay.
We conclude therefore that under certain carefully controlled
conditions, the Fc fragment forms an Fc fragment stradomer. This
effect may be due to post-translational modifications such as
glycosylation changes.
Example 5--a Core Stradomer which is an Fc-Coated Bead May Alter
Phanocytic Potential Relative to Uncoated Beads
[0378] PBMCs are isolated from the buffy coat of healthy donors
using Ficoll Hypaque density gradient centrifugation. After
isolation, PBMCs are washed twice with PBS. CD14+ cells are then
purified using MACS separation column (Miltenyi). The purified
cells are counted and resuspended to 2.times.10.sup.5/ml RPMI
complete media containing 800 .mu.L/ml GM-CSF and 5 ng/mL IL-4. The
cells are then seeded in the wells of non-tissue culture but
sterile 6-well plates. After seeding the CD14+ cells in the
non-tissue culture, polystyrene FITC microspheres (0.52 .mu.m)
coated with or without saturating amounts of Fc or IVIG are added
to the cells at a 1:1 ratio and incubated for 6 days at 37.degree.
C., 5.0% CO2 and then analyzed for phagocytosis of microspheres by
FRCS.
[0379] Both IVIG-coated beads and Fe-coated beads act as core
stradomers and may thereby alter phagocytotic potential relative to
uncoated beads.
Example 6--Design of Immunologically Active Biomimetics with
Altered Fc.gamma.RIII Binding Affinities
[0380] It has been shown that a shared set of residues of IgG1 are
involved in binding to all Fc.gamma.Rs. It has also been
demonstrated that additional residues in IgG1 molecules are
involved in the binding to both Fc.gamma.RII and Fc.gamma.RIII.
Some residues when altered inhibited binding of one or more
receptors. Interestingly, the specific double mutation of
S298A/K334A enhanced binding of Fc.gamma.IIIa and reduced binding
to Fc.gamma.IIb. Those residues have been noted on the stradomer
construct shown in FIG. 16A-16B (using an asterisk at both amino
acids). We therefore can use site directed mutagenesis to generate
a stradomer molecule having the structure encoded by SEQ ID NO: 17
but with the corresponding S298A/K334A mutations.
Example 7--Expression of Recombinant Proteins
[0381] Numerous expression systems exist that are suitable for use
in producing the compositions discussed above. Eukaryote-based
systems in particular can be employed to produce nucleic acid
sequences, or their cognate polypeptides, proteins and peptides.
Many such systems are commercially and widely available.
[0382] In a preferred embodiment, the stradomers described herein
are produced using Chinese Hamster Ovary (CHO) cells which are well
established for the recombinant production of immunoglobulin
proteins following standardized protocols. Alternatively, for
example, transgenic animals may be utilized to produce the human
stradomers described herein, generally by expression into the milk
of the animal using well established transgenic animal techniques.
Lonberg N. Human antibodies from transgenic animals. Nat
Biotechnol. 2005 September; 23(9):1117-25; Kipriyanov S M, Le Gall
F. Generation and production of engineered antibodies. Mol
Biotechnol. 2004 January; 26(1):39-60; See also Ko K, Koprowski H.
Plant biopharming of monoclonal antibodies. Virus Res. 2005 July;
111(1):93-100.
[0383] The insect cell/baculovirus system can produce a high level
of protein expression of a heterologous nucleic acid segment, such
as described in U.S. Pat. Nos. 5,871,986, 4,879,236, both
incorporated herein by reference in their entirety, and which can
be bought, for example, under the name MAXBAC.RTM. 2.0 from
INVITROGEN.RTM. and BACPACK.TM. BACULOVIRUS EXPRESSION SYSTEM FROM
CLONTECH.RTM..
[0384] Other examples of expression systems include
STRATAGENE.RTM.'s COMPLETE CONTROL.TM. Inducible Mammalian
Expression System, which utilizes a synthetic ecdysone-inducible
receptor. Another example of an inducible expression system is
available from INVITROGEN.RTM., which carries the T-REX.TM.
(tetracycline-regulated expression) System, an inducible mammalian
expression system that uses the full-length CMV promoter.
INVITROGEN.RTM. also provides a yeast expression system called the
Pichia methanolica Expression System, which is designed for
high-level production of recombinant proteins in the methylotrophic
yeast Pichia methanolica. One of skill in the art would know how to
express vectors such as an expression construct described herein,
to produce its encoded nucleic acid sequence or its cognate
polypeptide, protein, or peptide. See, generally, Recombinant Gene
Expression Protocols By Rocky S. Tuan, Humana Press (1997), ISBN
0896033333; Advanced Technologies for Biopharmaceutical Processing
By Roshni L. Dutton, Jeno M. Scharer, Blackwell Publishing (2007),
ISBN 0813805171; Recombinant Protein Production With Prokaryotic
and Eukaryotic Cells By Otto-Wilhelm Merten, Contributor European
Federation of Biotechnology, Section on Microbial Physiology Staff,
Springer (2001), ISBN 0792371372.
Example 8--Expression and Purification of Immunologically Active
Biomimetics
[0385] Nucleic acid constructs described in Examples 1 and 2 are
transfected into cell lines that do not naturally express Ig. The
encoded polypeptides are expressed as secreted proteins due to
their secretory leader sequences, which generally are removed by
endogenous proteases during transport out of the cells or may be
subsequently cleaved and removed by techniques well known in the
art. These secreted immunologically active biomimetics are purified
using Protein A or His tag chromatographic approaches well known in
the art and size is verified by reducing and/or non-reducing SDS
PAGE (sodium dodecyl sulfate polyacrylamide gel
electrophoresis).
Example 9--Expression and Purification of Immunologically Active
Biomimetics for Large Scale Production
[0386] While various systems can be used to produce large amounts
of a specific protein including bacteria, insect cells or yeast,
expression in mammalian cells can minimize problems due to altered
glycosylation of the proteins. Mammalian cells like CHO cells have
been used to overproduce various proteins fused to an Ig backbone.
The Fc domain in the construct becomes a tag that permits
subsequent purification from the cell supernatant using protein
affinity column purification (Harris, C L, DM Lublin and BP Morgan
Efficient generation of monoclonal antibodies for specific protein
domains using recombinant immunoglobulin fusion proteins: pitfalls
and solutions, J. Immunol. Methods 268:245-258, 2002). Many fusion
proteins are directly cloned in frame with the constant region of
Ig, specifically the CH2 and CH3 partial Fc domain monomers. A
specific example of expression of interferon gamma receptor
extracellular domain being expressed with Ig has been used to
produce large amounts of the protein with functional activity
(Fountoulakis, M, C. Mesa, G. Schmid, R. Gentz, M. Manneberg, M.
Zulauf, Z. Dembic and G. Garotta, Interferon gamma receptor
extracellular domain expressed as IgG fusion protein in Chinese
hamster ovary cells: Purification, biochemical, characterization
and stoichiometry of binding, J. Biol. Chem. 270:3958-3964,
1995).
Example 10--Design of Immunologically Active Biomimetics with
Altered Fc Glycosylation
[0387] By a method essentially the same as that described by
Shields et al. with regard to homo-antibodies, de-fucosylated Fc
domains can be made in mutant CHO cells lacking enzymatic activity
for adding fucose to protein carbohydrates. These are used to
express stradomers with stronger Fc.gamma.RIII binding affinities
relative to a fucosylated form of the same molecule. (Robert L.
Shields, et al. Lack of Fucose on Human IgG1 N-Linked
Oligosaccharide Improves Binding to Human Fc RIR and
Antibody-dependent Cellular Toxicity. J. Biol. Chem., July 2002;
277: 26733-26740 (doi:10.1074/jbc.M202069200)).
[0388] It has been shown that changes in sialylation in the Fc
N-glycan can increase biological activity. Kaneko Y, Nimmerjahn F,
Ravetch J V. Science. 2006 Aug. 4; 313(5787):627-8. Thus stradomer
molecule having altered sialylation can be produced using similar
methods.
[0389] Alternative means to altering glycosylation of stradomer Fc
domains include chemoenzymatic techniques for producing
polypeptides with a specific glycosylation structure. See, Li, B.,
Song, H., Hauser, S., and Wang, L. X. 2006. A Highly Efficient
Chemoenzymatic Approach Toward Glycoprotein Synthesis. Org. Lett.
8:30813084; See, also, International Pat. App. No.
PCT/US07/70818.
Example 11--Fusion Constructs of Fc.gamma.RIIa (176 V/F)
Polymorphism
[0390] As discussed previously, the anti-inflammatory activity of
IVIG is dependent on primary interactions between the Fc domain and
Fc.gamma.RIIIa. These interactions can be effectively quantitated
using (SPR) technology to characterize both association and
dissociation constants of the immunologically active biomimetics
with the two recognized polymorphic variants of Fc.gamma.RIIIa (176
V/F). In order to define the binding affinity and dissociation of
our Fc domain monomeric control and stradomer constructs,
Fc.gamma.RIIIa HIS tag fusion proteins will be produced in CHO
cells with both V (SEQ ID NO: 33) and F (SEQ ID NO: 31) polymorphic
variants at position 176 (FIG. 20A and FIG. 20B). These sequences
can be put into pCDNA 3.1 and transfected into CHO cells. These
Fc.gamma.RIIIa fusion proteins are purified from the supernatants
from transfected cells using affinity Nit' columns to purify the
proteins. All Fc.gamma.RIIIa fusion proteins are characterized by
both cDNA sequencing and SDS PAGE.
[0391] Various other protocols in the art can be utilized to
express Fc.gamma.RIIIa and characterize interactions with
immunologically active biomimetic. See, e.g., the materials and
methods section of Robert L. Shields, et al. High Resolution
Mapping of the Binding Site on Human IgG1 for Fc.gamma.RI,
Fc.gamma.RII, Fc.gamma.RIII, and FcRn and Design of IgG1 Variants
with Improved Binding to the Fc.gamma.R. J. Biol. Chem., February
2001; 276: 6591-6604 (doi:10.1074/jbc.M009483200).
Example 12--Screening Immunologically Active Biomimetic Function In
Vitro
[0392] To test the function of immunologically active biomimetics
such as those presented in Example 1, an in vitro assay is designed
to recapitulate the mechanism by which it appears that native Fc
domains reduce inflammation in vivo. It has recently been
demonstrated that hIVIG inhibits the maturation of DCs and alters
the secretion of IL-10, IL-12 and TNF-alpha (Bayry, J, et al.,
Inhibition of maturation and function of dendritic cells by
intravenous immunoglobulin, Blood 101(2):758-765(2003)). Our
stradomers mediate effects on DCs similar to hIVIG. The inhibition
of DC maturation and alterations in cytokine secretion in vitro can
serve as an effective means to define some of the biological
activities of many stradomer constructs. The stradomer constructs
described above may be further validated using the following
experimental parameters:
TABLE-US-00005 TABLE 4 Group Experimental condition Outcome measure
1 (FACS) Outcome measure 2 ELISA/Elispot 1 None CD1a, 14, 40, 80,
83, 86, HLADR IL-10, IL-12, TNFa, IL-23 2 Soluble IVIG CD1a, 14,
40, 80, 83, 86, HLADR IL-10, IL-12, TNFa, IL-23 3 Fixed WIG CD1a,
14, 40, 80, 83, 86, HLADR IL-10, IL-12, TNFa, IL-23 4 Soluble Fc
CD1a, 14, 40, 80, 83, 86, HLADR IL-10, IL-12, TNFa, IL-23 5 Fixed
Fc CD1a, 14, 40, 80, 83, 86, HLADR IL-10, IL-12, TNFa, IL-23 6
Soluble Stradomer CD1a, 14, 40, 80, 83, 86, HLADR IL-10, IL-12,
TNFa, IL-23 7 Fixed Stradomer CD1a, 14, 40, 80, 83, 86, HLADR
IL-10, IL-12, TNFa, IL-23
[0393] In one preferred in vitro assay shown in Table 4, the impact
on human DC phenotype of soluble, immunologically active
biomimetics, having appropriate binding affinities, is measured.
Soluble non-cross-linked natural sequence Fc domain constructs can
serve as controls. Specific DC markers on the DC surface are
evaluated including markers of activation (CD80, CD83 and CD86) as
well as the Fc.gamma.Rs. See Prechtel A T, Turza N M, Theodoridis A
A, Steinkasserer A. CD83 knockdown in monocyte-derived DCs by small
interfering RNA leads to a diminished T cell stimulation. J
Immunol. 2007 May 1; 178(9):5454-64. In addition, multiplex
analysis can be employed to evaluate the impact of our
immunologically active biomimetics on DC cytokine production.
Jongbloed, Sarah L., et al. Enumeration and phenotypic analysis of
distinct dendritic cell subsets in psoriatic arthritis and
rheumatoid arthritis. Arthritis Res Ther. 2006; 8(1): R15
(Published online 2005 December 16. doi: 10.1186Iar1864). Finally,
to confirm DCs interact with monocytes as expected, control DCs and
DCs exposed to immunologically active biomimetics are cultured with
purified monocytes and evaluated by flow cytometry for changes in
the levels of activating Fc.gamma.RIIa receptors and other cell
surface determinants related to the activation state of the
monocytes.
[0394] In particular embodiments, stradomers can decrease the
Fc.gamma.RIIa receptors present on an immune cell thereby
increasing the ratio of inhibitory Fc.gamma.RIIb receptors to the
Fc.gamma.RIIa receptors which results in inhibition of immune cell
functions.
Example 13--Screening Immunologically Active Biomimetic Function In
Vivo
[0395] Numerous autoimmune diseases such as idiopathic
thrombocytopenic purpura, multiple sclerosis, asthma, and
inflammatory bowel diseases have established, art recognized animal
models for in vivo testing. Wu G F, Laufer T M. The role of
dendritic cells in multiple sclerosis. Curr Neurol Neurosci Rep.
2007 May; 7(3):245-52; Targan S R, Karp L C. Defects in mucosal
immunity leading to ulcerative colitis. Immunol Rev. 2005 August;
206:296-305. For example, multiple models of ITP are currently
available. See, e.g., Crow A R, et al. IVIG inhibits
reticuloendothelial system function and ameliorates murine passive
immune thrombocytopenia independent of anti-idiotype reactivity. Br
J Haematol. 2001; 115:679-686. Immunologically active biomimetics
designed to modulate the immune system, as appropriate for each
specific autoimmune disease, can be validated in such in vivo
models. Importantly, in many of these models, administration of
hIVIG likely results in a foreign species (e.g. mouse) anti-human
antibody response which has the potential to obscure or create
false positive product related anti-inflammatory effects.
[0396] We established a mouse model of Idiopathic Thrombocytopenic
Purpura according to the following methodology: Platelet counts
were measured in C57BL6 mice by serial tail vein nicking. 10 .mu.L
of blood was diluted in 15 .mu.L citrate buffer. Samples were then
analyzed for absolute platelet count on a HemaVet 950 cytometer.
For mice in an ITP control group, starting day 2, every afternoon
platelets were depleted by giving intra peritoneal injection of 2
.mu.g Rat Anti-Mouse CD41 (MWReg30), an anti-platelet antibody from
BD Biosciences pharmingen. Mice in the IVIG pretreatment control
group received 2 g/kg (40 mg/mice) human IVIG by i.p. injection
every morning and the same dose MWReg30 as the ITP control group.
We determined that IVIG is highly protective of platelet count in
this model of induced ITP and conclude that this model is useful
for testing stradomers against IVIG for relative degree of
protection from platelet count decreases. A stradomer can be
assessed in this model at various concentrations to assess
protection relative to IVIG as follows:
Groups in an Experiment
[0397] 1) Control--No ITP, No IVIG [0398] 2) ITP control group--2
ug MWReg30 every evening starting day 2 [0399] 3) IVIG pretreatment
group--40 mg IVIG every morning and 2 ug MWReg30 every evening
starting day 2 [0400] 4) Stradomer equivalent to 101\12 Fc domains
IV every morning [0401] 5) Stradomer equivalent to 101\11 Fc
domains IV every morning [0402] 6) Stradomer equivalent to 101\10
Fc domains IV every morning [0403] 7) Stradomer equivalent to 101\9
Fc domains IV every morning [0404] 8) Stradomer equivalent to
10{circumflex over ( )}8 Fc domains IV every morning [0405] 9)
Stradomer equivalent to 10{circumflex over ( )}7 Fc domains IV
every morning [0406] 10) Stradomer equivalent to 101\6 Fc domains
IV every morning
Example 14--Validating Immunologically Active Biomimetic Efficacy
In Vivo for Treating ITP
[0407] In another murine model of ITP, mice deficient in normal B
cell function can be used. Deficiency in normal B cell function
serves to eliminate the idiotype-antiidiotype effects of murine
anti-human Fc fragment antibodies that would be generated by the
administration of human Fc fragment or Fc partial fragment to a
mouse and consequent false positive results. The deficiency in B
cell function can be generated, for example, through the
administration of anti-B cell antibodies or occurs in genetically
engineered mice such as the m chain-knock out mouse (Jackson Labs
strain B6.129S2-Igh.sup.6tm1Cgn/J) that are deficient in mature
B-cells.
[0408] The immune system of immunodeficient mice is reconstituted
with either unmodified or B cell depleted PBMCs from
immunocompetent animals. These animals are subsequently treated
with anti-platelet antibodies to mimic ITP using well defined
techniques in the art. Animals are then treated with
immunologically active biomimetics according to the following
scheme:
TABLE-US-00006 TABLE 5 In vivo efficacy of [hIgG.sub.1 Fc domain -
hIgGi Fc domain] (SEQ ID NO: 22) immunologically active biomimetics
for the treatment of ITP. PBMC's used Animal to reconstitute
Outcome Group # mice Treatment Measure 1 5 None IgG1 Fc Platelet
Count 2 5 None IgG1 Fc - IgG1 Fc Platelet Stradomer Count 3 5
Unmodified IgG1 Fc Platelet Count 4 5 Unmodified IgG1 Fc - IgG1 Fc
Platelet Stradomer Count 5 5 B cell depleted IgG1 Fc Platelet Count
6 5 B cell depleted IgG1 Fc - IgG1 Fc Platelet Stradomer Count 7 5
Unmodified hIVIG Platelet Count
[0409] It is anticipated that groups 1 and 2 will not develop ITP
upon antibody infusion as they do not have the B cells to produce
anti-platelet antibodies necessary for platelet destruction. In
groups 3 and 4, it is expected that both the {hIgG.sub.1
Fc-hIgG.sub.1 Fc} stradomer polypeptide and the hIgG.sub.1 Fc
monomer polypeptide effectively ameliorate ITP because endogenous
murine antibodies react with hIgGi Fc domain epitopes to crosslink
the hIgG.sub.1 Fc monomer polypeptides. In contrast, in the absence
of endogenous murine antibodies, the {hIgG.sub.1 Fc-hIgG.sub.1 Fc}
stradomer polypeptide (group 6) is more effective than the
uncross-linked IgGi Fc monomer polypeptide (group 5) in
ameliorating ITP. Group 7 serves as a positive control for
treatment effect.
Example 15--Treating Patients with ITP Using Intravenous
Formulations of Stradomer Proteins (SEQ ID NOs: 18 & 22)
[0410] Treatment protocols for ITP with the exemplary stradomer
proteins encoded by SEQ ID NOs: 17 and 21 are utilized in a manner
tracking standard guidelines for ITP hIVIG therapy such as the
Executive Committee of the American Society of Hematology practice
guideline for the diagnosis and management of primary immune
thrombocytopenic purpura. See George, J N, et al. Idiopathic
thrombocytopenic purpura: a practice guideline developed by
explicit methods for the American Society of Hematology. Blood.
1996 Jul. 1; 88(1):3-40; See also, the 2000 guidelines by Italian
pediatric hematologists, the 2003 British hematologists guidelines
and the 2006 Japanese pediatric hematologists guidelines.
Alternatively, the stradomer IV protocols for ITP may include an
initial administration phase with dosages of about 0.1 to about
0.001 times the above treatment protocol dosages. The initial low
dose phase is designed to minimize any short term pro-inflammatory
effects of the stradomer administration while still being
sufficient to induce a long term anti-inflammatory effect, which is
subsequently enhanced and maintained by the second phase standard
dosing described above. The rationale for this alternative approach
is that some embodiments of a stradomer may have both a short term
inflammatory effect as well as a long term anti-inflammatory effect
through decreasing the expression of Fc.gamma.RIIa. An initial low
dose (or initial low doses) can be used to stimulate the long term
anti-inflammatory effect while minimizing the short term
inflammatory effect.
[0411] The effective stradomer dose is generally from about 0.01%
to about 15% of the effective hIVIG dose, more preferably, about
0.1% to about 3% of the effective hIVIG dose. The effective hIVIG
dose in ITP is generally in the range of about 100 mg/Kg to about 2
grams/Kg administered every 10-21 days.
[0412] The stradomer intravenous formulation will be substantially
the same as FDA approved hIVIG formulations but may exclude the
stabilizers present in some hIVIG formulations. See, e.g., the
product insert for Gammagard S/D, distributed by Baxter Healthcare
Corporation and approved for ITP therapy by the FDA.
Example 16--Treating Patients with ITP Using Intraperitoneal
Administration of a Core Stradomer
[0413] Treatment protocols for ITP with exemplary stradomer
proteins representing Fc fragments fixed to a core moiety such as a
liposome are utilized by intraperitoneal administration with
dosages of about 1% to about 0.001% of standard intravenous IVIG
protocol dosages. The rationale for this alternative approach is
that core stradomers comprised of fixed Fc fragments delivered in a
stable formulation to the intraperitoneal cavity will make
available the multiple Fc domains to affect monocytederived
effector cells similarly to IVIG but at substantially lower
doses.
Example 17--Design of Immunologically Active Biomimetics
(Stradobodies)
[0414] Two stradobodies have been constructed and transfected. For
each stradobody, encoding cDNA was synthesized from total RNA made
from hybridoma cell lines expressing the antibody of interest.
Establishing hybridoma cell lines is well known in the art.
Amplification of cDNA of interest encoding the antibody heavy and
light variable regions was done by BD SMART.TM. RACE amplification
kit (Clontech CA). Numerous other methods are available to generate
cDNA encoding the heavy and light chains for variable regions of
antibodies (Sassano, M. et. al., 1994. Nucleic Acids Res. May 11;
22(9):1768-9; Jones, S. T., Bendig, M. M., 1991. Biotechnology (NY)
January: 9(1):88-9.) To generate the stradobodies the heavy chain
variable regions are fused to the stradomer constructs by either
sewing by overlap extension with PCR (Hutton and Pease) or utilize
existing compatible restriction sites to fuse the appropriate
fragments. Stradobody proteins are expressed in CHO-S cells and
isolated from cell supernatants by protein A column affinity
purification. Binding of the purified stradobodies to the antigen
of interest is confirmed by flow cytometry binding studies
utilizing cell lines expressing the antigen.
[0415] A standard ADCC assay employing NK cells as effectors and
antigen expressing tumor cells as targets at various
effector-to-target ratios is employed to compare the potential of
the stradobody and the monoclonal antibody (Mab) that shares the
same Fab region to induce ADCC against high and low antigen
expressing tumor cell lines. Stradobodies are selected for
development that demonstrate similar results to the paired Mab in
the NK assay against the high epitope expressing cell line but
superior results to the paired Mab in the NK assay against the low
epitope expressing cell line.
Example 18--Treating Patients with Breast Cancer Using Intravenous
Formulations of Stradobody Containing the Antigen-Binding Domain of
Trastuzumab
[0416] Treatment protocols for breast cancer with the exemplary
stradobody containing a Fab that is or is similar to the Fab from
the marketed product trastuzumab having activity against the
her2/neu epitope are utilized in a manner tracking standard
guidelines for breast cancer therapy. See, Romond, E H et al.,
Trastuzumab plus Adjuvant Chemotherapy for Operable HER2-Positive
Breast Cancer. NEJM. 2005 Oct. 20; 353:1673-1684; Seidman, A D et
al., Weekly Trastuzumab and Paclitaxel Therapy for Metastatic
Breast Cancer With Analysis of Efficacy by HER2 Immunophenotype and
Gene Amplification. Journal of Clinical Oncology. Vol 19, Issue 10
(May), 2001: 2587-2595; Vogel, C L et al., Journal of Clinical
Oncology. Vol 20, Issue 3 (February), 2002:719-726
[0417] It is anticipated that the effective stradobody dose will
generally range from about 1% to about 500% of the effective
monoclonal antibody whose Fab is the same as the stradobody, more
preferably, about 50% to about 100% of the effective monoclonal
antibody dose. The effective monoclonal antibody dose in clinical
cancer treatment varies. For the Her-2 neu monoclonal antibody the
dose is generally in the range of about 2 mg/Kg to about 4 mg/Kg
administered every 7-21 days.
Example 19--Treating Patients with Head and Neck or Colon Cancer
Using Intravenous Formulations of Stradobody Containing the
Antigen-Binding Domain of Cetuximab
[0418] It is anticipated that treatment protocols for breast cancer
with the exemplary stradobody containing a Fab that is or is
similar to the Fab from the marketed product cetuximab having
activity against the EGFR epitope can be utilized in a manner
tracking standard guidelines for head and neck and colon cancer
therapies. See Robert, F et al. m Phase I Study of Anti-Epidermal
Growth Factor Receptor Antibody Cetuximab in Combination With
Radiation Therapy in Patients With Advanced Head and Neck Cancer.
Journal of Clinical Oncology, Vol 19, Issue 13 (July), 2001:
3234-3243; Bonner, J A et al., Cetuximab prolongs survival in
patients with locoregionally advanced squamous cell carcinoma of
head and neck: A phase III study of high dose radiation therapy
with or without cetuximab. Journal of Clinical Oncology, 2004 ASCO
Annual Meeting Proceedings (Post-Meeting Edition). Vol 22, No 14S
(July 15 Supplement), 2004: 5507; Shin, D M et al., Epidermal
Growth Factor Receptor-targeted Therapy with C225 and Cisplatin in
Patients with Head and Neck Cancer. Clinical Cancer Research Vol.
7, 12041213, May 2001; Cunningham, D et al. Cetuximab Monotherapy
and Cetuximab plus Irinotecan in Irinotecan-Refractory Metastatic
Colorectal Cancer. NEJM. Volume 351:337-345, 2004.
[0419] It is anticipated that the effective EGFR/IER1 stradobody
dose will generally range from about 1% to about 500% of the
effective monoclonal antibody whose Fab is the same as the
stradobody, more preferably, about 50% to about 100% of the
effective monoclonal antibody dose. The effective monoclonal
antibody dose in clinical cancer treatment varies. For the EGFR
monoclonal antibody the dose is generally in the range of about
250-400 mg/square meter which is about 5 mg/Kg-25 mg/Kg
administered every 7-21 days.
Example 20. Increased Multimerization by Altered Glycosylation May
Increase Immunologically Active Biomimetic Activity
[0420] The glycosylation patterns of expressed proteins are
dependent on the cell line in which the protein is expressed. The
Chinese Hamster Ovarian cell (CHO cell) commonly used for protein
expression and purification results in a glycosylation pattern that
is different from, for example, the HEK 293 cells which are of
human origin and also is commonly used for protein expression of
endogeneous proteins. As the binding properties of Fc fragments and
cluster stradomer units can be affected by the glycosylation
pattern, increased multimerization and therefore increased
biological activity of the expressed peptides can be achieved by
expression in cell lines other than CHO or in cell lines including
CHO that are genetically altered to change the glycosylation
pattern to an N-glycan that promotes increased aggregation between
Fc fragments or Fc domain-containing peptides. Increased
multimerization of Fc fragment or selected cluster stradomer units
by altering glycosylation patterns may increase the ability of
immunologically active biomimetics to mimic the effects of
hIVIG.
Example 21. Does Exposure of Mature DC (mDC) to IVIG or rFcF
(Recombinant Fc Fragments) Alter their Phenotype?
[0421] The rFCF fragments from human IgG1 to be used in this
experiment were produced by standard recombinant protein
technology. The two chains of the human rFCF each consisted of the
hinge region (15 amino acids), the CH2 domain (110 amino acids),
and the CH3 domain (106 amino acids) of human IgG1 heavy chain.
[0422] CD14+ cells can be isolated from peripheral blood
mononuclear cells (PBMC) obtained from the blood of a healthy human
donor using a Miltenyi MACS separation column. The cells are
cultured at a final concentration of 2.times.10.sup.5/mL in GMCSF
(800 IU/mL) and IL-4 (5 ng/mL) for 5 days at 37.degree. C. The
media in all cultures is refreshed on day 3 of culture. At day 5,
lipopolysaccharide (LPS; 10 .mu.g/ml) is added to appropriate
cultures to induce maturation to a mature DC. Mature DCs are known
in the art not to express substantive levels of the CD16, CD32 or
CD64. The cells are then cultured for an additional two days and
aliquots are analyzed for CD11c, CD80, CD83, CD86, CD1a, and CD14
expression by two dimensional fluorescence flow cytometry (FFC).
The remaining cells cultured with LPS are then placed in wells with
soluble or coated IVIG or human rFcF (all at 10 .mu.g/mL) for 24
hours at 37.degree. C., harvested and analyzed for expression of
the markers listed above by two-dimensional FFC.
[0423] Experimental groups are as follows:
[0424] (1) CD14+ cells; GM-CSF; TL-4; no LPS ("7d-LPS")
[0425] (2) CD14+ cells: GM-CSF; TL-4; LPS ("7d+LPS")
[0426] (3) CD14+ cells; GM-CSF; TL-4; LPS; coated WIG ("cIVIG")
[0427] (4) CD14+ cells; GM-CSF; TL-4; LPS; soluble IVIG
("sIVIG")
[0428] (5) CD14+ cells; GM-CSF; TL-4; LPS; coated rFcF ("cFc")
[0429] (6) CD14+ cells; GM-CSF; TL-4; LPS; soluble rFcF ("sFc")
[0430] (7) CD14+ cells; GM-CSF; IL-4; LPS ("Control")
Example 22. Does Exposure of iDC to Coated WIG Inhibit Phagocytosis
of Opsonized Red Blood Cells?
[0431] CD14+ cells are purified from human PBMC of a healthy human
donor as described in Example 21 and cultured at 37.degree. C. for
6 days with GM-CSF and IL-4 at the concentrations indicated in the
previous examples and in the presence or absence of coated or
soluble IVIG. The cells are harvested and then incubated at either
37.degree. C. or 4.degree. C. for two hours with Rho-positive human
red blood cells that are uncoated or coated with fluorescein
isothiocyanate (FITC) conjugated anti-D antibody. After incubation
with red blood cells, CD14+ cells are stained for APC-conjugated
CD1a. Phagocytosis is then evaluated by two dimensional FFC
measuring side light scatter (SSC-A), forward light scatter
(FSC-A), FITC fluorescence (FITC-A), and APC fluorescence
(CD1a).
Example 23. Does Exposure to Coated IVIG Decrease the Ability of
iDC to Stimulate an Allogeneic Mixed Lymphocyte Reaction
[0432] CD14+ cells are isolated from the blood of a healthy human
donor as described in the previous examples. They are then cultured
at 37.degree. C. for 6 days with GM CSF and IL-4 in the presence or
absence of soluble and coated IVIG. The concentrations of all these
reagents are as described in above. The cells are then harvested
and plated into the wells of 96 well microtiter tissue culture
plates at various numbers (with the highest dose being
2.5.times.10.sup.4 per well). CD3+ T cells are purified from the
PBMC of a second human donor that was HLA incompatible with the
donor from which the CD14+ cells are isolated. The T cells are
added to each of the wells of the 96 well tissue culture plates
(10.sup.5 T cells per well). After five days of co-culture, 1
.mu.Ci of .sup.3H-thymidine is added to each of the culture wells.
The cultures are then incubated for a further 6 hours and
incorporation of the .sup.3H-thymidine ("cpm") is measured as an
indication of the degree of cell proliferation in the cultures.
Three different iDC stimulator populations are tested: one
generated by culture with GM-CSF and IL-4 only, one generated by
culture with GM-CSF, IL-4, and coated IVIG, and one generated by
culture with GM-CSF, IL-4, and soluble IVIG.
Example 24. Effect of Exposure of iDC to Coated and Soluble rFcF
and IVIG on Cytokine Expression by the iDC and mDC
[0433] Cultures containing CD14+ cells, GM-CSF, and IL-4 and either
rFcF (coated or soluble) or IVIG (coated or soluble) are set up
under the conditions described in the previous examples. Instead of
testing the cells for expression of cell surface markers,
phagocytic ability, or the ability to stimulate allogeneic MLRs,
the cytokines the cells produce are measured. It is expected that
coated rFcF will modulate cytokine production by the cells in a
manner similar to IVIG but not similar to soluble rFcF. Thus, it is
expected that the level of cytokines that inhibit inflammatory
responses (e.g., interleukin4, interleukin-6, and interleukin-12)
will be enhanced by exposure of the cells to coated rFcF. Moreover,
it is expected that exposure of the cells to coated rFcF will
result in a decrease in the level of production by the cells of
cytokines that enhance inflammatory responses (e.g., interferon,
interleukin-23, and tumor necrosis factor-I).
Example 25. Recombinant Mouse Fc Fragments
[0434] Recombinant Fc fragments (rFcF) from mouse IgG2a were
produced using standard cloning and recombinant protein expression
techniques. The two chains of the mouse rFcF each consisted of the
hinge region (21 amino acids), the CH2 domain (110 amino acids),
and the CH3 domain (107 amino acids) of mouse IgG2a heavy chain.
The mouse IgG2a was active in the human iDC assay when coated to
the walls and floors of plate wells.
[0435] Although the present invention and its advantages have been
described in detail, it should be understood that various changes,
substitutions and alterations can be made herein without departing
from the spirit and scope of the invention as defined by the
appended claims. Moreover, the scope of the present application is
not intended to be limited to the particular embodiments of the
process, machine, manufacture, compositions of matter, means,
methods, and steps described in the specification. As one of
ordinary skill in the art will readily appreciate from the
disclosure of the present invention, processes, machines,
manufacture, compositions of matter, means, methods, or steps,
presently existing or later to be developed that perform
substantially the same function or achieve substantially the same
result as the corresponding embodiments described herein may be
utilized according to the present invention. Accordingly, the
appended claims are intended to include within their scope such
processes, machines, manufacture, compositions of matter, means,
methods, or steps. All U.S. and foreign patents, patent application
publications, and non-patent literature (including, but not limited
to, abstracts, scientific journal articles, books, product
literature and manuals) referred to or cited herein are hereby
incorporated by reference in their entireties.
LIST OF REFERENCES
[0436] The following references are incorporated by reference in
their entirety. [0437] 1. Smiley, D. & MG, T. Southwestern
internal medicine conference: High dose intravenous gamma globulin
therapy: How does it work? Am J Med Sci 309, 295-303 (1995). [0438]
2. Nimmerjahn, F. & Ravetch, J. V. The anti-inflammatory
activity of IgG: the intravenous IgG paradox. J. Exp. Med. 204,
11-15 (2007). [0439] 3. Samuelsson, A., Towers, T. L. &
Ravetch, J. V. Anti-inflammatory Activity of IVIG Mediated Through
the Inhibitory Fc Receptor. Science 291, 484-486 (2001). [0440] 4.
Follea, G. et al. Intravenous plasmin-treated gammaglobulin therapy
in idiopathic thrombocytopenic purpura. Nouv Rev Fr Hematol 27,
5-10 (1985). [0441] 5. Solal-Celigny, P., Bernard, J., Herrera, A.
& Biovin, P. Treatment of adult autoimmune thrombocytopenic
purpura with high-dose intravenous plasmin-cleaved gammaglobulins.
Scand J Haematol 31, 39-44 (1983). [0442] 6. Debre, M. &
Bonnet, M. C. Infusion of Gcgamma fragments for treatment of
children with acute immune thrombocytopenic purpura. Lancet 342,
945-49 (1993). [0443] 7. Burdach, S. E., Evers, K. & Geurson,
R. Treatment of acute idiopathic thrombocytopenic purpura of
childhood with intravenous immunoglobulin G: Comparative efficacy
of 7S and 5S preparations. J Pediatr 109, 770-775 (1986). [0444] 8.
Siragam, V. et al. Intravenous immunoglobulin ameliorates ITP via
activating Fc.gamma. receptors on dendritic cells. Nat Med 12, 688
(2006). [0445] 9. Clarkson, S. et al. Treatment of refractory
immune thrombocytopenic purpura with an anti-Fe gamma-receptor
antibody. N Engl J Med 314, 1236-1239 (1986). [0446] 10. Bleeker,
W. K. et al. Vasoactive side effects of intravenous immunoglobulin
preparations in a rat model and their treatment with recombinant
platelet-activating factor acetylhydrolase. Blood 95, 1856-1861
(2000). [0447] 11. Teeling, J. L. et al. Therapeutic efficacy of
intravenous immunoglobulin preparations depends on the
immunoglobulin G dimers: studies in experimental immune
thrombocytopenia. Blood 98, 1095-1099 (2001). [0448] 12. Augener,
W., Friedman, B. & Brittinger, G. Are aggregates of IgG the
effective part of high-dose immunoglobulin therapy in adult
idiopathic thrombocytopenic purpura (ITP)? Blut 50, 249-252 (1985).
[0449] 13. Tankersley, D. L., Preston, M. S. & Finlayson, J. S.
Immunoglobulin G dimer: An idiotypeanti-idiotype complex. Molecular
Immunology 25, 41 (1988). [0450] 14. Shields et al., High
Resolution Mapping of the Binding Site on Human IgG1 for
Fc.gamma.R1, Fc.gamma.RII, Fc.gamma.RIII, and FcRn and Design of
IgG1 Variants with Improved Binding to the FOR J. Biol. Chem.,
February 2001; 276: 6591-6604; doi:10.1074/jbc.M009483200 [0451]
15. Sondermann, P., Huber, R., Oosthuizen, V., and Jacob, U. (2000)
Nature 406, 267-273 [0452] 16. Robert L. Shields, Jadine Lai,
Rodney Keck, Lori Y. O'Connell, Kyu Hong, Y. Gloria Meng, Stefanie
H. A. Weikert, and Leonard G. Presta Lack of Fucose on Human IgG1
N-Linked Oligosaccharide Improves Binding to Human Fc.gamma.RIII
and Antibody-dependent Cellular Toxicity. J. Biol. Chem., July
2002; 277: 26733-26740 [0453] 17. Ann Wright and Sherie L.
Morrison. Effect of C2-Associated Carbohydrate Structure on Ig
Effector Function: Studies with Chimeric Mouse-Human IgG1
Antibodies in Glycosylation Mutants of Chinese Hamster Ovary Cells.
J. Immunol., April 1998; 160: 3393-3402. [0454] 18. Crow A R, et
al. IVIg inhibits reticuloendothelial system function and
ameliorates murine passive immune thrombocytopenia independent of
antiidiotype reactivity. Br J Haematol. 2001; 115:679-686. [0455]
19. Inhibition of maturation and function of dendritic cells by
intravenous immunoglobulin Jagadeesh Bayry, Sebastien
Lacroix-Desmazes, Cedric Carbonneil, Namita Misra, Vladimira
Donkova, Anastas Pashov, Alain Chevailler, Luc Mouthon, Bernard
Weill, Patrick Bruneval, Michel D. Kazatchkine, and Srini V. Kaveri
Blood 2003 101: 758-765. Prepublished online Aug. 29, 2002; DOI
10.1182/blood-2002-05-1447 [0456] 20. R. Deng and J. P. Balthasar.
Comparison of the effects of antibody-coated liposomes, IVIG, and
anti-RBC immunotherapy in a murine model of passive chronic immune
thrombocytopenia. Blood, Mar. 15, 2007; 109(6): 2470-2476.
Prepublished online as a Blood First Edition Paper on Nov. 28,
2006; DOI 10.1182/blood-2006-04-018093. [0457] 21. Kabat, E. A.,
Wu, T. T., Perry, H. M., Gottesman, K. S., and Foeller, C. (1991)
Sequences of Proteins of Immunological Interest, 5th Ed., United
States Public Health Service, National Institutes of Health,
Bethesda [0458] 22. U.S. Published Patent Application 20060074225.
Sequence CWU 1
1
981699DNAHomo sapiensmisc_featureIgG1 Fc domainCDS(1)..(699) 1agt
gag ccc aaa tct tgt gac aaa act cac aca tgc cca ccg tgc cca 48Ser
Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro1 5 10
15gca cct gaa ctc ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa
96Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
20 25 30ccc aag gac acc ctc atg atc tcc cgg acc cct gag gtc aca tgc
gtg 144Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val 35 40 45gtg gtg gac gtg agc cac gaa gac cct gag gtc aag ttc aac
tgg tac 192Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr 50 55 60gtg gac ggc gtg gag gtg cat aat gcc aag aca aag ccg
cgg gag gag 240Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu65 70 75 80cag tac aac agc acg tac cgg gtg gtc agc gtc
ctc acc gtc ctg cac 288Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His 85 90 95cag gac tgg ctg aat ggc aag gag tac aag
tgc aag gtc tcc aac aaa 336Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 100 105 110gcc ctc cca gcc ccc atc gag aaa
acc atc tcc aaa gcc aaa ggg cag 384Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln 115 120 125ccc cga gaa cca cag gtg
tac acc ctg ccc cca tcc cgg gat gag ctg 432Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 130 135 140acc aag aac cag
gtc agc ctg acc tgc ctg gtc aaa ggc ttc tat ccc 480Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro145 150 155 160agc
gac atc gcc gtg gag tgg gag agc aat ggg cag ccg gag aac aac 528Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 165 170
175tac aag acc acg cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc
576Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
180 185 190tac agc aag ctc acc gtg gac aag agc agg tgg cag cag ggg
aac gtc 624Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val 195 200 205ttc tca tgc tcc gtg atg cat gag gct ctg cac aac
cac tac acg cag 672Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 210 215 220aag agc ctc tcc ctg tct ccg ggt aaa
699Lys Ser Leu Ser Leu Ser Pro Gly Lys225 2302233PRTHomo sapiens
2Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro1 5
10 15Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys 20 25 30Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val 35 40 45Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr 50 55 60Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu65 70 75 80Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
Val Leu Thr Val Leu His 85 90 95Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys 100 105 110Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln 115 120 125Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 130 135 140Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro145 150 155
160Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
165 170 175Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu 180 185 190Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val 195 200 205Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln 210 215 220Lys Ser Leu Ser Leu Ser Pro Gly
Lys225 2303684DNAHomo sapiensmisc_featureIgG2 Fc
domainCDS(1)..(684) 3gag cgc aaa tgt tgt gtc gag tgc cca ccg tgc
cca gca cca cct gtg 48Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys
Pro Ala Pro Pro Val1 5 10 15gca gga ccg tca gtc ttc ctc ttc ccc cca
aaa ccc aag gac acc ctc 96Ala Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu 20 25 30atg atc tcc cgg acc cct gag gtc acg
tgc gtg gtg gtg gac gtg agc 144Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser 35 40 45cac gaa gac ccc gag gtc cag ttc
aac tgg tac gtg gac ggc gtg gag 192His Glu Asp Pro Glu Val Gln Phe
Asn Trp Tyr Val Asp Gly Val Glu 50 55 60gtg cat aat gcc aag aca aag
cca cgg gag gag cag ttc aac agc acg 240Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr65 70 75 80ttc cgt gtg gtc agc
gtc ctc acc gtt gtg cac cag gac tgg ctg aac 288Phe Arg Val Val Ser
Val Leu Thr Val Val His Gln Asp Trp Leu Asn 85 90 95ggc aag gag tac
aag tgc aag gtc tcc aac aaa ggc ctc cca gcc ccc 336Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro 100 105 110atc gag
aaa acc atc tcc aaa acc aaa ggg cag ccc cga gaa cca cag 384Ile Glu
Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln 115 120
125gtg tac acc ctg ccc cca tcc cgg gag gag atg acc aag aac cag gtc
432Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val
130 135 140agc ctg acc tgc ctg gtc aaa ggc ttc tac ccc agc gac atc
gcc gtg 480Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val145 150 155 160gag tgg gag agc aat ggg cag ccg gag aac aac
tac aag acc aca cct 528Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro 165 170 175ccc atg ctg gac tcc gac ggc tcc ttc
ttc ctc tac agc aag ctc acc 576Pro Met Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr 180 185 190gtg gac aag agc agg tgg cag
cag ggg aac gtc ttc tca tgc tcc gtg 624Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val 195 200 205atg cat gag gct ctg
cac aac cac tac acg cag aag agc ctc tcc ctg 672Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 210 215 220tct ccg ggt
aaa 684Ser Pro Gly Lys2254228PRTHomo sapiens 4Glu Arg Lys Cys Cys
Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val1 5 10 15Ala Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 20 25 30Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 35 40 45His Glu
Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu 50 55 60Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr65 70 75
80Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp Leu Asn
85 90 95Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala
Pro 100 105 110Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg
Glu Pro Gln 115 120 125Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met
Thr Lys Asn Gln Val 130 135 140Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val145 150 155 160Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 165 170 175Pro Met Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr 180 185 190Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 195 200
205Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
210 215 220Ser Pro Gly Lys2255837DNAHomo sapiensmisc_featureIgG3 Fc
domainCDS(1)..(837) 5gag ctc aaa acc cca ctt ggt gac aca act cac
aca tgc cca cgg tgc 48Glu Leu Lys Thr Pro Leu Gly Asp Thr Thr His
Thr Cys Pro Arg Cys1 5 10 15cca gag ccc aaa tct tgt gac aca cct ccc
ccg tgc cca cgg tgc cca 96Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro
Pro Cys Pro Arg Cys Pro 20 25 30gag ccc aaa tct tgt gac aca cct ccc
cca tgc cca cgg tgc cca gag 144Glu Pro Lys Ser Cys Asp Thr Pro Pro
Pro Cys Pro Arg Cys Pro Glu 35 40 45ccc aaa tct tgt gac aca cct ccc
cca tgc cca cgg tgc cca gca cct 192Pro Lys Ser Cys Asp Thr Pro Pro
Pro Cys Pro Arg Cys Pro Ala Pro 50 55 60gaa ctc ctg gga gga ccg tca
gtc ttc ctc ttc ccc cca aaa ccc aag 240Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys65 70 75 80gat acc ctt atg att
tcc cgg acc cct gag gtc acg tgc gtg gtg gtg 288Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 85 90 95gac gtg agc cac
gaa gac ccc gag gtc cag ttc aag tgg tac gtg gac 336Asp Val Ser His
Glu Asp Pro Glu Val Gln Phe Lys Trp Tyr Val Asp 100 105 110ggc gtg
gag gtg cat aat gcc aag aca aag ccg cgg gag gag cag ttc 384Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 115 120
125aac agc acg ttc cgt gtg gtc agc gtc ctc acc gtc ctg cac cag gac
432Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
130 135 140tgg ctg aac ggc aag gag tac aag tgc aag gtc tcc aac aaa
gcc ctc 480Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu145 150 155 160cca gcc ccc atc gag aaa acc atc tcc aaa acc
aaa gga cag ccc cga 528Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr
Lys Gly Gln Pro Arg 165 170 175gaa cca cag gtg tac acc ctg ccc cca
tcc cgg gag gag atg acc aag 576Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Glu Glu Met Thr Lys 180 185 190aac cag gtc agc ctg acc tgc
ctg gtc aaa ggc ttc tac ccc agc gac 624Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp 195 200 205atc gcc gtg gag tgg
gag agc agc ggg cag ccg gag aac aac tac aac 672Ile Ala Val Glu Trp
Glu Ser Ser Gly Gln Pro Glu Asn Asn Tyr Asn 210 215 220acc acg cct
ccc atg ctg gac tcc gac ggc tcc ttc ttc ctc tac agc 720Thr Thr Pro
Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser225 230 235
240aag ctc acc gtg gac aag agc agg tgg cag cag ggg aac atc ttc tca
768Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Ile Phe Ser
245 250 255tgc tcc gtg atg cat gag gct ctg cac aac cgc ttc acg cag
aag agc 816Cys Ser Val Met His Glu Ala Leu His Asn Arg Phe Thr Gln
Lys Ser 260 265 270ctc tcc ctg tct ccg ggt aaa 837Leu Ser Leu Ser
Pro Gly Lys 2756279PRTHomo sapiens 6Glu Leu Lys Thr Pro Leu Gly Asp
Thr Thr His Thr Cys Pro Arg Cys1 5 10 15Pro Glu Pro Lys Ser Cys Asp
Thr Pro Pro Pro Cys Pro Arg Cys Pro 20 25 30Glu Pro Lys Ser Cys Asp
Thr Pro Pro Pro Cys Pro Arg Cys Pro Glu 35 40 45Pro Lys Ser Cys Asp
Thr Pro Pro Pro Cys Pro Arg Cys Pro Ala Pro 50 55 60Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys65 70 75 80Asp Thr
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 85 90 95Asp
Val Ser His Glu Asp Pro Glu Val Gln Phe Lys Trp Tyr Val Asp 100 105
110Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe
115 120 125Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp 130 135 140Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu145 150 155 160Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Thr Lys Gly Gln Pro Arg 165 170 175Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Glu Glu Met Thr Lys 180 185 190Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 195 200 205Ile Ala Val
Glu Trp Glu Ser Ser Gly Gln Pro Glu Asn Asn Tyr Asn 210 215 220Thr
Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser225 230
235 240Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Ile Phe
Ser 245 250 255Cys Ser Val Met His Glu Ala Leu His Asn Arg Phe Thr
Gln Lys Ser 260 265 270Leu Ser Leu Ser Pro Gly Lys 2757687DNAHomo
sapiensmisc_featureIgG4 Fc domainCDS(1)..(687) 7gag tcc aaa tat ggt
ccc ccg tgc cca tca tgc cca gca cct gag ttc 48Glu Ser Lys Tyr Gly
Pro Pro Cys Pro Ser Cys Pro Ala Pro Glu Phe1 5 10 15ctg ggg gga cca
tca gtc ttc ctg ttc ccc cca aaa ccc aag gac act 96Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 20 25 30ctc atg atc
tcc cgg acc cct gag gtc acg tgc gtg gtg gtg gac gtg 144Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 35 40 45agc cag
gaa gac ccc gag gtc cag ttc aac tgg tac gtg gat ggc gtg 192Ser Gln
Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val 50 55 60gag
gtg cat aat gcc aag aca aag ccg cgg gag gag cag ttc aac agc 240Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser65 70 75
80acg tac cgt gtg gtc agc gtc ctc acc gtc gtg cac cag gac tgg ctg
288Thr Tyr Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp Leu
85 90 95aac ggc aag gag tac aag tgc aag gtc tcc aac aaa ggc ctc ccg
tcc 336Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro
Ser 100 105 110tcc atc gag aaa acc atc tcc aaa gcc aaa ggg cag ccc
cga gag cca 384Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro 115 120 125cag gtg tac acc ctg ccc cca tcc cag gag gag
atg acc aag aac cag 432Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu
Met Thr Lys Asn Gln 130 135 140gtc agc ctg acc tgc ctg gtc aaa ggc
ttc tac ccc agc gac atc gcc 480Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala145 150 155 160gtg gag tgg gag agc aat
ggg cag ccg gag aac aac tac aag acc acg 528Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 165 170 175cct ccc gtg ctg
gac tcc gac ggc tcc ttc ttc ctc tac agc agg cta 576Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu 180 185 190acc gtg
gac aag agc agg tgg cag gag ggg aat gtc ttc tca tgc tcc 624Thr Val
Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser 195 200
205gtg atg cat gag gct ctg cac aac cac tac acg cag aag agc ctc tcc
672Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
210 215 220ctg tct ctg ggt aaa 687Leu Ser Leu Gly Lys2258229PRTHomo
sapiens 8Glu Ser Lys Tyr Gly Pro Pro Cys Pro Ser Cys Pro Ala Pro
Glu Phe1 5 10 15Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr 20 25 30Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val 35 40 45Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp
Tyr Val Asp Gly Val 50 55 60Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Phe Asn Ser65 70 75 80Thr Tyr Arg Val Val Ser Val Leu
Thr Val Val His Gln Asp Trp Leu 85 90 95Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Gly Leu Pro Ser 100 105 110Ser Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
115 120 125Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys
Asn Gln 130 135 140Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala145 150 155 160Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr 165 170 175Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Arg Leu 180 185 190Thr Val Asp Lys Ser
Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser 195 200 205Val Met His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 210 215 220Leu
Ser Leu Gly Lys225948DNAHomo sapiensmisc_featureIgG1 hinge
regionCDS(1)..(48) 9agt gag ccc aaa tct tgt gac aaa act cac aca tgc
cca ccg tgc cca 48Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys
Pro Pro Cys Pro1 5 10 151016PRTHomo sapiens 10Ser Glu Pro Lys Ser
Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro1 5 10 151136DNAHomo
sapiensmisc_featureIgG2 hinge regionCDS(1)..(36) 11gag cgc aaa tgt
tgt gtc gag tgc cca ccg tgc cca 36Glu Arg Lys Cys Cys Val Glu Cys
Pro Pro Cys Pro1 5 101212PRTHomo sapiens 12Glu Arg Lys Cys Cys Val
Glu Cys Pro Pro Cys Pro1 5 1013186DNAHomo sapiensmisc_featureIgG3
hinge regionCDS(1)..(186) 13gag ctc aaa acc cca ctt ggt gac aca act
cac aca tgc cca cgg tgc 48Glu Leu Lys Thr Pro Leu Gly Asp Thr Thr
His Thr Cys Pro Arg Cys1 5 10 15cca gag ccc aaa tct tgt gac aca cct
ccc ccg tgc cca cgg tgc cca 96Pro Glu Pro Lys Ser Cys Asp Thr Pro
Pro Pro Cys Pro Arg Cys Pro 20 25 30gag ccc aaa tct tgt gac aca cct
ccc cca tgc cca cgg tgc cca gag 144Glu Pro Lys Ser Cys Asp Thr Pro
Pro Pro Cys Pro Arg Cys Pro Glu 35 40 45ccc aaa tct tgt gac aca cct
ccc cca tgc cca cgg tgc cca 186Pro Lys Ser Cys Asp Thr Pro Pro Pro
Cys Pro Arg Cys Pro 50 55 601462PRTHomo sapiens 14Glu Leu Lys Thr
Pro Leu Gly Asp Thr Thr His Thr Cys Pro Arg Cys1 5 10 15Pro Glu Pro
Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro 20 25 30Glu Pro
Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro Glu 35 40 45Pro
Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro 50 55
601536DNAHomo sapiensmisc_featureIgG4 hinge regionCDS(1)..(36)
15gag tcc aaa tat ggt ccc ccg tgc cca tca tgc cca 36Glu Ser Lys Tyr
Gly Pro Pro Cys Pro Ser Cys Pro1 5 101612PRTHomo sapiens 16Glu Ser
Lys Tyr Gly Pro Pro Cys Pro Ser Cys Pro1 5 10171588DNAArtificial
SequenceIgK/IgG1 Fc/IgG1 FcCDS(45)..(1550) 17gtcagttaag cttggtaccg
agctcggatc cagtaccctt cacc atg gag aca gac 56 Met Glu Thr Asp 1aca
ctc ctg cta tgg gta ctg ctg ctc tgg gtt cca ggt tcc act ggt 104Thr
Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro Gly Ser Thr Gly5 10 15
20gac gcg gca gat atc cag cac agt ggc ggc cgc tcg agt gag ccc aaa
152Asp Ala Ala Asp Ile Gln His Ser Gly Gly Arg Ser Ser Glu Pro Lys
25 30 35tct tgt gac aaa act cac aca tgc cca ccg tgc cca gca cct gaa
ctc 200Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu 40 45 50ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa ccc aag
gac acc 248Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr 55 60 65ctc atg atc tcc cgg acc cct gag gtc aca tgc gtg gtg
gtg gac gtg 296Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val 70 75 80agc cac gaa gac cct gag gtc aag ttc aac tgg tac
gtg gac ggc gtg 344Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val85 90 95 100gag gtg cat aat gcc aag aca aag ccg cgg
gag gag cag tac aac agc 392Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser 105 110 115acg tac cgg gtg gtc agc gtc ctc
acc gtc ctg cac cag gac tgg ctg 440Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu 120 125 130aat ggc aag gag tac aag
tgc aag gtc tcc aac aaa gcc ctc cca gcc 488Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 135 140 145ccc atc gag aaa
acc atc tcc aaa gcc aaa ggg cag ccc cga gaa cca 536Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 150 155 160cag gtg
tac acc ctg ccc cca tcc cgg gat gag ctg acc aag aac cag 584Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln165 170 175
180gtc agc ctg acc tgc ctg gtc aaa ggc ttc tat ccc agc gac atc gcc
632Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
185 190 195gtg gag tgg gag agc aat ggg cag ccg gag aac aac tac aag
acc acg 680Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr 200 205 210cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc
tac agc aag ctc 728Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu 215 220 225acc gtg gac aag agc agg tgg cag cag ggg
aac gtc ttc tca tgc tcc 776Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser 230 235 240gtg atg cat gag gct ctg cac aac
cac tac acg cag aag agc ctc tcc 824Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser245 250 255 260ctg tct ccg ggt aaa
agt cta gac ccc aaa tct tgt gac aaa act cac 872Leu Ser Pro Gly Lys
Ser Leu Asp Pro Lys Ser Cys Asp Lys Thr His 265 270 275aca tgc cca
ccg tgc cca gca cct gaa ctc ctg ggg gga ccg tca gtc 920Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 280 285 290ttc
ctc ttc ccc cca aaa ccc aag gac acc ctc atg atc tcc cgg acc 968Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 295 300
305cct gag gtc aca tgc gtg gtg gtg gac gtg agc cac gaa gac cct gag
1016Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
310 315 320gtc aag ttc aac tgg tac gtg gac ggc gtg gag gtg cat aat
gcc aag 1064Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys325 330 335 340aca aag ccg cgg gag gag cag tac aac agc acg
tac cgg gtg gtc agc 1112Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser 345 350 355gtc ctc acc gtc ctg cac cag gac tgg
ctg aat ggc aag gag tac aag 1160Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys 360 365 370tgc aag gtc tcc aac aaa gcc
ctc cca gcc ccc atc gag aaa acc atc 1208Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile 375 380 385tcc aaa gcc aaa ggg
cag ccc cga gaa cca cag gtg tac acc ctg ccc 1256Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 390 395 400cca tcc cgg
gat gag ctg acc aag aac cag gtc agc ctg acc tgc ctg 1304Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu405 410 415
420gtc aaa ggc ttc tat ccc agc gac atc gcc gtg gag tgg gag agc aat
1352Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
425 430 435ggg cag ccg gag aac aac tac aag acc acg cct ccc gtg ctg
gac tcc 1400Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser 440 445 450gac ggc tcc ttc ttc ctc tac agc aag ctc acc gtg
gac aag agc agg 1448Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg 455 460 465tgg cag cag ggg aac gtc ttc tca tgc tcc
gtg atg cat gag gct ctg 1496Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu 470 475 480cac aac cac tac acg cag aag agc
ctc tcc ctg tct ccg ggt aaa acc 1544His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys Thr485 490 495 500ggt tga catcatcacc
atcaccattg atgagttaaa cccgctga 1588Gly18501PRTArtificial
SequenceSynthetic Construct 18Met Glu Thr Asp Thr Leu Leu Leu Trp
Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp
Ile Gln His Ser Gly Gly Arg Ser 20 25 30Ser Glu Pro Lys Ser Cys Asp
Lys Thr His Thr Cys Pro Pro Cys Pro 35 40 45Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 50 55 60Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val65 70 75 80Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 85 90 95Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 100 105
110Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
115 120 125Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys 130 135 140Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln145 150 155 160Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu 165 170 175Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro 180 185 190Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 195 200 205Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 210 215 220Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val225 230
235 240Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln 245 250 255Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Asp Pro
Lys Ser Cys 260 265 270Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly 275 280 285Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met 290 295 300Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His305 310 315 320Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 325 330 335His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 340 345
350Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
355 360 365Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile 370 375 380Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val385 390 395 400Tyr Thr Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser 405 410 415Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu 420 425 430Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 435 440 445Val Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 450 455 460Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met465 470
475 480His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser 485 490 495Pro Gly Lys Thr Gly 50019952DNAArtificial
SequenceIgG1 monomer sequenceCDS(45)..(932) 19gtcagttaag cttggtaccg
agctcggatc cagtaccctt cacc atg gag aca gac 56 Met Glu Thr Asp 1aca
ctc ctg cta tgg gta ctg ctg ctc tgg gtt cca ggt tcc act ggt 104Thr
Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro Gly Ser Thr Gly5 10 15
20gac gcg gca gat atc cag cac agt ggc ggc cgc tcg agt gag ccc aaa
152Asp Ala Ala Asp Ile Gln His Ser Gly Gly Arg Ser Ser Glu Pro Lys
25 30 35tct tgt gac aaa act cac aca tgc cca ccg tgc cca gca cct gaa
ctc 200Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu 40 45 50ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa ccc aag
gac acc 248Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr 55 60 65ctc atg atc tcc cgg acc cct gag gtc aca tgc gtg gtg
gtg gac gtg 296Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val 70 75 80agc cac gaa gac cct gag gtc aag ttc aac tgg tac
gtg gac ggc gtg 344Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val85 90 95 100gag gtg cat aat gcc aag aca aag ccg cgg
gag gag cag tac aac agc 392Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser 105 110 115acg tac cgg gtg gtc agc gtc ctc
acc gtc ctg cac cag gac tgg ctg 440Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu 120 125 130aat ggc aag gag tac aag
tgc aag gtc tcc aac aaa gcc ctc cca gcc 488Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 135 140 145ccc atc gag aaa
acc atc tcc aaa gcc aaa ggg cag ccc cga gaa cca 536Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 150 155 160cag gtg
tac acc ctg ccc cca tcc cgg gat gag ctg acc aag aac cag 584Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln165 170 175
180gtc agc ctg acc tgc ctg gtc aaa ggc ttc tat ccc agc gac atc gcc
632Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
185 190 195gtg gag tgg gag agc aat ggg cag ccg gag aac aac tac aag
acc acg 680Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr 200 205 210cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc
tac agc aag ctc 728Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu 215 220 225acc gtg gac aag agc agg tgg cag cag ggg
aac gtc ttc tca tgc tcc 776Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser 230 235 240gtg atg cat gag gct ctg cac aac
cac tac acg cag aag agc ctc tcc 824Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser245 250 255 260ctg tct ccg ggt aaa
agt cta gag ggc ccg cgg ttc gaa ggt aag cct 872Leu Ser Pro Gly Lys
Ser Leu Glu Gly Pro Arg Phe Glu Gly Lys Pro 265 270 275atc cct aac
cct ctc ctc ggt ctc gat tct acg cgt acc ggt cat cat 920Ile Pro Asn
Pro Leu Leu Gly Leu Asp Ser Thr Arg Thr Gly His His 280 285 290cac
cat cac cat tgatgagtta aacccgctga 952His His His His
29520296PRTArtificial SequenceSynthetic Construct 20Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Gln His Ser Gly Gly Arg Ser 20 25 30Ser Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 35 40 45Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 50 55
60Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val65
70 75 80Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr 85 90 95Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu 100 105 110Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His 115 120 125Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 130 135 140Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln145 150 155 160Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 165 170
175Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
180 185 190Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn 195 200 205Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu 210 215 220Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val225 230 235 240Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr Gln 245 250 255Lys Ser Leu Ser Leu
Ser Pro Gly Lys Ser Leu Glu Gly Pro Arg Phe 260 265 270Glu Gly Lys
Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg 275 280 285Thr
Gly His His His His His His 290 295211588DNAArtificial SequenceIgG1
dimer sequence without tagsCDS(45)..(1550) 21gtcagttaag cttggtaccg
agctcggatc cagtaccctt cacc atg gag aca gac 56 Met Glu Thr Asp 1aca
ctc ctg cta tgg gta ctg ctg ctc tgg gtt cca ggt tcc act ggt 104Thr
Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro Gly Ser Thr Gly5 10 15
20gac gcg gca gat atc cag cac agt ggc ggc cgc tcg agt gag ccc aaa
152Asp Ala Ala Asp Ile Gln His Ser Gly Gly Arg Ser Ser Glu Pro Lys
25 30 35tct tgt gac aaa act cac aca tgc cca ccg tgc cca gca cct gaa
ctc 200Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu 40 45 50ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa ccc aag
gac acc 248Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr 55 60 65ctc atg atc tcc cgg acc cct gag gtc aca tgc gtg gtg
gtg gac gtg 296Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val 70 75 80agc cac gaa gac cct gag gtc aag ttc aac tgg tac
gtg gac ggc gtg 344Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val85 90 95 100gag gtg cat aat gcc aag aca aag ccg cgg
gag gag cag tac aac agc 392Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser 105 110 115acg tac cgg gtg gtc agc gtc ctc
acc gtc ctg cac cag gac tgg ctg 440Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu 120 125 130aat ggc aag gag tac aag
tgc aag gtc tcc aac aaa gcc ctc cca gcc 488Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 135 140 145ccc atc gag aaa
acc atc tcc aaa gcc aaa ggg cag ccc cga gaa cca 536Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 150 155 160cag gtg
tac acc ctg ccc cca tcc cgg gat gag ctg acc aag aac cag 584Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln165 170 175
180gtc agc ctg acc tgc ctg gtc aaa ggc ttc tat ccc agc gac atc gcc
632Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
185 190 195gtg gag tgg gag agc aat ggg cag ccg gag aac aac tac aag
acc acg 680Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr 200 205 210cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc
tac agc aag ctc 728Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu 215 220 225acc gtg gac aag agc agg tgg cag cag ggg
aac gtc ttc tca tgc tcc 776Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser 230 235 240gtg atg cat gag gct ctg cac aac
cac tac acg cag aag agc ctc tcc 824Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser245 250 255 260ctg tct ccg ggt aaa
agt cta gac ccc aaa tct tgt gac aaa act cac 872Leu Ser Pro Gly Lys
Ser Leu Asp Pro Lys Ser Cys Asp Lys Thr His 265 270 275aca tgc cca
ccg tgc cca gca cct gaa ctc ctg ggg gga ccg tca gtc 920Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 280 285 290ttc
ctc ttc ccc cca aaa ccc aag gac acc ctc atg atc tcc cgg acc 968Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 295 300
305cct gag gtc aca tgc gtg gtg gtg gac gtg agc cac gaa gac cct gag
1016Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
310 315 320gtc aag ttc aac tgg tac gtg gac ggc gtg gag gtg cat aat
gcc aag 1064Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys325 330 335 340aca aag ccg cgg gag gag cag tac aac agc acg
tac cgg gtg gtc agc 1112Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser 345 350 355gtc ctc acc gtc ctg cac cag gac tgg
ctg aat ggc aag gag tac aag 1160Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys 360 365 370tgc aag gtc tcc aac aaa gcc
ctc cca gcc ccc atc gag aaa acc atc 1208Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile 375 380 385tcc aaa gcc aaa ggg
cag ccc cga gaa cca cag gtg tac acc ctg ccc 1256Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 390 395 400cca tcc cgg
gat gag ctg acc aag aac cag gtc agc ctg acc tgc ctg 1304Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu405 410 415
420gtc aaa ggc ttc tat ccc agc gac atc gcc gtg gag tgg gag agc aat
1352Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
425 430 435ggg cag ccg gag aac aac tac aag acc acg cct ccc gtg ctg
gac tcc 1400Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser 440 445 450gac ggc tcc ttc ttc ctc tac agc aag ctc acc gtg
gac aag agc agg 1448Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg 455 460 465tgg cag cag ggg aac gtc ttc tca tgc tcc
gtg atg cat gag gct ctg 1496Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu 470 475 480cac aac cac tac acg cag aag agc
ctc tcc ctg tct ccg ggt aaa acc 1544His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys Thr485 490 495 500ggt tga catcatcacc
atcaccattg atgagttaaa cccgctga 1588Gly22501PRTArtificial
SequenceSynthetic Construct 22Met Glu Thr Asp Thr Leu Leu Leu Trp
Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp
Ile Gln His Ser Gly Gly Arg Ser 20 25 30Ser Glu Pro Lys Ser Cys Asp
Lys Thr His Thr Cys Pro Pro Cys Pro 35 40 45Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 50 55 60Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val65 70 75 80Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 85 90 95Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 100 105
110Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
115 120 125Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys 130 135 140Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln145 150 155 160Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu 165 170 175Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro 180 185 190Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 195 200 205Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 210 215 220Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val225 230
235 240Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln 245 250 255Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Asp Pro
Lys Ser Cys 260 265 270Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly 275 280 285Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met 290 295 300Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His305 310 315 320Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 325 330 335His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 340 345
350Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
355 360 365Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile 370 375 380Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val385 390 395 400Tyr Thr Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser 405 410 415Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu 420 425 430Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 435 440 445Val Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 450 455 460Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met465 470
475 480His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser 485 490 495Pro Gly Lys Thr Gly 500231636DNAArtificial
SequenceIgG1 dimer sequence with epitope tagsCDS(45)..(1616)
23gtcagttaag cttggtaccg agctcggatc cagtaccctt cacc atg gag aca gac
56 Met Glu Thr Asp 1aca ctc ctg cta tgg gta ctg ctg ctc tgg gtt cca
ggt tcc act ggt 104Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro
Gly Ser Thr Gly5 10 15 20gac gcg gca gat atc cag cac agt ggc ggc
cgc tcg agt gag ccc aaa 152Asp Ala Ala Asp Ile Gln His Ser Gly Gly
Arg Ser Ser Glu Pro Lys 25 30 35tct tgt gac aaa act cac aca tgc cca
ccg tgc cca gca cct gaa ctc 200Ser Cys Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu 40 45 50ctg ggg gga ccg tca gtc ttc ctc
ttc ccc cca aaa ccc aag gac acc 248Leu Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr 55 60 65ctc atg atc tcc cgg acc cct
gag gtc aca tgc gtg gtg gtg gac gtg 296Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val 70 75 80agc cac gaa gac cct gag
gtc aag ttc aac tgg tac gtg gac ggc gtg 344Ser His Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val85 90 95 100gag gtg cat aat
gcc aag aca aag ccg cgg gag gag cag tac aac agc 392Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 105 110 115acg tac
cgg gtg gtc agc gtc ctc acc gtc ctg cac cag gac tgg ctg 440Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 120 125
130aat ggc aag gag tac aag tgc aag gtc tcc aac aaa gcc ctc cca gcc
488Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
135 140 145ccc atc gag aaa acc atc tcc aaa gcc aaa ggg cag ccc cga
gaa cca 536Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro 150 155 160cag gtg tac acc ctg ccc cca tcc cgg gat gag ctg
acc aag aac cag 584Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln165 170 175 180gtc agc ctg acc tgc ctg gtc aaa ggc
ttc tat ccc agc gac atc gcc 632Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala 185 190 195gtg gag tgg gag agc aat ggg
cag ccg gag aac aac tac aag acc acg 680Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr 200 205 210cct ccc gtg ctg gac
tcc gac ggc tcc ttc ttc ctc tac agc aag ctc 728Pro Pro Val Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 215 220 225acc gtg gac
aag agc agg tgg cag cag ggg aac gtc ttc tca tgc tcc 776Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 230 235 240gtg
atg cat gag gct ctg cac aac cac tac acg cag aag agc ctc tcc 824Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser245 250
255 260ctg tct ccg ggt aaa agt cta gac ccc aaa tct tgt gac aaa act
cac 872Leu Ser Pro Gly Lys Ser Leu Asp Pro Lys Ser Cys Asp Lys Thr
His 265 270 275aca tgc cca ccg tgc cca gca cct gaa ctc ctg ggg gga
ccg tca gtc 920Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val 280 285 290ttc ctc ttc ccc cca aaa ccc aag gac acc ctc
atg atc tcc cgg acc 968Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr 295 300 305cct gag gtc aca tgc gtg gtg gtg gac
gtg agc cac gaa gac cct gag 1016Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro Glu 310 315 320gtc aag ttc aac tgg tac gtg
gac ggc gtg gag gtg cat aat gcc aag 1064Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys325 330 335 340aca aag ccg cgg
gag gag cag tac aac agc acg tac cgg gtg gtc agc 1112Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 345 350 355gtc ctc
acc gtc ctg cac cag gac tgg ctg aat ggc aag gag tac aag 1160Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 360 365
370tgc aag gtc tcc aac aaa gcc ctc cca gcc ccc atc gag aaa acc atc
1208Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
375 380 385tcc aaa gcc aaa ggg cag ccc cga gaa cca cag gtg tac acc
ctg ccc 1256Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro 390 395 400cca tcc cgg gat gag ctg acc aag aac cag gtc agc
ctg acc tgc ctg 1304Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu405 410 415 420gtc aaa ggc ttc tat ccc agc gac atc
gcc gtg gag tgg gag agc aat 1352Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn 425 430 435ggg cag ccg gag aac aac tac
aag acc acg cct ccc gtg ctg gac tcc 1400Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser 440 445 450gac ggc tcc ttc ttc
ctc tac agc aag ctc acc gtg gac aag agc agg 1448Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 455 460 465tgg cag cag
ggg aac gtc ttc tca tgc tcc gtg atg cat gag gct ctg 1496Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 470 475 480cac
aac cac tac acg cag aag agc ctc tcc ctg tct ccg ggt aaa ttc 1544His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Phe485 490
495 500gaa ggt aag cct atc cct aac cct ctc ctc ggt ctc gat tct acg
cgt 1592Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr
Arg 505 510 515acc ggt cat cat cac cat cac cat tgatgagtta
aacccgctga 1636Thr Gly His His His His His His
52024524PRTArtificial SequenceSynthetic Construct 24Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Gln His Ser Gly Gly Arg Ser 20 25 30Ser Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 35 40 45Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 50 55
60Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val65
70 75 80Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr 85 90 95Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu 100 105 110Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu
Thr Val Leu His 115 120 125Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 130 135 140Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln145 150 155 160Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 165 170 175Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 180 185 190Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 195 200
205Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
210 215 220Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val225 230 235 240Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln 245 250 255Lys Ser Leu Ser Leu Ser Pro Gly Lys
Ser Leu Asp Pro Lys Ser Cys 260 265 270Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly 275 280 285Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 290 295 300Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His305 310 315
320Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val
325 330 335His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr 340 345 350Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly 355 360 365Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile 370 375 380Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val385 390 395 400Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 405 410 415Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 420 425 430Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 435 440
445Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
450 455 460Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met465 470 475 480His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser 485 490 495Pro Gly Lys Phe Glu Gly Lys Pro Ile
Pro Asn Pro Leu Leu Gly Leu 500 505 510Asp Ser Thr Arg Thr Gly His
His His His His His 515 520251763DNAArtificial SequenceIgG3/IgG1
dimer sequence with epitope tagsCDS(45)..(1760) 25gtcagttaag
cttggtaccg agctcggatc cagtaccctt cacc atg gag aca gac 56 Met Glu
Thr Asp 1aca ctc ctg cta tgg gta ctg ctg ctc tgg gtt cca ggt tcc
act ggt 104Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro Gly Ser
Thr Gly5 10 15 20gac gcg gca gat atc gag ctc aaa acc cca ctt ggt
gac aca act cac 152Asp Ala Ala Asp Ile Glu Leu Lys Thr Pro Leu Gly
Asp Thr Thr His 25 30 35aca tgc cca cgg tgc cca gag ccc aaa tct tgt
gac aca cct ccc ccg 200Thr Cys Pro Arg Cys Pro Glu Pro Lys Ser Cys
Asp Thr Pro Pro Pro 40 45 50tgc cca cgg tgc cca gag ccc aaa tct tgt
gac aca cct ccc cca tgc 248Cys Pro Arg Cys Pro Glu Pro Lys Ser Cys
Asp Thr Pro Pro Pro Cys 55 60 65cca cgg tgc cca gag ccc aaa tct tgt
gac aca cct ccc cca tgc cca 296Pro Arg Cys Pro Glu Pro Lys Ser Cys
Asp Thr Pro Pro Pro Cys Pro 70 75 80cgg tgc cca gca cct gaa ctc ctg
gga gga ccg tca gtc ttc ctc ttc 344Arg Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe85 90 95 100ccc cca aaa ccc aag gat
acc ctt atg att tcc cgg acc cct gag gtc 392Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val 105 110 115acg tgc gtg gtg
gtg gac gtg agc cac gaa gac ccc gag gtc cag ttc 440Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe 120 125 130aag tgg
tac gtg gac ggc gtg gag gtg cat aat gcc aag aca aag ccg 488Lys Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro 135 140
145cgg gag gag cag ttc aac agc acg ttc cgt gtg gtc agc gtc ctc acc
536Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr
150 155 160gtc ctg cac cag gac tgg ctg aac ggc aag gag tac aag tgc
aag gtc 584Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val165 170 175 180tcc aac aaa gcc ctc cca gcc ccc atc gag aaa
acc atc tcc aaa acc 632Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Thr 185 190 195aaa gga cag ccc cga gaa cca cag gtg
tac acc ctg ccc cca tcc cgg 680Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg 200 205 210gag gag atg acc aag aac cag
gtc agc ctg acc tgc ctg gtc aaa ggc 728Glu Glu Met Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly 215 220 225ttc tac ccc agc gac
atc gcc gtg gag tgg gag agc agc ggg cag ccg 776Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu Ser Ser Gly Gln Pro 230 235 240gag aac aac
tac aac acc acg cct ccc atg ctg gac tcc gac ggc tcc 824Glu Asn Asn
Tyr Asn Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser245 250 255
260ttc ttc ctc tac agc aag ctc acc gtg gac aag agc agg tgg cag cag
872Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
265 270 275ggg aac atc ttc tca tgc tcc gtg atg cat gag gct ctg cac
aac cgc 920Gly Asn Ile Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn Arg 280 285 290ttc acg cag aag agc ctc tcc ctg tct ccg ggt aaa
ggc ggc cgc tcg 968Phe Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
Gly Gly Arg Ser 295 300 305agt gag ccc aaa tct tgt gac aaa act cac
aca tgc cca ccg tgc cca 1016Ser Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro 310 315 320gca cct gaa ctc ctg ggg gga ccg
tca gtc ttc ctc ttc ccc cca aaa 1064Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys325 330 335 340ccc aag gac acc ctc
atg atc tcc cgg acc cct gag gtc aca tgc gtg 1112Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 345 350 355gtg gtg gac
gtg agc cac gaa gac cct gag gtc aag ttc aac tgg tac 1160Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 360 365 370gtg
gac ggc gtg gag gtg cat aat gcc aag aca aag ccg cgg gag gag 1208Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 375 380
385cag tac aac agc acg tac cgg gtg gtc agc gtc ctc acc gtc ctg cac
1256Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
390 395 400cag gac tgg ctg aat ggc aag gag tac aag tgc aag gtc tcc
aac aaa 1304Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys405 410 415 420gcc ctc cca gcc ccc atc gag aaa acc atc tcc
aaa gcc aaa ggg cag 1352Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln 425 430 435ccc cga gaa cca cag gtg tac acc ctg
ccc cca tcc cgg gat gag ctg 1400Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu 440 445 450acc aag aac cag gtc agc ctg
acc tgc ctg gtc aaa ggc ttc tat ccc 1448Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro 455 460 465agc gac atc gcc gtg
gag tgg gag agc aat ggg cag ccg gag aac aac 1496Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 470 475 480tac aag acc
acg cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc 1544Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu485 490 495
500tac agc aag ctc acc gtg gac aag agc agg tgg cag cag ggg aac gtc
1592Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
505 510 515ttc tca tgc tcc gtg atg cat gag gct ctg cac aac cac tac
acg cag 1640Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln 520 525 530aag agc ctc tcc ctg tct ccg ggt aaa agt cta gag
ggc ccg cgg ttc 1688Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu
Gly Pro Arg Phe 535 540 545gaa ggt aag cct atc cct aac cct ctc ctc
ggt ctc gat tct acg cgt 1736Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu
Gly Leu Asp Ser Thr Arg 550 555 560acc ggt cat cat cac cat cac cat
tga 1763Thr Gly His His His His His His565 57026572PRTArtificial
SequenceSynthetic Construct 26Met Glu Thr Asp Thr Leu Leu Leu Trp
Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp
Ile Glu Leu Lys Thr Pro Leu Gly 20 25 30Asp Thr Thr His Thr Cys Pro
Arg Cys Pro Glu Pro Lys Ser Cys Asp 35 40 45Thr Pro Pro Pro Cys Pro
Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr 50 55 60Pro Pro Pro Cys Pro
Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro65 70 75 80Pro Pro Cys
Pro Arg Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 85 90 95Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 100 105
110Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro
115 120 125Glu Val Gln Phe Lys Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala 130 135 140Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr
Phe Arg Val Val145 150 155 160Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr 165 170 175Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr 180 185 190Ile Ser Lys Thr Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 195 200 205Pro Pro Ser
Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys 210 215 220Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser225 230
235 240Ser Gly Gln Pro Glu Asn Asn Tyr Asn Thr Thr Pro Pro Met Leu
Asp 245 250 255Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser 260 265 270Arg Trp Gln Gln Gly Asn Ile Phe Ser Cys Ser
Val Met His Glu Ala 275 280 285Leu His Asn Arg Phe Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys 290 295 300Gly Gly Arg Ser Ser Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys305 310 315 320Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu 325 330 335Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 340 345
350Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys
355 360 365Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys 370 375 380Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu385 390 395 400Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys 405 410 415Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr Ile Ser Lys 420 425 430Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 435 440 445Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 450 455 460Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln465 470
475 480Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly 485 490 495Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln 500 505 510Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn 515 520 525His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly Lys Ser Leu Glu 530 535 540Gly Pro Arg Phe Glu Gly Lys
Pro Ile Pro Asn Pro Leu Leu Gly Leu545 550 555 560Asp Ser Thr Arg
Thr Gly His His His His His His 565 570272224DNAArtificial
SequenceIgE(CH2)/IgG1(hinge-CH2-CH3)/IgG1 (hinge-CH2)/ IgE(CH4)
fusion without epitope tagsCDS(45)..(2183) 27gtcagttaag cttggtaccg
agctcggatc cagtaccctt cacc atg gag aca gac 56 Met Glu Thr Asp 1aca
ctc ctg cta tgg gta ctg ctg ctc tgg gtt cca ggt tcc act ggt 104Thr
Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro Gly Ser Thr Gly5 10 15
20gac gcg gca gat atc gtc tgc tcc agg gac ttc acc ccg ccc acc gtg
152Asp Ala Ala Asp Ile Val Cys Ser Arg Asp Phe Thr Pro Pro Thr Val
25 30 35aag atc tta cag tcg tcc tgc gac ggc ggc ggg cac ttc ccc ccg
acc 200Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly His Phe Pro Pro
Thr 40 45 50atc cag ctc ctg tgc ctc gtc tct ggg tac acc cca ggg act
atc aac 248Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr Thr Pro Gly Thr
Ile Asn 55 60 65atc acc tgg ctg gag gac ggg cag gtc atg gac gtg gac
ttg tcc acc 296Ile Thr Trp Leu Glu Asp Gly Gln Val Met Asp Val Asp
Leu Ser Thr 70 75 80gcc tct acc acg cag gag ggt gag ctg gcc tcc aca
caa agc gag ctc 344Ala Ser Thr Thr Gln Glu Gly Glu Leu Ala Ser Thr
Gln Ser Glu Leu85 90 95 100acc ctc agc cag aag cac tgg ctg tca gac
cgc acc tac acc tgc cag 392Thr Leu Ser Gln Lys His Trp Leu Ser Asp
Arg Thr Tyr Thr Cys Gln 105 110 115gtc acc tat caa ggt cac acc ttt
gag gac agc acc aag aag tgt gca 440Val Thr Tyr Gln Gly His Thr Phe
Glu Asp Ser Thr Lys Lys Cys Ala 120 125 130ggc ggc cgc tcg agt gag
ccc aaa tct tgt gac aaa act cac aca tgc 488Gly Gly Arg Ser Ser Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys 135 140 145cca ccg tgc cca
gca cct gaa ctc ctg ggg gga ccg tca gtc ttc ctc 536Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu 150 155 160ttc ccc
cca aaa ccc aag gac acc ctc atg atc tcc cgg acc cct gag 584Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu165 170 175
180gtc aca tgc gtg gtg gtg gac gtg agc cac gaa gac cct gag gtc aag
632Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys
185 190 195ttc aac tgg tac gtg gac ggc gtg gag gtg cat aat gcc aag
aca aag 680Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys 200 205 210ccg cgg gag gag cag tac aac agc acg tac cgg gtg
gtc agc gtc ctc 728Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu 215 220 225acc gtc ctg cac cag gac tgg ctg aat ggc
aag gag tac aag tgc aag 776Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys 230 235 240gtc tcc aac aaa gcc ctc cca gcc
ccc atc gag aaa acc atc tcc aaa 824Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys245 250 255 260gcc aaa ggg cag ccc
cga gaa cca cag gtg tac acc ctg ccc cca tcc 872Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 265 270 275cgg gat gag
ctg acc aag aac cag gtc agc ctg acc tgc ctg gtc aaa 920Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 280 285 290ggc
ttc tat ccc agc gac atc gcc gtg gag tgg gag agc aat ggg cag 968Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 295 300
305ccg gag
aac aac tac aag acc acg cct ccc gtg ctg gac tcc gac ggc 1016Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 310 315
320tcc ttc ttc ctc tac agc aag ctc acc gtg gac aag agc agg tgg cag
1064Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln325 330 335 340cag ggg aac gtc ttc tca tgc tcc gtg atg cat gag
gct ctg cac aac 1112Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn 345 350 355cac tac acg cag aag agc ctc tcc ctg tct
ccg ggt aaa agt cta gac 1160His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys Ser Leu Asp 360 365 370ccc aaa tct tgt gac aaa act cac
aca tgc cca ccg tgc cca gca cct 1208Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro 375 380 385gaa ctc ctg ggg gga ccg
tca gtc ttc ctc ttc ccc cca aaa ccc aag 1256Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 390 395 400gac acc ctc atg
atc tcc cgg acc cct gag gtc aca tgc gtg gtg gtg 1304Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val405 410 415 420gac
gtg agc cac gaa gac cct gag gtc aag ttc aac tgg tac gtg gac 1352Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 425 430
435ggc gtg gag gtg cat aat gcc aag aca aag ccg cgg gag gag cag tac
1400Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
440 445 450aac agc acg tac cgg gtg gtc agc gtc ctc acc gtc ctg cac
cag gac 1448Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp 455 460 465tgg ctg aat ggc aag gag tac aag tgc aag gtc tcc
aac aaa gcc ctc 1496Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu 470 475 480cca gcc ccc atc gag aaa acc atc tcc aaa
gcc aaa ggg cag ccc cga 1544Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg485 490 495 500gaa cca cag gtg tac acc ctg
ccc cca tcc cgg gat gag ctg acc aag 1592Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu Thr Lys 505 510 515aac cag gtc agc ctg
acc tgc ctg gtc aaa ggc ttc tat ccc agc gac 1640Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 520 525 530atc gcc gtg
gag tgg gag agc aat ggg cag ccg gag aac aac tac aag 1688Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 535 540 545acc
acg cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc tac agc 1736Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 550 555
560aag ctc acc gtg gac aag agc agg tgg cag cag ggg aac gtc ttc tca
1784Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser565 570 575 580tgc tcc gtg atg cat gag gct ctg cac aac cac tac
acg cag aag agc 1832Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser 585 590 595ctc tcc ctg tct ccg ggt aaa ggc ccg cgt
gct gcc ccg gaa gtc tat 1880Leu Ser Leu Ser Pro Gly Lys Gly Pro Arg
Ala Ala Pro Glu Val Tyr 600 605 610gcg ttt gcg acg ccg gag tgg ccg
ggg agc cgg gac aag cgc acc ctc 1928Ala Phe Ala Thr Pro Glu Trp Pro
Gly Ser Arg Asp Lys Arg Thr Leu 615 620 625gcc tgc ctg atc cag aac
ttc atg cct gag gac atc tcg gtg cag tgg 1976Ala Cys Leu Ile Gln Asn
Phe Met Pro Glu Asp Ile Ser Val Gln Trp 630 635 640ctg cac aac gag
gtg cag ctc ccg gac gcc cgg cac agc acg acg cag 2024Leu His Asn Glu
Val Gln Leu Pro Asp Ala Arg His Ser Thr Thr Gln645 650 655 660ccc
cgc aag acc aag ggc tcc ggc ttc ttc gtc ttc agc cgc ctg gag 2072Pro
Arg Lys Thr Lys Gly Ser Gly Phe Phe Val Phe Ser Arg Leu Glu 665 670
675gtg acc agg gcc gaa tgg gag cag aaa gat gag ttc atc tgc cgt gca
2120Val Thr Arg Ala Glu Trp Glu Gln Lys Asp Glu Phe Ile Cys Arg Ala
680 685 690gtc cat gag gca gcg agc ccc tca cag acc gtc cag cga gcg
gtg tct 2168Val His Glu Ala Ala Ser Pro Ser Gln Thr Val Gln Arg Ala
Val Ser 695 700 705gta aat ccc ggt aaa tgacatcatc accatcacca
ttgatgagtt aaacccgctg a 2224Val Asn Pro Gly Lys
71028713PRTArtificial SequenceSynthetic Construct 28Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Val Cys Ser Arg Asp Phe Thr 20 25 30Pro Pro
Thr Val Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly His 35 40 45Phe
Pro Pro Thr Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr Thr Pro 50 55
60Gly Thr Ile Asn Ile Thr Trp Leu Glu Asp Gly Gln Val Met Asp Val65
70 75 80Asp Leu Ser Thr Ala Ser Thr Thr Gln Glu Gly Glu Leu Ala Ser
Thr 85 90 95Gln Ser Glu Leu Thr Leu Ser Gln Lys His Trp Leu Ser Asp
Arg Thr 100 105 110Tyr Thr Cys Gln Val Thr Tyr Gln Gly His Thr Phe
Glu Asp Ser Thr 115 120 125Lys Lys Cys Ala Gly Gly Arg Ser Ser Glu
Pro Lys Ser Cys Asp Lys 130 135 140Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro145 150 155 160Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 165 170 175Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 180 185 190Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 195 200
205Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
210 215 220Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu225 230 235 240Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys 245 250 255Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr 260 265 270Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr 275 280 285Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 290 295 300Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu305 310 315
320Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
325 330 335Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 340 345 350Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly 355 360 365Lys Ser Leu Asp Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro Pro 370 375 380Cys Pro Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro385 390 395 400Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr 405 410 415Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 420 425 430Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 435 440
445Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
450 455 460Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser465 470 475 480Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys 485 490 495Gly Gln Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Asp 500 505 510Glu Leu Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe 515 520 525Tyr Pro Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 530 535 540Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe545 550 555
560Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
565 570 575Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr 580 585 590Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Gly
Pro Arg Ala Ala 595 600 605Pro Glu Val Tyr Ala Phe Ala Thr Pro Glu
Trp Pro Gly Ser Arg Asp 610 615 620Lys Arg Thr Leu Ala Cys Leu Ile
Gln Asn Phe Met Pro Glu Asp Ile625 630 635 640Ser Val Gln Trp Leu
His Asn Glu Val Gln Leu Pro Asp Ala Arg His 645 650 655Ser Thr Thr
Gln Pro Arg Lys Thr Lys Gly Ser Gly Phe Phe Val Phe 660 665 670Ser
Arg Leu Glu Val Thr Arg Ala Glu Trp Glu Gln Lys Asp Glu Phe 675 680
685Ile Cys Arg Ala Val His Glu Ala Ala Ser Pro Ser Gln Thr Val Gln
690 695 700Arg Ala Val Ser Val Asn Pro Gly Lys705
7102931DNAArtificial SequencePCR primer 29gtctctagag gagcccaaat
cttgtgacaa a 313034DNAArtificial SequencePCR primer 30gcgtaccggt
tcatttaccc ggggacaggg agag 3431603DNAArtificial SequenceN-terminal
Fc gamma receptor IIIa - phenylalanine polymorphic
variantCDS(1)..(600) 31atg tgg cag ctg ctc ctc cca act gct ctg cta
ctt cta gtt tca gct 48Met Trp Gln Leu Leu Leu Pro Thr Ala Leu Leu
Leu Leu Val Ser Ala1 5 10 15ggc atg cgg act gaa gat ctc cca aag gct
gtg gtg ttc ctg gag cct 96Gly Met Arg Thr Glu Asp Leu Pro Lys Ala
Val Val Phe Leu Glu Pro 20 25 30caa tgg tac agg gtg ctc gag aag gac
agt gtg act ctg aag tgc cag 144Gln Trp Tyr Arg Val Leu Glu Lys Asp
Ser Val Thr Leu Lys Cys Gln 35 40 45gga gcc tac tcc cct gag gac aat
tcc aca cag tgg ttt cac aat gag 192Gly Ala Tyr Ser Pro Glu Asp Asn
Ser Thr Gln Trp Phe His Asn Glu 50 55 60agc ctc atc tca agc cag gcc
tcg agc tac ttc att gac gct gcc aca 240Ser Leu Ile Ser Ser Gln Ala
Ser Ser Tyr Phe Ile Asp Ala Ala Thr65 70 75 80gtc gac gac agt gga
gag tac agg tgc cag aca aac ctc tcc acc ctc 288Val Asp Asp Ser Gly
Glu Tyr Arg Cys Gln Thr Asn Leu Ser Thr Leu 85 90 95agt gac ccg gtg
cag cta gaa gtc cat atc ggc tgg ctg ttg ctc cag 336Ser Asp Pro Val
Gln Leu Glu Val His Ile Gly Trp Leu Leu Leu Gln 100 105 110gcc cct
cgg tgg gtg ttc aag gag gaa gac cct att cac ctg agg tgt 384Ala Pro
Arg Trp Val Phe Lys Glu Glu Asp Pro Ile His Leu Arg Cys 115 120
125cac agc tgg aag aac act gct ctg cat aag gtc aca tat tta cag aat
432His Ser Trp Lys Asn Thr Ala Leu His Lys Val Thr Tyr Leu Gln Asn
130 135 140ggc aaa ggc agg aag tat ttt cat cat aat tct gac ttc tac
att cca 480Gly Lys Gly Arg Lys Tyr Phe His His Asn Ser Asp Phe Tyr
Ile Pro145 150 155 160aaa gcc aca ctc aaa gac agc ggc tcc tac ttc
tgc agg ggg ctt ttt 528Lys Ala Thr Leu Lys Asp Ser Gly Ser Tyr Phe
Cys Arg Gly Leu Phe 165 170 175ggg agt aaa aat gtg tct tca gag act
gtg aac atc acc atc act caa 576Gly Ser Lys Asn Val Ser Ser Glu Thr
Val Asn Ile Thr Ile Thr Gln 180 185 190ggt ttg cat cat cac cat cat
cat tag 603Gly Leu His His His His His His 195
20032200PRTArtificial SequenceSynthetic Construct 32Met Trp Gln Leu
Leu Leu Pro Thr Ala Leu Leu Leu Leu Val Ser Ala1 5 10 15Gly Met Arg
Thr Glu Asp Leu Pro Lys Ala Val Val Phe Leu Glu Pro 20 25 30Gln Trp
Tyr Arg Val Leu Glu Lys Asp Ser Val Thr Leu Lys Cys Gln 35 40 45Gly
Ala Tyr Ser Pro Glu Asp Asn Ser Thr Gln Trp Phe His Asn Glu 50 55
60Ser Leu Ile Ser Ser Gln Ala Ser Ser Tyr Phe Ile Asp Ala Ala Thr65
70 75 80Val Asp Asp Ser Gly Glu Tyr Arg Cys Gln Thr Asn Leu Ser Thr
Leu 85 90 95Ser Asp Pro Val Gln Leu Glu Val His Ile Gly Trp Leu Leu
Leu Gln 100 105 110Ala Pro Arg Trp Val Phe Lys Glu Glu Asp Pro Ile
His Leu Arg Cys 115 120 125His Ser Trp Lys Asn Thr Ala Leu His Lys
Val Thr Tyr Leu Gln Asn 130 135 140Gly Lys Gly Arg Lys Tyr Phe His
His Asn Ser Asp Phe Tyr Ile Pro145 150 155 160Lys Ala Thr Leu Lys
Asp Ser Gly Ser Tyr Phe Cys Arg Gly Leu Phe 165 170 175Gly Ser Lys
Asn Val Ser Ser Glu Thr Val Asn Ile Thr Ile Thr Gln 180 185 190Gly
Leu His His His His His His 195 20033603DNAArtificial
SequenceN-terminal Fc gamma receptor IIIa - valine polymorphic
variantCDS(1)..(600) 33atg tgg cag ctg ctc ctc cca act gct ctg cta
ctt cta gtt tca gct 48Met Trp Gln Leu Leu Leu Pro Thr Ala Leu Leu
Leu Leu Val Ser Ala1 5 10 15ggc atg cgg act gaa gat ctc cca aag gct
gtg gtg ttc ctg gag cct 96Gly Met Arg Thr Glu Asp Leu Pro Lys Ala
Val Val Phe Leu Glu Pro 20 25 30caa tgg tac agg gtg ctc gag aag gac
agt gtg act ctg aag tgc cag 144Gln Trp Tyr Arg Val Leu Glu Lys Asp
Ser Val Thr Leu Lys Cys Gln 35 40 45gga gcc tac tcc cct gag gac aat
tcc aca cag tgg ttt cac aat gag 192Gly Ala Tyr Ser Pro Glu Asp Asn
Ser Thr Gln Trp Phe His Asn Glu 50 55 60agc ctc atc tca agc cag gcc
tcg agc tac ttc att gac gct gcc aca 240Ser Leu Ile Ser Ser Gln Ala
Ser Ser Tyr Phe Ile Asp Ala Ala Thr65 70 75 80gtc gac gac agt gga
gag tac agg tgc cag aca aac ctc tcc acc ctc 288Val Asp Asp Ser Gly
Glu Tyr Arg Cys Gln Thr Asn Leu Ser Thr Leu 85 90 95agt gac ccg gtg
cag cta gaa gtc cat atc ggc tgg ctg ttg ctc cag 336Ser Asp Pro Val
Gln Leu Glu Val His Ile Gly Trp Leu Leu Leu Gln 100 105 110gcc cct
cgg tgg gtg ttc aag gag gaa gac cct att cac ctg agg tgt 384Ala Pro
Arg Trp Val Phe Lys Glu Glu Asp Pro Ile His Leu Arg Cys 115 120
125cac agc tgg aag aac act gct ctg cat aag gtc aca tat tta cag aat
432His Ser Trp Lys Asn Thr Ala Leu His Lys Val Thr Tyr Leu Gln Asn
130 135 140ggc aaa ggc agg aag tat ttt cat cat aat tct gac ttc tac
att cca 480Gly Lys Gly Arg Lys Tyr Phe His His Asn Ser Asp Phe Tyr
Ile Pro145 150 155 160aaa gcc aca ctc aaa gac agc ggc tcc tac ttc
tgc agg ggg ctt gtt 528Lys Ala Thr Leu Lys Asp Ser Gly Ser Tyr Phe
Cys Arg Gly Leu Val 165 170 175ggg agt aaa aat gtg tct tca gag act
gtg aac atc acc atc act caa 576Gly Ser Lys Asn Val Ser Ser Glu Thr
Val Asn Ile Thr Ile Thr Gln 180 185 190ggt ttg cat cat cac cat cat
cac tag 603Gly Leu His His His His His His 195
20034200PRTArtificial SequenceSynthetic Construct 34Met Trp Gln Leu
Leu Leu Pro Thr Ala Leu Leu Leu Leu Val Ser Ala1 5 10 15Gly Met Arg
Thr Glu Asp Leu Pro Lys Ala Val Val Phe Leu Glu Pro 20 25 30Gln Trp
Tyr Arg Val Leu Glu Lys Asp Ser Val Thr Leu Lys Cys Gln 35 40 45Gly
Ala Tyr Ser Pro Glu Asp Asn Ser Thr Gln Trp Phe His Asn Glu 50 55
60Ser Leu Ile Ser Ser Gln Ala Ser Ser Tyr Phe Ile Asp Ala Ala Thr65
70 75 80Val Asp Asp Ser Gly Glu Tyr Arg Cys Gln Thr Asn Leu Ser Thr
Leu 85 90 95Ser Asp Pro Val Gln Leu Glu Val His Ile Gly Trp Leu Leu
Leu Gln 100 105 110Ala Pro Arg Trp Val Phe Lys Glu Glu Asp Pro Ile
His Leu Arg Cys 115 120 125His Ser Trp Lys Asn Thr Ala Leu His Lys
Val Thr Tyr Leu Gln Asn 130 135 140Gly Lys Gly Arg Lys Tyr Phe His
His Asn Ser Asp Phe Tyr Ile Pro145 150 155 160Lys Ala Thr Leu Lys
Asp Ser Gly Ser Tyr Phe Cys Arg Gly Leu Val
165 170 175Gly Ser Lys Asn Val Ser Ser Glu Thr Val Asn Ile Thr Ile
Thr Gln 180 185 190Gly Leu His His His His His His 195
2003520PRTHomo sapiensMISC_FEATUREIgK signal sequence 35Met Glu Thr
Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser
Thr Gly 203612PRTHomo sapiens 36Glu Arg Lys Cys Cys Val Glu Cys Pro
Pro Cys Pro1 5 103788PRTSaccharomyces cerevisiae 37Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys Glu Leu Leu Gly1 5 10 15Gly Gly Ser
Ile Lys Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser 20 25 30Lys Ile
Tyr His Ile Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile 35 40 45Gly
Glu Arg Gly His Gly Gly Gly Ser Asn Ser Gln Val Ser His Arg 50 55
60Tyr Pro Arg Phe Gln Ser Ile Lys Val Gln Phe Thr Glu Tyr Lys Lys65
70 75 80Glu Lys Gly Phe Ile Leu Thr Ser 8538524PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 38Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Gln His Gly Gly Arg Ser Ser 20 25 30Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 35 40 45Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 50 55
60Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val65
70 75 80Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val 85 90 95Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln 100 105 110Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln 115 120 125Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala 130 135 140Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro145 150 155 160Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 165 170 175Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 180 185 190Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 195 200
205Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
210 215 220Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe225 230 235 240Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys 245 250 255Ser Leu Ser Leu Ser Pro Gly Lys Ser
Leu Asp Glu Pro Lys Ser Cys 260 265 270Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly 275 280 285Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 290 295 300Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His305 310 315
320Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val
325 330 335His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr 340 345 350Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly 355 360 365Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile 370 375 380Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val385 390 395 400Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 405 410 415Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 420 425 430Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 435 440
445Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
450 455 460Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met465 470 475 480His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser 485 490 495Pro Gly Lys Phe Glu Gly Lys Pro Ile
Pro Asn Pro Leu Leu Gly Leu 500 505 510Asp Ser Thr Arg Thr Gly His
His His His His His 515 52039499PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 39Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Gln His Gly Gly Arg Ser Ser 20 25 30Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 35 40 45Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 50 55
60Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val65
70 75 80Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val 85 90 95Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln 100 105 110Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln 115 120 125Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala 130 135 140Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro145 150 155 160Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 165 170 175Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 180 185 190Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 195 200
205Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
210 215 220Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe225 230 235 240Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys 245 250 255Ser Leu Ser Leu Ser Pro Gly Lys Ser
Leu Glu Glu Pro Lys Ser Cys 260 265 270Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly 275 280 285Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 290 295 300Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His305 310 315
320Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val
325 330 335His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr 340 345 350Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly 355 360 365Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile 370 375 380Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val385 390 395 400Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 405 410 415Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 420 425 430Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 435 440
445Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
450 455 460Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met465 470 475 480His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser 485 490 495Pro Gly Lys40628PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 40Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Val Cys Ser Arg Asp Phe Thr 20 25 30Pro Pro
Thr Val Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly His 35 40 45Phe
Pro Pro Thr Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr Thr Pro 50 55
60Gly Thr Ile Asn Ile Thr Trp Leu Glu Asp Gly Gln Val Met Asp Val65
70 75 80Asp Leu Ser Thr Ala Ser Thr Thr Gln Glu Gly Glu Leu Ala Ser
Thr 85 90 95Gln Ser Glu Leu Thr Leu Ser Gln Lys His Trp Leu Ser Asp
Arg Thr 100 105 110Tyr Thr Cys Gln Val Thr Tyr Gln Gly His Thr Phe
Glu Asp Ser Thr 115 120 125Lys Lys Cys Ala Gly Gly Arg Ser Ser Glu
Pro Lys Ser Cys Asp Lys 130 135 140Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro145 150 155 160Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 165 170 175Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 180 185 190Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 195 200
205Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
210 215 220Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu225 230 235 240Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys 245 250 255Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr 260 265 270Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr 275 280 285Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 290 295 300Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu305 310 315
320Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
325 330 335Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 340 345 350Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly 355 360 365Lys Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro 370 375 380Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys385 390 395 400Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 405 410 415Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 420 425 430Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 435 440
445Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
450 455 460Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys465 470 475 480Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Pro 485 490 495Arg Ala Ala Pro Glu Val Tyr Ala Phe
Ala Thr Pro Glu Trp Pro Gly 500 505 510Arg Asp Lys Arg Thr Leu Ala
Cys Leu Ile Gln Asn Phe Met Pro Glu 515 520 525Asp Ile Ser Val Gln
Trp Leu His Asn Glu Val Gln Leu Pro Asp Ala 530 535 540Arg His Ser
Thr Thr Gln Pro Arg Lys Thr Lys Gly Ser Gly Phe Phe545 550 555
560Val Phe Ser Arg Leu Glu Val Thr Arg Ala Glu Trp Glu Gln Lys Asp
565 570 575Glu Phe Ile Cys Arg Ala Val His Glu Ala Ala Ser Pro Ser
Gln Thr 580 585 590Val Gln Arg Ala Val Ser Val Asn Pro Gly Lys Phe
Glu Gly Lys Pro 595 600 605Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser
Thr Arg Thr Gly His His 610 615 620His His His
His62541629PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 41Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Val Cys Ser Arg
Asp Phe Thr 20 25 30Pro Pro Thr Val Lys Ile Leu Gln Ser Ser Cys Asp
Gly Gly Gly His 35 40 45Phe Pro Pro Thr Ile Gln Leu Leu Cys Leu Val
Ser Gly Tyr Thr Pro 50 55 60Gly Thr Ile Asn Ile Thr Trp Leu Glu Asp
Gly Gln Val Met Asp Val65 70 75 80Asp Leu Ser Thr Ala Ser Thr Thr
Gln Glu Gly Glu Leu Ala Ser Thr 85 90 95Gln Ser Glu Leu Thr Leu Ser
Gln Lys His Trp Leu Ser Asp Arg Thr 100 105 110Tyr Thr Cys Gln Val
Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr 115 120 125Lys Lys Cys
Gly Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys 130 135 140Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro145 150
155 160Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser 165 170 175Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp 180 185 190Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn 195 200 205Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg Val 210 215 220Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu225 230 235 240Tyr Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 245 250 255Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 260 265
270Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
275 280 285Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu 290 295 300Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu305 310 315 320Asp Ser Asp Gly Ser Phe Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys 325 330 335Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu 340 345 350Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 355 360 365Lys Ser Leu
Asp Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro 370 375 380Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe385 390
395 400Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val 405 410 415Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys Phe 420 425 430Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro 435 440 445Arg Glu Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr 450 455 460Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val465 470 475 480Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala 485 490 495Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 500 505
510Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly
515 520 525Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro 530 535 540Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp
Ser Asp Gly Ser545 550 555 560Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln 565 570 575Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu His Asn His 580 585 590Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys Phe Glu Gly Lys 595 600 605Pro Ile Pro
Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg Thr Gly His 610 615 620His
His His
His His62542713PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 42Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Val Cys
Ser Arg Asp Phe Thr 20 25 30Pro Pro Thr Val Lys Ile Leu Gln Ser Ser
Cys Asp Gly Gly Gly His 35 40 45Phe Pro Pro Thr Ile Gln Leu Leu Cys
Leu Val Ser Gly Tyr Thr Pro 50 55 60Gly Thr Ile Asn Ile Thr Trp Leu
Glu Asp Gly Gln Val Met Asp Val65 70 75 80Asp Leu Ser Thr Ala Ser
Thr Thr Gln Glu Gly Glu Leu Ala Ser Thr 85 90 95Gln Ser Glu Leu Thr
Leu Ser Gln Lys His Trp Leu Ser Asp Arg Thr 100 105 110Tyr Thr Cys
Gln Val Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr 115 120 125Lys
Lys Cys Gly Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys 130 135
140Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro145 150 155 160Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 165 170 175Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His Glu Asp 180 185 190Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn 195 200 205Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 210 215 220Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu225 230 235 240Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 245 250
255Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
260 265 270Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr 275 280 285Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu 290 295 300Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu305 310 315 320Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 325 330 335Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu 340 345 350Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 355 360 365Lys
Ser Leu Asp Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro 370 375
380Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
Phe385 390 395 400Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val 405 410 415Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe 420 425 430Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro 435 440 445Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr 450 455 460Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val465 470 475 480Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala 485 490
495Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
500 505 510Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly 515 520 525Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro 530 535 540Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser545 550 555 560Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln 565 570 575Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His 580 585 590Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys Gly Pro Arg Ala 595 600 605Ala
Pro Glu Val Tyr Ala Phe Ala Thr Pro Glu Trp Pro Gly Arg Asp 610 615
620Lys Arg Thr Leu Ala Cys Leu Ile Gln Asn Phe Met Pro Glu Asp
Ile625 630 635 640Ser Val Gln Trp Leu His Asn Glu Val Gln Leu Pro
Asp Ala Arg His 645 650 655Ser Thr Thr Gln Pro Arg Lys Thr Lys Gly
Ser Gly Phe Phe Val Phe 660 665 670Ser Arg Leu Glu Val Thr Arg Ala
Glu Trp Glu Gln Lys Asp Glu Phe 675 680 685Ile Cys Arg Ala Val His
Glu Ala Ala Ser Pro Ser Gln Thr Val Gln 690 695 700Arg Ala Val Ser
Val Asn Pro Gly Lys705 71043733PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 43Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Gln His Gly Gly Arg Ser Ser 20 25 30Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 35 40 45Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 50 55
60Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val65
70 75 80Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val 85 90 95Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu Gln 100 105 110Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln 115 120 125Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala 130 135 140Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro145 150 155 160Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 165 170 175Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 180 185 190Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 195 200
205Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
210 215 220Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe225 230 235 240Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln Lys 245 250 255Ser Leu Ser Leu Ser Pro Gly Lys Ser
Leu Asp Glu Pro Lys Ser Cys 260 265 270Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly 275 280 285Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 290 295 300Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His305 310 315
320Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val
325 330 335His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr 340 345 350Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly 355 360 365Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile 370 375 380Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val385 390 395 400Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 405 410 415Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 420 425 430Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 435 440
445Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
450 455 460Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met465 470 475 480His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser 485 490 495Pro Gly Lys Phe Glu Glu Pro Lys Ser
Cys Asp Lys Thr His Thr Cys 500 505 510Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu 515 520 525Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 530 535 540Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys545 550 555
560Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
565 570 575Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
Val Leu 580 585 590Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys 595 600 605Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys 610 615 620Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser625 630 635 640Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 645 650 655Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 660 665 670Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 675 680
685Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
690 695 700Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn705 710 715 720His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 725 73044566PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 44Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Ser Ser
Lys Pro His Leu Val 20 25 30Thr Gln Leu Thr His Ala His Gly Cys Pro
Glu Pro Lys Ser Cys Asp 35 40 45Thr Pro Pro Pro Cys Pro Arg Cys Pro
Glu Pro Lys Ser Cys Asp Thr 50 55 60Pro Pro Pro Cys Pro Arg Cys Pro
Glu Pro Lys Ser Cys Asp Thr Pro65 70 75 80Pro Pro Cys Pro Arg Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 85 90 95Val Phe Leu Phe Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 100 105 110Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 115 120 125Glu
Val Gln Phe Lys Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 130 135
140Lys Thr Lys Leu Arg Glu Glu Gln Tyr Asn Ser Thr Phe Arg Val
Val145 150 155 160Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr 165 170 175Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr 180 185 190Ile Ser Lys Thr Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu 195 200 205Pro Pro Ser Arg Glu Glu
Met Thr Lys Asn Gln Val Ser Leu Thr Cys 210 215 220Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser225 230 235 240Asn
Gly Gln Pro Glu Asn Asn Tyr Asn Thr Thr Pro Pro Met Leu Asp 245 250
255Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
260 265 270Arg Trp Gln Gln Gly Asn Ile Phe Ser Cys Ser Val Met His
Glu Ala 275 280 285Leu His Asn Arg Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly Lys 290 295 300Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys305 310 315 320Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu 325 330 335Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 340 345 350Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 355 360 365Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 370 375
380Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu385 390 395 400Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys 405 410 415Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys 420 425 430Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser 435 440 445Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys 450 455 460Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln465 470 475 480Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 485 490
495Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
500 505 510Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn 515 520 525His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys Phe Glu Gly 530 535 540Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu
Asp Ser Thr Arg Thr Gly545 550 555 560His His His His His His
56545529PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 45Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Gln His Gly Gly
Arg Ser Ser 20 25 30Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala 35 40 45Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro 50 55 60Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val65 70 75 80Val Asp Val Ser His Glu Asp Pro
Glu Val Lys Phe Asn Trp Tyr Val 85 90 95Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln 100 105 110Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln 115 120 125Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 130 135 140Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro145 150
155 160Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr 165 170 175Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro Ser 180 185 190Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn Tyr 195 200 205Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr 210 215 220Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe225 230 235 240Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 245 250 255Ser Leu
Ser Leu Ser Pro Gly Lys Ser Leu Glu Gly Pro Arg Phe Glu 260 265
270Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
275 280 285Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro 290 295 300Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val305 310 315 320Val Asp Val Ser His Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr Val 325 330 335Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln 340 345 350Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln 355 360 365Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 370 375 380Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro385 390
395 400Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr 405 410 415Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro Ser
420 425 430Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr 435 440 445Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr 450 455 460Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln Gln Gly Asn Val Phe465 470 475 480Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln Lys 485 490 495Ser Leu Ser Leu Ser
Pro Gly Lys Phe Glu Gly Lys Pro Ile Pro Asn 500 505 510Pro Leu Leu
Gly Leu Asp Ser Thr Arg Thr Gly His His His His His 515 520
525His46559PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 46Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Glu Leu Lys Thr
Pro Leu Gly 20 25 30Asp Thr Thr His Thr Cys Pro Arg Cys Pro Glu Pro
Lys Ser Cys Asp 35 40 45Thr Pro Pro Pro Cys Pro Arg Cys Pro Glu Pro
Lys Ser Cys Asp Thr 50 55 60Pro Pro Pro Cys Pro Arg Cys Pro Glu Pro
Lys Ser Cys Asp Thr Pro65 70 75 80Pro Pro Cys Pro Arg Cys Pro Gly
Gly Arg Ser Ser Glu Pro Lys Ser 85 90 95Cys Asp Lys Thr His Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu 100 105 110Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 115 120 125Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 130 135 140His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu145 150
155 160Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr 165 170 175Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn 180 185 190Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro 195 200 205Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln 210 215 220Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys Asn Gln Val225 230 235 240Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 245 250 255Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 260 265
270Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr
275 280 285Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val 290 295 300Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu305 310 315 320Ser Pro Gly Lys Ser Leu Asp Glu Pro
Lys Ser Cys Asp Lys Thr His 325 330 335Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 340 345 350Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 355 360 365Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 370 375 380Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys385 390
395 400Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser 405 410 415Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys 420 425 430Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile 435 440 445Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro 450 455 460Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu465 470 475 480Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 485 490 495Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 500 505
510Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
515 520 525Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu 530 535 540His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys545 550 55547806PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 47Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Glu Leu Lys Thr Pro Leu Gly 20 25 30Asp Thr
Thr His Thr Cys Pro Arg Cys Pro Glu Pro Lys Ser Cys Asp 35 40 45Thr
Pro Pro Pro Cys Pro Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr 50 55
60Pro Pro Pro Cys Pro Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro65
70 75 80Pro Pro Cys Pro Arg Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
Ser 85 90 95Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg 100 105 110Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro 115 120 125Glu Val Gln Phe Lys Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala 130 135 140Lys Thr Lys Leu Arg Glu Glu Gln
Tyr Asn Ser Thr Phe Arg Val Val145 150 155 160Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 165 170 175Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 180 185 190Ile
Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 195 200
205Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys
210 215 220Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser225 230 235 240Asn Gly Gln Pro Glu Asn Asn Tyr Asn Thr Thr
Pro Pro Met Leu Asp 245 250 255Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser 260 265 270Arg Trp Gln Gln Gly Asn Ile
Phe Ser Cys Ser Val Met His Glu Ala 275 280 285Leu His Asn Arg Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 290 295 300Gly Gly Arg
Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys305 310 315
320Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
325 330 335Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu 340 345 350Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro Glu Val Lys 355 360 365Phe Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys 370 375 380Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu385 390 395 400Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 405 410 415Val Ser Asn
Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 420 425 430Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 435 440
445Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
450 455 460Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly Gln465 470 475 480Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly 485 490 495Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln 500 505 510Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn 515 520 525His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu 530 535 540Gly Pro Arg
Phe Glu Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys545 550 555
560Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
565 570 575Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu 580 585 590Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro Glu Val Lys 595 600 605Phe Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys 610 615 620Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu625 630 635 640Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 645 650 655Val Ser Asn
Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 660 665 670Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 675 680
685Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
690 695 700Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly Gln705 710 715 720Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly 725 730 735Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln 740 745 750Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn 755 760 765His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys Phe Glu Gly 770 775 780Lys Pro Ile
Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg Thr Gly785 790 795
800His His His His His His 80548394PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 48Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Glu Asp Thr Cys Gly Glu Leu 20 25 30Glu Phe
Gln Asn Asp Glu Ile Val Lys Thr Ile Ser Val Lys Val Ile 35 40 45Asp
Asp Glu Glu Tyr Glu Lys Asn Lys Thr Phe Phe Leu Glu Ile Gly 50 55
60Lys Pro Arg Leu Val Glu Met Ser Glu Lys Lys Ala Leu Leu Leu Asn65
70 75 80Glu Leu Gly Gly Phe Thr Ile Thr Gly Lys Tyr Leu Phe Gly Gln
Pro 85 90 95Val Phe Arg Lys Val His Ala Arg Glu His Pro Ile Leu Ser
Thr Val 100 105 110Ile Thr Ile Ala Asp Glu Tyr Asp Asp Lys Gln Pro
Leu Thr Ser Lys 115 120 125Glu Lys Glu Glu Gly Gly Arg Ser Ser Glu
Pro Lys Ser Cys Asp Lys 130 135 140Thr His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro145 150 155 160Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 165 170 175Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 180 185 190Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 195 200
205Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
210 215 220Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu225 230 235 240Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys 245 250 255Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr 260 265 270Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr 275 280 285Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 290 295 300Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu305 310 315
320Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
325 330 335Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 340 345 350Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly 355 360 365Lys Phe Glu Gly Lys Pro Ile Pro Asn Pro
Leu Leu Gly Leu Asp Ser 370 375 380Thr Arg Thr Gly His His His His
His His385 39049634PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 49Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Glu Asp
Thr Cys Gly Glu Leu 20 25 30Glu Phe Gln Asn Asp Glu Ile Val Lys Thr
Ile Ser Val Lys Val Ile 35 40 45Asp Asp Glu Glu Tyr Glu Lys Asn Lys
Thr Phe Phe Leu Glu Ile Gly 50 55 60Lys Pro Arg Leu Val Glu Met Ser
Glu Lys Lys Ala Leu Leu Leu Asn65 70 75 80Glu Leu Gly Gly Phe Thr
Ile Thr Gly Lys Tyr Leu Phe Gly Gln Pro 85 90 95Val Phe Arg Lys Val
His Ala Arg Glu His Pro Ile Leu Ser Thr Val 100 105 110Ile Thr Ile
Ala Asp Glu Tyr Asp Asp Lys Gln Pro Leu Thr Ser Lys 115 120 125Glu
Lys Glu Glu Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys 130 135
140Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro145 150 155 160Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 165 170 175Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His Glu Asp 180 185 190Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn 195 200 205Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 210 215 220Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu225 230 235 240Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 245 250
255Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
260 265 270Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr 275 280 285Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu 290 295 300Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu305 310 315 320Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 325 330 335Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu 340 345 350Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 355 360 365Lys
Ser Leu Glu Gly Pro Arg Phe Glu Glu Pro Lys Ser Cys Asp Lys 370 375
380Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro385 390 395 400Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 405 410 415Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His Glu Asp 420 425 430Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn 435 440 445Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 450 455 460Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu465 470 475 480Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 485 490
495Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
500 505 510Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser
Leu Thr 515 520 525Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu 530 535 540Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu545 550 555 560Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 565 570
575Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
580 585 590Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly 595 600 605Lys Phe Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu
Gly Leu Asp Ser 610 615 620Thr Arg Thr Gly His His His His His
His625 63050296PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 50Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Gln His
Ser Gly Gly Arg Ser 20 25 30Ser Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro 35 40 45Ala Pro Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys 50 55 60Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val65 70 75 80Val Val Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 85 90 95Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 100 105 110Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His 115 120 125Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 130 135
140Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln145 150 155 160Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu 165 170 175Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro 180 185 190Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn 195 200 205Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 210 215 220Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val225 230 235 240Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln 245 250
255Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu Gly Pro Arg Phe
260 265 270Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser
Thr Arg 275 280 285Thr Gly His His His His His His 290
29551252PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 51Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro 20 25 30Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe 35 40 45Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val 50 55 60Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe65 70 75 80Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro 85 90 95Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr 100 105 110Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 115 120 125Ser Asn Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala 130 135 140Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg145 150
155 160Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly 165 170 175Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro 180 185 190Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser 195 200 205Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln 210 215 220Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu His Asn His225 230 235 240Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 245 25052336PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 52Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Gln His Ser Gly Gly Arg Ser 20 25 30Ser Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 35 40 45Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 50 55
60Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val65
70 75 80Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr 85 90 95Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu 100 105 110Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His 115 120 125Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 130 135 140Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln145 150 155 160Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 165 170 175Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 180 185 190Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 195 200
205Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
210 215 220Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val225 230 235 240Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln 245 250 255Lys Ser Leu Ser Leu Ser Pro Gly Lys
Ser Leu Glu Gly Pro Arg Phe 260 265 270Glu Glu Leu Lys Thr Pro Leu
Gly Asp Thr Thr His Thr Cys Pro Arg 275 280 285Cys Pro Glu Pro Lys
Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys 290 295 300Pro Glu Pro
Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro305 310 315
320Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys Pro Arg Cys Pro Ala
325 330 33553738PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 53Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Gln His
Gly Gly Arg Ser Ser 20 25 30Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala 35 40 45Pro Glu Leu Leu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro 50 55 60Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val65 70 75 80Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 85 90 95Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 100 105 110Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 115 120 125Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 130 135
140Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
Pro145 150 155 160Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr 165 170 175Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser 180 185 190Asp Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr 195 200 205Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 210 215 220Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe225 230 235 240Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 245 250
255Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Asp Glu Pro Lys Ser Cys
260 265 270Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
Leu Gly 275 280 285Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met 290 295 300Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His305 310 315 320Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val Glu Val 325 330 335His Asn Ala Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 340 345 350Arg Val Val
Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 355 360 365Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 370 375
380Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val385 390 395 400Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser 405 410 415Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu 420 425 430Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro 435 440 445Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 450 455 460Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met465 470 475 480His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 485 490
495Pro Gly Lys Phe Glu Asp Gln Asp Ile Ala Ile Arg Val Phe Ala Ile
500 505 510Pro Pro Ser Phe Ala Ser Ile Phe Leu Thr Lys Ser Thr Lys
Leu Thr 515 520 525Cys Leu Val Thr Asp Leu Thr Thr Tyr Asp Ser Val
Thr Ile Ser Trp 530 535 540Thr Arg Gln Asn Gly Glu Ala Val Lys Thr
His Thr Asn Ile Ser Glu545 550 555 560Ser His Pro Asn Ala Thr Phe
Ser Ala Val Gly Glu Ala Ser Ile Cys 565 570 575Glu Asp Asp Trp Asn
Ser Gly Glu Arg Phe Thr Cys Thr Val Thr His 580 585 590Thr Asp Leu
Pro Ser Pro Leu Lys Gln Thr Ile Ser Arg Pro Lys Gly 595 600 605Val
Ala Leu His Arg Pro Asp Val Tyr Leu Leu Pro Pro Ala Arg Glu 610 615
620Gln Leu Asn Leu Arg Glu Ser Ala Thr Ile Thr Cys Leu Val Thr
Gly625 630 635 640Phe Ser Pro Ala Asp Val Phe Val Gln Trp Met Gln
Arg Gly Gln Pro 645 650 655Leu Ser Pro Glu Lys Tyr Val Thr Ser Ala
Pro Met Pro Glu Pro Gln 660 665 670Ala Pro Gly Arg Tyr Phe Ala His
Ser Ile Leu Thr Val Ser Glu Glu 675 680 685Glu Trp Asn Thr Gly Glu
Thr Tyr Thr Cys Val Val Ala His Glu Ala 690 695 700Leu Pro Asn Arg
Val Thr Glu Arg Thr Val Asp Lys Ser Thr Gly Lys705 710 715 720Pro
Thr Leu Tyr Asn Val Ser Leu Val Met Ser Asp Thr Ala Gly Thr 725 730
735Cys Tyr54510PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 54Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Gln His
Ser Gly Gly Arg Ser 20 25 30Ser Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro 35 40 45Ala Pro Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys 50 55 60Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val65 70 75 80Val Val Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 85 90 95Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 100 105 110Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His 115 120 125Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 130 135
140Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln145 150 155 160Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu 165 170 175Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro 180 185 190Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn 195 200 205Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 210 215 220Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val225 230 235 240Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln 245 250
255Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu Gly Pro Arg Phe
260 265 270Glu Asp Gln Asp Ile Ala Ile Arg Val Phe Ala Ile Pro Pro
Ser Phe 275 280 285Ala Ser Ile Phe Leu Thr Lys Ser Thr Lys Leu Thr
Cys Leu Val Thr 290 295 300Asp Leu Thr Thr Tyr Asp Ser Val Thr Ile
Ser Trp Thr Arg Gln Asn305 310 315 320Gly Glu Ala Val Lys Thr His
Thr Asn Ile Ser Glu Ser His Pro Asn 325 330 335Ala Thr Phe Ser Ala
Val Gly Glu Ala Ser Ile Cys Glu Asp Asp Trp 340 345 350Asn Ser Gly
Glu Arg Phe Thr Cys Thr Val Thr His Thr Asp Leu Pro 355 360 365Ser
Pro Leu Lys Gln Thr Ile Ser Arg Pro Lys Gly Val Ala Leu His 370 375
380Arg Pro Asp Val Tyr Leu Leu Pro Pro Ala Arg Glu Gln Leu Asn
Leu385 390 395 400Arg Glu Ser Ala Thr Ile Thr Cys Leu Val Thr Gly
Phe Ser Pro Ala 405 410 415Asp Val Phe Val Gln Trp Met Gln Arg Gly
Gln Pro Leu Ser Pro Glu 420 425 430Lys Tyr Val Thr Ser Ala Pro Met
Pro Glu Pro Gln Ala Pro Gly Arg 435 440 445Tyr Phe Ala His Ser Ile
Leu Thr Val Ser Glu Glu Glu Trp Asn Thr 450 455 460Gly Glu Thr Tyr
Thr Cys Val Val Ala His Glu Ala Leu Pro Asn Arg465 470 475 480Val
Thr Glu Arg Thr Val Asp Lys Ser Thr Gly Lys Pro Thr Leu Tyr 485 490
495Asn Val Ser Leu Val Met Ser Asp Thr Ala Gly Thr Cys Tyr 500 505
51055394PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 55Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Val Cys Ser Arg
Asp Phe Thr 20 25 30Pro Pro Thr Val Lys Ile Leu Gln Ser Ser Cys Asp
Gly Gly Gly His 35 40 45Phe Pro Pro Thr Ile Gln Leu Leu Cys Leu Val
Ser Gly Tyr Thr Pro 50 55 60Gly Thr Ile Asn Ile Thr Trp Leu Glu Asp
Gly Gln Val Met Asp Val65 70 75 80Asp Leu Ser Thr Ala Ser Thr Thr
Gln Glu Gly Glu Leu Ala Ser Thr 85 90 95Gln Ser Glu Leu Thr Leu Ser
Gln Lys His Trp Leu Ser Asp Arg Thr 100 105 110Tyr Thr Cys Gln Val
Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr 115 120 125Lys Lys Cys
Gly Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys 130 135 140Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro145 150
155 160Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser 165 170 175Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp 180 185 190Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn 195 200 205Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg Val 210 215 220Val Ser Val Leu Thr Val Leu
His Gln Asp
Trp Leu Asn Gly Lys Glu225 230 235 240Tyr Lys Cys Lys Val Ser Asn
Lys Ala Leu Pro Ala Pro Ile Glu Lys 245 250 255Thr Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 260 265 270Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 275 280 285Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 290 295
300Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu305 310 315 320Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys 325 330 335Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met His Glu 340 345 350Ala Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly 355 360 365Lys Phe Glu Gly Lys Pro
Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser 370 375 380Thr Arg Thr Gly
His His His His His His385 39056362PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 56Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Val Cys Ser Arg Asp Phe Thr Pro Pro Thr Val Lys 20 25 30Ile Leu
Gln Ser Ser Cys Asp Gly Gly Gly His Phe Pro Pro Thr Ile 35 40 45Gln
Leu Leu Cys Leu Val Ser Gly Tyr Thr Pro Gly Thr Ile Asn Ile 50 55
60Thr Trp Leu Glu Asp Gly Gln Val Met Asp Val Asp Leu Ser Thr Ala65
70 75 80Ser Thr Thr Gln Glu Gly Glu Leu Ala Ser Thr Gln Ser Glu Leu
Thr 85 90 95Leu Ser Gln Lys His Trp Leu Ser Asp Arg Thr Tyr Thr Cys
Gln Val 100 105 110Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr Lys
Lys Cys Glu Pro 115 120 125Lys Ser Cys Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu 130 135 140Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp145 150 155 160Thr Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 165 170 175Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly 180 185 190Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 195 200
205Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp
210 215 220Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro225 230 235 240Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu 245 250 255Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys Asn 260 265 270Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile 275 280 285Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 290 295 300Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys305 310 315
320Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
325 330 335Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu 340 345 350Ser Leu Ser Pro Gly Lys Phe Glu Gly Lys 355
36057519PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 57Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Glu Arg Lys Cys
Cys Val Glu 20 25 30Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro
Ser Val Phe Leu 35 40 45Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu 50 55 60Val Thr Cys Val Val Val Asp Val Ser His
Glu Asp Pro Glu Val Gln65 70 75 80Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys 85 90 95Pro Arg Glu Glu Gln Phe Asn
Ser Thr Phe Arg Val Val Ser Val Leu 100 105 110Thr Val Val His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 115 120 125Val Ser Asn
Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 130 135 140Thr
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser145 150
155 160Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys 165 170 175Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln 180 185 190Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met
Leu Asp Ser Asp Gly 195 200 205Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln 210 215 220Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn225 230 235 240His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys Arg Ser Ser 245 250 255Glu Pro
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 260 265
270Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
275 280 285Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val Val 290 295 300Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val305 310 315 320Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln 325 330 335Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu His Gln 340 345 350Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 355 360 365Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 370 375 380Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr385 390
395 400Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser 405 410 415Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn Tyr 420 425 430Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu Tyr 435 440 445Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val Phe 450 455 460Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln Lys465 470 475 480Ser Leu Ser Leu
Ser Pro Gly Lys Ser Leu Glu Gly Pro Arg Phe Glu 485 490 495Gly Lys
Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg Thr 500 505
510Gly His His His His His His 51558488PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 58Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Glu Arg Lys Cys Cys Val Glu 20 25 30Cys Pro
Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu 35 40 45Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 50 55
60Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Gln65
70 75 80Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys 85 90 95Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser
Val Leu 100 105 110Thr Val Val His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys 115 120 125Val Ser Asn Lys Gly Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys 130 135 140Thr Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser145 150 155 160Arg Glu Glu Met Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 165 170 175Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 180 185 190Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp Ser Asp Gly 195 200
205Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
210 215 220Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn225 230 235 240His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys Arg Ser Ser 245 250 255Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala 260 265 270Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro 275 280 285Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 290 295 300Val Asp Val
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val305 310 315
320Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
325 330 335Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln 340 345 350Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala 355 360 365Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro 370 375 380Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Glu Glu Met Thr385 390 395 400Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 405 410 415Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 420 425 430Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 435 440
445Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
450 455 460Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys465 470 475 480Ser Leu Ser Leu Ser Pro Gly Lys
48559303PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 59Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Glu Arg Lys Cys
Cys Val Glu 20 25 30Cys Pro Pro Cys Pro Arg Ser Ser Glu Pro Lys Ser
Cys Asp Lys Thr 35 40 45His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser 50 55 60Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg65 70 75 80Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro 85 90 95Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn Ala 100 105 110Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 115 120 125Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 130 135 140Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr145 150
155 160Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu 165 170 175Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser
Leu Thr Cys 180 185 190Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser 195 200 205Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp 210 215 220Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser225 230 235 240Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 245 250 255Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 260 265
270Ser Leu Glu Gly Pro Arg Phe Glu Gly Lys Pro Ile Pro Asn Pro Leu
275 280 285Leu Gly Leu Asp Ser Thr Arg Thr Gly His His His His His
His 290 295 30060272PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 60Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Glu Arg
Lys Cys Cys Val Glu 20 25 30Cys Pro Pro Cys Pro Arg Ser Ser Glu Pro
Lys Ser Cys Asp Lys Thr 35 40 45His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly Pro Ser 50 55 60Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg65 70 75 80Thr Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro 85 90 95Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 100 105 110Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 115 120 125Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 130 135
140Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr145 150 155 160Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu 165 170 175Pro Pro Ser Arg Glu Glu Met Thr Lys Asn
Gln Val Ser Leu Thr Cys 180 185 190Leu Val Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser 195 200 205Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 210 215 220Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser225 230 235 240Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 245 250
255Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
260 265 27061264PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 61Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Glu Arg Lys Cys Cys Val Glu
Cys Pro Pro Cys Pro 20 25 30Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala 35 40 45Pro Glu Leu Leu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro 50 55 60Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val65 70 75 80Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 85 90 95Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 100 105 110Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 115 120 125Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 130 135
140Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
Pro145 150 155 160Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu Met Thr 165 170 175Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser 180 185 190Asp Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr 195 200 205Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 210 215 220Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe225 230 235 240Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 245 250
255Ser Leu Ser Leu Ser Pro Gly Lys 26062538PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 62Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Glu Arg Lys Cys Cys Val Glu 20 25 30Cys Pro
Pro Cys Pro Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr
35 40 45His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
Ser 50 55 60Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg65 70 75 80Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro 85 90 95Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn Ala 100 105 110Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr Tyr Arg Val Val 115 120 125Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr 130 135 140Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr145 150 155 160Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 165 170
175Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys
180 185 190Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser 195 200 205Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp 210 215 220Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser225 230 235 240Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala 245 250 255Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 260 265 270Ser Leu Asp
Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro 275 280 285Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro 290 295
300Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr305 310 315 320Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys Phe Asn 325 330 335Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg 340 345 350Glu Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val 355 360 365Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 370 375 380Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys385 390 395 400Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu 405 410
415Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
420 425 430Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu 435 440 445Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe 450 455 460Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly465 470 475 480Asn Val Phe Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr 485 490 495Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys Ser Leu Glu Gly Pro 500 505 510Arg Phe Glu
Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser 515 520 525Thr
Arg Thr Gly His His His His His His 530 53563507PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 63Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Glu Arg Lys Cys Cys Val Glu 20 25 30Cys Pro
Pro Cys Pro Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr 35 40 45His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 50 55
60Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg65
70 75 80Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro 85 90 95Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala 100 105 110Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val 115 120 125Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr 130 135 140Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr145 150 155 160Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 165 170 175Pro Pro Ser
Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys 180 185 190Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 195 200
205Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp
210 215 220Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys Ser225 230 235 240Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala 245 250 255Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys 260 265 270Ser Leu Asp Glu Pro Lys Ser
Cys Asp Lys Thr His Thr Cys Pro Pro 275 280 285Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro 290 295 300Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr305 310 315
320Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
325 330 335Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
Pro Arg 340 345 350Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
Val Leu Thr Val 355 360 365Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser 370 375 380Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys385 390 395 400Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu 405 410 415Glu Met Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 420 425 430Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 435 440
445Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
450 455 460Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly465 470 475 480Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu His Asn His Tyr 485 490 495Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 500 50564511PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 64Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Val Cys
Ser Arg Asp Phe Thr 20 25 30Pro Pro Thr Val Lys Ile Leu Gln Ser Ser
Cys Asp Gly Gly Gly His 35 40 45Phe Pro Pro Thr Ile Gln Leu Leu Cys
Leu Val Ser Gly Tyr Thr Pro 50 55 60Gly Thr Ile Asn Ile Thr Trp Leu
Glu Asp Gly Gln Val Met Asp Val65 70 75 80Asp Leu Ser Thr Ala Ser
Thr Thr Gln Glu Gly Glu Leu Ala Ser Thr 85 90 95Gln Ser Glu Leu Thr
Leu Ser Gln Lys His Trp Leu Ser Asp Arg Thr 100 105 110Tyr Thr Cys
Gln Val Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr 115 120 125Lys
Lys Cys Gly Gly Gly Asp Ile Val Cys Ser Arg Asp Phe Thr Pro 130 135
140Pro Thr Val Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly His
Phe145 150 155 160Pro Pro Thr Ile Gln Leu Leu Cys Leu Val Ser Gly
Tyr Thr Pro Gly 165 170 175Thr Ile Asn Ile Thr Trp Leu Glu Asp Gly
Gln Val Met Asp Val Asp 180 185 190Leu Ser Thr Ala Ser Thr Thr Gln
Glu Gly Glu Leu Ala Ser Thr Gln 195 200 205Ser Glu Leu Thr Leu Ser
Gln Lys His Trp Leu Ser Asp Arg Thr Tyr 210 215 220Thr Cys Gln Val
Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr Lys225 230 235 240Lys
Cys Gly Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr 245 250
255His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
260 265 270Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg 275 280 285Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro 290 295 300Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala305 310 315 320Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val 325 330 335Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 340 345 350Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 355 360 365Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 370 375
380Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr
Cys385 390 395 400Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser 405 410 415Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp 420 425 430Ser Asp Gly Ser Phe Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser 435 440 445Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala 450 455 460Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys465 470 475 480Ser
Leu Glu Gly Pro Arg Phe Glu Gly Lys Pro Ile Pro Asn Pro Leu 485 490
495Leu Gly Leu Asp Ser Thr Arg Thr Gly His His His His His His 500
505 51065480PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 65Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Val Cys Ser Arg
Asp Phe Thr 20 25 30Pro Pro Thr Val Lys Ile Leu Gln Ser Ser Cys Asp
Gly Gly Gly His 35 40 45Phe Pro Pro Thr Ile Gln Leu Leu Cys Leu Val
Ser Gly Tyr Thr Pro 50 55 60Gly Thr Ile Asn Ile Thr Trp Leu Glu Asp
Gly Gln Val Met Asp Val65 70 75 80Asp Leu Ser Thr Ala Ser Thr Thr
Gln Glu Gly Glu Leu Ala Ser Thr 85 90 95Gln Ser Glu Leu Thr Leu Ser
Gln Lys His Trp Leu Ser Asp Arg Thr 100 105 110Tyr Thr Cys Gln Val
Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr 115 120 125Lys Lys Cys
Gly Gly Gly Asp Ile Val Cys Ser Arg Asp Phe Thr Pro 130 135 140Pro
Thr Val Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly His Phe145 150
155 160Pro Pro Thr Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr Thr Pro
Gly 165 170 175Thr Ile Asn Ile Thr Trp Leu Glu Asp Gly Gln Val Met
Asp Val Asp 180 185 190Leu Ser Thr Ala Ser Thr Thr Gln Glu Gly Glu
Leu Ala Ser Thr Gln 195 200 205Ser Glu Leu Thr Leu Ser Gln Lys His
Trp Leu Ser Asp Arg Thr Tyr 210 215 220Thr Cys Gln Val Thr Tyr Gln
Gly His Thr Phe Glu Asp Ser Thr Lys225 230 235 240Lys Cys Gly Gly
Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr 245 250 255His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 260 265
270Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
275 280 285Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro 290 295 300Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala305 310 315 320Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr Tyr Arg Val Val 325 330 335Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr 340 345 350Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 355 360 365Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 370 375 380Pro
Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys385 390
395 400Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser 405 410 415Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro
Val Leu Asp 420 425 430Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser 435 440 445Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala 450 455 460Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys465 470 475
48066332PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 66Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly
Ser Ile Lys 20 25 30Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys
Ile Tyr His Ile 35 40 45Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile
Gly Glu Arg Gly His 50 55 60Gly Gly Gly Ser Ser Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys65 70 75 80Pro Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu 85 90 95Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu 100 105 110Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys 115 120 125Phe Asn Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 130 135 140Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu145 150
155 160Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys 165 170 175Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys 180 185 190Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser 195 200 205Arg Glu Glu Met Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys 210 215 220Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln225 230 235 240Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 245 250 255Ser Phe
Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln 260 265
270Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
275 280 285His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser
Leu Glu 290 295 300Gly Pro Arg Phe Glu Gly Lys Pro Ile Pro Asn Pro
Leu Leu Gly Leu305 310 315 320Asp Ser Thr Arg Thr Gly His His His
His His His 325 33067301PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 67Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly Ser Ile Lys 20 25 30Gln Ile
Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile 35 40 45Glu
Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg Gly His 50 55
60Gly Gly Gly Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys65
70 75 80Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu 85 90 95Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 100 105 110Val Thr Cys Val
Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 115 120 125Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 130 135
140Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu145 150 155 160Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys 165 170 175Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys 180 185 190Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser 195 200 205Arg Glu Glu Met Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys 210 215 220Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln225 230 235 240Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 245 250
255Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
260 265 270Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn 275 280 285His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 290 295 30068444PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 68Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Leu Gly
Gly Gly Ser Ile Lys 20 25 30Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu
Ser Lys Ile Tyr His Ile 35 40 45Glu Asn Glu Ile Ala Arg Ile Lys Lys
Leu Ile Gly Glu Arg Gly His 50 55 60Gly Gly Gly Asp Ile Val Cys Ser
Arg Asp Phe Thr Pro Pro Thr Val65 70 75 80Lys Ile Leu Gln Ser Ser
Cys Asp Gly Gly Gly His Phe Pro Pro Thr 85 90 95Ile Gln Leu Leu Cys
Leu Val Ser Gly Tyr Thr Pro Gly Thr Ile Asn 100 105 110Ile Thr Trp
Leu Glu Asp Gly Gln Val Met Asp Val Asp Leu Ser Thr 115 120 125Ala
Ser Thr Thr Gln Glu Gly Glu Leu Ala Ser Thr Gln Ser Glu Leu 130 135
140Thr Leu Ser Gln Lys His Trp Leu Ser Asp Arg Thr Tyr Thr Cys
Gln145 150 155 160Val Thr Tyr Gln Gly His Thr Phe Glu Asp Ser Thr
Lys Lys Cys Gly 165 170 175Gly Gly Arg Ser Ser Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys 180 185 190Pro Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu 195 200 205Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 210 215 220Val Thr Cys Val
Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys225 230 235 240Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 245 250
255Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
260 265 270Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys 275 280 285Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys 290 295 300Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser305 310 315 320Arg Glu Glu Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys 325 330 335Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 340 345 350Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 355 360 365Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln 370 375
380Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn385 390 395 400His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys Ser Leu Glu 405 410 415Gly Pro Arg Phe Glu Gly Lys Pro Ile Pro
Asn Pro Leu Leu Gly Leu 420 425 430Asp Ser Thr Arg Thr Gly His His
His His His His 435 44069413PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 69Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly Ser Ile Lys 20 25 30Gln Ile
Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile 35 40 45Glu
Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg Gly His 50 55
60Gly Gly Gly Asp Ile Val Cys Ser Arg Asp Phe Thr Pro Pro Thr Val65
70 75 80Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly His Phe Pro Pro
Thr 85 90 95Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr Thr Pro Gly Thr
Ile Asn 100 105 110Ile Thr Trp Leu Glu Asp Gly Gln Val Met Asp Val
Asp Leu Ser Thr 115 120 125Ala Ser Thr Thr Gln Glu Gly Glu Leu Ala
Ser Thr Gln Ser Glu Leu 130 135 140Thr Leu Ser Gln Lys His Trp Leu
Ser Asp Arg Thr Tyr Thr Cys Gln145 150 155 160Val Thr Tyr Gln Gly
His Thr Phe Glu Asp Ser Thr Lys Lys Cys Gly 165 170 175Gly Gly Arg
Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys 180 185 190Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu 195 200
205Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
210 215 220Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys225 230 235 240Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala Lys Thr Lys 245 250 255Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser Val Leu 260 265 270Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys 275 280 285Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 290 295 300Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser305 310 315
320Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
325 330 335Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly Gln 340 345 350Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly 355 360 365Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg Trp Gln 370 375 380Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu His Asn385 390 395 400His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 405 41070565PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 70Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly Ser Ile Lys 20 25 30Gln Ile
Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile 35 40 45Glu
Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg Gly His 50 55
60Ile Leu Gly Gly Gly Asp Ile Glu Arg Lys Cys Cys Val Glu Cys Pro65
70 75 80Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu Phe
Pro 85 90 95Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr 100 105 110Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Gln Phe Asn 115 120 125Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg 130 135 140Glu Glu Gln Phe Asn Ser Thr Phe
Arg Val Val Ser Val Leu Thr Val145 150 155 160Val His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 165 170 175Asn Lys Gly
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys 180 185 190Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu 195 200
205Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
210 215 220Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu225 230 235 240Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp
Ser Asp Gly Ser Phe 245 250 255Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly 260 265 270Asn Val Phe Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr 275 280 285Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys Arg Ser Ser Glu Pro 290 295 300Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu305 310 315
320Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
325 330 335Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp 340 345 350Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly 355 360 365Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn 370 375 380Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp385 390 395 400Leu Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro 405 410 415Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 420 425 430Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn 435 440
445Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
450 455 460Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr465 470 475 480Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys 485 490 495Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys 500 505 510Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu 515 520 525Ser Leu Ser Pro Gly
Lys Ser Leu Glu Gly Pro Arg Phe Glu Gly Lys 530 535 540Pro Ile Pro
Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg Thr Gly His545 550 555
560His His His His His 56571534PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 71Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly Ser Ile Lys 20 25 30Gln Ile
Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile 35 40 45Glu
Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg Gly His 50 55
60Ile Leu Gly Gly Gly Asp Ile Glu Arg Lys Cys Cys Val Glu Cys Pro65
70 75 80Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu Phe
Pro 85 90 95Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr 100 105 110Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Gln Phe Asn 115 120 125Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg 130 135 140Glu Glu Gln Phe Asn Ser Thr Phe
Arg Val Val Ser Val Leu Thr Val145 150 155 160Val His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 165 170 175Asn Lys Gly
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys 180 185 190Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu 195 200
205Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
210 215 220Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu225 230 235 240Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp
Ser Asp Gly Ser Phe 245 250 255Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly 260 265 270Asn Val Phe Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr 275 280 285Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys Arg Ser Ser Glu Pro 290 295 300Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu305 310 315
320Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
325 330 335Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp 340 345 350Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly 355 360 365Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn 370 375 380Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp385 390 395 400Leu Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro 405 410 415Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 420 425 430Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn 435 440
445Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
450 455 460Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr465 470 475 480Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys 485 490 495Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys 500 505 510Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu 515 520 525Ser Leu Ser Pro Gly
Lys 53072344PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 72Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly
Ser Ile Lys 20 25 30Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys
Ile Tyr His Ile 35 40 45Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile
Gly Glu Arg Gly His 50 55 60Asp Ile Glu Arg Lys Cys Cys Val Glu Cys
Pro Pro Cys Pro Arg Ser65 70 75 80Ser Glu Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro Pro Cys Pro 85 90 95Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys 100 105 110Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 115 120 125Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 130 135 140Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu145 150
155 160Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His 165 170 175Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys 180 185 190Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln 195 200 205Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Glu Glu Met 210 215 220Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro225 230 235 240Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 245 250 255Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 260
265 270Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val 275 280 285Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln 290 295 300Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu
Glu Gly Pro Arg Phe305 310 315 320Glu Gly Lys Pro Ile Pro Asn Pro
Leu Leu Gly Leu Asp Ser Thr Arg 325 330 335Thr Gly His His His His
His His 34073313PRTARTIFICIAL SEQUENCEchemically-synthesized
stradomer monomer 73Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu
Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Leu Gly
Gly Gly Ser Ile Lys 20 25 30Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu
Ser Lys Ile Tyr His Ile 35 40 45Glu Asn Glu Ile Ala Arg Ile Lys Lys
Leu Ile Gly Glu Arg Gly His 50 55 60Asp Ile Glu Arg Lys Cys Cys Val
Glu Cys Pro Pro Cys Pro Arg Ser65 70 75 80Ser Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys Pro 85 90 95Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 100 105 110Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 115 120 125Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 130 135
140Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu145 150 155 160Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His 165 170 175Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 180 185 190Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly Gln 195 200 205Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met 210 215 220Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro225 230 235 240Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 245 250
255Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
260 265 270Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val 275 280 285Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 290 295 300Lys Ser Leu Ser Leu Ser Pro Gly Lys305
31074372PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 74Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly
Ser Ile Lys 20 25 30Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys
Ile Tyr His Ile 35 40 45Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile
Gly Glu Arg Gly His 50 55 60Ile Leu Gly Gly Gly Ser Ile Lys Gln Ile
Glu Asp Lys Ile Glu Glu65 70 75 80Ile Leu Ser Lys Ile Tyr His Ile
Glu Asn Glu Ile Ala Arg Ile Lys 85 90 95Lys Leu Ile Gly Glu Arg Gly
His Gly Gly Gly Ser Ser Glu Pro Lys 100 105 110Ser Cys Asp Lys Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 115 120 125Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 130 135 140Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val145 150
155 160Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val 165 170 175Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser 180 185 190Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu 195 200 205Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala 210 215 220Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro225 230 235 240Gln Val Tyr Thr
Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 245 250 255Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 260 265
270Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
275 280 285Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu 290 295 300Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser305 310 315 320Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser 325 330 335Leu Ser Pro Gly Lys Ser Leu
Glu Gly Pro Arg Phe Glu Gly Lys Pro 340 345 350Ile Pro Asn Pro Leu
Leu Gly Leu Asp Ser Thr Arg Thr Gly His His 355 360 365His His His
His 37075341PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 75Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Asp Ile Leu Gly Gly Gly
Ser Ile Lys 20 25 30Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys
Ile Tyr His Ile 35 40 45Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile
Gly Glu Arg Gly His 50 55 60Ile Leu Gly Gly Gly Ser Ile Lys Gln Ile
Glu Asp Lys Ile Glu Glu65 70 75 80Ile Leu Ser Lys Ile Tyr His Ile
Glu Asn Glu Ile Ala Arg Ile Lys 85 90 95Lys Leu Ile Gly Glu Arg Gly
His Gly Gly Gly Ser Ser Glu Pro Lys 100 105 110Ser Cys Asp Lys Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 115 120 125Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 130 135 140Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val145 150
155 160Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val 165 170 175Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser 180 185 190Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu 195 200 205Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala 210 215 220Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro225 230 235 240Gln Val Tyr Thr
Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 245 250 255Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 260 265
270Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
275 280 285Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu 290 295 300Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser305 310 315 320Val Met His Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser 325 330 335Leu Ser Pro Gly Lys
34076412PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 76Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Val Cys Ser Arg Asp Phe Thr
Pro Pro Thr Val 35 40 45Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly
His Phe Pro Pro Thr 50 55 60Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr
Thr Pro Gly Thr Ile Asn65 70 75 80Ile Thr Trp Leu Glu Asp Gly Gln
Val Met Asp Val Asp Leu Ser Thr 85 90 95Ala Ser Thr Thr Gln Glu Gly
Glu Leu Ala Ser Thr Gln Ser Glu Leu 100 105 110Thr Leu Ser Gln Lys
His Trp Leu Ser Asp Arg Thr Tyr Thr Cys Gln 115 120 125Val Thr Tyr
Gln Gly His Thr Phe Glu Asp Ser Thr Lys Lys Cys Gly 130 135 140Gly
Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys145 150
155 160Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu 165 170 175Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu 180 185 190Val Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys 195 200 205Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys 210 215 220Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu225 230 235 240Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 245 250 255Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 260 265
270Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
275 280 285Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys 290 295 300Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln305 310 315 320Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly 325 330 335Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln 340 345 350Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn 355 360 365His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu 370 375 380Gly
Pro Arg Phe Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu385 390
395 400Asp Ser Thr Arg Thr Gly His His His His His His 405
41077381PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 77Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Val Cys Ser Arg Asp Phe Thr
Pro Pro Thr Val 35 40 45Lys Ile Leu Gln Ser Ser Cys Asp Gly Gly Gly
His Phe Pro Pro Thr 50 55 60Ile Gln Leu Leu Cys Leu Val Ser Gly Tyr
Thr Pro Gly Thr Ile Asn65 70 75 80Ile Thr Trp Leu Glu Asp Gly Gln
Val Met Asp Val Asp Leu Ser Thr 85 90 95Ala Ser Thr Thr Gln Glu Gly
Glu Leu Ala Ser Thr Gln Ser Glu Leu 100 105 110Thr Leu Ser Gln Lys
His Trp Leu Ser Asp Arg Thr Tyr Thr Cys Gln 115 120 125Val Thr Tyr
Gln Gly His Thr Phe Glu Asp Ser Thr Lys Lys Cys Gly 130 135 140Gly
Gly Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys145 150
155 160Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu 165 170 175Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu 180 185 190Val Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys 195 200 205Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys 210 215 220Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu225 230 235 240Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 245 250 255Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 260 265
270Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
275 280 285Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys 290 295 300Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln305 310 315 320Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly 325 330 335Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln 340 345 350Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn 355 360 365His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370 375
38078575PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 78Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Leu Gly Gly Gly Ser Ile Lys
Gln Ile Glu Asp 35 40 45Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His
Ile Glu Asn Glu Ile 50 55 60Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg
Gly His Gly Gly Gly Ser65 70 75 80Ser Glu Arg Lys Cys Cys Val Glu
Cys Pro Pro Cys Pro Ala Pro Pro 85 90 95Val Ala Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr 100 105 110Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val 115 120 125Ser His Glu
Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val 130 135 140Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser145 150
155 160Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp
Leu 165 170 175Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly
Leu Pro Ala 180 185 190Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
Gln Pro Arg Glu Pro 195 200 205Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu Met Thr Lys Asn Gln 210 215 220Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala225 230 235 240Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 245 250 255Pro Pro
Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 260 265
270Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
275 280 285Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser 290 295 300Leu Ser Pro Gly Lys Arg Ser Ser Glu Pro Lys Ser
Cys Asp Lys Thr305 310 315 320His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly Pro Ser 325 330 335Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg 340 345 350Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 355 360 365Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 370 375 380Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val385 390
395 400Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr 405 410 415Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr 420 425 430Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu 435 440 445Pro Pro Ser Arg Glu Glu Met Thr Lys
Asn Gln Val Ser Leu Thr Cys 450 455 460Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser465 470 475 480Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 485 490 495Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 500 505
510Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
515
520 525Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 530 535 540Ser Leu Glu Gly Pro Arg Phe Glu Gly Lys Pro Ile Pro
Asn Pro Leu545 550 555 560Leu Gly Leu Asp Ser Thr Arg Thr Gly His
His His His His His 565 570 57579544PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 79Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala Ala Glu Arg Lys Cys Cys Val Glu Cys Pro 20 25 30Pro Cys
Pro Asp Ile Leu Gly Gly Gly Ser Ile Lys Gln Ile Glu Asp 35 40 45Lys
Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile Glu Asn Glu Ile 50 55
60Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg Gly His Gly Gly Gly Ser65
70 75 80Ser Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro
Pro 85 90 95Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr 100 105 110Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val 115 120 125Ser His Glu Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp Gly Val 130 135 140Glu Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser145 150 155 160Thr Phe Arg Val Val
Ser Val Leu Thr Val Val His Gln Asp Trp Leu 165 170 175Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala 180 185 190Pro
Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro 195 200
205Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
210 215 220Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala225 230 235 240Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr 245 250 255Pro Pro Met Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu 260 265 270Thr Val Asp Lys Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser 275 280 285Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 290 295 300Leu Ser Pro
Gly Lys Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys Thr305 310 315
320His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
325 330 335Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg 340 345 350Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro 355 360 365Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala 370 375 380Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg Val Val385 390 395 400Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 405 410 415Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 420 425 430Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 435 440
445Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys
450 455 460Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser465 470 475 480Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp 485 490 495Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser 500 505 510Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala 515 520 525Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 530 535
54080315PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 80Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Glu Arg Lys Cys Cys Val Glu
Cys Pro Pro Cys 35 40 45Pro Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro 50 55 60Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe65 70 75 80Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val 85 90 95Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro Glu Val Lys Phe 100 105 110Asn Trp Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro 115 120 125Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr 130 135 140Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val145 150
155 160Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala 165 170 175Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser Arg 180 185 190Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly 195 200 205Phe Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro 210 215 220Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser225 230 235 240Phe Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln 245 250 255Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 260 265
270Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu Gly
275 280 285Pro Arg Phe Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly
Leu Asp 290 295 300Ser Thr Arg Thr Gly His His His His His His305
310 31581284PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 81Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Glu Arg Lys Cys Cys Val Glu
Cys Pro Pro Cys 35 40 45Pro Arg Ser Ser Glu Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro 50 55 60Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe65 70 75 80Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val 85 90 95Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro Glu Val Lys Phe 100 105 110Asn Trp Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro 115 120 125Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr 130 135 140Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val145 150
155 160Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala 165 170 175Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser Arg 180 185 190Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly 195 200 205Phe Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro 210 215 220Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser225 230 235 240Phe Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln 245 250 255Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 260 265
270Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 275
28082344PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 82Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Leu Gly Gly Gly Ser Ile Lys
Gln Ile Glu Asp 35 40 45Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His
Ile Glu Asn Glu Ile 50 55 60Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg
Gly His Gly Gly Gly Ser65 70 75 80Ser Glu Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro Pro Cys Pro 85 90 95Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys 100 105 110Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 115 120 125Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 130 135 140Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu145 150
155 160Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His 165 170 175Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys 180 185 190Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln 195 200 205Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Glu Glu Met 210 215 220Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro225 230 235 240Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 245 250 255Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 260 265
270Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
275 280 285Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln 290 295 300Lys Ser Leu Ser Leu Ser Pro Gly Lys Ser Leu Glu
Gly Pro Arg Phe305 310 315 320Glu Gly Lys Pro Ile Pro Asn Pro Leu
Leu Gly Leu Asp Ser Thr Arg 325 330 335Thr Gly His His His His His
His 34083313PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 83Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Leu Gly Gly Gly Ser Ile Lys
Gln Ile Glu Asp 35 40 45Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His
Ile Glu Asn Glu Ile 50 55 60Ala Arg Ile Lys Lys Leu Ile Gly Glu Arg
Gly His Gly Gly Gly Ser65 70 75 80Ser Glu Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro Pro Cys Pro 85 90 95Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys 100 105 110Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 115 120 125Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 130 135 140Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu145 150
155 160Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His 165 170 175Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys 180 185 190Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln 195 200 205Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Glu Glu Met 210 215 220Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro225 230 235 240Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 245 250 255Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 260 265
270Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
275 280 285Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln 290 295 300Lys Ser Leu Ser Leu Ser Pro Gly Lys305
31084531PRTARTIFICIAL SEQUENCEchemically-synthesized stradomer
monomer 84Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp
Val Pro1 5 10 15Gly Ser Thr Gly Asp Ala Ala Glu Arg Lys Cys Cys Val
Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile Glu Arg Lys Cys Cys Val Glu
Cys Pro Pro Cys 35 40 45Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys 50 55 60Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val65 70 75 80Val Val Asp Val Ser His Glu Asp
Pro Glu Val Gln Phe Asn Trp Tyr 85 90 95Val Asp Gly Val Glu Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu 100 105 110Gln Phe Asn Ser Thr
Phe Arg Val Val Ser Val Leu Thr Val Val His 115 120 125Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 130 135 140Gly
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln145 150
155 160Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu
Met 165 170 175Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro 180 185 190Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn 195 200 205Tyr Lys Thr Thr Pro Pro Met Leu Asp
Ser Asp Gly Ser Phe Phe Leu 210 215 220Tyr Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val225 230 235 240Phe Ser Cys Ser
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln 245 250 255Lys Ser
Leu Ser Leu Ser Pro Gly Lys Arg Ser Ser Glu Pro Lys Ser 260 265
270Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
275 280 285Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu 290 295 300Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser305 310 315 320His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu 325 330 335Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr 340 345 350Tyr Arg Val Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 355 360 365Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 370 375 380Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln385 390
395 400Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
Val 405 410 415Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val 420 425 430Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro 435 440 445Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr 450 455 460Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val465 470 475 480Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 485 490 495Ser Pro
Gly Lys Ser Leu Glu Gly Pro Arg Phe Glu Gly Lys Pro Ile 500 505
510Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg Thr Gly His His His
515 520 525His His His 53085500PRTARTIFICIAL
SEQUENCEchemically-synthesized stradomer monomer 85Met Glu Thr Asp
Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr
Gly Asp Ala
Ala Glu Arg Lys Cys Cys Val Glu Cys Pro 20 25 30Pro Cys Pro Asp Ile
Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys 35 40 45Pro Ala Pro Pro
Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 50 55 60Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val65 70 75 80Val
Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr 85 90
95Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
100 105 110Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val
Val His 115 120 125Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys 130 135 140Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Thr Lys Gly Gln145 150 155 160Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Glu Glu Met 165 170 175Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 180 185 190Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn 195 200 205Tyr
Lys Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu 210 215
220Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val225 230 235 240Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 245 250 255Lys Ser Leu Ser Leu Ser Pro Gly Lys Arg
Ser Ser Glu Pro Lys Ser 260 265 270Cys Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu 275 280 285Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 290 295 300Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser305 310 315 320His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 325 330
335Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
340 345 350Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn 355 360 365Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro 370 375 380Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln385 390 395 400Val Tyr Thr Leu Pro Pro Ser
Arg Glu Glu Met Thr Lys Asn Gln Val 405 410 415Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 420 425 430Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 435 440 445Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr 450 455
460Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val465 470 475 480Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu 485 490 495Ser Pro Gly Lys 50086159PRTHomo sapiens
86Met Lys Asn His Leu Leu Phe Trp Gly Val Leu Ala Val Phe Ile Lys1
5 10 15Ala Val His Val Lys Ala Gln Glu Asp Glu Arg Ile Val Leu Val
Asp 20 25 30Asn Lys Cys Lys Cys Ala Arg Ile Thr Ser Arg Ile Ile Arg
Ser Ser 35 40 45Glu Asp Pro Asn Glu Asp Ile Val Glu Arg Asn Ile Arg
Ile Ile Val 50 55 60Pro Leu Asn Asn Arg Glu Asn Ile Ser Asp Pro Thr
Ser Pro Leu Arg65 70 75 80Thr Arg Phe Val Tyr His Leu Ser Asp Leu
Cys Lys Lys Cys Asp Pro 85 90 95Thr Glu Val Glu Leu Asp Asn Gln Ile
Val Thr Ala Thr Gln Ser Asn 100 105 110Ile Cys Asp Glu Asp Ser Ala
Thr Glu Thr Cys Tyr Thr Tyr Asp Arg 115 120 125Asn Lys Cys Tyr Thr
Ala Val Val Pro Leu Val Tyr Gly Gly Glu Thr 130 135 140Lys Met Val
Glu Thr Ala Leu Thr Pro Asp Ala Cys Tyr Pro Asp145 150
1558715PRTHomo sapiens 87Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys Pro1 5 10 1588110PRTHomo sapiens 88Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys1 5 10 15Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 20 25 30Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 35 40 45Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 50 55
60Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His65
70 75 80Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys 85 90 95Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
100 105 11089107PRTHomo sapiens 89Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp1 5 10 15Glu Leu Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly65 70 75 80Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 1059011PRTHomo sapiens
90Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro1 5 1091109PRTHomo
sapiens 91Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro1 5 10 15Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val 20 25 30Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe
Asn Trp Tyr Val 35 40 45Asp Gly Met Glu Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln 50 55 60Phe Asn Ser Thr Phe Arg Val Val Ser Val
Leu Thr Val Val His Gln65 70 75 80Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Gly 85 90 95Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Thr Lys 100 10592107PRTHomo sapiens 92Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu1 5 10 15Glu Met
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40
45Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe
50 55 60Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly65 70 75 80Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr 85 90 95Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100
1059362PRTHomo sapiens 93Glu Leu Lys Thr Pro Leu Gly Asp Thr Thr
His Thr Cys Pro Arg Cys1 5 10 15Pro Glu Pro Lys Ser Cys Asp Thr Pro
Pro Pro Cys Pro Arg Cys Pro 20 25 30Glu Pro Lys Ser Cys Asp Thr Pro
Pro Pro Cys Pro Arg Cys Pro Glu 35 40 45Pro Lys Ser Cys Asp Thr Pro
Pro Pro Cys Pro Arg Cys Pro 50 55 6094110PRTHomo sapiens 94Ala Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys1 5 10 15Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 20 25
30Val Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe Lys Trp Tyr
35 40 45Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
Glu 50 55 60Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val
Leu His65 70 75 80Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys 85 90 95Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Thr Lys 100 105 11095107PRTHomo sapiens 95Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu1 5 10 15Glu Met Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Ser Gly Gln Pro Glu 35 40 45Asn Asn
Tyr Asn Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe 50 55 60Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly65 70 75
80Asn Ile Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn Arg Phe
85 90 95Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100
1059612PRTHomo sapiens 96Glu Ser Lys Tyr Gly Pro Pro Cys Pro Ser
Cys Pro1 5 1097110PRTHomo sapiens 97Ala Pro Glu Phe Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys1 5 10 15Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val 20 25 30Val Val Asp Val Ser Gln
Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr 35 40 45Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 50 55 60Gln Phe Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His65 70 75 80Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 85 90 95Gly
Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys 100 105
11098107PRTHomo sapiens 98Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Gln Glu1 5 10 15Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe 20 25 30Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60Phe Leu Tyr Ser Arg Leu
Thr Val Asp Lys Ser Arg Trp Gln Glu Gly65 70 75 80Asn Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95Thr Gln Lys
Ser Leu Ser Leu Ser Leu Gly Lys 100 105
* * * * *