U.S. patent application number 17/024459 was filed with the patent office on 2021-08-05 for composition and method for the diagnosis and treatment of diseases associated with neurite degeneration.
The applicant listed for this patent is AbbVie Deutschland GmbH & Co. KG, AbbVie Inc.. Invention is credited to Philip D. Bardwell, Lili Huang, Yuliya Kutskova, John Memmott, Bernhard Mueller.
Application Number | 20210238270 17/024459 |
Document ID | / |
Family ID | 1000005526710 |
Filed Date | 2021-08-05 |
United States Patent
Application |
20210238270 |
Kind Code |
A1 |
Mueller; Bernhard ; et
al. |
August 5, 2021 |
COMPOSITION AND METHOD FOR THE DIAGNOSIS AND TREATMENT OF DISEASES
ASSOCIATED WITH NEURITE DEGENERATION
Abstract
Provided herein are antibodies and methods of using the
antibodies to treat and diagnose neurite degenerative diseases and
disorders.
Inventors: |
Mueller; Bernhard;
(Ludwigshafen, DE) ; Huang; Lili; (North Chicago,
IL) ; Bardwell; Philip D.; (North Chicago, IL)
; Kutskova; Yuliya; (North Chicago, IL) ; Memmott;
John; (North Chicago, IL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AbbVie Deutschland GmbH & Co. KG
AbbVie Inc. |
Wiesbaden
North Chicago |
IL |
DE
US |
|
|
Family ID: |
1000005526710 |
Appl. No.: |
17/024459 |
Filed: |
September 17, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16166702 |
Oct 22, 2018 |
|
|
|
17024459 |
|
|
|
|
15155815 |
May 16, 2016 |
10106602 |
|
|
16166702 |
|
|
|
|
14580818 |
Dec 23, 2014 |
9365643 |
|
|
15155815 |
|
|
|
|
14033707 |
Sep 23, 2013 |
9102722 |
|
|
14580818 |
|
|
|
|
13750846 |
Jan 25, 2013 |
|
|
|
14033707 |
|
|
|
|
61591324 |
Jan 27, 2012 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 16/28 20130101;
C07K 16/22 20130101; C07K 16/18 20130101; A61K 51/1021 20130101;
G01N 2800/28 20130101; C07K 2317/565 20130101; C07K 2317/24
20130101; C07B 59/008 20130101; A61K 39/3955 20130101; G01N 33/6896
20130101; C07K 2317/33 20130101; C07K 2317/55 20130101; C07K
2317/34 20130101; C07K 2317/21 20130101; G01N 2333/705 20130101;
C07K 2317/624 20130101; C07K 2317/56 20130101; G01N 2800/285
20130101; A61K 51/1018 20130101; C07B 2200/05 20130101; A61K
49/0002 20130101; C07K 2317/622 20130101; C07K 2317/54 20130101;
C07K 2317/76 20130101; C07K 2317/31 20130101; A61K 2039/505
20130101; A61K 49/0058 20130101 |
International
Class: |
C07K 16/22 20060101
C07K016/22; C07K 16/28 20060101 C07K016/28; C07K 16/18 20060101
C07K016/18; A61K 39/395 20060101 A61K039/395; A61K 49/00 20060101
A61K049/00; A61K 51/10 20060101 A61K051/10; G01N 33/68 20060101
G01N033/68; C07B 59/00 20060101 C07B059/00 |
Claims
1. An isolated antibody or antibody fragment thereof which binds to
Repulsive Guidance Molecule a ("RGMa"), wherein the antibody
comprises a domain or region selected from the group consisting of:
(a) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:1, (b) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:5, (c) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:9, (d) a variable light domain region comprising the amino acid
sequence of SEQ ID NO:13, (e) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:17, (f) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:21, (g) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:25, (h) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:29, (i) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:33, (j) a variable light domain region comprising the amino acid
sequence of SEQ ID NO:37; (k) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:41; (l) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:45; (m) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:49; (n) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:53, (o) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:57, (p) a variable light domain region comprising the amino acid
sequence of SEQ ID NO:61, (q) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:152, (r) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:95, (s) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:99, (t) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:103, (u) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:107, (v) a variable light domain region comprising the amino
acid sequence of SEQ ID NO:111, (w) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:115, (x) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:119, (y) a variable heavy domain region comprising the amino
acid sequence of SEQ ID NO:123, (z) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:127, (aa) a
variable heavy domain region comprising the amino acid sequence of
SEQ ID NO:131, (bb) a variable light domain region comprising the
amino acid sequence of SEQ ID NO:135, (cc) a variable light domain
region comprising the amino acid sequence of SEQ ID NO:67, (dd) a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:68, (ee) a variable light domain region comprising the
amino acid sequence of SEQ ID NO:69 (ff) a variable light domain
region comprising the amino acid sequence of SEQ ID NO:70, (gg) a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:71, (hh) a variable light domain region comprising the
amino acid sequence of SEQ ID NO:72, (ii) a variable light domain
region comprising the amino acid sequence of SEQ ID NO:73, (jj) a
variable heavy domain comprising the amino acid sequence of SEQ ID
NO:1 and a variable light domain region comprising the amino acid
sequence of SEQ ID NO:5, (kk) a variable heavy domain comprising
the amino acid sequence of SEQ ID NO:9 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:13, (ll) a
variable heavy domain comprising the amino acid sequence of SEQ ID
NO:17 and a variable light domain region comprising the amino acid
sequence of SEQ ID NO:21, (mm) a variable heavy domain comprising
the amino acid sequence of SEQ ID NO:25 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:29, (nn) a
variable heavy domain comprising the amino acid sequence of SEQ ID
NO:33 and a variable light domain region comprising the amino acid
sequence of SEQ ID NO:37, (oo) a variably heavy domain comprising
the amino acid sequence of SEQ ID NO:41 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:45, (pp) a
variable heavy domain comprising the amino acid sequence of SEQ ID
NO:49 and a variable light domain region comprising the amino acid
sequence of SEQ ID NO:53, (qq) a variable heavy domain comprising
the amino acid sequence of SEQ ID NO:57 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:61, (rr) a
variable heavy domain region comprising the amino acid sequence of
SEQ ID NO:152 and a variable light domain region comprising the
amino acid sequence of SEQ ID NO:95, (ss) a variable heavy domain
region comprising the amino acid sequence of SEQ ID NO:99 and a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:103, (tt) a variable heavy domain region comprising the
amino acid sequence of SEQ ID NO:107 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:111, (uu) a
variable heavy domain region comprising the amino acid sequence of
SEQ ID NO:115 and a variable light domain region comprising the
amino acid sequence of SEQ ID NO:119, (vv) a variable heavy domain
region comprising the amino acid sequence of SEQ ID NO:123 and a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:127, (ww) a variable heavy domain region comprising the
amino acid sequence of SEQ ID NO:131 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:135, (xx) a
variable heavy chain comprising a complementarity determining
region (CDR)1 comprising the amino acid sequence of SEQ ID NO:2, a
CDR2 comprising the amino acid sequence of SEQ ID NO:3, and a CDR3
comprising the amino acid sequence of SEQ ID NO:4, (yy) a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:6, a CDR2 comprising the amino acid sequence of SEQ ID
NO:7, and a CDR3 comprising the amino acid sequence of SEQ ID NO:8,
(zz) a variable heavy chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:10, a CDR2 comprising the amino acid
sequence of SEQ ID NO:11, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:12, (aaa) a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:14, a CDR2
comprising the amino acid sequence of SEQ ID NO:15, and a CDR3
comprising the amino acid sequence of SEQ ID NO:16, (bbb) a
variable heavy chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:18, a CDR2 comprising the amino acid sequence
of SEQ ID NO:19, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:20, (ccc) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:22, a CDR2
comprising the amino acid sequence of SEQ ID NO:23, and a CDR3
comprising the amino acid sequence of SEQ ID NO:24, (ddd) a
variable heavy chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:26, a CDR2 comprising the amino acid sequence
of SEQ ID NO:27, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:28, (eee) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:30, a CDR2
comprising the amino acid sequence of SEQ ID NO:31, and a CDR3
comprising the amino acid sequence of SEQ ID NO:32, (fff) a
variable heavy chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:34, a CDR2 comprising the amino acid sequence
of SEQ ID NO:35, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:36, (ggg) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:38, a CDR2
comprising the amino acid sequence of SEQ ID NO:39, and a CDR3
comprising the amino acid sequence of SEQ ID NO:40, (hhh) a
variable heavy chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:42, a CDR2 comprising the amino acid sequence
of SEQ ID NO:43, and CDR3 comprising the amino acid sequence of SEQ
ID NO:44; (iii) a variable light chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:46, a CDR2 comprising the
amino acid sequence of SEQ ID NO:47, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:48; (jjj) a variable heavy chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:50, a CDR2 comprising the amino acid sequence of SEQ ID NO:51,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:52 and a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:54, a CDR2 comprising the amino acid sequence
of SEQ ID NO:55, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:56, (kick) a variable heavy chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:58, a CDR2
comprising the amino acid sequence of SEQ ID NO:59, and a CDR3
comprising the amino acid sequence of SEQ ID NO:60, (lll) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:62, a CDR2 comprising the amino acid sequence
of SEQ ID NO:63, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:64, (mmm) a variable heavy chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:92 or 153, a CDR2
comprising the amino acid sequence of SEQ ID NO:93 or 154, and a
CDR3 comprising the amino acid sequence of SEQ ID NO:94 or 155,
(nnn) a variable light chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:96 or 156, a CDR2 comprising the amino
acid sequence of SEQ ID NO:97 or 157, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:98 or 158, (000) a variable heavy
chain comprising a CDR1 comprising the amino acid sequence of SEQ
ID NO:100, a CDR2 comprising the amino acid sequence of SEQ ID
NO:101, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:102, (ppp) a variable light chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:104, a CDR2 comprising the
amino acid sequence of SEQ ID NO:105, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:106, (qqq) a variable heavy chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:108, a CDR2 comprising the amino acid sequence of SEQ ID NO:109,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:110,
(rrr) a variable light chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:112, a CDR2 comprising the amino acid
sequence of SEQ ID NO:113, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:114, (sss) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:116, a CDR2
comprising the amino acid sequence of SEQ ID NO:117, and a CDR3
comprising the amino acid sequence of SEQ ID NO:118, (ttt) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:120, a CDR2 comprising the amino acid
sequence of SEQ ID NO:121, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:122, (uuu) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:124, a CDR2
comprising the amino acid sequence of SEQ ID NO:125, and a CDR3
comprising the amino acid sequence of SEQ ID NO:126, (vvv) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:128, a CDR2 comprising the amino acid
sequence of SEQ ID NO:129, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:130, (www) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:132, a CDR2
comprising the amino acid sequence of SEQ ID NO:133, and a CDR3
comprising the amino acid sequence of SEQ ID NO:134, (xxx) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:136, a CDR2 comprising the amino acid
sequence of SEQ ID NO:137, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:138, (yyy) a variable light chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:67, (zzz) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:6, a CDR2 comprising the amino acid sequence
of SEQ ID NO:7, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:68, (aaaa) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:69, (bbbb) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:6, a CDR2 comprising the amino acid sequence
of SEQ ID NO:7, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:70, (cccc) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:71, (dddd) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:6, a CDR2 comprising the amino acid sequence
of SEQ ID NO:7, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:72, (eeee) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:73, (ffff) a
variable heavy chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4 and a variable light chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:6, a CDR2 comprising the amino
acid sequence of SEQ ID NO:7, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:8, (gggg) a variable heavy chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:2, a CDR2
comprising the amino acid sequence of SEQ ID NO:3, and a CDR3
comprising the amino acid sequence of SEQ ID NO:4 and a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:6, a CDR2 comprising the amino acid sequence of SEQ ID
NO:7, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:67, (hhhh) a variable heavy chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:92 or 153, a CDR2 comprising
the amino acid sequence of SEQ ID NO:93 or 154, and a CDR3
comprising the amino acid sequence of SEQ ID NO:94 or 155 and a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:96 or 156, a CDR2 comprising the amino acid
sequence of SEQ ID NO:97 or 157, and a CDR3 comprising the amino
acid sequence of SEQ ID NO:98 or 158, (iiii) a variable heavy chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:100, a CDR2 comprising the amino acid sequence of SEQ ID NO:101,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:102 and
a variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:104, a CDR2 comprising the amino acid
sequence of SEQ ID NO:105, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:106, (jjjj) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:108, a CDR2
comprising the amino acid sequence of SEQ ID NO:109, and a CDR3
comprising the amino acid sequence of SEQ ID NO:110 and a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:112, a CDR2 comprising the amino acid sequence of SEQ ID
NO:113, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:114, (kkkk) a variable heavy chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:116, a CDR2 comprising the
amino acid sequence of SEQ ID NO:117, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:118 and a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:120, a CDR2 comprising the amino acid sequence of SEQ ID NO:121,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:122,
(llll) a variable heavy chain comprising a CDR1 comprising the
amino acid sequence of SEQ ID NO:124, a CDR2 comprising the amino
acid sequence of SEQ ID NO:125, and a CDR3 comprising the amino
acid sequence of SEQ ID NO:126 and a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:128, a CDR2 comprising the amino acid sequence of SEQ ID NO:129,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:130,
(mmmm) a variable heavy chain comprising a CDR1 comprising the
amino acid sequence of SEQ ID NO:132, a CDR2 comprising the amino
acid sequence of SEQ ID NO:133, and a CDR3 comprising the amino
acid sequence of SEQ ID NO:134 and a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:136, a CDR2 comprising the amino acid sequence of SEQ ID NO:137,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:138,
(nnnn) a variable heavy chain comprising a CDR1 comprising the
amino acid sequence of SEQ ID NO:2, a CDR2 comprising the amino
acid sequence of SEQ ID NO:3, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:4 and a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:68, (0000) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:69, (pppp) a
variable heavy chain comprising a CDR 1 comprising
the amino acid sequence of SEQ ID NO:2, a CDR2 comprising the amino
acid sequence of SEQ ID NO:3, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:4, and a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:70, (qqqq) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:71, (rrrr) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:72, (ssss) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:73, (tttt) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:10, a CDR2 comprising the amino acid sequence
of SEQ ID NO:11, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:12, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:14, a CDR2
comprising the amino acid sequence of SEQ ID NO:15, and a CDR3
comprising the amino acid sequence of SEQ ID NO:16, (uuuu) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:18, a CDR2 comprising the amino acid sequence
of SEQ ID NO:19, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:20, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:22, a CDR2
comprising the amino acid sequence of SEQ ID NO:23, and a CDR3
comprising the amino acid sequence of SEQ ID NO:24, (vvvv) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:26, a CDR2 comprising the amino acid sequence
of SEQ ID NO:27, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:28, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:30, a CDR2
comprising the amino acid sequence of SEQ ID NO:31, and a CDR3
comprising the amino acid sequence of SEQ ID NO:32, (wwww) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:34, a CDR2 comprising the amino acid sequence
of SEQ ID NO:35, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:36, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:38, a CDR2
comprising the amino acid sequence of SEQ ID NO:39, and a CDR3
comprising the amino acid sequence of SEQ ID NO:40, (xxxx) a
variable heavy domain chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:42, a CDR2 comprising the amino acid
sequence of SEQ ID NO:43, and a CDR comprising the amino acid
sequence of SEQ ID NO:44, and a variable light domain chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:46, a CDR2 comprising the amino acid sequence of SEQ ID NO:47,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:48;
(yyyy) a variable heavy chain comprising a CDR 1 comprising the
amino acid sequence of SEQ ID NO:50, a CDR2 comprising the amino
acid sequence of SEQ ID NO:51, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:52, and a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:54, a CDR2
comprising the amino acid sequence of SEQ ID NO:55, and a CDR3
comprising the amino acid sequence of SEQ ID NO:56, (zzzz) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:58, a CDR2 comprising the amino acid sequence
of SEQ ID NO:59, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:60, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:62, a CDR2
comprising the amino acid sequence of SEQ ID NO:63, and a CDR3
comprising the amino acid sequence of SEQ ID NO:64.
2. The isolated antibody or antibody fragment of claim 1, wherein
the antibody is selected from the group consisting of a human
antibody, an immunoglobulin molecule, a disulfide linked Fv, a
monoclonal antibody, an affinity matured, a scFv, a chimeric
antibody, a single domain antibody, a CDR-grafted antibody, a
diabody, a humanized antibody, a multispecific antibody, a Fab, a
dual specific antibody, a DVD, a Fab', a bispecific antibody, a
F(ab')2, and a Fv.
3. The isolated antibody or antibody fragment of claim 3, wherein
the antibody or antibody fragment is human.
4. The isolated antibody or antibody fragment of claim 1, wherein
the monoclonal antibody or antibody fragment comprises a heavy
chain immunoglobulin constant domain selected from the group
consisting of a human IgM constant domain, a human IgG4 constant
domain, a human IgG1 constant domain, a human IgE constant domain,
a human IgG2 constant domain, a human igG3 constant domain, and a
human IgA constant domain.
5. The isolated antibody or antibody fragment of claim 4, wherein
the human IgG1 constant domain comprises SEQ ID NO:140.
6. The isolated antibody or antibody fragment of claim 4, wherein
the human IgG1 constant domain consists of SEQ ID NO:140.
7. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy region
comprising a sequence selected from the group consisting of SEQ ID
NO:1, SEQ ID NO:9, SEQ ID NO:17, SEQ ID NO:25, SEQ ID NO:33, SEQ ID
NO:41, SEQ ID NO:49, SEQ ID NO:57, SEQ ID NO:91, SEQ ID NO:99, SEQ
ID NO:107, SEQ ID NO:115, SEQ ID NO:123, and SEQ ID NO:131.
8. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable light region
comprising a sequence selected from the group consisting of SEQ ID
NO:5, SEQ ID NO:13, SEQ ID NO:21, SEQ ID NO:29, SEQ ID NO:37, SEQ
ID NO:45, SEQ ID NO:53, SEQ ID NO:61, SEQ ID NO:95, SEQ ID NO:103,
SEQ ID NO:111, SEQ ID NO:119, SEQ ID NO:127, and SEQ ID NO:135.
9. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable light domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8, or SEQ ID NO:6, SEQ ID
NO:7, and SEQ ID NO:67, SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:68,
or SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:69, or SEQ ID NO:6, SEQ
ID NO:7, and SEQ ID NO:70, or SEQ ID NO:6, SEQ ID NO:7, and SEQ ID
NO:71, or SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:72 or SEQ ID
NO:6, SEQ ID NO:7, and SEQ ID NO:73, or SEQ ID NO:14, SEQ ID NO:15,
and SEQ ID NO:16, or SEQ ID NO:22, SEQ ID NO:23, and SEQ ID NO:24,
or SEQ ID NO:30, SEQ ID NO:31, and SEQ ID NO:32, or SEQ ID NO:38,
SEQ ID NO:39, and SEQ ID NO:40, or SEQ ID NO:54, SEQ ID NO:55, and
SEQ ID NO:56, or SEQ ID NO:62, SEQ ID NO:63, and SEQ ID NO:64, or
SEQ ID NO:46, SEQ ID NO:47, and SEQ ID NO:48, SEQ ID NO:96, SEQ ID
NO:97, and SEQ ID NO:98, SEQ ID NO:104, SEQ ID NO:105, and SEQ ID
NO:106, SEQ ID NO:112, SEQ ID NO:113, and SEQ ID NO:114, SEQ ID
NO:120, SEQ ID NO:121, and SEQ ID NO:122, SEQ ID NO:128, SEQ ID
NO:129, and SEQ ID NO:130, SEQ ID NO:136, SEQ ID NO:137, and SEQ ID
NO:138, and SEQ ID NO: 156, and SEQ ID NO: 157, and SEQ ID NO:
158.
10. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:2, SEQ ID NO:3, and SEQ ID NO:4, or SEQ ID NO:10, SEQ ID
NO:11, and SEQ ID NO:12, or SEQ ID NO:18, SEQ ID NO:19, and SEQ ID
NO:20, or SEQ ID NO:26, SEQ ID NO:27, and SEQ ID NO:28, or SEQ ID
NO:34, SEQ ID NO:35, and SEQ ID NO:36, or SEQ ID NO:50, SEQ ID
NO:51, and SEQ ID NO:52, or SEQ ID NO:58, SEQ ID NO:59, and SEQ ID
NO:60, SEQ ID NO:42, SEQ ID NO:43, and SEQ ID NO:44, SEQ ID NO:92,
SEQ ID NO:93, and SEQ ID NO:94, SEQ ID NO:100, SEQ ID NO:101, and
SEQ ID NO:102, SEQ ID NO:108, SEQ ID NO:109, and SEQ ID NO:110, SEQ
ID NO:116, SEQ ID NO:117, and SEQ ID NO:118, SEQ ID NO:124, SEQ ID
NO:125, and SEQ ID NO:126, SEQ ID NO:132, SEQ ID NO:133, and SEQ ID
NO:134, and SEQ ID NO: 153, and SEQ ID NO: 154, and SEQ ID NO:
155.
11. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:2, SEQ ID NO:3, and SEQ ID NO:4, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8.
12. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:14, SEQ ID NO:15, and SEQ ID NO:16.
13. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:18, SEQ ID NO:19, and SEQ ID NO:20, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:22, SEQ ID NO:23, and SEQ ID NO:24.
14. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:26, SEQ ID NO:27, and SEQ ID NO:28, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:30, SEQ ID NO:31, and SEQ ID NO:32.
15. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementaritydetermining region (CDR) residues SEQ
ID NO:34, SEQ ID NO:35, and SEQ ID NO:36, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:38, SEQ ID NO:39, and SEQ ID NO:40.
16. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:50, SEQ ID NO:51, and SEQ ID NO:52, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:54, SEQ ID NO:55, and SEQ ID NO:56.
17. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:58, SEQ ID NO:59, and SEQ ID NO:60, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:62, SEQ ID NO:63, and SEQ ID NO:64.
18. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:42, SEQ ID NO:43, and SEQ ID NO:44, and a variable light
domain that comprises complementarity-determining region (CDR)
residues SEQ ID NO:46, SEQ ID NO:47, and SEQ ID NO:48.
19. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:92 or 153, SEQ ID NO:93 or 154, and SEQ ID NO:94 or 155,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:96 or
156, SEQ ID NO:97 or 157, and SEQ ID NO:98 or 158.
20. The isolated antibody or antibody fragment of claim 1, wherein
the antibody or antibody fragment comprises a variable heavy domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:100, SEQ ID NO:101, and SEQ ID NO:102, and a variable
light domain that comprises complementarity-determining region
(CDR) residues SEQ ID NO:104, SEQ ID NO:105, and SEQ ID NO:106.
21.-47. (canceled)
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This is a continuation of U.S. patent application Ser. No.
16/166,702, filed on Oct. 22, 2018, which is a continuation of U.S.
patent application Ser. No. 15/155,815, filed on May 16, 2016, now
U.S. Pat. No. 10,106,602, which is a continuation of U.S. patent
application Ser. No. 14/580,818, filed on Dec. 23, 2014, now U.S.
Pat. No. 9,365,643, which is a continuation of Ser. No. 14/033,707,
filed on Sep. 23, 2013, now U.S. Pat. No. 9,102,722, which is a
continuation of U.S. patent application Ser. No. 13/750,846, filed
on Jan. 25, 2013, which claims priority to U.S. Patent Application
No. 61/591,324, filed on Jan. 27, 2012, the entire contents of all
of which are fully incorporated herein by reference.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted in ASCII format via EFS-Web and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Sep. 17, 2020, is named 11423USC5_SEQUENCELISTING.txt, and is
102,400 bytes in size.
FIELD OF THE INVENTION
[0003] The present invention relates to antibodies and methods of
using the antibodies to treat and diagnose diseases associated with
neurite degeneration, such as multiple sclerosis.
BACKGROUND
[0004] The early stages of many neurodegenerative diseases are
characterized by neurite damage and compromised synaptic function.
Neurite degeneration often leads to neuronal cell death and can
impair the conduction of signals in the affected nerves, causing
impairment in sensation, movement, cognition, or other functions
depending on which nerves are involved. Neurite degeneration is
also a pathological hallmark of multiple sclerosis ("MS"). MS is an
autoimmune, neurodegenerative disease that affects about 350,000
people in the United States and is a major cause of nervous system
disability or death in young adults. A common clinical condition in
humans afflicted with MS is the degenerative formation of neural
lesions resulting from extensive degradation of the myelin sheaths
surrounding the axons of the neurons, and eventual degradation of
the axons themselves. The demyelination that occurs in MS is
believed to be initiated by the attack of protease enzymes on three
major neurological proteins: myelin basic protein (MBP),
proteo-lipid protein (PLP) and myelin oligodendrocyte glycoprotein
(MOG). Mechanistically, MS is an inflammatory demyelinating disease
that is at least partially caused by an autoimmune response to
myelin degradation products. Recent studies have emphasized the
role of neurite and axonal injury in addition to the well known
demyelation and inflammatory mechanisms.
[0005] Patients typically are diagnosed as having a neurite
degenerative disease based on a combination of patient history and
neurologic examination, including magnetic resonance imaging (MRI)
of the brain and spinal cord, electrodiagnostic procedures (e.g.,
evoked potential tests such as visual evoked potentials, brain stem
auditory evoked potentials, or somatosensory evoked potentials),
and lumbar puncture to look for evidence of immunoglobulin
synthesis in the cerebrospinal fluid.
[0006] Currently, there is no cure for diseases associated with
neurite degeneration, so treatment typically involves management of
symptoms and treatment of the frequency and severity of
relapses.
SUMMARY OF THE INVENTION
[0007] In one aspect, the present invention is directed to an
isolated antibody or antibody fragment thereof which binds to
Repulsive Guidance Molecule a ("RGMa"). The antibody comprises a
domain or region selected from (a) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:1, (b) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:5, (c) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:9, (d) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:13, (e) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:17, (f) a variable light domain region comprising the amino acid
sequence of SEQ ID NO:21, (g) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:25, (h) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:29, (i) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:33, (j) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:37; (k) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:41; (l) a variable light domain region comprising the amino acid
sequence of SEQ ID NO:45; (m) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:49; (n) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:53, (o) a variable heavy domain region comprising the amino acid
sequence of SEQ ID NO:57, (p) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:61, (q) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:152, (r) a variable light domain region comprising the amino
acid sequence of SEQ ID NO:95, (s) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:99, (t) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:103, (u) a variable heavy domain region comprising the amino
acid sequence of SEQ ID NO:107, (v) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:111, (w) a variable
heavy domain region comprising the amino acid sequence of SEQ ID
NO:115, (x) a variable light domain region comprising the amino
acid sequence of SEQ ID NO:119, (y) a variable heavy domain region
comprising the amino acid sequence of SEQ ID NO:123, (z) a variable
light domain region comprising the amino acid sequence of SEQ ID
NO:127, (aa) a variable heavy domain region comprising the amino
acid sequence of SEQ ID NO:131, (bb) a variable light domain region
comprising the amino acid sequence of SEQ ID NO:135, (cc) a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:67, (dd) a variable light domain region comprising the
amino acid sequence of SEQ ID NO:68, (ee) a variable light domain
region comprising the amino acid sequence of SEQ ID NO:69 (ff) a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:70, (gg) a variable light domain region comprising the
amino acid sequence of SEQ ID NO:71, (hh) a variable light domain
region comprising the amino acid sequence of SEQ ID NO:72, (ii) a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:73, (jj) a variable heavy domain comprising the amino
acid sequence of SEQ ID NO:1 and a variable light domain region
comprising the amino acid sequence of SEQ ID NO:5, (kk) a variable
heavy domain comprising the amino acid sequence of SEQ ID NO:9 and
a variable light domain region comprising the amino acid sequence
of SEQ ID NO:13, (ll) a variable heavy domain comprising the amino
acid sequence of SEQ ID NO:17 and a variable light domain region
comprising the amino acid sequence of SEQ ID NO:21, (mm) a variable
heavy domain comprising the amino acid sequence of SEQ ID NO:25 and
a variable light domain region comprising the amino acid sequence
of SEQ ID NO:29, (nn) a variable heavy domain comprising the amino
acid sequence of SEQ ID NO:33 and a variable light domain region
comprising the amino acid sequence of SEQ ID NO:37, (oo) a variably
heavy domain comprising the amino acid sequence of SEQ ID NO:41 and
a variable light domain region comprising the amino acid sequence
of SEQ ID NO:45, (pp) a variable heavy domain comprising the amino
acid sequence of SEQ ID NO:49 and a variable light domain region
comprising the amino acid sequence of SEQ ID NO:53, (qq) a variable
heavy domain comprising the amino acid sequence of SEQ ID NO:57 and
a variable light domain region comprising the amino acid sequence
of SEQ ID NO:61, (rr) a variable heavy domain region comprising the
amino acid sequence of SEQ ID NO:152 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:95, (ss) a
variable heavy domain region comprising the amino acid sequence of
SEQ ID NO:99 and a variable light domain region comprising the
amino acid sequence of SEQ ID NO:103, (tt) a variable heavy domain
region comprising the amino acid sequence of SEQ ID NO:107 and a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:111, (uu) a variable heavy domain region comprising the
amino acid sequence of SEQ ID NO:115 and a variable light domain
region comprising the amino acid sequence of SEQ ID NO:119, (vv) a
variable heavy domain region comprising the amino acid sequence of
SEQ ID NO:123 and a variable light domain region comprising the
amino acid sequence of SEQ ID NO:127, (ww) a variable heavy domain
region comprising the amino acid sequence of SEQ ID NO:131 and a
variable light domain region comprising the amino acid sequence of
SEQ ID NO:135, (xx) a variable heavy chain comprising a
complementarity determining region (CDR)1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, (yy) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:8, (zz) a variable
heavy chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:10, a CDR2 comprising the amino acid sequence of SEQ ID
NO:11, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:12, (aaa) a variable light chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:14, a CDR2 comprising the
amino acid sequence of SEQ ID NO:15, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:16, (bbb) a variable heavy chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:18, a CDR2 comprising the amino acid sequence of SEQ ID NO:19,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:20,
(ccc) a variable light chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:22, a CDR2 comprising the amino acid
sequence of SEQ ID NO:23, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:24, (ddd) a variable heavy chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:26, a CDR2
comprising the amino acid sequence of SEQ ID NO:27, and a CDR3
comprising the amino acid sequence of SEQ ID NO:28, (eee) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:30, a CDR2 comprising the amino acid sequence
of SEQ ID NO:31, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:32, (fff) a variable heavy chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:34, a CDR2
comprising the amino acid sequence of SEQ ID NO:35, and a CDR3
comprising the amino acid sequence of SEQ ID NO:36, (ggg) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:38, a CDR2 comprising the amino acid sequence
of SEQ ID NO:39, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:40, (hhh) a variable heavy chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:42, a CDR2
comprising the amino acid sequence of SEQ ID NO:43, and CDR3
comprising the amino acid sequence of SEQ ID NO:44; (iii) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:46, a CDR2 comprising the amino acid sequence
of SEQ ID NO:47, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:48; (jjj) a variable heavy chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:50, a CDR2
comprising the amino acid sequence of SEQ ID NO:51, and a CDR3
comprising the amino acid sequence of SEQ ID NO:52 and a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:54, a CDR2 comprising the amino acid sequence of SEQ ID
NO:55, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:56, (kkk) a variable heavy chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:58, a CDR2 comprising the
amino acid sequence of SEQ ID NO:59, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:60, (lll) a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:62, a CDR2 comprising the amino acid sequence of SEQ ID NO:63,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:64,
(mmm) a variable heavy chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:92 or 153, a CDR2 comprising the amino
acid sequence of SEQ ID NO:93 or 154, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:94 or 155, (nnn) a variable light
chain comprising a CDR1 comprising the amino acid sequence of SEQ
ID NO:96 or 156, a CDR2 comprising the amino acid sequence of SEQ
ID NO:97 or 157, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:98 or 158, (000) a variable heavy chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:100, a CDR2
comprising the amino acid sequence of SEQ ID NO:101, and a CDR3
comprising the amino acid sequence of SEQ ID NO:102, (ppp) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:104, a CDR2 comprising the amino acid
sequence of SEQ ID NO:105, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:106, (qqq) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:108, a CDR2
comprising the amino acid sequence of SEQ ID NO:109, and a CDR3
comprising the amino acid sequence of SEQ ID NO:110, (rrr) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:112, a CDR2 comprising the amino acid
sequence of SEQ ID NO:113, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:114, (sss) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:116, a CDR2
comprising the amino acid sequence of SEQ ID NO:117, and a CDR3
comprising the amino acid sequence of SEQ ID NO:118, (ttt) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:120, a CDR2 comprising the amino acid
sequence of SEQ ID NO:121, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:122, (uuu) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:124, a CDR2
comprising the amino acid sequence of SEQ ID NO:125, and a CDR3
comprising the amino acid sequence of SEQ ID NO:126, (vvv) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:128, a CDR2 comprising the amino acid
sequence of SEQ ID NO:129, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:130, (www) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:132, a CDR2
comprising the amino acid sequence of SEQ ID NO:133, and a CDR3
comprising the amino acid sequence of SEQ ID NO:134, (xxx) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:136, a CDR2 comprising the amino acid
sequence of SEQ ID NO:137, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:138, (yyy) a variable light chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:67, (zzz) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:6, a CDR2 comprising the amino acid sequence
of SEQ ID NO:7, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:68, (aaaa) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:69, (bbbb) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:6, a CDR2 comprising the amino acid sequence
of SEQ ID NO:7, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:70, (cccc) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:71, (dddd) a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:6, a CDR2 comprising the amino acid sequence
of SEQ ID NO:7, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:72, (eeee) a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:73, (ffff) a
variable heavy chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4 and a variable light chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:6, a CDR2 comprising the amino
acid sequence of SEQ ID NO:7, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:8, (gggg) a variable heavy chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:2, a CDR2
comprising the amino acid sequence of SEQ ID NO:3, and a CDR3
comprising the amino acid sequence of SEQ ID NO:4 and a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:6, a CDR2 comprising the amino acid sequence of SEQ ID
NO:7, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:67, (hhhh) a variable heavy chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:92 or 153, a CDR2 comprising
the amino acid sequence of SEQ ID NO:93 or 154, and a CDR3
comprising the amino acid sequence of SEQ ID NO:94 or 155 and a
variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:96 or 156, a CDR2 comprising the amino acid
sequence of SEQ ID NO:97 or 157, and a CDR3 comprising the amino
acid sequence of SEQ ID NO:98 or 158, (iiii) a variable heavy chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:100, a CDR2 comprising the amino acid sequence of SEQ ID NO:101,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:102 and
a variable light chain comprising a CDR1 comprising the amino acid
sequence of SEQ ID NO:104, a CDR2 comprising the amino acid
sequence of SEQ ID NO:105, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:106, (jjjj) a variable heavy chain comprising
a CDR1 comprising the amino acid sequence of SEQ ID NO:108, a CDR2
comprising the amino acid sequence of SEQ ID NO:109, and a CDR3
comprising the amino acid sequence of SEQ ID NO:110 and a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:112, a CDR2 comprising the amino acid sequence of SEQ ID
NO:113, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:114, (kkkk) a variable heavy chain comprising a CDR1 comprising
the amino acid sequence of SEQ ID NO:116, a CDR2 comprising the
amino acid sequence of SEQ ID NO:117, and a CDR3 comprising the
amino acid sequence of SEQ ID NO:118 and a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:120, a CDR2 comprising the amino acid sequence of SEQ ID NO:121,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:122,
(llll) a variable heavy chain comprising a CDR1 comprising the
amino acid sequence of SEQ ID NO:124, a CDR2 comprising the amino
acid sequence of SEQ ID NO:125, and a CDR3 comprising the amino
acid sequence of SEQ ID NO:126 and a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:128, a CDR2 comprising the amino acid sequence of SEQ ID NO:129,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:130,
(mmmm) a variable heavy chain comprising a CDR1 comprising the
amino acid sequence of SEQ ID NO:132, a CDR2 comprising the amino
acid sequence of SEQ ID NO:133, and a CDR3 comprising the amino
acid sequence of SEQ ID NO:134 and a variable light chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:136, a CDR2 comprising the amino acid sequence of SEQ ID NO:137,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:138,
(nnnn) a variable heavy chain comprising a CDR1 comprising the
amino acid sequence of SEQ ID NO:2, a CDR2 comprising the amino
acid sequence of SEQ ID NO:3, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:4 and a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:68, (0000) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of
SEQ ID NO:69, (pppp) a variable heavy chain comprising a CDR 1
comprising the amino acid sequence of SEQ ID NO:2, a CDR2
comprising the amino acid sequence of SEQ ID NO:3, and a CDR3
comprising the amino acid sequence of SEQ ID NO:4, and a variable
light chain comprising a CDR1 comprising the amino acid sequence of
SEQ ID NO:6, a CDR2 comprising the amino acid sequence of SEQ ID
NO:7, and a CDR3 comprising the amino acid sequence of SEQ ID
NO:70, (qqqq) a variable heavy chain comprising a CDR 1 comprising
the amino acid sequence of SEQ ID NO:2, a CDR2 comprising the amino
acid sequence of SEQ ID NO:3, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:4, and a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:71, (rrrr) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:72, (ssss) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:2, a CDR2 comprising the amino acid sequence
of SEQ ID NO:3, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:4, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:6, a CDR2
comprising the amino acid sequence of SEQ ID NO:7, and a CDR3
comprising the amino acid sequence of SEQ ID NO:73, (tttt) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:10, a CDR2 comprising the amino acid sequence
of SEQ ID NO:11, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:12, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:14, a CDR2
comprising the amino acid sequence of SEQ ID NO:15, and a CDR3
comprising the amino acid sequence of SEQ ID NO:16, (uuuu) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:18, a CDR2 comprising the amino acid sequence
of SEQ ID NO:19, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:20, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:22, a CDR2
comprising the amino acid sequence of SEQ ID NO:23, and a CDR3
comprising the amino acid sequence of SEQ ID NO:24, (vvvv) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:26, a CDR2 comprising the amino acid sequence
of SEQ ID NO:27, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:28, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:30, a CDR2
comprising the amino acid sequence of SEQ ID NO:31, and a CDR3
comprising the amino acid sequence of SEQ ID NO:32, (wwww) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:34, a CDR2 comprising the amino acid sequence
of SEQ ID NO:35, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:36, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:38, a CDR2
comprising the amino acid sequence of SEQ ID NO:39, and a CDR3
comprising the amino acid sequence of SEQ ID NO:40, (xxxx) a
variable heavy domain chain comprising a CDR1 comprising the amino
acid sequence of SEQ ID NO:42, a CDR2 comprising the amino acid
sequence of SEQ ID NO:43, and a CDR comprising the amino acid
sequence of SEQ ID NO:44, and a variable light domain chain
comprising a CDR1 comprising the amino acid sequence of SEQ ID
NO:46, a CDR2 comprising the amino acid sequence of SEQ ID NO:47,
and a CDR3 comprising the amino acid sequence of SEQ ID NO:48;
(yyyy) a variable heavy chain comprising a CDR 1 comprising the
amino acid sequence of SEQ ID NO:50, a CDR2 comprising the amino
acid sequence of SEQ ID NO:51, and a CDR3 comprising the amino acid
sequence of SEQ ID NO:52, and a variable light chain comprising a
CDR1 comprising the amino acid sequence of SEQ ID NO:54, a CDR2
comprising the amino acid sequence of SEQ ID NO:55, and a CDR3
comprising the amino acid sequence of SEQ ID NO:56, (zzzz) a
variable heavy chain comprising a CDR 1 comprising the amino acid
sequence of SEQ ID NO:58, a CDR2 comprising the amino acid sequence
of SEQ ID NO:59, and a CDR3 comprising the amino acid sequence of
SEQ ID NO:60, and a variable light chain comprising a CDR1
comprising the amino acid sequence of SEQ ID NO:62, a CDR2
comprising the amino acid sequence of SEQ ID NO:63, and a CDR3
comprising the amino acid sequence of SEQ ID NO:64.
[0008] The isolated antibody or antibody fragment may be a human
antibody, an immunoglobulin molecule, a disulfide linked Fv, a
monoclonal antibody, an affinity matured, a scFv, a chimeric
antibody, a single domain antibody, a CDR-grafted antibody, a
diabody, a humanized antibody, a multispecific antibody, a Fab, a
dual specific antibody, a DVD, a Fab', a bispecific antibody, a
F(ab')2, or a Fv. The antibody or antibody fragment may be human.
The antibody or antibody fragment may comprise a heavy chain
immunoglobulin constant domain selected from the group consisting
of a human IgM constant domain, a human IgG4 constant domain, a
human IgG1 constant domain, a human IgE constant domain, a human
IgG2 constant domain, a human IgG3 constant domain, or a human IgA
constant domain. The human IgG1 constant domain may comprise, or
consist of, SEQ ID NO:140.
[0009] The antibody or fragment thereof may comprise a variable
heavy region comprising a sequence selected from the group
consisting of SEQ ID NO:1, SEQ ID NO:9, SEQ ID NO:17, SEQ ID NO:25,
SEQ ID NO:33, SEQ ID NO:41, SEQ ID NO:49, SEQ ID NO:57, SEQ ID
NO:91, SEQ ID NO:99, SEQ ID NO:107, SEQ ID NO:115, SEQ ID NO:123,
and SEQ ID NO:131.
[0010] The isolated antibody or antibody fragment may comprise a
variable light region comprising a sequence selected from the group
consisting of SEQ ID NO:5, SEQ ID NO:13, SEQ ID NO:21, SEQ ID
NO:29, SEQ ID NO:37, SEQ ID NO:45, SEQ ID NO:53, SEQ ID NO:61, SEQ
ID NO:95, SEQ ID NO:103, SEQ ID NO:111, SEQ ID NO:119, SEQ ID
NO:127, and SEQ ID NO:135.
[0011] The isolated antibody or antibody fragment may comprise a
variable light domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8, or
SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:67, SEQ ID NO:6, SEQ ID
NO:7, and SEQ ID NO:68, or SEQ ID NO:6, SEQ ID NO:7, and SEQ ID
NO:69, or SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:70, or SEQ ID
NO:6, SEQ ID NO:7, and SEQ ID NO:71, or SEQ ID NO:6, SEQ ID NO:7,
and SEQ ID NO:72 or SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:73, or
SEQ ID NO:14, SEQ ID NO:15, and SEQ ID NO:16, or SEQ ID NO:22, SEQ
ID NO:23, and SEQ ID NO:24, or SEQ ID NO:30, SEQ ID NO:31, and SEQ
ID NO:32, or SEQ ID NO:38, SEQ ID NO:39, and SEQ ID NO:40, or SEQ
ID NO:54, SEQ ID NO:55, and SEQ ID NO:56, or SEQ ID NO:62, SEQ ID
NO:63, and SEQ ID NO:64, or SEQ ID NO:46, SEQ ID NO:47, and SEQ ID
NO:48, SEQ ID NO:96, SEQ ID NO:97, and SEQ ID NO:98, SEQ ID NO:104,
SEQ ID NO:105, and SEQ ID NO:106, SEQ ID NO:112, SEQ ID NO:113, and
SEQ ID NO:114, SEQ ID NO:120, SEQ ID NO:121, and SEQ ID NO:122, SEQ
ID NO:128, SEQ ID NO:129, and SEQ ID NO:130, SEQ ID NO:136, SEQ ID
NO:137, and SEQ ID NO:138, and SEQ ID NO: 156, and SEQ ID NO: 157,
and SEQ ID NO: 158.
[0012] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:2, SEQ ID NO:3, and SEQ ID NO:4, or
SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12, or SEQ ID NO:18, SEQ
ID NO:19, and SEQ ID NO:20, or SEQ ID NO:26, SEQ ID NO:27, and SEQ
ID NO:28, or SEQ ID NO:34, SEQ ID NO:35, and SEQ ID NO:36, or SEQ
ID NO:50, SEQ ID NO:51, and SEQ ID NO:52, or SEQ ID NO:58, SEQ ID
NO:59, and SEQ ID NO:60, SEQ ID NO:42, SEQ ID NO:43, and SEQ ID
NO:44, SEQ ID NO:92, SEQ ID NO:93, and SEQ ID NO:94, SEQ ID NO:100,
SEQ ID NO:101, and SEQ ID NO:102, SEQ ID NO:108, SEQ ID NO:109, and
SEQ ID NO:110, SEQ ID NO:116, SEQ ID NO:117, and SEQ ID NO:118, SEQ
ID NO:124, SEQ ID NO:125, and SEQ ID NO:126, SEQ ID NO:132, SEQ ID
NO:133, and SEQ ID NO:134, SEQ ID NO: 153, and SEQ ID NO: 154, and
SEQ ID NO: 155.
[0013] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:2, SEQ ID NO:3, and SEQ ID NO:4,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:6, SEQ
ID NO:7, and SEQ ID NO:8.
[0014] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:14, SEQ
ID NO:15, and SEQ ID NO:16.
[0015] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:18, SEQ ID NO:19, and SEQ ID NO:20,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:22, SEQ
ID NO:23, and SEQ ID NO:24.
[0016] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:26, SEQ ID NO:27, and SEQ ID NO:28,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:30, SEQ
ID NO:31, and SEQ ID NO:32.
[0017] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:34, SEQ ID NO:35, and SEQ ID NO:36,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:38, SEQ
ID NO:39, and SEQ ID NO:40.
[0018] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:50, SEQ ID NO:51, and SEQ ID NO:52,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:54, SEQ
ID NO:55, and SEQ ID NO:56.
[0019] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:58, SEQ ID NO:59, and SEQ ID NO:60,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:62, SEQ
ID NO:63, and SEQ ID NO:64.
[0020] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:42, SEQ ID NO:43, and SEQ ID NO:44,
and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:46, SEQ
ID NO:47, and SEQ ID NO:48.
[0021] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:92 or 153, SEQ ID NO:93 or 154, and
SEQ ID NO:94 or 155, and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:96 or
156, SEQ ID NO:97 or 157, and SEQ ID NO:98 or 158.
[0022] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:100, SEQ ID NO:101, and SEQ ID
NO:102, and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:104,
SEQ ID NO:105, and SEQ ID NO:106.
[0023] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:108, SEQ ID NO:109, and SEQ ID
NO:110, and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:112,
SEQ ID NO:113, and SEQ ID NO:114.
[0024] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:116, SEQ ID NO:117, and SEQ ID
NO:118, and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:120,
SEQ ID NO:121, and SEQ ID NO:122.
[0025] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:124, SEQ ID NO:125, and SEQ ID
NO:126, and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:128,
SEQ ID NO:129, and SEQ ID NO:130.
[0026] The isolated antibody or antibody fragment may comprise a
variable heavy domain that comprises complementarity-determining
region (CDR) residues SEQ ID NO:132, SEQ ID NO:133, and SEQ ID
NO:134, and a variable light domain that comprises
complementarity-determining region (CDR) residues SEQ ID NO:136,
SEQ ID NO:137, and SEQ ID NO:138.
[0027] The isolated antibody or antibody fragment may comprise an
agent selected from the group consisting of: an immunoadhesion
molecule, an imaging agent, and a therapeutic agent. The imaging
agent may be a radiolabel, an enzyme, a fluorescent label, a
luminescent label, a bioluminescent label, a magnetic label, or
biotin. The radiolabel may be 3H, 14C, 35S, 90Y, 99Tc, 111In, 125I,
131I, 177Lu, 166Ho, or 153Sm.
[0028] In another aspect, the present invention is directed to an
antibody, or fragment thereof, that binds to the RGMa epitope
PCKILKCNSEFWSATSGSHAPAS (hRGMa 47-69) (SEQ ID NO:79). The antibody
that binds to the RGMa epitope PCKILKCNSEFWSATSGSHAPAS (hRGMa
47-69) (SEQ ID NO:79), may comprise a variable heavy domain that
comprises complementarity-determining region (CDR) residues SEQ ID
NO:2, SEQ ID NO:3, and SEQ ID NO:4, and a variable light domain
that comprises complementarity-determining region (CDR) residues
SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8.
[0029] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment thereof which binds to
Repulsive Guidance Molecule a ("RGMa"). The antibody or antibody
fragment comprises a variable heavy domain that comprises three
complementarity-determining regions (CDR-H1, H2, and H3)
corresponding to the following formulas, respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5 (Formula 1-CDR-H1), wherein Xaa1 is an
amino acid selected from the group consisting of S, D, E, N, G, and
T; Xaa2 is an amino acid selected from the group consisting of H,
Y, L, S, and Q; Xaa3 is an amino acid selected from the group
consisting of G, D, A, T, and Y; Xaa4 is an amino acid selected
from the group consisting of I, M, and W; and Xaa5 is an amino acid
sequence from the group consisting of S, N, H, A, T, and Q;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa1-
4-Xaa15-Xaa16-(Xaa)n (Formula 2-CDR-H2), wherein n is 0 or 1, and
wherein Xaa1 is an amino acid selected from the group consisting of
W, V, A, G, L, E, S, and N; Xaa2 is an amino acid selected from the
group consisting of I, M, and F; Xaa3 is an amino acid selected
from the group consisting of S, N, D, F, and Y; Xaa4 is an amino
acid selected from the group consisting of P, Y, G, W, H, A, and S;
Xaa5 is an amino acid selected from the group consisting of Y, N,
D, E, S, K, G, and T; Xaa6 is an amino acid selected from the group
consisting of S, G, D, T, and N; Xaa7 is an amino acid selected
from the group consisting of G, S, I, E, N, and R; Xaa8 is an amino
acid selected from the group consisting of N, L, R, S, T, and Y;
Xaa9 is an amino acid selected from the group consisting of T, K,
G, N, I, and Y; Xaa10 is an amino acid selected from the group
consisting of N, G, Y, T, and K; Xaa11 is an amino acid selected
from the group consisting of Y, F, N, and H; Xaa12 is an amino acid
selected from the group consisting of A, T, V, P, L, and S; Xaa13
is an amino acid selected from the group consisting of Q, D, P, and
S; Xaa14 is an amino acid selected from the group consisting of K,
S, N, and L; Xaa15 is an amino acid selected from the group
consisting of L, F, V, K, and R; Xaa16 is an amino acid selected
from the group consisting of Q, K, R, and S; and Xaa17 is a
glycine; and Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-(Xaa)n (Formula
3-CDR-H3), wherein n is 0-11, and wherein Xaa1 is an amino acid
selected from the group consisting of V, S, E, N, L, D, Q, and A;
Xaa2 is an amino acid selected from the group consisting of G, T,
R, Y, L, I, D, and S; Xaa3 is an amino acid selected from the group
consisting of S, V, D, G, F, Y, P, M, C, L, and A; Xaa4 is an amino
acid selected from the group consisting of G, L, Y, N, E, K, A, and
F; Xaa5 is an amino acid selected from the group consisting of P,
S, Y, A, V, G, T, E, and W; Xaa6 is an amino acid selected from the
group consisting of Y, V, S, L, D, G, H, and P; Xaa7 is an amino
acid selected from the group consisting of Tyr, Asp, Gly, Ser, Phe,
Leu, and Cys; Xaa8 is an amino acid selected from the group
consisting of Tyr, Lys, Asp, Ala, and Gln; Xaa9 is an amino acid
selected from the group consisting of Met, Glu, Phe, Leu, Ser, Thr,
Pro, and Tyr; Xaa10 is an amino acid selected from the group
consisting of Asp, Gly, Tyr, Ser, Leu, His, and Phe; Xaa11 is an
amino acid selected from the group consisting of Val, Tyr, Leu,
His, Gly, Trp, and Asp; Xaa12 is an amino acid selected from the
group consisting of Tyr and Phe; Xaa13 is an amino acid selected
from the group consisting of Tyr, Gly, and Asp; Xaa14 is an amino
acid selected from the group consisting of Ala, Leu, Pro, and Tyr;
Xaa15 is an amino acid selected from the group consisting of Met,
Leu, and Phe; Xaa16 is an amino acid selected from the group
consisting of Asp and Gly; and Xaa17 is an amino acid selected from
the group consisting of an Val, Asp, and Tyr.
[0030] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment thereof which binds to
Repulsive Guidance Molecule a ("RGMa"). The antibody or antibody
fragment comprises a variable light domain that comprises three
complementarity-determining regions (CDR-L1, L2 and L3)
corresponding to the following formulas, respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-(Xaa)n
(Formula 1-CDR-L1), wherein n is 0-3, and wherein Xaa1 is an amino
acid selected from the group consisting of T, S, R, G, and Q; Xaa2
is an amino acid selected from the group consisting of G, L, and A;
Xaa3 is an amino acid selected from the group consisting of T, D,
S, N and A; Xaa4 is an amino acid selected from the group
consisting of S, K, G, Q, N, and E; Xaa5 is an amino acid sequence
from the group consisting of S, L, G, I, D, and P; Xaa6 is an amino
acid selected from the group consisting of S, G, N, H, and I; Xaa7
is an amino acid selected from the group consisting of V, D, I, S,
G and H; Xaa8 is an amino acid selected from the group consisting
of G, K, A, S, I, N, T, and D; Xaa9 is an amino acid selected from
the group consisting of D, Y, A, C, S, and F; Xaa10 is an amino
acid selected from the group consisting of S, A, G, L, V, and N;
Xaa11 is an amino acid selected from the group consisting of I, C,
Y, H, R, N, and S; Xaa12 is an amino acid selected from the group
consisting of Tyr, Gly, Ala, and Val; Xaa13 is an amino acid
selected from the group consisting of Val, and Asn; and Xaa14 is an
amino acid selected from the group consisting of Ser and His;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-(Xaa)n (Formula 2-CDR-L2),
wherein n is 0-4, and wherein Xaa1 is an amino acid selected from
the group consisting of D, Q, G, V, Y, S and E; Xaa2 is an amino
acid selected from the group consisting of V, D, N, and A; Xaa3 is
an amino acid selected from the group consisting of T, S, Y, N, and
K; Xaa4 is an amino acid selected from the group consisting of K,
N, D, Q and T; Xaa5 is an amino acid selected from the group
consisting of R, G, S, and L; Xaa6 is an amino acid selected from
the group consisting of P, S, I, and E; Xaa7 is an amino acid
selected from the group consisting of S, H, I, and T; Xaa8 is Asn;
Xaa9 is Lys; and Xaa10 is Gly; Xaa11 is Asp; and
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-(Xaa)n (Formula
3-CDR-L3), wherein n is 0-2, and wherein Xaa1 is an amino acid
selected from the group consisting of C, Q, H, F, H, L, V, I, K, Y,
and A; Xaa2 is an amino acid selected from the group consisting of
S, A, T, Q, and V; Xaa3 is an amino acid selected from the group
consisting of Y, W, and S; Xaa4 is an amino acid selected from the
group consisting of A, D, G, S, H and Y; Xaa5 is an amino acid
selected from the group consisting of G, S, N, P, D, V, and T; Xaa6
is an amino acid selected from the group consisting of I, T, S, G,
L, F and Y; Xaa7 is an amino acid selected from the group
consisting of D, T, L, I, P, and S; Xaa8 is an amino acid selected
from the group consisting of T, G, R, Y, D, N, W, L, F and P; Xaa9
is an amino acid selected from the group consisting of L, V, G, T,
and H; Xaa10 is an amino acid selected from the group consisting of
Val, Tyr, and His; Xaa11 is Leu or Val.
[0031] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment thereof which binds to
Repulsive Guidance Molecule a ("RGMa"), wherein the antibody or
antibody fragment comprises a variable heavy domain that comprises
three complementarity-determining regions (CDR-H1, H2, and H3)
corresponding to the following formulas, respectively:
[0032] Xaa1-Xaa2-Xaa3-Xaa4-Xaa5 (Formula 1-CDR-H1), wherein Xaa1 is
an amino acid selected from the group consisting of S, D, E, N, G,
and T; Xaa2 is an amino acid selected from the group consisting of
H, Y, L, S, and Q; Xaa3 is an amino acid selected from the group
consisting of G, D, A, T, and Y; Xaa4 is an amino acid selected
from the group consisting of I, M, and W; and Xaa5 is an amino acid
sequence from the group consisting of S, N, H, A, T, and Q;
[0033]
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa1-
3-Xaa14-Xaa15-Xaa16-(Xaa)n (Formula 2-CDR-H2), wherein n is 0 or 1,
and
[0034] wherein Xaa1 is an amino acid selected from the group
consisting of Y, V, A, G, L, G, S, and N; Xaa2 is an amino acid
selected from the group consisting of I, M, and F; Xaa3 is an amino
acid selected from the group consisting of S, N, D, F, and Y; Xaa4
is an amino acid selected from the group consisting of P, Y, G, W,
H, A, and S; Xaa5 is an amino acid selected from the group
consisting of Y, N, D, E, S, K, G, and T; Xaa6 is an amino acid
selected from the group consisting of S, G, D, T, and N; Xaa7 is an
amino acid selected from the group consisting of G, S, I, E, N, and
R; Xaa8 is an amino acid selected from the group consisting of N,
L, R, S, T, and Y; Xaa9 is an amino acid selected from the group
consisting of T, K, G, N, I, and Y; Xaa10 is an amino acid selected
from the group consisting of N, G, Y, T, and K; Xaa11 is an amino
acid selected from the group consisting of Y, F, N, and H; Xaa12 is
an amino acid selected from the group consisting of A, T, V, P, L,
and S; Xaa13 is an amino acid selected from the group consisting of
Q, D, P, and S; Xaa14 is an amino acid selected from the group
consisting of K, S, N, and L; Xaa15 is an amino acid selected from
the group consisting of L, F, V, K, and R; Xaa16 is an amino acid
selected from the group consisting of Q, K, R, and S; and Xaa17 is
a glycine; and
[0035] Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-(Xaa)n (Formula 3-CDR-H3),
wherein n is 0-11, and
[0036] wherein Xaa1 is an amino acid selected from the group
consisting of V, S, E, N, L, D, Q, and A; Xaa2 is an amino acid
selected from the group consisting of G, T, R, Y, L, I, D, and S;
Xaa3 is an amino acid selected from the group consisting of S, V,
D, G, F, Y, P, M, C, L, and A; Xaa4 is an amino acid selected from
the group consisting of G, L, Y, N, E, K, A, and F; Xaa5 is an
amino acid selected from the group consisting of P, S, Y, A, V, G,
T, E, and W; Xaa6 is an amino acid selected from the group
consisting of Y, V, S, L, D, G, H, and P; Xaa7 is an amino acid
selected from the group consisting of Tyr, Asp, Gly, Ser, Phe, Leu,
and Cys; Xaa8 is an amino acid selected from the group consisting
of Tyr, Lys, Asp, Ala, and Gln; Xaa9 is an amino acid selected from
the group consisting of Met, Glu, Phe, Leu, Ser, Thr, Pro, and Tyr;
Xaa10 is an amino acid selected from the group consisting of Asp,
Gly, Tyr, Ser, Leu, His, and Phe; Xaa11 is an amino acid selected
from the group consisting of Val, Tyr, Leu, His, Gly, Trp, and Asp;
Xaa12 is an amino acid selected from the group consisting of Tyr
and Phe; Xaa13 is an amino acid selected from the group consisting
of Tyr, Gly, and Asp; Xaa14 is an amino acid selected from the
group consisting of Ala, Leu, Pro, and Tyr; Xaa15 is an amino acid
selected from the group consisting of Met, Leu, and Phe; Xaa16 is
an amino acid selected from the group consisting of Asp and Gly;
and Xaa17 is an amino acid selected from the group consisting of an
Val, Asp, and Tyr; and wherein the antibody or antibody fragment
also comprises a variable light domain that comprises three
complementarity-determining regions (CDR-L1, L2, and L3)
corresponding to the following formulas, respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-(Xaa)n
(Formula 1-CDR-L1), wherein n is 0-3, and wherein Xaa1 is an amino
acid selected from the group consisting of T, S, R, G, and Q; Xaa2
is an amino acid selected from the group consisting of G, L, and A;
Xaa3 is an amino acid selected from the group consisting of T, D,
S, N and A; Xaa4 is an amino acid selected from the group
consisting of S, K, G, Q, N, and E; Xaa5 is an amino acid sequence
from the group consisting of S, L, G, I, D, and P; Xaa6 is an amino
acid selected from the group consisting of S, G, N, H, and I; Xaa7
is an amino acid selected from the group consisting of V, D, I, S,
G and H; Xaa8 is an amino acid selected from the group consisting
of G, K, A, S, I, N, T, and D; Xaa9 is an amino acid selected from
the group consisting of D, Y, A, C, S, and F; Xaa10 is an amino
acid selected from the group consisting of S, A, G, L, V, and N;
Xaa11 is an amino acid selected from the group consisting of I, C,
Y, H, R, N, and S; Xaa12 is an amino acid selected from the group
consisting of Tyr, Gly, Ala, and Val; Xaa13 is an amino acid
selected from the group consisting of Val, and Asn; and Xaa14 is an
amino acid selected from the group consisting of Ser and His;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-(Xaa)n (Formula 2-CDR-L2),
wherein n is 0-4, and wherein Xaa1 is an amino acid selected from
the group consisting of D, Q, G, V, Y, S and E; Xaa2 is an amino
acid selected from the group consisting of V, D, N, and A; Xaa3 is
an amino acid selected from the group consisting of T, S, Y, N, and
K; Xaa4 is an amino acid selected from the group consisting of K,
N, D, Q and T; Xaa5 is an amino acid selected from the group
consisting of R, G, S, and L; Xaa6 is an amino acid selected from
the group consisting of P, S, I, and E; Xaa7 is an amino acid
selected from the group consisting of S, H, I, and T; Xaa8 is Asn;
Xaa9 is Lys; and Xaa10 is Gly; Xaa11 is Asp; and
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-(Xaa)n (Formula
3-CDR-L3), wherein n is 0-2, and wherein Xaa1 is an amino acid
selected from the group consisting of C, Q, H, F, H, L, V, I, K, Y,
and A; Xaa2 is an amino acid selected from the group consisting of
S, A, T, Q, and V; Xaa3 is an amino acid selected from the group
consisting of Y, W, and S; Xaa4 is an amino acid selected from the
group consisting of A, D, G, S, H and Y; Xaa5 is an amino acid
selected from the group consisting of G, S, N, P, D, V, and T; Xaa6
is an amino acid selected from the group consisting of I, T, S, G,
L, F and Y; Xaa7 is an amino acid selected from the group
consisting of D, T, L, I, P, and S; Xaa8 is an amino acid selected
from the group consisting of T, G, R, Y, D, N, W, L, F and P; Xaa9
is an amino acid selected from the group consisting of L, V, G, T,
and H; Xaa10 is an amino acid selected from the group consisting of
Val, Tyr, and His; Xaa11 is Leu or Val.
[0037] In another aspect, the present invention is directed to a
pharmaceutical composition that comprises the herein described
antibody, antibody fragment, or mixture or derivative thereof.
[0038] In another aspect, the present invention is directed to a
method of treating, preventing, modulating, or attenuating a
disease or disorder associated with neurite degeneration,
comprising administering to a subject in need thereof a
therapeutically effective amount of the herein described antibody.
The neurite degenerative disorder may be multiple sclerosis,
Parkinson's disease; Alzheimer's disease; Huntington's disease;
amyotrophic lateral sclerosis and other motoneuron diseases;
Tay-Sachs disease; Niemann-Pick disease; Gaucher's disease;
Hurler's syndrome; idiopathic inflammatory demyelinating diseases;
vitamin B12 deficiency; central pontine myelinolysis; tabes
dorsalis; transverse myelitis; Devic's disease, progressive
multifocal leukoencephalopathy; optic neuritis; traumatic injury to
the CNS; ischemic cerebral stroke; a retinopathy; such as glaucoma,
diabetic retinopathy or age-dependent macular degeneration; and a
leukodystrophy.
[0039] In another aspect, the present invention is directed to a
method for determining whether a subject has a neurite degenerative
disorder. The method may comprise measuring the level of RGMa in a
sample from the subject; and comparing the level of RGMa in the
sample with a normal control. An altered level of RGMa indicates
that the subject has a neurite degenerative disorder. An increased
level of RGMa as compared to the normal control, indicates that the
subject has neurite degenerative disorder. The sample may be a
blood sample or a serum sample or a cerebrospinal fluid sample. The
step of measuring the level of RGMa in a sample, may be conducted
with an immunoassay. The immunoassay may be an enzyme-linked
immunosorbent assay (ELISA). The ELISA may be a sandwich ELISA.
[0040] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 67.
[0041] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 68.
[0042] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 69.
[0043] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 70.
[0044] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 71.
[0045] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 72.
[0046] In another aspect, the present invention is directed to an
isolated antibody or antibody fragment comprising SEQ ID NOs:1-7
and 73.
[0047] In another aspect, the present invention is directed to an
isolated monoclonal antibody or antibody fragment comprising SEQ ID
NOs:1-7 and 67, 68, 69, 70, 71, 72, or 73, that binds to the RGMa
epitope PCKILKCNSEFWSATSGSHAPAS (hRGMa 47-69) (SEQ ID NO:79).
BRIEF DESCRIPTION OF THE DRAWINGS
[0048] FIG. 1 shows testing results from a neurite outgrowth assay
using 50 .mu.g/ml of a hRGMa fragment. This fragment encompasses
the N-terminal amino acids 47-127 of SEQ ID NO:65 (See SEQ ID
NO:139) and contains both high affinity neogenin- and the bone
morphogenetic protein-interaction domains.
[0049] FIG. 2 shows testing results from neurite outgrowth assay
using 50 .mu.g/ml of full length hRGMa.
[0050] FIG. 3 shows a bar chart that is reflective of the level of
in vivo regenerative growth of retinal ganglion cells axons
perilesionally (0-500 .mu.m) in the presence of antibody
AE12-1.
[0051] FIG. 4 shows a bar chart that is reflective of the level of
in vivo regenerative growth of retinal ganglion cell axons
(500-1000 .mu.m) in the presence of antibody AE12-1 in direct
comparison with human 5F9.23.
[0052] FIGS. 5A and 5B show MS spectra from the reduced E1 fraction
of trypsin/Asp-N excised E. coli hRGMa with AE12-1 mAb showing the
+3 and +4 charge states (boxed) of two peptides corresponding to
the sequences SEQ ID NO: 74 (FIG. 5A) and SEQ ID NO: 80 shown on
the spectra. The peaks labeled with * are peptides that could not
be assigned to the hRGMa antigen and may be related to the
antibody.
[0053] FIGS. 6A and 6B show MS (FIG. 6A) and MS/MS (FIG. 6B)
spectra from denatured, reduced E1 fraction of hRGMa (MYC
construct) with AE12-1 mAb excised with trypsin and Asp-N,
confirming the sequence of the excised peptide as
KAGSPCKILKCNSEFWSATSGSHAPAS (SEQ ID NO:81).
[0054] FIGS. 7A and 7B show MS (top) and MS/MS (bottom) spectra
from denatured, reduced E1 fraction of hRGMa (MYC construct) with
AE12-1 mAb excised with trypsin and Asp-N, confirming the sequence
of the excised peptide as AGSPCKILKCNSEFWSATSGSHAPAS (SEQ ID
NO:89).
[0055] FIGS. 8A, 8B and 8C show micrographs of nerve lesions in
rats treated with a control antibody (hIgG at 10 mg/kg; FIG. 8A),
AE12-1 antibody at 1 mg/kg (FIG. 8B), or h5F9.23 antibody at 1
mg/kg (FIG. 8C).
[0056] FIGS. 9A and 9B show the results of an analysis of neurite
outgrowth of SH-SY5Y cells on 96 well plates coated with
fibronectin as a substrate after treatment with full length human
RGMa and its neutralization by AE12-1 (FIG. 9A) and AE12-1-H (FIG.
9B). Antibody and full length hRGMa were added at the same time and
subsequently cultures were incubated for 24 hours.
[0057] FIGS. 10A and 10B show the results of an analysis of neurite
outgrowth of SH-SY5Y cells on 96 well plates coated with
fibronectin as a substrate after treatment with full length human
RGMa and its neutralization by AE12-1-K (FIG. 10A) and AE12-1-F
(FIG. 10B). Antibody and full length hRGMa were added at the same
time and subsequently cultures were incubated for 24 hours.
[0058] FIGS. 11A and 11B show the results of an analysis of neurite
outgrowth of SH-SY5Y cells on 96 well plates coated with
fibronectin as a substrate after treatment with full length human
RGMa and its neutralization by AE-12-1-I (FIG. 11A) and AE-12-L
(FIG. 11B). Antibody and full length hRGMa were added at the same
time and the cultures were subsequently incubated for 24 hours.
[0059] FIGS. 12A and 12B show the results of an analysis of neurite
outgrowth of SH-SY5Y cells on 96 well plates coated with
fibronectin as a substrate after treatment with full length human
RGMa and its neutralization by AE12-1-V (FIG. 12A) and AE-12-1-Y
(FIG. 12B). Antibody and full length hRGMa were added at the same
time and the cultures were subsequently incubated for 24 hours.
[0060] FIGS. 13A, 13B, 13C, 13D, 13E and 13F show the results of an
RGMa binding assay on SH-SY5Y cells and primary neurons (HCA High
Content Analysis) using AE12-6 (FIGS. 13A and 13B), AE12-15 (FIGS.
13C and 13D), and AE12-23 (FIGS. 13E and 13F).
[0061] FIGS. 14A, 14B, 14C, 14D, 14E, 14f, 14G and 14H show the
results of an RGMa binding inhibition assay on SH-SY5Y cells cells
(via High Content Analysis (HCA)) using AE12-1 (FIG. 14A), and the
following AE12-1 cysteine variants: AE12-1F (FIG. 14B), AE12-1H
(FIG. 14C), AE12-1I (FIG. 14D), AE12-1L (FIG. 14E), AE12-1K (FIG.
14F), AE12-1V (FIG. 14G), and AE12-1Y (FIG. 14H).
[0062] FIGS. 15A, 15B and 15C show the neutralizing effect of
AE12-1 (FIG. 15B) and AE12-6 (FIG. 15C) on RGMa neurite outgrowth
repulsion in a neurite outgrowth assay on rat hippocampal primary
neurons. The r5F9 antibody is used as a control (FIG. 15A).
[0063] FIG. 16 shows that three (3) RGMa selective monoclonal
antibodies, specifically, AE12-1, AE12-1Y and h5F9.23, induce
massive regeneration of GAP-43 positive fibers beyond the crush
site as described in Example 9. Y-axis=number of axon bundles in
the area 0-500 .mu.m beyond crush site. *** p<0.001:
significance versus hIgG, ** p<0.01: significance versus hIgG, *
p<0.05: significance versus human IgG.
[0064] FIG. 17 shows that three (3) RGMa selective monoclonal
antibodies, specifically, AE12-1, AE12-1Y and h5F9.23, increase the
number of retinal axonal bundles, thereby protecting the retinal
nerve fiber layer. Y-axis=number of fiber bundles in the retina as
described in Example 10. ** p<0.01: significance versus hIgG, *
p<0.05: significance versus hIgG.
[0065] FIG. 18 shows that the RGMa mAbs AE12-1, AE12-1Y and h5F9.23
accelerate functional recovery in the spinal tEAE model as
described in Example 11. Antibody treatment (iv) was started
approximately one week after cytokine injection and was repeated
once per week. Doses given were 10 mg/kg. *** p<0.001:
significance versus hIgG, ** p<0.01: significance versus hIgG, *
p<0.05: significance versus hIgG.
[0066] FIGS. 19A, 19B and 19C show that the RGMa mAbs AE12-1,
AE12-1Y and ABT-207 (h5F9.23) increase GAP-43 (FIG. 19A) and MBP
(FIG. 19B) area and decrease the inflammatory lesion (FIG. 19C) in
direct comparison with the human IgG control antibody as described
in Example 11. *** p<0.001: significance versus hIgG, **
p<0.01: significance versus hIgG, * p<0.05: significance
versus hIgG.
[0067] FIG. 20 shows that the RGMa mAb AE12-1Y-QL accelerated
functional recovery in the spinal tEAE model at three different
doses 0.1; 1 and 10 mg/kg given once per week intravenously as
described in Example 11. Antibody treatment (iv) was started
approximately one week after cytokine injection and was repeated
once per week. *** p<0.001: significance versus hIgG, **
p<0.01: significance versus hIgG, * p<0.05: significance
versus hIgG.
DETAILED DESCRIPTION
[0068] The inventors have discovered new antibodies that bind to
Repulsive Guidance Molecule a ("RGMa") and may be used to treat
diseases related to neurite degeneration. Provided herein are
specific and non-specific antibodies that are capable of
attenuating clinical signs associated with diseases related to
neurite degeneration.
1. Definitions
[0069] The terminology used herein is for the purpose of describing
particular embodiments only and is not intended to be limiting. As
used in the specification and the appended claims, the singular
forms "a," "and" and "the" include plural references unless the
context clearly dictates otherwise.
[0070] a. About
[0071] "About" as used herein may refer to approximately a +/-10%
variation from the stated value. It is to be understood that such a
variation is always included in any given value provided herein,
whether or not specific reference is made to it.
[0072] b. Affinity Matured Antibody
[0073] "Affinity Matured Antibody" is used herein to refer to an
antibody with one or more alterations in one or more CDRs, which
result in an improvement in the affinity (i.e. K.sub.D, k.sub.d or
k.sub.a) of the antibody for a target antigen compared to a parent
antibody, which does not possess the alteration(s). Exemplary
affinity matured antibodies will have nanomolar or even picomolar
affinities for the target antigen. A variety of procedures for
producing affinity matured antibodies are known in the art,
including the screening of a combinatory antibody library that has
been prepared using bio-display. For example, Marks et al.,
BioTechnology, 10: 779-783 (1992) describes affinity maturation by
VH and VL domain shuffling. Random mutagenesis of CDR and/or
framework residues is described by Barbas et al., Proc. Nat. Acad.
Sci. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169: 147-155
(1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson
et al., J. Immunol., 154(7): 3310-3319 (1995); and Hawkins et al,
J. Mol. Biol., 226: 889-896 (1992). Selective mutation at selective
mutagenesis positions and at contact or hypermutation positions
with an activity-enhancing amino acid residue is described in U.S.
Pat. No. 6,914,128 B1.
[0074] c. Antibody and Antibodies
[0075] "Antibody" and "antibodies" as used herein refers to
monoclonal antibodies, multispecific antibodies, human antibodies,
humanized antibodies (fully or partially humanized), animal
antibodies such as, but not limited to, a bird (for example, a duck
or a goose), a shark, a whale, and a mammal, including a
non-primate (for example, a cow, a pig, a camel, a llama, a horse,
a goat, a rabbit, a sheep, a hamster, a guinea pig, a cat, a dog, a
rat, a mouse, etc.) or a non-human primate (for example, a monkey,
a chimpanzee, etc.), recombinant antibodies, chimeric antibodies,
single-chain Fvs ("scFv"), single chain antibodies, single domain
antibodies, Fab fragments, F(ab') fragments, F(ab')2 fragments,
disulfide-linked Fvs ("sdFv"), and anti-idiotypic ("anti-Id")
antibodies, dual-domain antibodies, dual variable domain (DVD) or
triple variable domain (TVD) antibodies (dual-variable domain
immunoglobulins and methods for making them are described in Wu,
C., et al., Nature Biotechnology, 25(11):1290-1297 (2007) and PCT
International Application WO 2001/058956, the contents of each of
which are herein incorporated by reference), and functionally
active epitope-binding fragments of any of the above. In
particular, antibodies include immunoglobulin molecules and
immunologically active fragments of immunoglobulin molecules,
namely, molecules that contain an analyte-binding site.
Immunoglobulin molecules can be of any type (for example, IgG, IgE,
IgM, IgD, IgA and IgY), class (for example, IgG1, IgG2, IgG3, IgG4,
IgA1 and IgA2) or subclass. For simplicity sake, an antibody
against an analyte is frequently referred to herein as being either
an "anti-analyte antibody," or merely an "analyte antibody" (e.g.,
an anti-RGMa antibody or an RGMa antibody).
[0076] d. Antibody Fragment
[0077] "Antibody fragment" as used herein refers to a portion of an
intact antibody comprising the antigen-binding site or variable
region. The portion does not include the constant heavy chain
domains (i.e. CH2, CH3 or CH4, depending on the antibody isotype)
of the Fc region of the intact antibody. Examples of antibody
fragments include, but are not limited to, Fab fragments, Fab'
fragments, Fab'-SH fragments, F(ab')2 fragments, Fd fragments, Fv
fragments, diabodies, single-chain Fv (scFv) molecules,
single-chain polypeptides containing only one light chain variable
domain, single-chain polypeptides containing the three CDRs of the
light-chain variable domain, single-chain polypeptides containing
only one heavy chain variable region, and single-chain polypeptides
containing the three CDRs of the heavy chain variable region.
[0078] e. Binding Constants
[0079] "Binding Constants" are described herein. The term
"association rate constant," "k.sub.on" or "k.sub.a" as used
herein, refers to the value indicating the binding rate of an
antibody to its target antigen or the rate of complex formation
between an antibody and antigen as shown by the equation below:
Antibody (Ab)+Antigen (Ag).fwdarw.Ab-Ag.
[0080] The term "dissociation rate constant," "k.sub.off" or
"k.sub.d" as used interchangeably herein, refers to the value
indicating the dissociation rate of an antibody from its target
antigen or separation of Ab-Ag complex over time into free antibody
and antigen as shown by the equation below:
Antibody (Ab)+Antigen (Ag).rarw.Ab-Ag.
[0081] Methods for determining association and dissociation rate
constants are well known in the art. Using fluorescence-based
techniques offers high sensitivity and the ability to examine
samples in physiological buffers at equilibrium. Other experimental
approaches and instruments such as a BIAcore.RTM. (biomolecular
interaction analysis) assay can be used (e.g., instrument available
from BIAcore International AB, a GE Healthcare company, Uppsala,
Sweden). Additionally, a KinExA.RTM. (Kinetic Exclusion Assay)
assay, available from Sapidyne Instruments (Boise, Id.) can also be
used.
[0082] The term "equilibrium dissociation constant" or "K.sub.D" as
used interchangeably, herein, refers to the value obtained by
dividing the dissociation rate (k.sub.off) by the association rate
(k.sub.on). The association rate, the dissociation rate and the
equilibrium dissociation constant are used to represent the binding
affinity of an antibody to an antigen.
[0083] f. Binding Protein
[0084] "Binding Protein" is used herein to refer to a monomeric or
multimeric protein that binds to and forms a complex with a binding
partner, such as, for example, a polypeptide, an antigen, a
chemical compound or other molecule, or a substrate of any kind. A
binding protein specifically binds a binding partner. Binding
proteins include antibodies, as well as antigen-binding fragments
thereof and other various forms and derivatives thereof as are
known in the art and described herein below, and other molecules
comprising one or more antigen-binding domains that bind to an
antigen molecule or a particular site (epitope) on the antigen
molecule. Accordingly, a binding protein includes, but is not
limited to, an antibody, a tetrameric immunoglobulin, an IgG
molecule, an IgG.sub.1 molecule, a monoclonal antibody, a chimeric
antibody, a CDR-grafted antibody, a humanized antibody, an affinity
matured antibody, and fragments of any such antibodies that retain
the ability to bind to an antigen.
[0085] g. Bispecific Antibody
[0086] "Bispecific antibody" is used herein to refer to a
full-length antibody that is generated by quadroma technology (see
Milstein et al., Nature, 305(5934): 537-540 (1983)), by chemical
conjugation of two different monoclonal antibodies (see, Staerz et
al., Nature, 314(6012): 628-631 (1985)), or by knob-into-hole or
similar approaches, which introduce mutations in the Fc region (see
Holliger et al., Proc. Natl. Acad. Sci. USA, 90(14): 6444-6448
(1993)), resulting in multiple different immunoglobulin species of
which only one is the functional bispecific antibody. A bispecific
antibody binds one antigen (or epitope) on one of its two binding
arms (one pair of HC/LC), and binds a different antigen (or
epitope) on its second arm (a different pair of HC/LC). By this
definition, a bispecific antibody has two distinct antigen-binding
arms (in both specificity and CDR sequences), and is monovalent for
each antigen to which it binds.
[0087] h. CDR
[0088] "CDR" is used herein to refer to the "complementarity
determining region" within an antibody variable sequence. There are
three CDRs in each of the variable regions of the heavy chain and
the light chain, which are designated "CDR1", "CDR2", and "CDR3",
for each of the variable regions. The term "CDR set" as used herein
refers to a group of three CDRs that occur in a single variable
region that binds the antigen. The exact boundaries of these CDRs
have been defined differently according to different systems. The
system described by Kabat (Kabat et al., Sequences of Proteins of
Immunological Interest (National Institutes of Health, Bethesda,
Md. (1987) and (1991)) not only provides an unambiguous residue
numbering system applicable to any variable region of an antibody,
but also provides precise residue boundaries defining the three
CDRs. These CDRs may be referred to as "Kabat CDRs". Chothia and
coworkers (Chothia and Lesk, J. Mol. Biol., 196: 901-917 (1987);
and Chothia et al., Nature, 342: 877-883 (1989)) found that certain
sub-portions within Kabat CDRs adopt nearly identical peptide
backbone conformations, despite having great diversity at the level
of amino acid sequence. These sub-portions were designated as "L
1", "L2", and "L3", or "H1", "H2", and "H3", where the "L" and the
"H" designate the light chain and the heavy chain regions,
respectively. These regions may be referred to as "Chothia CDRs",
which have boundaries that overlap with Kabat CDRs. Other
boundaries defining CDRs overlapping with the Kabat CDRs have been
described by Padlan, FASEB J., 9: 133-139 (1995), and MacCallum, J.
Mol. Biol., 262(5): 732-745 (1996). Still other CDR boundary
definitions may not strictly follow one of the herein systems, but
will nonetheless overlap with the Kabat CDRs, although they may be
shortened or lengthened in light of prediction or experimental
findings that particular residues or groups of residues or even
entire CDRs do not significantly impact antigen binding. The
methods used herein may utilize CDRs defined according to any of
these systems, although certain embodiments use Kabat- or
Chothia-defined CDRs.
[0089] i. Component or Components
[0090] "Component," "components," or "at least one component,"
refer generally to a capture antibody, a detection or conjugate
calibrator, a control, a sensitivity panel, a container, a buffer,
a diluent, a salt, an enzyme, a co-factor for an enzyme, a
detection reagent, a pretreatment reagent/solution, a substrate
(e.g., as a solution), a stop solution, and the like that can be
included in a kit for assay of a test sample, such as a patient
urine, serum or plasma sample, in accordance with the methods
described herein and other methods known in the art. Some
components can be in solution or lyophilized for reconstitution for
use in an assay.
[0091] j. Consensus or Consensus Sequence
[0092] "Consensus" or "Consensus Sequence" as used herein refers to
a synthetic nucleic acid sequence, or corresponding polypeptide
sequence, constructed based on analysis of an alignment of multiple
subtypes of a particular antigen. The sequence may be used to
induce broad immunity against multiple subtypes or serotypes of a
particular antigen. Synthetic antigens, such as fusion proteins,
may be manipulated to consensus sequences (or consensus
antigens).
[0093] k. Control
[0094] "Control" as used herein refers to a composition known to
not contain an analyte of interest ("negative"), e.g., RGMa (such
as membrane-associated RGMa, soluble RGMa, fragments of
membrane-associated RGMa, fragments of soluble RGMa, variants of
RGMa (membrane-associated or soluble RGMa) or any combinations
thereof), or to contain an analyte of interest ("positive
control"), e.g., RGMa (such as membrane-associated RGMa, soluble
RGMa, fragments of membrane-associated RGMa, fragments of soluble
RGMa, variants of RGMa (membrane-associated or soluble RGMa) or any
combinations thereof). A positive control can comprise a known
concentration of RGMa. "Control," "positive control," and
"calibrator" may be used interchangeably herein to refer to a
composition comprising a known concentration of RGMa. A "positive
control" can be used to establish assay performance characteristics
and is a useful indicator of the integrity of reagents (e.g.,
analytes). A "normal control" may refer to a sample or a subject
that is free from an iron-related disease or disorder.
[0095] 1. Derivative
[0096] "Derivative" of an antibody as used herein may refer to an
antibody having one or more modifications to its amino acid
sequence when compared to a genuine or parent antibody and exhibit
a modified domain structure. The derivative may still be able to
adopt the typical domain configuration found in native antibodies,
as well as an amino acid sequence, which is able to bind to targets
(antigens) with specificity. Typical examples of antibody
derivatives are antibodies coupled to other polypeptides,
rearranged antibody domains or fragments of antibodies. The
derivative may also comprise at least one further compound, e.g. a
protein domain, said protein domain being linked by covalent or
non-covalent bonds. The linkage can be based on genetic fusion
according to the methods known in the art. The additional domain
present in the fusion protein comprising the antibody employed in
accordance with the invention may preferably be linked by a
flexible linker, advantageously a peptide linker, wherein said
peptide linker comprises plural, hydrophilic, peptide-bonded amino
acids of a length sufficient to span the distance between the
C-terminal end of the further protein domain and the N-terminal end
of the antibody or vice versa. The antibody may be linked to an
effector molecule having a conformation suitable for biological
activity or selective binding to a solid support, a biologically
active substance (e.g. a cytokine or growth hormone), a chemical
agent, a peptide, a protein or a drug, for example.
[0097] m. Dual-Specific Antibody
[0098] "Dual-specific antibody" is used herein to refer to a
full-length antibody that can bind two different antigens (or
epitopes) in each of its two binding arms (a pair of HC/LC) (see
PCT publication WO 02/02773). Accordingly a dual-specific binding
protein has two identical antigen binding arms, with identical
specificity and identical CDR sequences, and is bivalent for each
antigen to which it binds.
[0099] n. Dual Variable Domain
[0100] "Dual variable domain" is used herein to refer to two or
more antigen binding sites on a binding protein, which may be
divalent (two antigen binding sites), tetravalent (four antigen
binding sites), or multivalent binding proteins. DVDs may be
monospecific, i.e., capable of binding one antigen (or one specific
epitope), or multispecific, i.e., capable of binding two or more
antigens (i.e., two or more epitopes of the same target antigen
molecule or two or more epitopes of different target antigens). A
preferred DVD binding protein comprises two heavy chain DVD
polypeptides and two light chain DVD polypeptides and is referred
to as a "DVD immunoglobulin" or "DVD-Ig". Such a DVD-Ig binding
protein is thus tetrameric and reminiscent of an IgG molecule, but
provides more antigen binding sites than an IgG molecule. Thus,
each half of a tetrameric DVD-Ig molecule is reminiscent of one
half of an IgG molecule and comprises a heavy chain DVD polypeptide
and a light chain DVD polypeptide, but unlike a pair of heavy and
light chains of an IgG molecule that provides a single antigen
binding domain, a pair of heavy and light chains of a DVD-Ig
provide two or more antigen binding sites.
[0101] Each antigen binding site of a DVD-Ig binding protein may be
derived from a donor ("parental") monoclonal antibody and thus
comprises a heavy chain variable domain (VH) and a light chain
variable domain (VL) with a total of six CDRs involved in antigen
binding per antigen binding site. Accordingly, a DVD-Ig binding
protein that binds two different epitopes (i.e., two different
epitopes of two different antigen molecules or two different
epitopes of the same antigen molecule) comprises an antigen binding
site derived from a first parental monoclonal antibody and an
antigen binding site of a second parental monoclonal antibody.
[0102] A description of the design, expression, and
characterization of DVD-Ig binding molecules is provided in PCT
Publication No. WO 2007/024715, U.S. Pat. No. 7,612,181, and Wu et
al., Nature Biotech., 25: 1290-1297 (2007). A preferred example of
such DVD-Ig molecules comprises a heavy chain that comprises the
structural formula VD1-(X1)n-VD2-C-(X2)n, wherein VD1 is a first
heavy chain variable domain, VD2 is a second heavy chain variable
domain, C is a heavy chain constant domain, X1 is a linker with the
proviso that it is not CH1, X2 is an Fc region, and n is 0 or 1,
but preferably 1; and a light chain that comprises the structural
formula VD1-(X1)n-VD2-C-(X2)n, wherein VD1 is a first light chain
variable domain, VD2 is a second light chain variable domain, C is
a light chain constant domain, X1 is a linker with the proviso that
it is not CH1, and X2 does not comprise an Fc region; and n is 0 or
1, but preferably 1. Such a DVD-Ig may comprise two such heavy
chains and two such light chains, wherein each chain comprises
variable domains linked in tandem without an intervening constant
region between variable regions, wherein a heavy chain and a light
chain associate to form tandem functional antigen binding sites,
and a pair of heavy and light chains may associate with another
pair of heavy and light chains to form a tetrameric binding protein
with four functional antigen binding sites. In another example, a
DVD-Ig molecule may comprise heavy and light chains that each
comprise three variable domains (VD1, VD2, VD3) linked in tandem
without an intervening constant region between variable domains,
wherein a pair of heavy and light chains may associate to form
three antigen binding sites, and wherein a pair of heavy and light
chains may associate with another pair of heavy and light chains to
form a tetrameric binding protein with six antigen binding
sites.
[0103] In a preferred embodiment, a DVD-Ig binding protein
according to the invention not only binds the same target molecules
bound by its parental monoclonal antibodies, but also possesses one
or more desirable properties of one or more of its parental
monoclonal antibodies. Preferably, such an additional property is
an antibody parameter of one or more of the parental monoclonal
antibodies. Antibody parameters that may be contributed to a DVD-Ig
binding protein from one or more of its parental monoclonal
antibodies include, but are not limited to, antigen specificity,
antigen affinity, potency, biological function, epitope
recognition, protein stability, protein solubility, production
efficiency, immunogenicity, pharmacokinetics, bioavailability,
tissue cross reactivity, and orthologous antigen binding.
[0104] A DVD-Ig binding protein binds at least one epitope of RGMa.
Non-limiting examples of a DVD-Ig binding protein include a DVD-Ig
binding protein that binds one or more epitopes of RGMa, a DVD-Ig
binding protein that binds an epitope of a human RGMa and an
epitope of a RGMa of another species (for example, mouse), and a
DVD-Ig binding protein that binds an epitope of a human RGMa and an
epitope of another target molecule (for example, VEGFR2 or
VEGFR1).
[0105] o. Epitope or Epitopes
[0106] "Epitope," or "epitopes," or "epitopes of interest" refer to
a site(s) on any molecule that is recognized and can bind to a
complementary site(s) on its specific binding partner. The molecule
and specific binding partner are part of a specific binding pair.
For example, an epitope can be on a polypeptide, a protein, a
hapten, a carbohydrate antigen (such as, but not limited to,
glycolipids, glycoproteins or lipopolysaccharides), or a
polysaccharide. Its specific binding partner can be, but is not
limited to, an antibody.
[0107] p. Framework or Framework Sequence
[0108] "Framework" (FR) or "Framework sequence" as used herein may
mean the remaining sequences of a variable region minus the CDRs.
Because the exact definition of a CDR sequence can be determined by
different systems (for example, see above), the meaning of a
framework sequence is subject to correspondingly different
interpretations. The six CDRs (CDR-L1, -L2, and -L3 of light chain
and CDR-H1, -H2, and -H3 of heavy chain) also divide the framework
regions on the light chain and the heavy chain into four
sub-regions (FR1, FR2, FR3, and FR4) on each chain, in which CDR1
is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and
CDR3 between FR3 and FR4. Without specifying the particular
sub-regions as FR1, FR2, FR3, or FR4, a framework region, as
referred by others, represents the combined FRs within the variable
region of a single, naturally occurring immunoglobulin chain. As
used herein, a FR represents one of the four sub-regions, and FRs
represents two or more of the four sub-regions constituting a
framework region.
[0109] Human heavy chain and light chain FR sequences are known in
the art that can be used as heavy chain and light chain "acceptor"
framework sequences (or simply, "acceptor" sequences) to humanize a
non-human antibody using techniques known in the art. In one
embodiment, human heavy chain and light chain acceptor sequences
are selected from the framework sequences listed in publicly
available databases such as V-base (hypertext transfer
protocol://vbase.mrc-cpe.cam.ac.uk/) or in the international
ImMunoGeneTics.RTM. (IMGT.RTM.) information system (hypertext
transfer
protocol://imgt.cines.fr/texts/IMGTrepertoire/LocusGenes/).
[0110] q. Functional Antigen Binding Site
[0111] "Functional antigen binding site" as used herein may mean a
site on a binding protein (e.g. an antibody) that is capable of
binding a target antigen. The antigen binding affinity of the
antigen binding site may not be as strong as the parent binding
protein, e.g., parent antibody, from which the antigen binding site
is derived, but the ability to bind antigen must be measurable
using any one of a variety of methods known for evaluating protein,
e.g., antibody, binding to an antigen. Moreover, the antigen
binding affinity of each of the antigen binding sites of a
multivalent protein, e.g., multivalent antibody, herein need not be
quantitatively the same.
[0112] r. Human Antibody
[0113] "Human antibody" as used herein may include antibodies
having variable and constant regions derived from human germline
immunoglobulin sequences. The human antibodies of the invention may
include amino acid residues not encoded by human germline
immunoglobulin sequences (e.g., mutations introduced by random or
site-specific mutagenesis in vitro or by somatic mutation in vivo).
However, the term "human antibody", as used herein, is not intended
to include antibodies in which CDR sequences derived from the
germline of another mammalian species, such as a mouse, have been
grafted onto human framework sequences.
[0114] s. Humanized Antibody
[0115] "Humanized antibody" is used herein to describe an antibody
that comprises heavy and light chain variable region sequences from
a non-human species (e.g. a mouse) but in which at least a portion
of the VH and/or VL sequence has been altered to be more
"human-like," i.e., more similar to human germline variable
sequences. A "humanized antibody" is an antibody or a variant,
derivative, analog, or fragment thereof, which immunospecifically
binds to an antigen of interest and which comprises a framework
(FR) region having substantially the amino acid sequence of a human
antibody and a complementary determining region (CDR) having
substantially the amino acid sequence of a non-human antibody. As
used herein, the term "substantially" in the context of a CDR
refers to a CDR having an amino acid sequence at least 80%, at
least 85%, at least 90%, at least 95%, at least 98% or at least 99%
identical to the amino acid sequence of a non-human antibody CDR. A
humanized antibody comprises substantially all of at least one, and
typically two, variable domains (Fab, Fab', F(ab')2, FabC, Fv) in
which all or substantially all of the CDR regions correspond to
those of a non-human immunoglobulin (i.e., donor antibody) and all
or substantially all of the framework regions are those of a human
immunoglobulin consensus sequence. In an embodiment, a humanized
antibody also comprises at least a portion of an immunoglobulin
constant region (Fc), typically that of a human immunoglobulin. In
some embodiments, a humanized antibody contains the light chain as
well as at least the variable domain of a heavy chain. The antibody
also may include the CH1, hinge, CH2, CH3, and CH4 regions of the
heavy chain. In some embodiments, a humanized antibody only
contains a humanized light chain. In some embodiments, a humanized
antibody only contains a humanized heavy chain. In specific
embodiments, a humanized antibody only contains a humanized
variable domain of a light chain and/or humanized heavy chain.
[0116] A humanized antibody can be selected from any class of
immunoglobulins, including IgM, IgG, IgD, IgA, and IgE, and any
isotype, including without limitation IgG1, IgG2, IgG3, and IgG4. A
humanized antibody may comprise sequences from more than one class
or isotype, and particular constant domains may be selected to
optimize desired effector functions using techniques well-known in
the art.
[0117] The framework regions and CDRs of a humanized antibody need
not correspond precisely to the parental sequences, e.g., the donor
antibody CDR or the consensus framework may be mutagenized by
substitution, insertion, and/or deletion of at least one amino acid
residue so that the CDR or framework residue at that site does not
correspond to either the donor antibody or the consensus framework.
In a preferred embodiment, such mutations, however, will not be
extensive. Usually, at least 80%, preferably at least 85%, more
preferably at least 90%, and most preferably at least 95% of the
humanized antibody residues will correspond to those of the
parental FR and CDR sequences. As used herein, the term "consensus
framework" refers to the framework region in the consensus
immunoglobulin sequence. As used herein, the term "consensus
immunoglobulin sequence" refers to the sequence formed from the
most frequently occurring amino acids (or nucleotides) in a family
of related immunoglobulin sequences (see, e.g., Winnaker, From
Genes to Clones (Verlagsgesellschaft, Weinheim, 1987)). A
"consensus immunoglobulin sequence" may thus comprise a "consensus
framework region(s)" and/or a "consensus CDR(s)". In a family of
immunoglobulins, each position in the consensus sequence is
occupied by the amino acid occurring most frequently at that
position in the family. If two amino acids occur equally
frequently, either can be included in the consensus sequence.
[0118] t. Identical or Identity
[0119] "Identical" or "identity," as used herein in the context of
two or more polypeptide or polynucleotide sequences, can mean that
the sequences have a specified percentage of residues that are the
same over a specified region. The percentage can be calculated by
optimally aligning the two sequences, comparing the two sequences
over the specified region, determining the number of positions at
which the identical residue occurs in both sequences to yield the
number of matched positions, dividing the number of matched
positions by the total number of positions in the specified region,
and multiplying the result by 100 to yield the percentage of
sequence identity. In cases where the two sequences are of
different lengths or the alignment produces one or more staggered
ends and the specified region of comparison includes only a single
sequence, the residues of the single sequence are included in the
denominator but not the numerator of the calculation.
[0120] u. Isolated Polynucleotide
[0121] "Isolated polynucleotide" as used herein may mean a
polynucleotide (e.g. of genomic, cDNA, or synthetic origin, or a
combination thereof) that, by virtue of its origin, the isolated
polynucleotide is not associated with all or a portion of a
polynucleotide with which the "isolated polynucleotide" is found in
nature; is operably linked to a polynucleotide that it is not
linked to in nature; or does not occur in nature as part of a
larger sequence.
[0122] v. Label and Detectable Label
[0123] "Label" and "detectable label" as used herein refer to a
moiety attached to an antibody or an analyte to render the reaction
between the antibody and the analyte detectable, and the antibody
or analyte so labeled is referred to as "detectably labeled." A
label can produce a signal that is detectable by visual or
instrumental means. Various labels include signal-producing
substances, such as chromogens, fluorescent compounds,
chemiluminescent compounds, radioactive compounds, and the like.
Representative examples of labels include moieties that produce
light, e.g., acridinium compounds, and moieties that produce
fluorescence, e.g., fluorescein. Other labels are described herein.
In this regard, the moiety, itself, may not be detectable but may
become detectable upon reaction with yet another moiety. Use of the
term "detectably labeled" is intended to encompass such
labeling.
[0124] Any suitable detectable label as is known in the art can be
used. For example, the detectable label can be a radioactive label
(such as .sup.3H, .sup.125I, .sup.35S, .sup.14C, .sup.32P, and
.sup.33P), an enzymatic label (such as horseradish peroxidase,
alkaline peroxidase, glucose 6-phosphate dehydrogenase, and the
like), a chemiluminescent label (such as acridinium esters,
thioesters, or sulfonamides; luminol, isoluminol, phenanthridinium
esters, and the like), a fluorescent label (such as fluorescein
(e.g., 5-fluorescein, 6-carboxyfluorescein, 3'6-carboxyfluorescein,
5(6)-carboxyfluorescein, 6-hexachloro-fluorescein,
6-tetrachlorofluorescein, fluorescein isothiocyanate, and the
like)), rhodamine, phycobiliproteins, R-phycoerythrin, quantum dots
(e.g., zinc sulfide-capped cadmium selenide), a thermometric label,
or an immuno-polymerase chain reaction label. An introduction to
labels, labeling procedures and detection of labels is found in
Polak and Van Noorden, Introduction to Immunocytochemistry,
2.sup.nd ed., Springer Verlag, N.Y. (1997), and in Haugland,
Handbook of Fluorescent Probes and Research Chemicals (1996), which
is a combined handbook and catalogue published by Molecular Probes,
Inc., Eugene, Oreg. A fluorescent label can be used in FPIA (see,
e.g., U.S. Pat. Nos. 5,593,896, 5,573,904, 5,496,925, 5,359,093,
and 5,352,803, which are hereby incorporated by reference in their
entireties). An acridinium compound can be used as a detectable
label in a homogeneous chemiluminescent assay (see, e.g., Adamczyk
et al., Bioorg. Med. Chem. Lett. 16: 1324-1328 (2006); Adamczyk et
al., Bioorg. Med. Chem. Lett. 4: 2313-2317 (2004); Adamczyk et al.,
Biorg. Med. Chem. Lett. 14: 3917-3921 (2004); and Adamczyk et al.,
Org. Lett. 5: 3779-3782 (2003)).
[0125] In one aspect, the acridinium compound is an
acridinium-9-carboxamide. Methods for preparing acridinium
9-carboxamides are described in Mattingly, J. Biolumin. Chemilumin.
6: 107-114 (1991); Adamczyk et al., J. Org. Chem. 63: 5636-5639
(1998); Adamczyk et al., Tetrahedron 55: 10899-10914 (1999);
Adamczyk et al., Org. Lett. 1: 779-781 (1999); Adamczyk et al.,
Bioconjugate Chem. 11: 714-724 (2000); Mattingly et al., In
Luminescence Biotechnology: Instruments and Applications; Dyke, K.
V. Ed.; CRC Press: Boca Raton, pp. 77-105 (2002); Adamczyk et al.,
Org. Lett. 5: 3779-3782 (2003); and U.S. Pat. Nos. 5,468,646,
5,543,524 and 5,783,699 (each of which is incorporated herein by
reference in its entirety for its teachings regarding same).
[0126] Another example of an acridinium compound is an
acridinium-9-carboxylate aryl ester. An example of an
acridinium-9-carboxylate aryl ester of formula II is
10-methyl-9-(phenoxycarbonyl)acridinium fluorosulfonate (available
from Cayman Chemical, Ann Arbor, Mich.). Methods for preparing
acridinium 9-carboxylate aryl esters are described in McCapra et
al., Photochem. Photobiol. 4: 1111-21 (1965); Razavi et al.,
Luminescence 15: 245-249 (2000); Razavi et al., Luminescence 15:
239-244 (2000); and U.S. Pat. No. 5,241,070 (each of which is
incorporated herein by reference in its entirety for its teachings
regarding same). Such acridinium-9-carboxylate aryl esters are
efficient chemiluminescent indicators for hydrogen peroxide
produced in the oxidation of an analyte by at least one oxidase in
terms of the intensity of the signal and/or the rapidity of the
signal. The course of the chemiluminescent emission for the
acridinium-9-carboxylate aryl ester is completed rapidly, i.e., in
under 1 second, while the acridinium-9-carboxamide chemiluminescent
emission extends over 2 seconds. Acridinium-9-carboxylate aryl
ester, however, loses its chemiluminescent properties in the
presence of protein. Therefore, its use requires the absence of
protein during signal generation and detection. Methods for
separating or removing proteins in the sample are well-known to
those skilled in the art and include, but are not limited to,
ultrafiltration, extraction, precipitation, dialysis,
chromatography, and/or digestion (see, e.g., Wells, High Throughput
Bioanalytical Sample Preparation. Methods and Automation
Strategies, Elsevier (2003)). The amount of protein removed or
separated from the test sample can be about 40%, about 45%, about
50%, about 55%, about 60%, about 65%, about 70%, about 75%, about
80%, about 85%, about 90%, or about 95%. Further details regarding
acridinium-9-carboxylate aryl ester and its use are set forth in
U.S. patent application Ser. No. 11/697,835, filed Apr. 9, 2007.
Acridinium-9-carboxylate aryl esters can be dissolved in any
suitable solvent, such as degassed anhydrous N,N-dimethylformamide
(DMF) or aqueous sodium cholate.
[0127] w. Linking Sequence and Linking Peptide Sequence
[0128] "Linking sequence" or "linking peptide sequence" refers to a
natural or artificial polypeptide sequence that is connected to one
or more polypeptide sequences of interest (e.g., full-length,
fragments, etc.). The term "connected" refers to the joining of the
linking sequence to the polypeptide sequence of interest. Such
polypeptide sequences are preferably joined by one or more peptide
bonds. Linking sequences can have a length of from about 4 to about
50 amino acids. Preferably, the length of the linking sequence is
from about 6 to about 30 amino acids. Natural linking sequences can
be modified by amino acid substitutions, additions, or deletions to
create artificial linking sequences. Exemplary linking sequences
include, but are not limited to: (i) Histidine (His) tags, such as
a 6.times.His tag (SEQ ID NO: 148), which has an amino acid
sequence of HHHHHH (SEQ ID NO:148), are useful as linking sequences
to facilitate the isolation and purification of polypeptides and
antibodies of interest; (ii) Enterokinase cleavage sites, like His
tags, are used in the isolation and purification of proteins and
antibodies of interest. Often, enterokinase cleavage sites are used
together with His tags in the isolation and purification of
proteins and antibodies of interest. Various enterokinase cleavage
sites are known in the art. Examples of enterokinase cleavage sites
include, but are not limited to, the amino acid sequence of DDDDK
(SEQ ID NO:149) and derivatives thereof (e.g., ADDDDK (SEQ ID
NO:150), etc.); (iii) Miscellaneous sequences can be used to link
or connect the light and/or heavy chain variable regions of single
chain variable region fragments. Examples of other linking
sequences can be found in Bird et al., Science 242: 423-426 (1988);
Huston et al., PNAS USA 85: 5879-5883 (1988); and McCafferty et
al., Nature 348: 552-554 (1990). Linking sequences also can be
modified for additional functions, such as attachment of drugs or
attachment to solid supports. In the context of the present
disclosure, the monoclonal antibody, for example, can contain a
linking sequence, such as a His tag, an enterokinase cleavage site,
or both.
[0129] x. Multivalent Binding Protein
[0130] "Multivalent binding protein" is used herein to refer to a
binding protein comprising two or more antigen binding sites (also
referred to herein as "antigen binding domains"). A multivalent
binding protein is preferably engineered to have three or more
antigen binding sites, and is generally not a naturally occurring
antibody. The term "multispecific binding protein" refers to a
binding protein that can bind two or more related or unrelated
targets, including a binding protein capable of binding two or more
different epitopes of the same target molecule.
[0131] y. Predetermined Cutoff and Predetermined Level
[0132] "Predetermined cutoff" and "predetermined level" refer
generally to an assay cutoff value that is used to assess
diagnostic/prognostic/therapeutic efficacy results by comparing the
assay results against the predetermined cutoff/level, where the
predetermined cutoff/level already has been linked or associated
with various clinical parameters (e.g., severity of disease,
progression/nonprogression/improvement, etc.). The present
disclosure provides exemplary predetermined levels. However, it is
well-known that cutoff values may vary depending on the nature of
the immunoassay (e.g., antibodies employed, etc.). It further is
well within the ordinary skill of one in the art to adapt the
disclosure herein for other immunoassays to obtain
immunoassay-specific cutoff values for those other immunoassays
based on this disclosure. Whereas the precise value of the
predetermined cutoff/level may vary between assays, the
correlations as described herein should be generally
applicable.
[0133] z. Pretreatment Reagent
[0134] "Pretreatment reagent," e.g., lysis, precipitation and/or
solubilization reagent, as used in a diagnostic assay as described
herein is one that lyses any cells and/or solubilizes any analyte
that is/are present in a test sample. Pretreatment is not necessary
for all samples, as described further herein. Among other things,
solubilizing the analyte (i.e., RGMa (such as membrane-associated
RGMa, soluble RGMa, fragments of membrane-associated RGMa,
fragments of soluble RGMa, variants of RGMa (membrane-associated or
soluble RGMa) or any combinations thereof)) entails release of the
analyte from any endogenous binding proteins present in the sample.
A pretreatment reagent may be homogeneous (not requiring a
separation step) or heterogeneous (requiring a separation step).
With use of a heterogeneous pretreatment reagent there is removal
of any precipitated analyte binding proteins from the test sample
prior to proceeding to the next step of the assay. The pretreatment
reagent optionally can comprise: (a) one or more solvents and salt,
(b) one or more solvents, salt and detergent, (c) detergent, (d)
detergent and salt, or (e) any reagent or combination of reagents
appropriate for cell lysis and/or solubilization of analyte.
[0135] aa. Quality Control Reagents
[0136] "Quality control reagents" in the context of immunoassays
and kits described herein, include, but are not limited to,
calibrators, controls, and sensitivity panels. A "calibrator" or
"standard" typically is used (e.g., one or more, such as a
plurality) in order to establish calibration (standard) curves for
interpolation of the concentration of an analyte, such as an
antibody or an analyte. Alternatively, a single calibrator, which
is near a predetermined positive/negative cutoff, can be used.
Multiple calibrators (i.e., more than one calibrator or a varying
amount of calibrator(s)) can be used in conjunction so as to
comprise a "sensitivity panel."
[0137] bb. Recombinant Antibody and Recombinant Antibodies
[0138] "Recombinant antibody" and "recombinant antibodies" refer to
antibodies prepared by one or more steps, including cloning nucleic
acid sequences encoding all or a part of one or more monoclonal
antibodies into an appropriate expression vector by recombinant
techniques and subsequently expressing the antibody in an
appropriate host cell. The terms include, but are not limited to,
recombinantly produced monoclonal antibodies, chimeric antibodies,
humanized antibodies (fully or partially humanized), multi-specific
or multi-valent structures formed from antibody fragments,
bifunctional antibodies, heteroconjugate Abs, DVD-Ig.RTM.s, and
other antibodies as described in (i) herein. (Dual-variable domain
immunoglobulins and methods for making them are described in Wu,
C., et al., Nature Biotechnology, 25:1290-1297 (2007)). The term
"bifunctional antibody," as used herein, refers to an antibody that
comprises a first arm having a specificity for one antigenic site
and a second arm having a specificity for a different antigenic
site, i.e., the bifunctional antibodies have a dual
specificity.
[0139] cc. Sample, Test Sample, and Patient Sample
[0140] "Sample," "test sample," and "patient sample" may be used
interchangeably herein. The sample, such as a sample of urine,
serum, plasma, amniotic fluid, cerebrospinal fluid, placental cells
or tissue, endothelial cells, leukocytes, or monocytes, can be used
directly as obtained from a patient or can be pre-treated, such as
by filtration, distillation, extraction, concentration,
centrifugation, inactivation of interfering components, addition of
reagents, and the like, to modify the character of the sample in
some manner as discussed herein or otherwise as is known in the
art.
[0141] dd. Series of Calibrating Compositions
[0142] "Series of calibrating compositions" refers to a plurality
of compositions comprising a known concentration of Cys-CRGMa,
wherein each of the compositions differs from the other
compositions in the series by the concentration of Cys-CRGMa.
[0143] ee. Solid Phase
[0144] "Solid phase" refers to any material that is insoluble, or
can be made insoluble by a subsequent reaction. The solid phase can
be chosen for its intrinsic ability to attract and immobilize a
capture agent. Alternatively, the solid phase can have affixed
thereto a linking agent that has the ability to attract and
immobilize the capture agent. The linking agent can, for example,
include a charged substance that is oppositely charged with respect
to the capture agent itself or to a charged substance conjugated to
the capture agent. In general, the linking agent can be any binding
partner (preferably specific) that is immobilized on (attached to)
the solid phase and that has the ability to immobilize the capture
agent through a binding reaction. The linking agent enables the
indirect binding of the capture agent to a solid phase material
before the performance of the assay or during the performance of
the assay. The solid phase can, for example, be plastic,
derivatized plastic, magnetic or non-magnetic metal, glass or
silicon, including, for example, a test tube, microtiter well,
sheet, bead, microparticle, chip, and other configurations known to
those of ordinary skill in the art.
[0145] ff. Specific Binding
[0146] "Specific binding" or "specifically binding" as used herein
may refer to the interaction of an antibody, a protein, or a
peptide with a second chemical species, wherein the interaction is
dependent upon the presence of a particular structure (e.g., an
antigenic determinant or epitope) on the chemical species; for
example, an antibody recognizes and binds to a specific protein
structure rather than to proteins generally. If an antibody is
specific for epitope "A", the presence of a molecule containing
epitope A (or free, unlabeled A), in a reaction containing labeled
"A" and the antibody, will reduce the amount of labeled A bound to
the antibody.
[0147] gg. Specific Binding Partner
[0148] "Specific binding partner" is a member of a specific binding
pair. A specific binding pair comprises two different molecules,
which specifically bind to each other through chemical or physical
means. Therefore, in addition to antigen and antibody specific
binding pairs of common immunoassays, other specific binding pairs
can include biotin and avidin (or streptavidin), carbohydrates and
lectins, complementary nucleotide sequences, effector and receptor
molecules, cofactors and enzymes, enzymes and enzyme inhibitors,
and the like. Furthermore, specific binding pairs can include
members that are analogs of the original specific binding members,
for example, an analyte-analog. Immunoreactive specific binding
members include antigens, antigen fragments, and antibodies,
including monoclonal and polyclonal antibodies as well as complexes
and fragments thereof, whether isolated or recombinantly
produced.
[0149] hh. Stringent Conditions
[0150] "Stringent conditions" is used herein to describe
hybridization to filter-bound DNA in 6.times. sodium
chloride/sodium citrate (SSC) at about 45.degree. C. followed by
one or more washes in 0.2.times.SSC/0.1% SDS at about 50-65.degree.
C. The term "under highly stringent conditions", refers to
hybridization to filter-bound nucleic acid in 6.times.SSC at about
45.degree. C. followed by one or more washes in 0.1.times.SSC/0.2%
SDS at about 68.degree. C., or under other stringent hybridization
conditions. See, for example, Ausubel, F. M. et al., eds., 1989,
Current Protocols in Molecular Biology, Vol. I, Green Publishing
Associates, Inc. and John Wiley & Sons, Inc., New York at pages
6.3.1-6.3.6 and 2.10.3.
[0151] ii. Treat, Treating or Treatment
[0152] "Treat", "treating" or "treatment" are each used
interchangeably herein to describe reversing, alleviating, or
inhibiting the progress of a disease, or one or more symptoms of
such disease, to which such term applies. Depending on the
condition of the subject, the term also refers to preventing a
disease, and includes preventing the onset of a disease, or
preventing the symptoms associated with a disease. A treatment may
be either performed in an acute or chronic way. The term also
refers to reducing the severity of a disease or symptoms associated
with such disease prior to affliction with the disease. Such
prevention or reduction of the severity of a disease prior to
affliction refers to administration of an antibody or
pharmaceutical composition of the present invention to a subject
that is not at the time of administration afflicted with the
disease. "Preventing" also refers to preventing the recurrence of a
disease or of one or more symptoms associated with such disease.
"Treatment" and "therapeutically," refer to the act of treating, as
"treating" is defined above.
[0153] jj. Tracer
[0154] "Tracer" as used herein refers to an analyte or analyte
fragment conjugated to a label, such as Cys-CRGMa conjugated to a
fluorescein moiety, wherein the analyte conjugated to the label can
effectively compete with the analyte for sites on an antibody
specific for the analyte.
[0155] kk. Variant
[0156] "Variant" is used herein to describe a peptide or
polypeptide that differs in amino acid sequence by the insertion,
deletion, or conservative substitution of amino acids, but retain
at least one biological activity. Representative examples of
"biological activity" include the ability to be bound by a specific
antibody or to promote an immune response. Variant is also used
herein to describe a protein with an amino acid sequence that is
substantially identical to a referenced protein with an amino acid
sequence that retains at least one biological activity. A
conservative substitution of an amino acid, i.e., replacing an
amino acid with a different amino acid of similar properties (e.g.,
hydrophilicity, degree and distribution of charged regions) is
recognized in the art as typically involving a minor change. These
minor changes can be identified, in part, by considering the
hydropathic index of amino acids, as understood in the art. Kyte et
al., J. Mol. Biol. 157:105-132 (1982). The hydropathic index of an
amino acid is based on a consideration of its hydrophobicity and
charge. It is known in the art that amino acids of similar
hydropathic indexes can be substituted and still retain protein
function. In one aspect, amino acids having hydropathic indexes of
.+-.2 are substituted. The hydrophilicity of amino acids can also
be used to reveal substitutions that would result in proteins
retaining biological function. A consideration of the
hydrophilicity of amino acids in the context of a peptide permits
calculation of the greatest local average hydrophilicity of that
peptide, a useful measure that has been reported to correlate well
with antigenicity and immunogenicity. U.S. Pat. No. 4,554,101,
incorporated fully herein by reference. Substitution of amino acids
having similar hydrophilicity values can result in peptides
retaining biological activity, for example immunogenicity, as is
understood in the art. Substitutions may be performed with amino
acids having hydrophilicity values within .+-.2 of each other. Both
the hyrophobicity index and the hydrophilicity value of amino acids
are influenced by the particular side chain of that amino acid.
Consistent with that observation, amino acid substitutions that are
compatible with biological function are understood to depend on the
relative similarity of the amino acids, and particularly the side
chains of those amino acids, as revealed by the hydrophobicity,
hydrophilicity, charge, size, and other properties. "Variant" also
can be used to refer to an antigenically reactive fragment of an
anti-RGMa antibody that differs from the corresponding fragment of
anti-RGMa antibody in amino acid sequence but is still
antigenically reactive and can compete with the corresponding
fragment of anti-RGMa antibody for binding with RGMa. "Variant"
also can be used to describe a polypeptide or a fragment thereof
that has been differentially processed, such as by proteolysis,
phosphorylation, or other post-translational modification, yet
retains its antigen reactivity.
[0157] ll. Vector
[0158] "Vector" is used herein to describe a nucleic acid molecule
that can transport another nucleic acid to which it has been
linked. One type of vector is a "plasmid", which refers to a
circular double-stranded DNA loop into which additional DNA
segments may be ligated. Another type of vector is a viral vector,
wherein additional DNA segments may be ligated into the viral
genome. Certain vectors can replicate autonomously in a host cell
into which they are introduced (e.g., bacterial vectors having a
bacterial origin of replication and episomal mammalian vectors).
Other vectors (e.g., non-episomal mammalian vectors) can be
integrated into the genome of a host cell upon introduction into
the host cell, and thereby are replicated along with the host
genome. Moreover, certain vectors are capable of directing the
expression of genes to which they are operatively linked. Such
vectors are referred to herein as "recombinant expression vectors"
(or simply, "expression vectors"). In general, expression vectors
of utility in recombinant DNA techniques are often in the form of
plasmids. "Plasmid" and "vector" may be used interchangeably as the
plasmid is the most commonly used form of vector. However, other
forms of expression vectors, such as viral vectors (e.g.,
replication defective retroviruses, adenoviruses and
adeno-associated viruses), which serve equivalent functions, can be
used. In this regard, RNA versions of vectors (including RNA viral
vectors) may also find use in the context of the present
disclosure.
[0159] For the recitation of numeric ranges herein, each
intervening number there between with the same degree of precision
is explicitly contemplated. For example, for the range of 6-9, the
numbers 7 and 8 are contemplated in addition to 6 and 9, and for
the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6,
6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
2. Anti-RGMa Antibodies
[0160] Provided herein are antibodies for use in methods of
treating neurite degenerative diseases and disorders. Several of
the herein described antibodies have been selected for binding to
RGMa, while minimizing or eliminating reactivity with Repulsive
Guidance Molecule c ("RGMc"). For example, see Table 4, wherein the
PROfusion-derived monoclonal antibody AE12-1 and AE12-1 variants
(AE12-1F, AE12-1H, AE12-1L, AE12-1V, AE12-1I, AE12-1K, and AE12-1Y)
exhibit RGMa neutralizing activity without (low detection) cross
reacting with RGMc. Because antibodies raised against RGMa can
often cross-react with RGMc and, at high intravenous doses may
result in iron accumulation in hepatocytes, the specific binding of
the herein described antibodies for RGMa is of therapeutic benefit.
Further, the high selectivity of these antibodies offers large
therapeutic dose windows or ranges for treatment.
[0161] a. RGMa
[0162] Human RGMa, which can exist as a 450 amino acid protein with
a predicted N-terminal signal peptide of 47 amino acids and a
C-terminal GPI-attachment signal, was first proposed to regulate
the guidance of retinal axons by binding to neogenin, a
transmembrane protein that is also a receptor for netrins, which
are secreted molecules that play a role in neuronal development and
cell survival. In addition to regulating retinal axonal guidance,
RGMa has been shown to inhibit axon growth in adult rats. See
Yamashita et al., Current Opinion in Neurobiology (2007)17:1-6.
Consistent with these mechanisms, RGMa expression increases after
an injury to the spinal cord, during which time inhibition of RGMa
enhances axonal growth. See Kitayama et al., PLoS One, (2011) Vol.
6 (9), pages 1-9; and Hata et al., J. Cell Biol. (2006)173:47-58.
RGMa expression is also upregulated at the lesion site and in scar
tissue of humans suffering from focal cerebral ischemia or
traumatic brain injury. See Yamashita et al., Current Opinion in
Neurobiology (2007)17:1-6; Schwab et al., Arch Neurol
(2005)22:2134-2144; and Muramatsu et al., Nat. Medicine (2011)
17:488-94.
[0163] RGMa may have the following amino acid sequence:
TABLE-US-00001 (SEQ ID NO: 65) MQPPRERLVV TGRAGWMGMG RGAGRSALGF
WPTLAFLLCS FPAATSPCKI LKCNSEFWSA TSGSHA PASDDTPEFC AALRSYALCT
RRTARTCRGD LAYHSAVHGI EDLMSQHNCS KDGPTSQPRL RTLPPAGDSQ ERSDSPEICH
YEKSFHKHSA TPNYTHCGLF GDPHLRTFTD RFQTCKVQGA WPLIDNNYLN VQVTNTPVLP
GSAATATSKL TIIFKNFQEC VDQKVYQAEM DELPAAFVDG SKNGGDKHGA NSLKITEKVS
GQHVEIQAKY IGTTIVVRQV GRYLTFAVRM PEEVVNAVED WDSQGLYLCL RGCPLNQQID
FQAFHTNAEG TGARRLAAAS PAPTAPETFP YETAVAKCKE KLPVEDLYYQ ACVFDLLTTG
DVNFTLAAYY ALEDVKMLHS NKDKLHLYER TRDLPGRAAA GLPLAPRPLL GALVPLLALL
PVFC.
The RGMa may be a fragment or variant of SEQ ID NO:65.
[0164] The fragment of RGMa may be between 5 and 425 amino acids,
between 10 and 400 amino acids, between 50 and 350 amino acids,
between 100 and 300 amino acids, between 150 and 250 amino acids,
between 200 and 300 amino acids, or between 75 and 150 amino acids
in length. The fragment may comprise a contiguous number of amino
acids from SEQ ID NO:65.
[0165] The fragment of RGMa may have the following amino acid
sequence:
TABLE-US-00002 (SEQ ID NO: 66) PCKI LKCNSEFWSA TSGSHA PASDDTPEFC
AALRSYALCT RRTARTCRGD LAYHSAVHGI EDLMSQHNCS KDGPTSQPRL RTLPPAGDSQ
ERSDSPEICH YEKSFHKHSA TPNYTHCGLF GD,
which corresponds to amino acids 47-168 of SEQ ID NO:65. The RGMa
fragment may be a fragment of SEQ ID NO:66. The RGMa fragment may
be a variant of SEQ ID NO:66. The RGMa fragment may have the
following RGMa sequence:
TABLE-US-00003 (SEQ ID NO: 74) PCKILKCNSEFWSATSGSHAPAS.
[0166] RGMa may exist as a cell membrane bound form and/or as a
soluble form.
[0167] b. RGMa--Recognizing Antibody
[0168] The antibody is an antibody that binds to RGMa, a fragment
thereof, or a variant thereof. The antibody may be a fragment of
the anti-RGMa antibody or a variant or a derivative thereof. The
antibody may be a polyclonal or monoclonal antibody. The antibody
may be a chimeric antibody, a single chain antibody, an affinity
matured antibody, a human antibody, a humanized antibody, a fully
human antibody or an antibody fragment, such as a Fab fragment, or
a mixture thereof. Antibody fragments or derivatives may comprise
F(ab')2, Fv or scFv fragments. The antibody derivatives can be
produced by peptidomimetics. Further, techniques described for the
production of single chain antibodies can be adapted to produce
single chain antibodies.
[0169] Human antibodies may be derived from phage-display
technology or from transgenic mice that express human
immmunoglobulin genes. The human antibody may be generated as a
result of a human in vivo immune response and isolated. See, for
example, Funaro et al., BMC Biotechnology, 2008(8):85. Therefore,
the antibody may be a product of the human and not animal
repertoire. Because it is of human origin, the risks of reactivity
against self-antigens may be minimized. Alternatively, standard
yeast display libraries and display technologies may be used to
select and isolate human anti-RGMa antibodies. For example,
libraries of naive human single chain variable fragments (scFv) may
be used to select human anti-RGMa antibodies. Transgenic animals
may be used to express human antibodies.
[0170] Humanized antibodies may be antibody molecules from
non-human species antibody that binds the desired antigen having
one or more complementarity determining regions (CDRs) from the
non-human species and framework regions from a human immunoglobulin
molecule.
[0171] The antibody is distinguishable from known antibodies in
that it possesses different biological function(s) than those known
in the art. For example, not only do the antibodies of the
invention recognize and bind RGMa, they are further characterized
by having an additional biological activity, for example, the
ability to attenuate clinical signs associated with diseases
related to neurite degeneration.
[0172] The antibody may specifically bind to RGMa. The
RGMa-specific RGMa antibody may comprise SEQ ID NOs:1 and 5; SEQ ID
NOs:2-4 and 6-8; SEQ ID NOs:2-4, 6, 7, and 67; SEQ ID NOs:2-4, 6,
7, and 68; SEQ ID NOs:2-4, 6, 7, and 69; SEQ ID NOs:2-4, 6, 7, and
70; SEQ ID NOs:2-4, 6, 7, and 71; SEQ ID NOs:2-4, 6, 7, and 72; or
SEQ ID NOs:2-4, 6, 7, and 73. The antibody may bind to SEQ ID
NO:65, SEQ ID NO:66, SEQ ID NO:74, or a fragment or variant
thereof. The antibody may recognize and specifically bind an
epitope present on a RGMa polypeptide or a variant as described
above. The epitope may be SEQ ID NO:66, SEQ ID NO:74, or a variant
thereof.
[0173] (1) Antibody Binding Characteristics
[0174] The antibody may immunospecifically bind to RGMa (SEQ ID
NO:65), SEQ ID NO:66, SEQ ID NO:74, a fragment thereof, or a
variant thereof and may have a k.sub.off (or k.sub.d) of at least
1.0.times.10.sup.-3 s.sup.-1, of at least 1.0.times.10.sup.-4
s.sup.-1, of at least 1.0.times.10.sup.-5 s.sup.-1, of at least
1.0.times.10.sup.-6 s.sup.-1 or has a k.sub.off (or k.sub.d)
ranging from 1.0.times.10.sup.-3 s.sup.-1 to 1.0.times.10.sup.-6
s.sup.-1, from 1.0.times.10.sup.-3 s.sup.-1 to 1.0.times.10.sup.-5
s.sup.-1 or from 1.0.times.10.sup.-3 s.sup.-1 to
1.0.times.10.sup.-4 s.sup.-1. The fragment may be SEQ ID NO:66 or
SEQ ID NO:74.
[0175] The antibody may immunospecifically bind to RGMa (SEQ ID
NO:65), SEQ ID NO:66, SEQ ID NO:74, a fragment thereof, or a
variant thereof and has a k.sub.on (or k.sub.a) of at least
2.4.times.10.sup.4 M.sup.-1s.sup.-1, of at least about
2.5.times.10.sup.4M.sup.-1s.sup.-1, of at least about
3.3.times.10.sup.4M.sup.-1s.sup.-1, of at least about
5.0.times.10.sup.4 M.sup.-1s.sup.-1, of at least about
1.25.times.10.sup.6M.sup.-1s.sup.-1 of at least about
1.35.times.10.sup.6M.sup.-1s.sup.-1, of at least about
1.0.times.10.sup.6 M.sup.-1s.sup.-1, of at least about
1.0.times.10.sup.7M.sup.-1s.sup.-1, or has a k.sub.on (or k.sub.a)
ranging from about 5.0.times.10.sup.4M.sup.-1s.sup.-1 to about
1.0.times.10.sup.8M.sup.-1s.sup.-1, from about
3.3.times.10.sup.4M.sup.-1s.sup.-1 to about
1.0.times.10.sup.9M.sup.-1s.sup.-1, from about 2.5.times.10.sup.4
M.sup.-1s.sup.-1 to about 1.25.times.10.sup.6M.sup.-1s.sup.-1, from
about 2.4.times.10.sup.4M.sup.-1s.sup.-1 to about
1.35.times.10.sup.7M.sup.-1s.sup.-1. The fragment may be SEQ ID
NO:66 or SEQ ID NO:74.
[0176] (2) Antibody Structure
[0177] (a) Heavy Chain and Light Chain CDRs
[0178] The antibody may immunospecifically bind to RGMa (SEQ ID
NO:65), SEQ ID NO:66, SEQ ID NO:74, a fragment thereof, or a
variant thereof and comprise a variable heavy chain and/or variable
light chain shown in Table 1. The antibody may immunospecifically
bind to RGMa, a fragment thereof, or a variant thereof and comprise
one or more of the heavy chain or light chain CDR sequences also
shown in Table 1. The light chain of the antibody may be a kappa
chain or a lambda chain. For example, see Table 1.
[0179] Provided herein is an isolated nucleic acid encoding an
antibody that immunospecifically binds to RGMa, a fragment thereof,
or a variant thereof. The isolated nucleic acid may comprise a
nucleotide sequence that hybridizes, under stringent conditions, to
the nucleic acid molecule that encodes an antibody comprising the
heavy chain or light chain CDR sequences shown in Table 1.
TABLE-US-00004 TABLE 1 List of Amino Acid Sequences of VH and VL
Regions of Fully Human Anti-RGMa Monoclonal Antibodies (AE12-1 to
AE12-8, AE12-13, AE12-15, AE12-20, AE12-21, AE12-23, and AE12-24)
SEQ ID PROTEIN REGION NO. SEQUENCE AE12-1 (VH) 1
EVQLVQSGAEVKKPGASVKVSCKAS GYTFTSHGISWVRQAPGQGLDWMG
WISPYSGNTNYAQKLQGRVTMTTD TSTSTAYMELSSLRSEDTAVYYCAR
VGSGPYYYMDVWGQGTLVTVSS AE12-1 (VH) CDR-H1 2 SHGIS AE12-1 (VH)
CDR-H2 3 WISPYSGNTNYAQKLQG AE12-1 (VH) CDR-H3 4 VGSGPYYYMDV AE12-1
(VL) (Lambda chain) 5 QSALTQPRSVSGSPGQSVTISCTG
TSSSVGDSIYVSWYQQHPGKAPK LMLYDVTKRPSGVPDRFSGSKSG
NTASLTISGLQAEDEADYYCCSY AGTDTLFGGGTKVTVL AE12-1 (VL) CDR-L1 6
TGTSSSVGDSIYVS AE12-1 (VL) CDR-L2 7 DVTKRPS AE12-1 (VL) CDR-L3 8
CSYAGTDTL AE12-2 (VH) 9 EVQLVQSGAEVKKPGASVKVSC
KASGYTFTSYDINWVRQATGQG LEWMGWMNPNSGNTGYAQKFQ
GRVTMTRNTSISTAYMELSSLRSE DTAVYYCARSTSLSVWGQGTLVT VSS AE12-2 (VH)
CDR-H1 10 SYDIN AE12-2 (VH) CDR-H2 11 WMNPNSGNTGYAQKFQG AE12-2 (VH)
CDR-H3 12 STSLSV AE12-2 (VL) (Lambda chain) 13
SYELTQPPSVSVSPGQTASITCSGD KLGDKYACWYQQKPGQSPVLVIY
QDSKRPSGIPKRFSGSNSGDTATLT ISGTQAMDEADYYCQAWDSSTGV FGPGTKVTVL AE12-2
(VL) CDR-L1 14 SGDKLGDKYAC AE12-2 (VL) CDR-L2 15 QDSKRPS AE12-2
(VL) CDR-L3 16 QAWDSSTGV AE12-3 (VH) 17 EVQLVESGGGLVQPGRSLRLSCA
ASGFTFDDYAMHWVRQAPGKGL EWVAVISYDGSNKYYADSVKGR
FTISRDNSKNTLYLQMNSLRAED TAVYYCARERVYSSGKEGYYYG MDVWGQGTMVTVSS
AE12-3 (VH) CDR-H1 18 DYAMH AE12-3 (VH) CDR-H2 19 VISYDGSNKYYADSVKG
AE12-3 (VH) CDR-H3 20 ERVYSSGKEGYYYGMDV AE12-3 (VL) (Lambda chain)
21 QSGLTQPPSVSAAPGQRVTISCTG SGSNIGAGYGVHWYQQLPATAPK
ILIYGDYNRPSGVPDRFSGSRSGTS ASLTITGLQAEDEADYYCQSYDNS LRGVLFGGGTKLTVL
AE12-3 (VL) CDR-L1 22 TGSGSNIGAGYGVH AE12-3 (VL) CDR-L2 23 GDYNRPS
AE12-3 (VL) CDR-L3 24 QSYDNSLRGVL AE12-4 (VH) 25 EVQLVESGGGVVQPGTSL
RLSCAASGFPFSSYGMHW VRQAPGKGLEWVAAISG DGILKYYTDSVKGRFTISRD
NSKNTLYLQMNNLSGEDTG LYYCARNYDNSLDYWGQGTL VTVSS AE12-4 (VH) CDR-H1
26 SYGMH AE12-4 (VH) CDR-H2 27 AISGDGILKYYTDSVKG AE12-4 (VH) CDR-H3
28 NYDNSLDY AE12-4 (VL) (Lambda chain) 29 QPVLTQSPSVSASLGASVKV
TCTLSSGHSAYAIAWHQQQP EKGPRYLMKVNSDGSHNK GDGVPDRFSGSSSGAERYL
IISGLQSEDEADYYCQTWG PGIRVFGGGTKLTVL AE12-4 (VL) CDR-L1 30
TLSSGHSAYAIA AE12-4 (VL) CDR-L2 31 VNSDGSHNKGD AE12-4 (VL) CDR-L3
32 QTWGPGIRV AE12-5 (VH) 33 EVQLVQSGAEVKKPGASVKVSCK
VSGHSLSELTIHWVRQAPGKGLEW MGGFDPEDGRGTYAPNFRGRVTM
TEDTSTDTAYMELSGLRSEDAAVY YCATLLGEYDSYFDLWGRGTLVTV SS AE12-5 (VH)
CDR-H1 34 ELTIH AE12-5 (VH) CDR-H2 35 GFDPEDGRGTYAPNFRG AE12-5 (VH)
CDR-H3 36 LLGEYDSYFDL AE12-5 (VL) (Kappa chain) 37
DVVMTQSPDFQSVTPEDKVTITCR ASQSIGSCLHWYQQKPDQSPKLLI
KYASQSISGVPSRFSGSGSGTDFTL TINSLEAEDAATYYCHQSSSLPYT FGQGTKLEIK
AE12-5 (VL) CDR-L1 38 RASQSIGSCLH AE12-5 (VL) CDR-L2 39 YASQSIS
AE12-5 (VL) CDR-L3 40 HQSSSLPYT AE12-6 (VH) 41
EVQLVQSGAEVKKPGASVKVSCKASG YIFTNYDIAWVRQAPGQGLEWMGWM
NPDSGNTGFVQKFKGRVTATSNTDITT AYMELSSLTSEDTAVYYCARDRFGSGY
DLDHWGQGTLVTVSS AE12-6 (VH) CDR-H1 42 NYDIA AE12-6 (VH) CDR-H2 43
WMNPDSGNTGFVQKFKG AE12-6 (VH) CDR-H3 44 DRFGSGYDLDH AE12-6 (VL)
(Lambda chain) 45 SYELTQPPSVSVAPGQTARITCGGNNIGS
KSVHWYQQKPGQAPVLVVYDDSDRPSG IPERFSGSNSGNTATLTISRVEAGDEADY
YCQVWGSSSDHYVFGTGTKVTVL AE12-6 (VL) CDR-L1 46 GGNNIGSKSVH AE12-6
(VL) CDR-L2 47 DDSDRPS AE12-6 (VL) CDR-L3 48 QVWGSSSDHYV AE12-7
(VH) 49 EVQLVESGGGLVQPGGSLRLSCAASGF TSSSYAMTWVRQAPGKGLEWVSGISGS
GESTYYADSVKGRFTISRDNSKNTLYLQ MNSLRVEDTAIYYCARQGYGAHDYWG QGTLVTVSS
AE12-7 (VH) CDR-H1 50 SYAMT AE12-7 (VH) CDR-H2 51 GISGSGESTYYADSVKG
AE12-7 (VH) CDR-H3 52 QGYGAHDY AE12-7 (VL) (Lambda chain) 53
QSVLTQPPSASGTPGQRVTISCSGASSNVG SNRVNWYQQFPGMAPKLLIYSNNQRPSGV
PDRFSGSKSGTSASLAISGLQSEDEADYYCA AWDDSLNGYVFGTGTKVTVL AE12-7 (VL)
CDR-L1 54 SGASSNVGSNRVN AE12-7 (VL) CDR-L2 55 SNNQRPS AE12-7 (VL)
CDR-L3 56 AAWDDSLNGYV AE12-8 (VH) 57 EVQLLESGGGLVKPGGSLRLSCAASGFTFD
DYAMHWVRQAPGKGLEWVSLISWDGG STYYADSVKGRFTISRDNSKNSLYLQMN
SLRAEDTALYYCAKDIPKVGGYSYGYG ALGYWGQGTPVTVSS AE12-8 (VH) CDR-H1 58
DYAMH AE12-8 (VH) CDR-H2 59 LISWDGGSTYYADSVKG AE12-8 (VH) CDR-H3 60
DIPKVGGYSYGYGALGY AE12-8 (VL) (Lambda chain) 61
SYELTQPPSVSVAPGQTARITCGGNNIGD ISVHWYQQKSGQAPMLVVHDDSDRPSG
IPERFSGSNSGSSATLTISRVEAGDEAD YHCQVWDSGSGHHVFGTGTKVTVL AE12-8 (VL)
CDR-L1 62 GGNNIGDISVH AE12-8 (VL) CDR-L2 63 DDSDRPS AE12-8 (VL)
CDR-L3 64 QVWDSGSGHHV AE12-13 (VH) 91 EVQLQESGAGLLKPSETLSLTCAVYGG
SFSGYYWSWIRQPPGKGLEWIGEINHS GSTNYNPSLKSRVTISVDTSKNQFSLKL
SSVTAADTAVYYCARDDGAGVFDLW GRGTLVTVSS AE12-13 (VH) CDR-H1 92 GYYWS
AE12-13 (VH) CDR-H2 93 EINHSGSTNYNPSLKS AE12-13 (VH) CDR-H3 94
DDGAGVFDL AE12-13 (VL) (Kappa chain) 95 DIQLTQSPSSLSASVGDGVTITCQASQ
DISNYLNWYQQKPGKAPKLLIYDASN LETGVPSRFSGSGSGTFFTLTINNLQPE
DFATYYCQQSGNTPWTFGQGTKVEINR AE12-13 (VL) CDR-L1 96 QASQDISNYLN
AE12-13 (VL) CDR-L2 97 DASNLET AE12-13 (VL) CDR-L3 98 QQSGNTPWT
AE12-15 (VH) 99 EVQLVQSGAEVKEPGASVKVSCKA SGYTFTDYYIQWVRQAPGHGLEWM
GWINPKTGGTNYLQKFQGRVTMTR DTSTRTAYMELSSLRSDDTAFYYCV
REDMNTVLATSWFDPWGQGTLVTVSS AE12-15 (VH) CDR-H1 100 DYYIQ AE12-15
(VH) CDR-H2 101 WINPKTGGTNYLQKFQG AE12-15 (VH) CDR-H3 102
EDMNTVLATSWFDP AE12-15 (VL) (Lambda 103 SYELTQPPSVSVSPGQTARITCSGNQ
chain) LGHKFASWYQQKPGQSPVVVIYED KKRPSGIPERFSGSNSGNTATLTISG
TQAMDEADYYCQVWDVITDHYVF GTGTKVTVLG AE12-15 (VL) CDR-L1 104
SGNQLGHKFAS AE12-15 (VL) CDR-L2 105 EDKKRPS AE12-15 (VL) CDR-L3 106
QVWDVITDHYV
AE12-20 (VH) 107 EVQLVQSGSEVKKPGASVKLSCKT SGYTFTNSAIHWVRQAPGQRLEWM
GWINAGNGNTKYSQKFQGRVTITR DTSASTAYMELSSLRSEDTAVYYCA
WAYCGGDCYSLDYWGQGTLVTVSS AE12-20 (VH) CDR-H1 108 NSAIH AE12-20 (VH)
CDR-H2 109 WINAGNGNTKYSQKFQG AE12-20 (VH) CDR-H3 110 AYCGGDCYSLDY
AE12-20 (VL) (Kappa chain) 111 DIQVTQSPSSLAASVGDRVTITCQAS
QDISNYLNWYQQRPGKAPKLLIYDA SNLETGVPPRFSGDGSGTHFSFTITNV
QPEDVGTYYCQQYDSLPLTFGQGTR LEIKR AE12-20 (VL) CDR-L1 112 QASQDISNYLN
AE12-20 (VL) CDR-L2 113 DASNLET AE12-20 (VL) CDR-L3 114 QQYDSLPLT
AE12-21 (VH) 115 EVQLLESGGDLVRPGGSLRLTCEGSG
FNFFTQTIHWVRQAPGKGLEWVASIS SDSNYIYHADSLKGRFTVSRDNAQDS
VFLQMNSLRVEDTAVYYCARDILLEP LAPHYYYGLDVWGQGTTVTVSS AE12-21 (VH)
CDR-H1 116 TQTIH AE12-21 (VH) CDR-H2 117 SISSDSNYIYHADSLKG AE12-21
(VH) CDR-H3 118 DILLEPLAPHYYYGLDV AE12-21 (VL) (Kappa chain) 119
DIQVTQSPSSLSASVGDRVTITCRAS QPISTYVNWYQQKPGKAPKLLIYDA
STLEIGVPSRISGSGSGTDFTFTISSLQ PEDIATYYCQQYDNFPLTFGGGTKV DIKR AE12-21
(VL) CDR-L1 120 RASQPISTYVN AE12-21 (VL) CDR-L2 121 DASTLEI AE12-21
(VL) CDR-L3 122 QQYDNFPLT AE12-23 (VH) 123
EVQLQESGPGLVKPSETLSLTCTVSG GSISGYYWSWIRQSPGKGLEWIGEIFH
TGRTYYNPSLRSRLTISVDTSKNQFSL KLSSLTAADTAVYYCARDSAFGSFD YWGQGTLVTVSS
AE12-23 (VH) CDR-H1 124 GYYWS AE12-23 (VH) CDR-H2 125
EIFHTGRTYYNPSLRS AE12-23 (VH) CDR-H3 126 DSAFGSFDY AE12-23 (VL)
(Kappa chain) 127 DIRVTQSPSSLSASVGDRVTITCQAN
EDISIYLNWYQQRPGKAPKWYDA SNLETGVPSRFSGSGSGTDFTFTISS
LQPEDFATYYCQQYHTYPFTFGGGT KVDIKR AE12-23 (VL) CDR-L1 128
QANEDISIYLN AE12-23 (VL) CDR-L2 129 DASNLET AE12-23 (VL) CDR-L3 130
QQYHTYPFT AE12-24 (VH) 131 EVQLQESGPGLVKPSETLSLTCNVSG
GSISSYYWSWIRQPPGKGLEWIGNIYY SGSTNYNPSLKSRVTISVDTSKSQFSLK
LSSVTAADTAVYYCARALDFWSGQY FDYWGQGTLVTVSS AE12-24 (VH) CDR-H1 132
SYYWS AE12-24 (VH) CDR-H2 133 NIYYSGSTNYNPSLKS AE12-24 (VH) CDR-H3
134 ALDFWSGQYFDY AE12-24 (VL) (Kappa chain) 135
DIVMTQTPSSLSASVGDRVTITCQASQD ISDYLNWYQQKPGKAPKLLIYDASTLE
SGVPSRFSGSGSGTDFTLTISGLQPEDF ATYYCQQSYSIPPTFGPGTRLEIKR AE12-24 (VL)
CDR-L1 136 QASQDISDYLN AE12-24 (VL) CDR-L2 137 DASTLES AE12-24 (VL)
CDR-L3 138 QQSYSIPPT
[0180] The antibody or variant or derivative thereof may contain
one or more amino acid sequences that are greater than 95%, 90%,
85%, 80%, 75%, 70%, 65%, 60%, 55%, or 50% identical to one or more
of SEQ ID NOs:1-64 and 67-73. The antibody or variant or derivative
thereof may be encoded by one or more nucleic acid sequences that
are greater than 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, or
50% identical to one or more of SEQ ID NOs:1-64 and 67-73.
Polypeptide identity and homology can be determined, for example,
by the algorithm described in the report: Wilbur, W. J. and Lipman,
D. J. Proc. Natl. Acad. Sci. USA 80, 726-730 (1983). The herein
described antibody, variant or derivative thereof may be encoded by
a nucleic acid that hybridizes under stringent conditions with the
complement of one or more of SEQ ID NOs:3-42. The herein described
antibody, variant or derivative thereof may be encoded by a nucleic
acid that hybridizes under highly stringent conditions with the
complement of one or more nucleic acids that encode one or more of
SEQ ID NOs:1-64 and 67-73.
[0181] The antibody may comprise SEQ ID NO:8, wherein the Cys
residue of SEQ ID NO:8 is substituted for another amino acid. The
antibody may comprise SEQ ID NOs:1 and 5, or 2-4 and 6-8, wherein
the Cys residue of SEQ ID NO:8 is substituted for another amino
acid, or wherein the Cys residue at position 91 of SEQ ID NO:5 is
substituted with another amino acid. The Cys residue at position 91
of SEQ ID NO:5 may be substituted with a phenylalanine, a
histidine, a leucine, a valine, an isoleucine, a lysine, or a
tyrosine, for example. The Cys residue of SEQ ID NO:8 may be
substituted with a phenylalanine (see SEQ ID NO:67), a histidine
(see SEQ ID NO:68), a leucine (see SEQ ID NO:69), a valine (see SEQ
ID NO:70), an isoleucine (see SEQ ID NO:71), a lysine (see SEQ ID
NO:72), or a tyrosine (see SEQ ID NO:73), for example. See Table
2.
[0182] The antibody may be an IgG, IgE, IgM, IgD, IgA and IgY
molecule class (for example, IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2)
or subclass. For example, the antibody may be an IgG1 molecule
having the following constant region sequence:
TABLE-US-00005 (SEQ ID NO: 140)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH
TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
CDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED
PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK.
[0183] The above constant region in SEQ ID NO:140 contains two (2)
mutations of the wildtype constant region sequence at positions 234
and 235. Specifically, these mutations are leucine to alanine
changes at each of positions 234 and 235 (which are referred to as
the "LLAA" mutations). These mutations are shown above in bold and
underlining. The purpose of these mutations is to eliminate the
effector function.
[0184] Alternatively, an IgG1 molecule can have the above constant
region sequence (SEQ ID NO:140) containing one or more mutations.
For example, the constant region sequence of SEQ ID NO:140 may
containing a mutation at amino acid 250 where threonine is replaced
with glutamine (SEQ ID NO:141), a mutation at amino acid 428 where
methionine is replaced with leucine (SEQ ID NO:142) or mutations at
amino acid 250 where threonine is replaced with glutamine and a
mutation at amino acid 428 where methionine is replaced with
leucine (SEQ ID NO:143) as shown below in Table 2A.
[0185] Alternatively, an IgG1 molecule can contain a heavy chain
comprising: AE12-1 (VH) CDR-H1 (SEQ ID NO:2), AE12-1 (VH) CDR-H2
(SEQ ID NO:3), AE12-1 (VH) CDR-H3 (SEQ ID NO:4) and a light chain
comprising: AE12-1 (VL) CDR-L1 (SEQ ID NO:6), AE12-1 (VL) CDR-L2
(SEQ ID NO:7) and AE12-1-V (VL) CDR-L3 (SEQ ID NO:70) and a
constant sequence of SEQ ID NO:143 as shown below in Table 2B (this
antibody is referred to as AE12-1V-QL and has a light chain
sequence of SEQ ID NO:144 and a heavy chain sequence of SEQ ID NO:
145).
[0186] Alternatively, an IgG1 molecule can contain a heavy chain
comprising: AE12-1 (VH) CDR-H1 (SEQ ID NO:2), AE12-1 (VH) CDR-H2
(SEQ ID NO:3), AE12-1 (VH) CDR-H3 (SEQ ID NO:4) and a light chain
comprising: AE12-1 (VL) CDR-L1 (SEQ ID NO:6), AE12-1 (VL) CDR-L2
(SEQ ID NO:7) and AE12-1-Y (VL) CDR-L3 (SEQ ID NO:73) and a
constant sequence of SEQ ID NO:143 as shown below in Table 2B (this
antibody is referred to as AE12-1Y-QL and has a light chain
sequence of SEQ ID NO:146 and a heavy chain sequence of SEQ ID NO:
147).
TABLE-US-00006 TABLE 2 PROTEIN REGION SEQ ID NO. SEQUENCE AE12-1-F
(VL) CDR-L3 67 FSYAGTDTL AE12-1-H (VL) CDR-L3 68 HSYAGTDTL AE12-1-L
(VL) CDR-L3 69 LSYAGTDTL AE12-1-V (VL) CDR-L3 70 VSYAGTDTL AE12-1-I
(VL) CDR-L3 71 ISYAGTDTL AE12-1-K (VL) CDR-L3 72 KSYAGTDTL AE12-1-Y
(VL) CDR-L3 73 YSYAGTDTL
TABLE-US-00007 TABLE 2A Amino acid SEQ ID Mutation NO: SEQUENCE
None 140 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK T250Q 141
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFP
PKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK M428L 142
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK T250Q and 143
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN M428L
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFP
PKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL VKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
TABLE-US-00008 TABLE 2B SEQ PROTEIN ID REGION NO: SEQUENCE AE12-1V-
144 QSALTQPRSVSGSPGQSVTISCTGTSSSVGDSIYVSWYQQHPGKAPK QL Light
LMLYDVTKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCVSYA chain
GTDTLFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDF (CDR's
YPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKS underlined
HRSYSCQVTHEGSTVEKTVAPTECS* and mutations bolded) AE12-1V- 145
EVQLVQSGAEVKKPGASVKVSCKASGYTFTSHGISWVRQAPGQGLDW QL Heavy
MGWISPYSGNTNYAQKLQGRVTMTTDTSTSTAYMELSSLRSEDTAVY chain
YCARVGSGPYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGG (CDR's
TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV underlined
TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEA and
AGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV mutations
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA bolded)
PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA
VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VLHEALHNHYTQKSLSLSPGK* AE12-1Y- 146
QSALTQPRSVSGSPGQSVTISCTGTSSSVGDSIYVSWYQQHPGKAP QL Light
KLMLYDVTKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCYS chain
YAGTDTLFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLI (CDR's
SDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPE underlined
QWKSHRSYSCQVTHEGSTVEKTVAPTECS* and mutations bolded) AE12-1Y- 147
EVQLVQSGAEVKKPGASVKVSCKASGYTFTSHGISWVRQAPGQGLDWM QL Heavy
GWISPYSGNTNYAQKLQGRVTMTTDTSTSTAYMELSSLRSEDTAVYYC chain
ARVGSGPYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL (CDR's
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS underlined
SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVF and
LFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP mutations
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG bolded)
QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSL SLSPGK*
[0187] The antibody or antibody fragment may comprise a variable
heavy domain that comprises three complementarity-determining
regions (CDR-H1, H2, and H3) corresponding to the following
formulas, respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5 (Formula 1-CDR-H1), wherein Xaa1 is an
amino acid selected from the group consisting of S, D, E, N, G, and
T; Xaa2 is an amino acid selected from the group consisting of H,
Y, L, S, and Q; Xaa3 is an amino acid selected from the group
consisting of G, D, A, T, and Y; Xaa4 is an amino acid selected
from the group consisting of I, M, and W; and Xaa5 is an amino acid
sequence from the group consisting of S, N, H, A, T, and Q;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa1-
4-Xaa15-Xaa16-(Xaa)n (Formula 2-CDR-H2), wherein n is 0 or 1, and
wherein Xaa1 is an amino acid selected from the group consisting of
W, V, A, G, L, E, S, and N; Xaa2 is an amino acid selected from the
group consisting of I, M, and F; Xaa3 is an amino acid selected
from the group consisting of S, N, D, F, and Y; Xaa4 is an amino
acid selected from the group consisting of P, Y, G, W, H, A, and S;
Xaa5 is an amino acid selected from the group consisting of Y, N,
D, E, S, K, G, and T; Xaa6 is an amino acid selected from the group
consisting of S, G, D, T, and N; Xaa7 is an amino acid selected
from the group consisting of G, S, I, E, N, and R; Xaa8 is an amino
acid selected from the group consisting of N, L, R, S, T, and Y;
Xaa9 is an amino acid selected from the group consisting of T, K,
G, N, I, and Y; Xaa10 is an amino acid selected from the group
consisting of N, G, Y, T, and K; Xaa11 is an amino acid selected
from the group consisting of Y, F, N, and H; Xaa12 is an amino acid
selected from the group consisting of A, T, V, P, L, and S; Xaa13
is an amino acid selected from the group consisting of Q, D, P, and
S; Xaa14 is an amino acid selected from the group consisting of K,
S, N, and L; Xaa15 is an amino acid selected from the group
consisting of L, F, V, K, and R; Xaa16 is an amino acid selected
from the group consisting of Q, K, R, and S; and Xaa17 is a
glycine; and Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-(Xaa)n (Formula
3-CDR-H3), wherein n is 0-11, and wherein Xaa1 is an amino acid
selected from the group consisting of V, S, E, N, L, D, Q, and A;
Xaa2 is an amino acid selected from the group consisting of G, T,
R, Y, L, I, D, and S; Xaa3 is an amino acid selected from the group
consisting of S, V, D, G, F, Y, P, M, C, L, and A; Xaa4 is an amino
acid selected from the group consisting of G, L, Y, N, E, K, A, and
F; Xaa5 is an amino acid selected from the group consisting of P,
S, Y, A, V, G, T, E, and W; Xaa6 is an amino acid selected from the
group consisting of Y, V, S, L, D, G, H, and P; Xaa7 is an amino
acid selected from the group consisting of Tyr, Asp, Gly, Ser, Phe,
Leu, and Cys; Xaa8 is an amino acid selected from the group
consisting of Tyr, Lys, Asp, Ala, and Gln; Xaa9 is an amino acid
selected from the group consisting of Met, Glu, Phe, Leu, Ser, Thr,
Pro, and Tyr; Xaa10 is an amino acid selected from the group
consisting of Asp, Gly, Tyr, Ser, Leu, His, and Phe; Xaa11 is an
amino acid selected from the group consisting of Val, Tyr, Leu,
His, Gly, Trp, and Asp; Xaa12 is an amino acid selected from the
group consisting of Tyr and Phe; Xaa13 is an amino acid selected
from the group consisting of Tyr, Gly, and Asp; Xaa14 is an amino
acid selected from the group consisting of Ala, Leu, Pro, and Tyr;
Xaa15 is an amino acid selected from the group consisting of Met,
Leu, and Phe; Xaa16 is an amino acid selected from the group
consisting of Asp and Gly; and Xaa17 is an amino acid selected from
the group consisting of an Val, Asp, and Tyr.
[0188] The isolated antibody or antibody fragment thereof may
comprise a variable light domain that comprises three
complementarity-determining regions (CDR-L1, L2, and L3)
corresponding to the following formulas, respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-(Xaa)n
(Formula 1-CDR-L1), wherein n is 0-3, and wherein Xaa1 is an amino
acid selected from the group consisting of T, S, R, G, and Q; Xaa2
is an amino acid selected from the group consisting of G, L, and A;
Xaa3 is an amino acid selected from the group consisting of T, D,
S, N and A; Xaa4 is an amino acid selected from the group
consisting of S, K, G, Q, N, and E; Xaa5 is an amino acid sequence
from the group consisting of S, L, G, I, D, and P; Xaa6 is an amino
acid selected from the group consisting of S, G, N, H, and I; Xaa7
is an amino acid selected from the group consisting of V, D, I, S,
G and H; Xaa8 is an amino acid selected from the group consisting
of G, K, A, S, I, N, T, and D; Xaa9 is an amino acid selected from
the group consisting of D, Y, A, C, S, and F; Xaa10 is an amino
acid selected from the group consisting of S, A, G, L, V, and N;
Xaa11 is an amino acid selected from the group consisting of I, C,
Y, H, R, N, and S; Xaa12 is an amino acid selected from the group
consisting of Tyr, Gly, Ala, and Val; Xaa13 is an amino acid
selected from the group consisting of Val, and Asn; and Xaa14 is an
amino acid selected from the group consisting of Ser and His;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-(Xaa)n (Formula 2-CDR-L2),
wherein n is 0-4, and wherein Xaa1 is an amino acid selected from
the group consisting of D, Q, G, V, Y, S and E; Xaa2 is an amino
acid selected from the group consisting of V, D, N, and A; Xaa3 is
an amino acid selected from the group consisting of T, S, Y, N, and
K; Xaa4 is an amino acid selected from the group consisting of K,
N, D, Q and T; Xaa5 is an amino acid selected from the group
consisting of R, G, S, and L; Xaa6 is an amino acid selected from
the group consisting of P, S, I, and E; Xaa7 is an amino acid
selected from the group consisting of S, H, I, and T; Xaa8 is Asn;
Xaa9 is Lys; and Xaa10 is Gly; Xaa11 is Asp; and
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-(Xaa)n (Formula
3-CDR-L3), wherein n is 0-2, and wherein Xaa1 is an amino acid
selected from the group consisting of C, Q, H, F, H, L, V, I, K, Y,
and A; Xaa2 is an amino acid selected from the group consisting of
S, A, T, Q, and V; Xaa3 is an amino acid selected from the group
consisting of Y, W, and S; Xaa4 is an amino acid selected from the
group consisting of A, D, G, S, H and Y; Xaa5 is an amino acid
selected from the group consisting of G, S, N, P, D, V, and T; Xaa6
is an amino acid selected from the group consisting of I, T, S, G,
L, F and Y; Xaa7 is an amino acid selected from the group
consisting of D, T, L, I, P, and S; Xaa8 is an amino acid selected
from the group consisting of T, G, R, Y, D, N, W, L, F and P; Xaa9
is an amino acid selected from the group consisting of L, V, G, T,
and H; Xaa10 is an amino acid selected from the group consisting of
Val, Tyr, and His; Xaa11 is Leu or Val.
[0189] The antibody or antibody fragment comprises a variable heavy
domain that comprises three complementarity-determining regions
(CDR-H1, H2, and H3) corresponding to the following formulas,
respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5 (Formula 1-CDR-H1), wherein Xaa1 is an
amino acid selected from the group consisting of S, D, E, N, G, and
T; Xaa2 is an amino acid selected from the group consisting of H,
Y, L, S, and Q; Xaa3 is an amino acid selected from the group
consisting of G, D, A, T, and Y; Xaa4 is an amino acid selected
from the group consisting of I, M, and W; and Xaa5 is an amino acid
sequence from the group consisting of S, N, H, A, T, and Q;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa1-
4-Xaa15-Xaa16-(Xaa)n (Formula 2-CDR-H2), wherein n is 0 or 1, and
wherein Xaa1 is an amino acid selected from the group consisting of
Y, V, A, G, L, G, S, and N; Xaa2 is an amino acid selected from the
group consisting of I, M, and F; Xaa3 is an amino acid selected
from the group consisting of S, N, D, F, and Y; Xaa4 is an amino
acid selected from the group consisting of P, Y, G, W, H, A, and S;
Xaa5 is an amino acid selected from the group consisting of Y, N,
D, E, S, K, G, and T; Xaa6 is an amino acid selected from the group
consisting of S, G, D, T, and N; Xaa7 is an amino acid selected
from the group consisting of G, S, I, E, N, and R; Xaa8 is an amino
acid selected from the group consisting of N, L, R, S, T, and Y;
Xaa9 is an amino acid selected from the group consisting of T, K,
G, N, I, and Y; Xaa10 is an amino acid selected from the group
consisting of N, G, Y, T, and K; Xaa11 is an amino acid selected
from the group consisting of Y, F, N, and H; Xaa12 is an amino acid
selected from the group consisting of A, T, V, P, L, and S; Xaa13
is an amino acid selected from the group consisting of Q, D, P, and
S; Xaa14 is an amino acid selected from the group consisting of K,
S, N, and L; Xaa15 is an amino acid selected from the group
consisting of L, F, V, K, and R; Xaa16 is an amino acid selected
from the group consisting of Q, K, R, and S; and Xaa17 is a
glycine; and Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-(Xaa)n (Formula
3-CDR-H3), wherein n is 0-11, and wherein Xaa1 is an amino acid
selected from the group consisting of V, S, E, N, L, D, Q, and A;
Xaa2 is an amino acid selected from the group consisting of G, T,
R, Y, L, I, D, and S; Xaa3 is an amino acid selected from the group
consisting of S, V, D, G, F, Y, P, M, C, L, and A; Xaa4 is an amino
acid selected from the group consisting of G, L, Y, N, E, K, A, and
F; Xaa5 is an amino acid selected from the group consisting of P,
S, Y, A, V, G, T, E, and W; Xaa6 is an amino acid selected from the
group consisting of Y, V, S, L, D, G, H, and P; Xaa7 is an amino
acid selected from the group consisting of Tyr, Asp, Gly, Ser, Phe,
Leu, and Cys; Xaa8 is an amino acid selected from the group
consisting of Tyr, Lys, Asp, Ala, and Gln; Xaa9 is an amino acid
selected from the group consisting of Met, Glu, Phe, Leu, Ser, Thr,
Pro, and Tyr; Xaa10 is an amino acid selected from the group
consisting of Asp, Gly, Tyr, Ser, Leu, His, and Phe; Xaa11 is an
amino acid selected from the group consisting of Val, Tyr, Leu,
His, Gly, Trp, and Asp; Xaa12 is an amino acid selected from the
group consisting of Tyr and Phe; Xaa13 is an amino acid selected
from the group consisting of Tyr, Gly, and Asp; Xaa14 is an amino
acid selected from the group consisting of Ala, Leu, Pro, and Tyr;
Xaa15 is an amino acid selected from the group consisting of Met,
Leu, and Phe; Xaa16 is an amino acid selected from the group
consisting of Asp and Gly; and Xaa17 is an amino acid selected from
the group consisting of an Val, Asp, and Tyr; and wherein the
antibody or antibody fragment also comprises a variable light
domain that comprises three complementarity-determining regions
(CDR-L1, L2, and L3) corresponding to the following formulas,
respectively:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-(Xaa)n
(Formula 1-CDR-L1), wherein n is 0-3, and wherein Xaa1 is an amino
acid selected from the group consisting of T, S, R, G, and Q; Xaa2
is an amino acid selected from the group consisting of G, L, and A;
Xaa3 is an amino acid selected from the group consisting of T, D,
S, N and A; Xaa4 is an amino acid selected from the group
consisting of S, K, G, Q, N, and E; Xaa5 is an amino acid sequence
from the group consisting of S, L, G, I, D, and P; Xaa6 is an amino
acid selected from the group consisting of S, G, N, H, and I; Xaa7
is an amino acid selected from the group consisting of V, D, I, S,
G and H; Xaa8 is an amino acid selected from the group consisting
of G, K, A, S, I, N, T, and D; Xaa9 is an amino acid selected from
the group consisting of D, Y, A, C, S, and F; Xaa10 is an amino
acid selected from the group consisting of S, A, G, L, V, and N;
Xaa11 is an amino acid selected from the group consisting of I, C,
Y, H, R, N, and S; Xaa12 is an amino acid selected from the group
consisting of Tyr, Gly, Ala, and Val; Xaa13 is an amino acid
selected from the group consisting of Val, and Asn; and Xaa14 is an
amino acid selected from the group consisting of Ser and His;
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-(Xaa)n (Formula 2-CDR-L2),
wherein n is 0-4, and wherein Xaa1 is an amino acid selected from
the group consisting of D, Q, G, V, Y, S and E; Xaa2 is an amino
acid selected from the group consisting of V, D, N, and A; Xaa3 is
an amino acid selected from the group consisting of T, S, Y, N, and
K; Xaa4 is an amino acid selected from the group consisting of K,
N, D, Q and T; Xaa5 is an amino acid selected from the group
consisting of R, G, S, and L; Xaa6 is an amino acid selected from
the group consisting of P, S, I, and E; Xaa7 is an amino acid
selected from the group consisting of S, H, I, and T; Xaa8 is Asn;
Xaa9 is Lys; and Xaa10 is Gly; Xaa11 is Asp; and
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-(Xaa)n (Formula
3-CDR-L3), wherein n is 0-2, and wherein Xaa1 is an amino acid
selected from the group consisting of C, Q, H, F, H, L, V, I, K, Y,
and A; Xaa2 is an amino acid selected from the group consisting of
S, A, T, Q, and V; Xaa3 is an amino acid selected from the group
consisting of Y, W, and S; Xaa4 is an amino acid selected from the
group consisting of A, D, G, S, H and Y; Xaa5 is an amino acid
selected from the group consisting of G, S, N, P, D, V, and T; Xaa6
is an amino acid selected from the group consisting of I, T, S, G,
L, F and Y; Xaa7 is an amino acid selected from the group
consisting of D, T, L, I, P, and S; Xaa8 is an amino acid selected
from the group consisting of T, G, R, Y, D, N, W, L, F and P; Xaa9
is an amino acid selected from the group consisting of L, V, G, T,
and H; Xaa10 is an amino acid selected from the group consisting of
Val, Tyr, and His; Xaa11 is Leu or Val.
[0190] In Formula 1-CDR-L1, if n is 1, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12.
[0191] In Formula 1-CDR-L1, if n is 2, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13.
[0192] In Formula 1-CDR-L1, if n is 3, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-
.
[0193] In Formula 2-CDR-L2, if n is 1, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8.
[0194] In Formula 2-CDR-L2, if n is 2, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9.
[0195] In Formula 2-CDR-L2, if n is 3, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10.
[0196] In Formula 2-CDR-L2, if n is 4, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11.
[0197] In Formula 3-CDR-L3, if n is 1, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10.
[0198] In Formula 3-CDR-L3, if n is 2, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11.
[0199] In Formula 2-CDR-H2, if n is 1, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-
-Xaa15-Xaa16-Xaa17.
[0200] In Formula 3-CDR-H3, if n is 1, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7.
[0201] In Formula 3-CDR-H3, if n is 2, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8.
[0202] In Formula 3-CDR-H3, if n is 3, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9.
[0203] In Formula 3-CDR-H3, if n is 4, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10.
[0204] In Formula 3-CDR-H3, if n is 5, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11.
[0205] In Formula 3-CDR-H3, if n is 6, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12.
[0206] In Formula 3-CDR-H3, if n is 7, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13.
[0207] In Formula 3-CDR-H3, if n is 8, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-
.
[0208] In Formula 3-CDR-H3, if n is 9, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-
-Xaa15.
[0209] In Formula 3-CDR-H3, if n is 10, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-
-Xaa15-Xaa16.
[0210] In Formula 3-CDR-H3, if n is 11, then the formula will be as
follows:
Xaa1-Xaa2-Xaa3-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaa10-Xaa11-Xaa12-Xaa13-Xaa14-
-Xaa15-Xaa16-Xaa17.
[0211] c. Antibody Preparation/Production
[0212] Antibodies may be prepared by any of a variety of
techniques. In general, antibodies can be produced by cell culture
techniques, including the generation of monoclonal antibodies via
conventional techniques, or via transfection of antibody genes,
heavy chains and/or light chains into suitable bacterial or
mammalian cell hosts, in order to allow for the production of
antibodies, wherein the antibodies may be recombinant. The various
forms of the term "transfection" are intended to encompass a wide
variety of techniques commonly used for the introduction of
exogenous DNA into a prokaryotic or eukaryotic host cell, e.g.,
electroporation, calcium-phosphate precipitation, DEAE-dextran
transfection and the like. Although it is possible to express the
antibodies of the invention in either prokaryotic or eukaryotic
host cells, expression of antibodies in eukaryotic cells is
preferable, and most preferable in mammalian host cells, because
such eukaryotic cells (and in particular mammalian cells) are more
likely than prokaryotic cells to assemble and secrete a properly
folded and immunologically active antibody.
[0213] Exemplary mammalian host cells for expressing the
recombinant antibodies of the invention include Chinese Hamster
Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub
and Chasin, Proc. Natl. Acad. Sci. USA, 77: 4216-4220 (1980)), used
with a DHFR selectable marker, e.g., as described in Kaufman and
Sharp, J. Mol. Biol., 159: 601-621 (1982), NS0 myeloma cells, COS
cells, and SP2 cells. When recombinant expression vectors encoding
antibody genes are introduced into mammalian host cells, the
antibodies are produced by culturing the host cells for a period of
time sufficient to allow for expression of the antibody in the host
cells or, more preferably, secretion of the antibody into the
culture medium in which the host cells are grown. Antibodies can be
recovered from the culture medium using standard protein
purification methods.
[0214] Host cells can also be used to produce functional antibody
fragments, such as Fab fragments or scFv molecules. It will be
understood that variations on the above procedure are within the
scope of the present invention. For example, it may be desirable to
transfect a host cell with DNA encoding functional fragments of
either the light chain and/or the heavy chain of an antibody of
this invention. Recombinant DNA technology may also be used to
remove some, or all, of the DNA encoding either or both of the
light and heavy chains that is not necessary for binding to the
antigens of interest. The molecules expressed from such truncated
DNA molecules are also encompassed by the antibodies of the
invention. In addition, bifunctional antibodies may be produced in
which one heavy and one light chain are an antibody of the
invention (i.e., binds human RGMa) and the other heavy and light
chain are specific for an antigen other than human RGMa by
crosslinking an antibody of the invention to a second antibody by
standard chemical crosslinking methods.
[0215] In a preferred system for recombinant expression of an
antibody, or antigen-binding portion thereof, of the invention, a
recombinant expression vector encoding both the antibody heavy
chain and the antibody light chain is introduced into dhfr-CHO
cells by calcium phosphate-mediated transfection. Within the
recombinant expression vector, the antibody heavy and light chain
genes are each operatively linked to CMV enhancer/AdMLP promoter
regulatory elements to drive high levels of transcription of the
genes. The recombinant expression vector also carries a DHFR gene,
which allows for selection of CHO cells that have been transfected
with the vector using methotrexate selection/amplification. The
selected transformant host cells are cultured to allow for
expression of the antibody heavy and light chains and intact
antibody is recovered from the culture medium. Standard molecular
biology techniques are used to prepare the recombinant expression
vector, transfect the host cells, select for transformants, culture
the host cells and recover the antibody from the culture medium.
Still further the invention provides a method of synthesizing a
recombinant antibody of the invention by culturing a host cell of
the invention in a suitable culture medium until a recombinant
antibody of the invention is synthesized. The method can further
comprise isolating the recombinant antibody from the culture
medium.
[0216] Methods of preparing monoclonal antibodies involve the
preparation of immortal cell lines capable of producing antibodies
having the desired specificity. Such cell lines may be produced
from spleen cells obtained from an immunized animal. The animal may
be immunized with RGMa or a fragment and/or variant thereof. For
example, any of SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:74, a
fragment of SEQ ID NO:65, SEQ ID NO:66 or SEQ ID NO:74, or a
variant of SEQ ID NO:65, SEQ ID NO:66 SEQ ID NO:74 may be used to
immunize the animal. The peptide used to immunize the animal may
comprise amino acids encoding human Fc, for example the fragment
crystallizable region or tail region of human antibody. The spleen
cells may then be immortalized by, for example, fusion with a
myeloma cell fusion partner. A variety of fusion techniques may be
employed. For example, the spleen cells and myeloma cells may be
combined with a nonionic detergent for a few minutes and then
plated at low density on a selective medium that supports that
growth of hybrid cells, but not myeloma cells. One such technique
uses hypoxanthine, aminopterin, thymidine (HAT) selection. After a
sufficient time, usually about 1 to 2 weeks, colonies of hybrids
are observed. Single colonies are selected and their culture
supernatants tested for binding activity against the polypeptide.
Hybridomas having high reactivity and specificity may be used.
[0217] Monoclonal antibodies may be isolated from the supernatants
of growing hybridoma colonies. In addition, various techniques may
be employed to enhance the yield, such as injection of the
hybridoma cell line into the peritoneal cavity of a suitable
vertebrate host, such as a mouse. Monoclonal antibodies may then be
harvested from the ascites fluid or the blood. Contaminants may be
removed from the antibodies by conventional techniques, such as
chromatography, gel filtration, precipitation, and extraction.
Affinity chromatography is an example of a method that can be used
in a process to purify the antibodies.
[0218] The proteolytic enzyme papain preferentially cleaves IgG
molecules to yield several fragments, two of which (the F(ab)
fragments) each comprise a covalent heterodimer that includes an
intact antigen-binding site. The enzyme pepsin is able to cleave
IgG molecules to provide several fragments, including the F(ab')2
fragment, which comprises both antigen-binding sites.
[0219] The Fv fragment can be produced by preferential proteolytic
cleavage of an IgM, and on rare occasions IgG or IgA immunoglobulin
molecules. The Fv fragment may be derived using recombinant
techniques. The Fv fragment includes a non-covalent VH::VL
heterodimer including an antigen-binding site which retains much of
the antigen recognition and binding capabiltites of the native
antibody molecule.
[0220] The antibody, antibody fragment, or derivative may comprise
a heavy chain and a light chain complementarity determining region
("CDR") set, respectively interposed between a heavy chain and a
light chain framework ("FR") set which provide support to the CDRs
and define the spatial relationship of the CDRs relative to each
other. The CDR set may contain three hypervariable regions of a
heavy or light chain V region. Proceeding from the N-terminus of a
heavy or light chain, these regions are denoted as "CDR1," "CDR2,"
and "CDR3," respectively. An antigen-binding site, therefore, may
include six CDRs, comprising the CDR set from each of a heavy and a
light chain V region. A polypeptide comprising a single CDR, (e.g.,
a CDR1, CDR2 or CDR3) may be referred to as a "molecular
recognition unit." Crystallographic analyses of antigen-antibody
complexes have demonstrated that the amino acid residues of CDRs
form extensive contact with bound antigen, wherein the most
extensive antigen contact is with the heavy chain CDR3. Thus, the
molecular recognition units may be primarily responsible for the
specificity of an antigen-binding site. In general, the CDR
residues are directly and most substantially involved in
influencing antigen binding.
[0221] Other suitable methods of producing or isolating antibodies
of the requisite specificity can be used, including, but not
limited to, methods that select recombinant antibody from a peptide
or protein library (e.g., but not limited to, a bacteriophage,
ribosome, oligonucleotide, RNA, cDNA, yeast or the like, display
library); e.g., as available from various commercial vendors such
as Cambridge Antibody Technologies (Cambridgeshire, UK), MorphoSys
(Martinsreid/Planegg, Del.), Biovation (Aberdeen, Scotland, UK)
Biolnvent (Lund, Sweden), using methods known in the art. See U.S.
Pat. Nos. 4,704,692; 5,723,323; 5,763,192; 5,814,476; 5,817,483;
5,824,514; 5,976,862. Alternative methods rely upon immunization of
transgenic animals (e.g., SCID mice, Nguyen et al. (1997)
Microbiol. Immunol. 41:901-907; Sandhu et al. (1996) Crit. Rev.
Biotechnol. 16:95-118; Eren et al. (1998) Immunol. 93:154-161) that
are capable of producing a repertoire of human antibodies, as known
in the art and/or as described herein. Such techniques, include,
but are not limited to, ribosome display (Hanes et al. (1997) Proc.
Natl. Acad. Sci. USA, 94:4937-4942; Hanes et al. (1998) Proc. Natl.
Acad. Sci. USA, 95:14130-14135); single cell antibody producing
technologies (e.g., selected lymphocyte antibody method ("SLAM")
(U.S. Pat. No. 5,627,052, Wen et al. (1987) J. Immunol. 17:887-892;
Babcook et al. (1996) Proc. Natl. Acad. Sci. USA 93:7843-7848); gel
microdroplet and flow cytometry (Powell et al. (1990) Biotechnol.
8:333-337; One Cell Systems, (Cambridge, Mass.).; Gray et al.
(1995) J. Imm. Meth. 182:155-163; Kenny et al. (1995) Bio/Technol.
13:787-790); B-cell selection (Steenbakkers et al. (1994) Molec.
Biol. Reports 19:125-134 (1994)).
[0222] An affinity matured antibody may be produced by any one of a
number of procedures that are known in the art. For example, see
Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity
maturation by VH and VL domain shuffling. Random mutagenesis of CDR
and/or framework residues is described by Barbas et al., Proc. Nat.
Acad. Sci. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169:
147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995);
Jackson et al., J. Immunol., 154(7): 3310-3319 (1995); Hawkins et
al, J. Mol. Biol., 226: 889-896 (1992). Selective mutation at
selective mutagenesis positions and at contact or hypermutation
positions with an activity enhancing amino acid residue is
described in U.S. Pat. No. 6,914,128 B 1.
[0223] Antibody variants of the present invention can also be
prepared using delivering a polynucleotide encoding an antibody of
this invention to a suitable host such as to provide transgenic
animals or mammals, such as goats, cows, horses, sheep, and the
like, that produce such antibodies in their milk. These methods are
known in the art and are described for example in U.S. Pat. Nos.
5,827,690; 5,849,992; 4,873,316; 5,849,992; 5,994,616; 5,565,362;
and 5,304,489.
[0224] Antibody variants also can be prepared by delivering a
polynucleotide of this invention to provide transgenic plants and
cultured plant cells (e.g., but not limited to tobacco, maize, and
duckweed) that produce such antibodies, specified portions or
variants in the plant parts or in cells cultured therefrom. For
example, Cramer et al. (1999) Curr. Top. Microbol. Immunol.
240:95-118 and references cited therein, describe the production of
transgenic tobacco leaves expressing large amounts of recombinant
proteins, e.g., using an inducible promoter. Transgenic maize have
been used to express mammalian proteins at commercial production
levels, with biological activities equivalent to those produced in
other recombinant systems or purified from natural sources. See,
e.g., Hood et al., Adv. Exp. Med. Biol. (1999) 464:127-147 and
references cited therein. Antibody variants have also been produced
in large amounts from transgenic plant seeds including antibody
fragments, such as single chain antibodies (scFv's), including
tobacco seeds and potato tubers. See, e.g., Conrad et al. (1998)
Plant Mol. Biol. 38:101-109 and reference cited therein. Thus,
antibodies of the present invention can also be produced using
transgenic plants, according to known methods.
[0225] Antibody derivatives can be produced, for example, by adding
exogenous sequences to modify immunogenicity or reduce, enhance or
modify binding, affinity, on-rate, off-rate, avidity, specificity,
half-life, or any other suitable characteristic. Generally part or
all of the non-human or human CDR sequences are maintained while
the non-human sequences of the variable and constant regions are
replaced with human or other amino acids.
[0226] Small antibody fragments may be diabodies having two
antigen-binding sites, wherein fragments comprise a heavy chain
variable domain (VH) connected to a light chain variable domain
(VL) in the same polypeptide chain (VH VL). See for example, EP
404,097; WO 93/11161; and Hollinger et al., (1993) Proc. Natl.
Acad. Sci. USA 90:6444-6448. By using a linker that is too short to
allow pairing between the two domains on the same chain, the
domains are forced to pair with the complementary domains of
another chain and create two antigen-binding sites. See also, U.S.
Pat. No. 6,632,926 to Chen et al. which is hereby incorporated by
reference in its entirety and discloses antibody variants that have
one or more amino acids inserted into a hypervariable region of the
parent antibody and a binding affinity for a target antigen which
is at least about two fold stronger than the binding affinity of
the parent antibody for the antigen.
[0227] The antibody may be a linear antibody. The procedure for
making a linear antibody is known in the art and described in
Zapata et al. (1995) Protein Eng. 8(10):1057-1062. Briefly, these
antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1)
which form a pair of antigen binding regions. Linear antibodies can
be bispecific or monospecific.
[0228] The antibodies may be recovered and purified from
recombinant cell cultures by known methods including, but not
limited to, protein A purification, ammonium sulfate or ethanol
precipitation, acid extraction, anion or cation exchange
chromatography, phosphocellulose chromatography, hydrophobic
interaction chromatography, affinity chromatography,
hydroxylapatite chromatography and lectin chromatography. High
performance liquid chromatography ("HPLC") can also be used for
purification.
[0229] It may be useful to detectably or therapeutically label the
antibody. Methods for conjugating antibodies to these agents are
known in the art. For the purpose of illustration only, antibodies
can be labeled with a detectable moiety such as a radioactive atom,
a chromophore, a fluorophore, or the like. Such labeled antibodies
can be used for diagnostic techniques, either in vivo, or in an
isolated test sample. Antibodies can also be conjugated, for
example, to a pharmaceutical agent, such as chemotherapeutic drug
or a toxin. They can be linked to a cytokine, to a ligand, to
another antibody. Suitable agents for coupling to antibodies to
achieve an anti-tumor effect include cytokines, such as interleukin
2 (IL-2) and Tumor Necrosis Factor (TNF); photosensitizers, for use
in photodynamic therapy, including aluminum (III) phthalocyanine
tetrasulfonate, hematoporphyrin, and phthalocyanine; radionuclides,
such as iodine-131 (131I), yttrium-90 (90Y), bismuth-212 (212Bi),
bismuth-213 (213Bi), technetium-99m (99mTc), rhenium-186 (186Re),
and rhenium-188 (188Re); antibiotics, such as doxorubicin,
adriamycin, daunorubicin, methotrexate, daunomycin,
neocarzinostatin, and carboplatin; bacterial, plant, and other
toxins, such as diphtheria toxin, pseudomonas exotoxin A,
staphylococcal enterotoxin A, abrin-A toxin, ricin A
(deglycosylated ricin A and native ricin A), TGF-alpha toxin,
cytotoxin from chinese cobra (naja naja atra), and gelonin (a plant
toxin); ribosome inactivating proteins from plants, bacteria and
fungi, such as restrictocin (a ribosome inactivating protein
produced by Aspergillus restrictus), saporin (a ribosome
inactivating protein from Saponaria officinalis), and RNase;
tyrosine kinase inhibitors; ly207702 (a difluorinated purine
nucleoside); liposomes containing anti cystic agents (e.g.,
antisense oligonucleotides, plasmids which encode for toxins,
methotrexate, etc.); and other antibodies or antibody fragments,
such as F(ab).
[0230] The antibodies can be sequenced and replicated by
recombinant or synthetic means. They also can be further sequenced
down to the linear sequence of nucleotides that encode them.
Accordingly, this invention provides these polynucleotides, alone
or in combination with a carrier, vector or host cell as described
above, that encode a sequence of an antibody of this invention.
[0231] Antibody production via the use of hybridoma technology, the
selected lymphocyte antibody method (SLAM), transgenic animals, and
recombinant antibody libraries is described in more detail
below.
[0232] (1) Anti-RGMa Monoclonal Antibodies Using Hybridoma
Technology
[0233] Monoclonal antibodies can be prepared using a wide variety
of techniques known in the art including the use of hybridoma,
recombinant, and phage display technologies, or a combination
thereof. For example, monoclonal antibodies can be produced using
hybridoma techniques including those known in the art and taught,
for example, in Harlow et al., Antibodies: A Laboratory Manual,
second edition, (Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, 1988); Hammerling, et al., In Monoclonal Antibodies and
T-Cell Hybridomas, (Elsevier, N.Y., 1981). It is also noted that
the term "monoclonal antibody" as used herein is not limited to
antibodies produced through hybridoma technology. The term
"monoclonal antibody" refers to an antibody that is derived from a
single clone, including any eukaryotic, prokaryotic, or phage
clone, and not the method by which it is produced.
[0234] In an embodiment, the present invention provides methods of
generating monoclonal antibodies as well as antibodies produced by
the method. The method may comprise culturing a hybridoma cell
secreting an antibody of the invention wherein, preferably, the
hybridoma is generated by fusing splenocytes isolated from an
animal, e.g., a rat or a mouse, immunized with RGMa with myeloma
cells and then screening the hybridomas resulting from the fusion
for hybridoma clones that secrete an antibody able to bind a
polypeptide of the invention. Briefly, rats can be immunized with
an RGMa antigen. In a preferred embodiment, the RGMa antigen is
administered with an adjuvant to stimulate the immune response.
Such adjuvants include complete or incomplete Freund's adjuvant,
RIBI (muramyl dipeptides) or ISCOM (immunostimulating complexes).
Such adjuvants may protect the polypeptide from rapid dispersal by
sequestering it in a local deposit, or they may contain substances
that stimulate the host to secrete factors that are chemotactic for
macrophages and other components of the immune system. Preferably,
if a polypeptide is being administered, the immunization schedule
will involve two or more administrations of the polypeptide, spread
out over several weeks; however, a single administration of the
polypeptide may also be used.
[0235] After immunization of an animal with an RGMa antigen,
antibodies and/or antibody-producing cells may be obtained from the
animal. An anti-RGMa antibody-containing serum is obtained from the
animal by bleeding or sacrificing the animal. The serum may be used
as it is obtained from the animal, an immunoglobulin fraction may
be obtained from the serum, or the anti-RGMa antibodies may be
purified from the serum. Serum or immunoglobulins obtained in this
manner are polyclonal, thus having a heterogeneous array of
properties.
[0236] Once an immune response is detected, e.g., antibodies
specific for the antigen RGMa are detected in the rat serum, the
rat spleen is harvested and splenocytes isolated. The splenocytes
are then fused by well-known techniques to any suitable myeloma
cells, for example cells from cell line SP20 available from the
American Type Culture Collection (ATCC, Manassas, Va., US).
Hybridomas are selected and cloned by limited dilution. The
hybridoma clones are then assayed by methods known in the art for
cells that secrete antibodies capable of binding RGMa. Ascites
fluid, which generally contains high levels of antibodies, can be
generated by immunizing rats with positive hybridoma clones.
[0237] In another embodiment, antibody-producing immortalized
hybridomas may be prepared from the immunized animal. After
immunization, the animal is sacrificed and the splenic B cells are
fused to immortalized myeloma cells as is well known in the art.
See, e.g., Harlow and Lane, supra. In a preferred embodiment, the
myeloma cells do not secrete immunoglobulin polypeptides (a
non-secretory cell line). After fusion and antibiotic selection,
the hybridomas are screened using RGMa, or a portion thereof, or a
cell expressing RGMa. In a preferred embodiment, the initial
screening is performed using an enzyme-linked immunosorbent assay
(ELISA) or a radioimmunoassay (RIA), preferably an ELISA. An
example of ELISA screening is provided in PCT Publication No. WO
00/37504.
[0238] Anti-RGMa antibody-producing hybridomas are selected,
cloned, and further screened for desirable characteristics,
including robust hybridoma growth, high antibody production, and
desirable antibody characteristics, as discussed further below.
Hybridomas may be cultured and expanded in vivo in syngeneic
animals, in animals that lack an immune system, e.g., nude mice, or
in cell culture in vitro. Methods of selecting, cloning and
expanding hybridomas are well known to those of ordinary skill in
the art.
[0239] In a preferred embodiment, hybridomas are rat hybridomas. In
another embodiment, hybridomas are produced in a non-human, non-rat
species such as mice, sheep, pigs, goats, cattle, or horses. In yet
another preferred embodiment, the hybridomas are human hybridomas,
in which a human non-secretory myeloma is fused with a human cell
expressing an anti-RGMa antibody.
[0240] Antibody fragments that recognize specific epitopes may be
generated by known techniques. For example, Fab and F(ab')2
fragments of the invention may be produced by proteolytic cleavage
of immunoglobulin molecules, using enzymes such as papain (to
produce two identical Fab fragments) or pepsin (to produce a
F(ab')2 fragment). A F(ab')2 fragment of an IgG molecule retains
the two antigen-binding sites of the larger ("parent") IgG
molecule, including both light chains (containing the variable
light chain and constant light chain regions), the CH1 domains of
the heavy chains, and a disulfide-forming hinge region of the
parent IgG molecule. Accordingly, a F(ab')2 fragment is still
capable of crosslinking antigen molecules like the parent IgG
molecule.
[0241] (2) Anti-RGMa Monoclonal Antibodies Using SLAM.
[0242] In another aspect of the invention, recombinant antibodies
are generated from single, isolated lymphocytes using a procedure
referred to in the art as the selected lymphocyte antibody method
(SLAM), as described in U.S. Pat. No. 5,627,052; PCT Publication
No. WO 92/02551; and Babcook et al., Proc. Natl. Acad. Sci. USA,
93: 7843-7848 (1996). In this method, single cells secreting
antibodies of interest, e.g., lymphocytes derived from any one of
the immunized animals are screened using an antigen-specific
hemolytic plaque assay, wherein the antigen RGMa, a subunit of
RGMa, or a fragment thereof, is coupled to sheep red blood cells
using a linker, such as biotin, and used to identify single cells
that secrete antibodies with specificity for RGMa. Following
identification of antibody-secreting cells of interest, heavy- and
light-chain variable region cDNAs are rescued from the cells by
reverse transcriptase-PCR (RT-PCR) and these variable regions can
then be expressed, in the context of appropriate immunoglobulin
constant regions (e.g., human constant regions), in mammalian host
cells, such as COS or CHO cells. The host cells transfected with
the amplified immunoglobulin sequences, derived from in vivo
selected lymphocytes, can then undergo further analysis and
selection in vitro, for example, by panning the transfected cells
to isolate cells expressing antibodies to RGMa. The amplified
immunoglobulin sequences further can be manipulated in vitro, such
as by in vitro affinity maturation method. See, for example, PCT
Publication No. WO 97/29131 and PCT Publication No. WO
00/56772.
[0243] (3) Anti-RGMa Monoclonal Antibodies Using Transgenic
Animals.
[0244] In another embodiment of the invention, antibodies are
produced by immunizing a non-human animal comprising some, or all,
of the human immunoglobulin locus with a RGMa antigen. In an
embodiment, the non-human animal is a XENOMOUSE.RTM. transgenic
mouse, an engineered mouse strain that comprises large fragments of
the human immunoglobulin loci and is deficient in mouse antibody
production. See, e.g., Green et al., Nature Genetics, 7: 13-21
(1994) and U.S. Pat. Nos. 5,916,771; 5,939,598; 5,985,615;
5,998,209; 6,075,181; 6,091,001; 6,114,598; and 6,130,364. See also
PCT Publication Nos. WO 91/10741; WO 94/02602; WO 96/34096; WO
96/33735; WO 98/16654; WO 98/24893; WO 98/50433; WO 99/45031; WO
99/53049; WO 00/09560; and WO 00/37504. The XENOMOUSE.RTM.
transgenic mouse produces an adult-like human repertoire of fully
human antibodies, and generates antigen-specific human monoclonal
antibodies. The XENOMOUSE.RTM. transgenic mouse contains
approximately 80% of the human antibody repertoire through
introduction of megabase sized, germline configuration YAC
fragments of the human heavy chain loci and x light chain loci. See
Mendez et al., Nature Genetics, 15: 146-156 (1997), Green and
Jakobovits, J. Exp. Med., 188: 483-495 (1998), the disclosures of
which are hereby incorporated by reference.
[0245] (4) Anti-RGMa Monoclonal Antibodies Using Recombinant
Antibody Libraries.
[0246] In vitro methods also can be used to make the antibodies of
the invention, wherein an antibody library is screened to identify
an antibody having the desired RGMa-binding specificity. Methods
for such screening of recombinant antibody libraries are well known
in the art and include methods described in, for example, U.S. Pat.
No. 5,223,409 (Ladner et al.); PCT Publication No. WO 92/18619
(Kang et al.); PCT Publication No. WO 91/17271 (Dower et al.); PCT
Publication No. WO 92/20791 (Winter et al.); PCT Publication No. WO
92/15679 (Markland et al.); PCT Publication No. WO 93/01288
(Breitling et al.); PCT Publication No. WO 92/01047 (McCafferty et
al.); PCT Publication No. WO 92/09690 (Garrard et al.); Fuchs et
al., Bio/Technology, 9: 1369-1372 (1991); Hay et al., Hum. Antibod.
Hybridomas, 3: 81-85 (1992); Huse et al., Science, 246: 1275-1281
(1989); McCafferty et al., Nature, 348: 552-554 (1990); Griffiths
et al., EMBO J., 12: 725-734 (1993); Hawkins et al., J. Mol. Biol.,
226: 889-896 (1992); Clackson et al., Nature, 352: 624-628 (1991);
Gram et al., Proc. Natl. Acad. Sci. USA, 89: 3576-3580 (1992);
Garrard et al., Bio/Technology, 9: 1373-1377 (1991); Hoogenboom et
al., Nucl. Acids Res., 19: 4133-4137 (1991); Barbas et al., Proc.
Natl. Acad. Sci. USA, 88: 7978-7982 (1991); US Patent Application
Publication No. 2003/0186374; and PCT Publication No. WO 97/29131,
the contents of each of which are incorporated herein by
reference.
[0247] The recombinant antibody library may be from a subject
immunized with RGMa, or a portion of RGMa. Alternatively, the
recombinant antibody library may be from a naive subject, i.e., one
who has not been immunized with RGMa, such as a human antibody
library from a human subject who has not been immunized with human
RGMa. Antibodies of the invention are selected by screening the
recombinant antibody library with the peptide comprising human RGMa
to thereby select those antibodies that recognize RGMa. Methods for
conducting such screening and selection are well known in the art,
such as described in the references in the preceding paragraph. To
select antibodies of the invention having particular binding
affinities for RGMa, such as those that dissociate from human RGMa
with a particular K.sub.off rate constant, the art-known method of
surface plasmon resonance can be used to select antibodies having
the desired K.sub.off rate constant. To select antibodies of the
invention having a particular neutralizing activity for hRGMa, such
as those with a particular IC.sub.50, standard methods known in the
art for assessing the inhibition of RGMa activity may be used.
[0248] In one aspect, the invention pertains to an isolated
antibody, or an antigen-binding portion thereof, that binds human
RGMa. Preferably, the antibody is a neutralizing antibody. In
various embodiments, the antibody is a recombinant antibody or a
monoclonal antibody.
[0249] For example, antibodies of the present invention can also be
generated using various phage display methods known in the art. In
phage display methods, functional antibody domains are displayed on
the surface of phage particles which carry the polynucleotide
sequences encoding them. Such phage can be utilized to display
antigen-binding domains expressed from a repertoire or
combinatorial antibody library (e.g., human or murine). Phage
expressing an antigen binding domain that binds the antigen of
interest can be selected or identified with antigen, e.g., using
labeled antigen or antigen bound or captured to a solid surface or
bead. Phage used in these methods are typically filamentous phage
including fd and M13 binding domains expressed from phage with Fab,
Fv, or disulfide stabilized Fv antibody domains recombinantly fused
to either the phage gene III or gene VIII protein. Examples of
phage display methods that can be used to make the antibodies of
the present invention include those disclosed in Brinkmann et al.,
J. Immunol. Methods, 182: 41-50 (1995); Ames et al., J. Immunol.
Methods, 184:177-186 (1995); Kettleborough et al., Eur. J.
Immunol., 24: 952-958 (1994); Persic et al., Gene, 187: 9-18
(1997); Burton et al., Advances in Immunology, 57: 191-280 (1994);
PCT Publication No. WO 92/01047; PCT Publication Nos. WO 90/02809;
WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO
95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484;
5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908;
5,516,637; 5,780,225; 5,658,727; 5,733,743; and 5,969,108.
[0250] As described in the above references, after phage selection,
the antibody coding regions from the phage can be isolated and used
to generate whole antibodies including human antibodies or any
other desired antigen binding fragment, and expressed in any
desired host, including mammalian cells, insect cells, plant cells,
yeast, and bacteria, e.g., as described in detail below. For
example, techniques to recombinantly produce Fab, Fab', and F(ab')2
fragments can also be employed using methods known in the art such
as those disclosed in PCT publication No. WO 92/22324; Mullinax et
al., BioTechniques, 12(6): 864-869 (1992); Sawai et al., Am. J.
Reprod. Immunol., 34: 26-34 (1995); and Better et al., Science,
240: 1041-1043 (1988). Examples of techniques which can be used to
produce single-chain Fvs and antibodies include those described in
U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al., Methods in
Enzymology, 203: 46-88 (1991); Shu et al., Proc. Natl. Acad. Sci.
USA, 90: 7995-7999 (1993); and Skerra et al., Science, 240:
1038-1041 (1988).
[0251] Alternative to screening of recombinant antibody libraries
by phage display, other methodologies known in the art for
screening large combinatorial libraries can be applied to the
identification of antibodies of the invention. One type of
alternative expression system is one in which the recombinant
antibody library is expressed as RNA-protein fusions, as described
in PCT Publication No. WO 98/31700 (Szostak and Roberts), and in
Roberts and Szostak, Proc. Natl. Acad. Sci. USA, 94: 12297-12302
(1997). In this system, a covalent fusion is created between an
mRNA and the peptide or protein that it encodes by in vitro
translation of synthetic mRNAs that carry puromycin, a peptidyl
acceptor antibiotic, at their 3' end. Thus, a specific mRNA can be
enriched from a complex mixture of mRNAs (e.g., a combinatorial
library) based on the properties of the encoded peptide or protein,
e.g., antibody, or portion thereof, such as binding of the
antibody, or portion thereof, to the dual specificity antigen.
Nucleic acid sequences encoding antibodies, or portions thereof,
recovered from screening of such libraries can be expressed by
recombinant means as described above (e.g., in mammalian host
cells) and, moreover, can be subjected to further affinity
maturation by either additional rounds of screening of mRNA-peptide
fusions in which mutations have been introduced into the originally
selected sequence(s), or by other methods for affinity maturation
in vitro of recombinant antibodies, as described above. A preferred
example of this methodology, is PROfusion display technology.
[0252] In another approach the antibodies of the present invention
can also be generated using yeast display methods known in the art.
In yeast display methods, genetic methods are used to tether
antibody domains to the yeast cell wall and display them on the
surface of yeast. In particular, such yeast can be utilized to
display antigen-binding domains expressed from a repertoire or
combinatorial antibody library (e.g., human or murine). Examples of
yeast display methods that can be used to make the antibodies of
the present invention include those disclosed in U.S. Pat. No.
6,699,658 (Wittrup et al.) incorporated herein by reference.
[0253] d. Production of Recombinant RGMa Antibodies
[0254] Antibodies of the present invention may be produced by any
of a number of techniques known in the art. For example, expression
from host cells, wherein expression vector(s) encoding the heavy
and light chains is (are) transfected into a host cell by standard
techniques. The various forms of the term "transfection" are
intended to encompass a wide variety of techniques commonly used
for the introduction of exogenous DNA into a prokaryotic or
eukaryotic host cell, e.g., electroporation, calcium-phosphate
precipitation, DEAE-dextran transfection and the like. Although it
is possible to express the antibodies of the invention in either
prokaryotic or eukaryotic host cells, expression of antibodies in
eukaryotic cells is preferable, and most preferable in mammalian
host cells, because such eukaryotic cells (and in particular
mammalian cells) are more likely than prokaryotic cells to assemble
and secrete a properly folded and immunologically active
antibody.
[0255] Exemplary mammalian host cells for expressing the
recombinant antibodies of the invention include Chinese Hamster
Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub
and Chasin, Proc. Natl. Acad. Sci. USA, 77: 4216-4220 (1980), used
with a DHFR selectable marker, e.g., as described in Kaufman and
Sharp, J. Mol. Biol., 159: 601-621 (1982), NS0 myeloma cells, COS
cells, and SP2 cells. When recombinant expression vectors encoding
antibody genes are introduced into mammalian host cells, the
antibodies are produced by culturing the host cells for a period of
time sufficient to allow for expression of the antibody in the host
cells or, more preferably, secretion of the antibody into the
culture medium in which the host cells are grown. Antibodies can be
recovered from the culture medium using standard protein
purification methods.
[0256] Host cells can also be used to produce functional antibody
fragments, such as Fab fragments or scFv molecules. It will be
understood that variations on the above procedure are within the
scope of the present invention. For example, it may be desirable to
transfect a host cell with DNA encoding functional fragments of
either the light chain and/or the heavy chain of an antibody of
this invention. Recombinant DNA technology may also be used to
remove some, or all, of the DNA encoding either or both of the
light and heavy chains that is not necessary for binding to the
antigens of interest. The molecules expressed from such truncated
DNA molecules are also encompassed by the antibodies of the
invention. In addition, bifunctional antibodies may be produced in
which one heavy and one light chain are an antibody of the
invention (i.e., binds human RGMa) and the other heavy and light
chain are specific for an antigen other than human RGMa by
crosslinking an antibody of the invention to a second antibody by
standard chemical crosslinking methods.
[0257] In a preferred system for recombinant expression of an
antibody, or antigen-binding portion thereof, of the invention, a
recombinant expression vector encoding both the antibody heavy
chain and the antibody light chain is introduced into dhfr-CHO
cells by calcium phosphate-mediated transfection. Within the
recombinant expression vector, the antibody heavy and light chain
genes are each operatively linked to CMV enhancer/AdMLP promoter
regulatory elements to drive high levels of transcription of the
genes. The recombinant expression vector also carries a DHFR gene,
which allows for selection of CHO cells that have been transfected
with the vector using methotrexate selection/amplification. The
selected transformant host cells are cultured to allow for
expression of the antibody heavy and light chains and intact
antibody is recovered from the culture medium. Standard molecular
biology techniques are used to prepare the recombinant expression
vector, transfect the host cells, select for transformants, culture
the host cells and recover the antibody from the culture medium.
Still further the invention provides a method of synthesizing a
recombinant antibody of the invention by culturing a host cell of
the invention in a suitable culture medium until a recombinant
antibody of the invention is synthesized. The method can further
comprise isolating the recombinant antibody from the culture
medium.
[0258] (a) Humanized Antibody
[0259] The humanized antibody may be an antibody or a variant,
derivative, analog or portion thereof which immunospecifically
binds to an antigen of interest and which comprises a framework
(FR) region having substantially the amino acid sequence of a human
antibody and a complementary determining region (CDR) having
substantially the amino acid sequence of a non-human antibody. The
humanized antibody may be from a non-human species antibody that
binds the desired antigen having one or more complementarity
determining regions (CDRs) from the non-human species and framework
regions from a human immunoglobulin molecule.
[0260] As used herein, the term "substantially" in the context of a
CDR refers to a CDR having an amino acid sequence at least 90%, at
least 95%, at least 98% or at least 99% identical to the amino acid
sequence of a non-human antibody CDR. A humanized antibody
comprises substantially all of at least one, and typically two,
variable domains (Fab, Fab', F(ab')2, FabC, Fv) in which all or
substantially all of the CDR regions correspond to those of a
non-human immunoglobulin (i.e., donor antibody) and all or
substantially all of the framework regions are those of a human
immunoglobulin consensus sequence. According to one aspect, a
humanized antibody also comprises at least a portion of an
immunoglobulin constant region (Fc), typically that of a human
immunoglobulin. In some embodiments, a humanized antibody contains
both the light chain as well as at least the variable domain of a
heavy chain. The antibody also may include the CH1, hinge, CH2,
CH3, and CH4 regions of the heavy chain. In some embodiments, a
humanized antibody only contains a humanized light chain. In some
embodiments, a humanized antibody only contains a humanized heavy
chain. In specific embodiments, a humanized antibody only contains
a humanized variable domain of a light chain and/or of a heavy
chain.
[0261] The humanized antibody can be selected from any class of
immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any
isotype, including without limitation IgG 1, IgG2, IgG3 and IgG4.
The humanized antibody may comprise sequences from more than one
class or isotype, and particular constant domains may be selected
to optimize desired effector functions using techniques well-known
in the art.
[0262] The framework and CDR regions of a humanized antibody need
not correspond precisely to the parental sequences, e.g., the donor
antibody CDR or the consensus framework may be mutagenized by
substitution, insertion and/or deletion of at least one amino acid
residue so that the CDR or framework residue at that site does not
correspond to either the donor antibody or the consensus framework.
In one embodiment, such mutations, however, will not be extensive.
Usually, at least 90%, at least 95%, at least 98%, or at least 99%
of the humanized antibody residues will correspond to those of the
parental FR and CDR sequences. As used herein, the term "consensus
framework" refers to the framework region in the consensus
immunoglobulin sequence. As used herein, the term "consensus
immunoglobulin sequence" refers to the sequence formed from the
most frequently occurring amino acids (or nucleotides) in a family
of related immunoglobulin sequences (See e.g., Winnaker, From Genes
to Clones (Verlagsgesellschaft, Weinheim, Germany 1987)). In a
family of immunoglobulins, each position in the consensus sequence
is occupied by the amino acid occuring most frequently at that
position in the family. If two amino acids occur equally
frequently, either can be included in the consensus sequence.
[0263] The humanized antibody may be designed to minimize unwanted
immunological response toward rodent anti-human antibodies, which
limits the duration and effectiveness of therapeutic applications
of those moieties in human recipients. The humanized antibody may
have one or more amino acid residues introduced into it from a
source that is non-human. These non-human residues are often
referred to as "import" residues, which are typically taken from a
variable domain. Humanization may be performed by substituting
hypervariable region sequences for the corresponding sequences of a
human antibody. Accordingly, such "humanized" antibodies are
chimeric antibodies wherein substantially less than an intact human
variable domain has been substituted by the corresponding sequence
from a non-human species. For example, see U.S. Pat. No. 4,816,567,
the contents of which are herein incorporated by reference. The
humanized antibody may be a human antibody in which some
hypervariable region residues, and possibly some FR residues are
substituted by residues from analogous sites in rodent antibodies.
Humanization or engineering of antibodies of the present invention
can be performed using any known method, such as but not limited to
those described in U.S. Pat. Nos. 5,723,323; 5,976,862; 5,824,514;
5,817,483; 5,814,476; 5,763,192; 5,723,323; 5,766,886; 5,714,352;
6,204,023; 6,180,370; 5,693,762; 5,530,101; 5,585,089; 5,225,539;
and 4,816,567.
[0264] The humanized antibody may retain high affinity for RGMa and
other favorable biological properties. The humanized antibody may
be prepared by a process of analysis of the parental sequences and
various conceptual humanized products using three-dimensional
models of the parental and humanized sequences. Three-dimensional
immunoglobulin models are commonly available. Computer programs are
available that illustrate and display probable three-dimensional
conformational structures of selected candidate immunoglobulin
sequences. Inspection of these displays permits analysis of the
likely role of the residues in the functioning of the candidate
immunoglobulin sequence, i.e., the analysis of residues that
influence the ability of the candidate immunoglobulin to bind its
antigen. In this way, FR residues can be selected and combined from
the recipient and import sequences so that the desired antibody
characteristics, such as increased affinity for RGMa, is achieved.
In general, the hypervariable region residues may be directly and
most substantially involved in influencing antigen binding.
[0265] As an alternative to humanization, human antibodies (also
referred to herein as "fully human antibodies") can be generated.
For example, it is possible to isolate human antibodies from
libararies via PROfusion and/or yeast related technologies. See
Examples provided below. It is also possible to produce transgenic
animals (e.g. mice that are capable, upon immunization, of
producing a full repertoire of human antibodies in the absence of
endogenous immunoglobulin production. For example, the homozygous
deletion of the antibody heavy-chain joining region (J.sub.H) gene
in chimeric and germ-line mutant mice results in complete
inhibition of endogenous antibody production. Transfer of the human
germ-line immunoglobulin gene array in such germ-line mutant mice
will result in the production of human antibodies upon antigen
challenge. The humanized or fully human antibodies may be prepared
according to the methods described in U.S. Pat. Nos. 5,770,429;
5,833,985; 5,837,243; 5,922,845; 6,017,517; 6,096,311; 6,111,166;
6,270,765; 6,303,755; 6,365,116; 6,410,690; 6,682,928; and
6,984,720, the contents each of which are herein incorporated by
reference.
3. Pharmaceutical Compositions
[0266] The antibody may be a component in a pharmaceutical
composition. The pharmaceutical composition may also contain a
pharmaceutically acceptable carrier. The pharmaceutical
compositions comprising antibodies of the invention are for use in,
but not limited to, diagnosing, detecting, or monitoring a
disorder, in preventing, treating, managing, or ameliorating of a
disorder or one or more symptoms thereof, and/or in research. In a
specific embodiment, a composition comprises one or more antibodies
of the invention. In another embodiment, the pharmaceutical
composition comprises one or more antibodies of the invention and
one or more prophylactic or therapeutic agents other than
antibodies of the invention for treating a disorder in which
activity of a targeted RGMa is detrimental. In a further
embodiment, the prophylactic or therapeutic agents are known to be
useful for, or have been, or are currently being used in the
prevention, treatment, management, or amelioration of a disorder,
or one or more symptoms thereof. In accordance with these
embodiments, the composition may further comprise of a carrier,
diluent or excipient.
[0267] The antibodies of the invention can be incorporated into
pharmaceutical compositions suitable for administration to a
subject. Typically, the pharmaceutical composition comprises an
antibody of the invention and a pharmaceutically acceptable
carrier. As used herein, "pharmaceutically acceptable carrier"
includes any and all solvents, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents, and the like that are physiologically compatible.
Examples of pharmaceutically acceptable carriers include one or
more of water, saline, phosphate buffered saline, dextrose,
glycerol, ethanol and the like, as well as combinations thereof. In
many cases, it will be preferable to include isotonic agents, for
example, sugars, polyalcohols such as mannitol, sorbitol, or sodium
chloride in the composition. Pharmaceutically acceptable carriers
may further comprise minor amounts of auxiliary substances such as
wetting or emulsifying agents, preservatives or buffers, which
enhance the shelf life or effectiveness of the antibody.
[0268] In a further embodiment, the pharmaceutical composition
comprises at least one additional therapeutic agent for treating a
disorder as disclosed herein.
[0269] Various delivery systems are known and can be used to
administer one or more antibodies of the invention or the
combination of one or more antibodies of the invention and a
prophylactic agent or therapeutic agent useful for preventing,
managing, treating, or ameliorating a disorder or one or more
symptoms thereof, e.g., encapsulation in liposomes, microparticles,
microcapsules, recombinant cells capable of expressing the antibody
or antibody fragment, receptor-mediated endocytosis (see, e.g., Wu
and Wu, J. Biol. Chem. 262:4429-4432 (1987)), construction of a
nucleic acid as part of a retroviral or other vector, etc. Methods
of administering a prophylactic or therapeutic agent of the
invention include, but are not limited to, parenteral
administration (e.g., intradermal, intramuscular, intraperitoneal,
intravenous and subcutaneous), epidurala administration,
intratumoral administration, and mucosal administration (e.g.,
intranasal and oral routes). In addition, pulmonary administration
can be employed, e.g., by use of an inhaler or nebulizer, and
formulation with an aerosolizing agent. See, e.g., U.S. Pat. Nos.
6,019,968; 5,985,320; 5,985,309; 5,934,272; 5,874,064; 5,855,913;
5,290,540; and 4,880,078; and PCT Publication Nos. WO 92/19244;
WO97/32572; WO97/44013; WO98/31346; and WO99/66903, each of which
is incorporated herein by reference in their entireties. In one
embodiment, an antibody of the invention, combination therapy, or a
composition of the invention is administered using Alkermes
AIR.RTM. pulmonary drug delivery technology (Alkermes, Inc.,
Cambridge, Mass.). In a specific embodiment, prophylactic or
therapeutic agents of the invention are administered
intramuscularly, intravenously, intratumorally, orally,
intranasally, pulmonary, or subcutaneously. The prophylactic or
therapeutic agents may be administered by any convenient route, for
example by infusion or bolus injection, by absorption through
epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and
intestinal mucosa, etc.) and may be administered together with
other biologically active agents. Administration can be systemic or
local.
[0270] In a specific embodiment, it may be desirable to administer
the antibodies of the invention locally to the area in need of
treatment; this may be achieved by, for example, and not by way of
limitation, local infusion, by injection, or by means of an
implant, said implant being of a porous or non-porous material,
including membranes and matrices, such as sialastic membranes,
polymers, fibrous matrices (e.g., Tissuel.RTM.), or collagen
matrices. In one embodiment, an effective amount of one or more
antibodies of the invention is administered locally to the affected
area to a subject to prevent, treat, manage, and/or ameliorate a
disorder or a symptom thereof. In another embodiment, an effective
amount of one or more antibodies of the invention is administered
locally to the affected area in combination with an effective
amount of one or more therapies (e.g., one or more prophylactic or
therapeutic agents) other than an antibody of the invention of a
subject to prevent, treat, manage, and/or ameliorate a disorder or
one or more symptoms thereof.
[0271] In another embodiment, the antibody can be delivered in a
controlled release or sustained release system. In one embodiment,
a pump may be used to achieve controlled or sustained release (see
Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:20;
Buchwald et al., 1980, Surgery 88:507; Saudek et al., 1989, N.
Engl. J. Med. 321:574). In another embodiment, polymeric materials
can be used to achieve controlled or sustained release of the
therapies of the invention (see e.g., Medical Applications of
Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton,
Fla. (1974); Controlled Drug Bioavailability, Drug Product Design
and Performance, Smolen and Ball (eds.), Wiley, New York (1984);
Ranger and Peppas, 1983, J., Macromol. Sci. Rev. Macromol. Chem.
23:61; see also Levy et al., 1985, Science 228:190; During et al.,
1989, Ann. Neurol. 25:351; Howard et al., 1989, J. Neurosurg. 7
1:105); U.S. Pat. Nos. 5,679,377; 5,916,597; 5,912,015; 5,989,463;
5,128,326; PCT Publication No. WO99/15154; and PCT Publication No.
WO99/20253. Examples of polymers used in sustained release
formulations include, but are not limited to, poly(2-hydroxy ethyl
methacry-late), poly(methyl methacrylate), poly(acrylic acid),
poly(ethylene-co-vinyl acetate), poly(methacrylic acid),
polyglycolides (PLG), polyanhydrides, poly(N-vinyl pyrrolidone),
poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol),
polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and
polyorthoesters. In a particular embodiment, the polymer used in a
sustained release formulation is inert, free of leachable
impurities, stable on storage, sterile, and biodegradable. In yet
another embodiment, a controlled or sustained release system can be
placed in proximity of the prophylactic or therapeutic target, thus
requiring only a fraction of the systemic dose (see, e.g., Goodson,
in Medical Applications of Controlled Release, supra, vol. 2, pp.
115-138 (1984)).
[0272] Controlled release systems are discussed in the review by
Langer (1990, Science 249:1527-1533). Any technique known to one of
skill in the art can be used to produce sustained release
formulations comprising one or more antibodies of the invention.
See, e.g., U.S. Pat. No. 4,526,938, PCT publication WO91/05548, PCT
publication WO96/20698, Ning et al., 1996, "Intratumoral
Radioimmunotheraphy of a Human Colon Cancer Xenograft Using a
Sustained-Release Gel," Radiotherapy & Oncology 39:179-189;
Song et al., 1995, "Antibody Mediated Lung Targeting of
Long-Circulating Emulsions," PDA Journal of Pharmaceutical Science
& Technology 50:372-397; Cleek et al., 1997, "Biodegradable
Polymeric Carriers for a bFGF Antibody for Cardiovascular
Application," Pro. Int'l. Symp. Control. Rel. Bioact. Mater.
24:853-854; and Lam et al., 1997, "Microencapsulation of
Recombinant Humanized Monoclonal Antibody for Local Delivery,"
Proc. Int'l. Symp. Control Rel. Bioact. Mater. 24:759-760, each of
which is incorporated herein by reference in their entireties.
[0273] In a specific embodiment, where the composition of the
invention is a nucleic acid encoding an antibody, the nucleic acid
can be administered in vivo to promote expression of its encoded
antibody, by constructing it as part of an appropriate nucleic acid
expression vector and administering it so that it becomes
intracellular, e.g., by use of a retroviral vector (see U.S. Pat.
No. 4,980,286), or by direct injection, or by use of microparticle
bombardment (e.g., a gene gun; Biolistic, Dupont), or coating with
lipids or cell-surface receptors or transfecting agents, or by
administering it in linkage to a homeobox-like peptide which is
known to enter the nucleus (see, e.g., Joliot et al., 1991, Proc.
Natl. Acad. Sci. USA 88:1864-1868). Alternatively, a nucleic acid
can be introduced intracellularly and incorporated within host cell
DNA for expression by homologous recombination.
[0274] A pharmaceutical composition of the invention is formulated
to be compatible with its intended route of administration.
Examples of routes of administration include, but are not limited
to, parenteral, e.g., intravenous, intradermal, subcutaneous, oral,
intranasal (e.g., inhalation), transdermal (e.g., topical),
transmucosal, and rectal administration. In a specific embodiment,
the composition is formulated in accordance with routine procedures
as a pharmaceutical composition adapted for intravenous,
subcutaneous, intramuscular, oral, intranasal, or topical
administration to human beings. Typically, compositions for
intravenous administration are solutions in sterile isotonic
aqueous buffer. Where necessary, the composition may also include a
solubilizing agent and a local anesthetic such as lignocaine to
ease pain at the site of the injection.
[0275] If the compositions of the invention are to be administered
topically, the compositions can be formulated in the form of an
ointment, cream, transdermal patch, lotion, gel, shampoo, spray,
aerosol, solution, emulsion, or other form well-known to one of
skill in the art. See, e.g., Remington's Pharmaceutical Sciences
and Introduction to Pharmaceutical Dosage Forms, 19th ed., Mack
Pub. Co., Easton, Pa. (1995). For non-sprayable topical dosage
forms, viscous to semi-solid or solid forms comprising a carrier or
one or more excipients compatible with topical application and
having a dynamic viscosity greater than water are typically
employed. Suitable formulations include, without limitation,
solutions, suspensions, emulsions, creams, ointments, powders,
liniments, salves, and the like, which are, if desired, sterilized
or mixed with auxiliary agents (e.g., preservatives, stabilizers,
wetting agents, buffers, or salts) for influencing various
properties, such as, for example, osmotic pressure. Other suitable
topical dosage forms include sprayable aerosol preparations wherein
the active ingredient, for example in combination with a solid or
liquid inert carrier, is packaged in a mixture with a pressurized
volatile (e.g., a gaseous propellant, such as freon) or in a
squeeze bottle. Moisturizers or humectants can also be added to
pharmaceutical compositions and dosage forms if desired. Examples
of such additional ingredients are well-known in the art.
[0276] If the method of the invention comprises intranasal
administration of a composition, the composition can be formulated
in an aerosol form, spray, mist or in the form of drops. In
particular, prophylactic or therapeutic agents for use according to
the present invention can be conveniently delivered in the form of
an aerosol spray presentation from pressurized packs or a
nebuliser, with the use of a suitable propellant (e.g.,
dichlorodifluoromethane, trichloro-fluoromethane,
dichlorotetrafluoroethane, carbon dioxide or other suitable gas).
In the case of a pressurized aerosol the dosage unit may be
determined by providing a valve to deliver a metered amount.
Capsules and cartridges (composed of, e.g., gelatin) for use in an
inhaler or insufflator may be formulated containing a powder mix of
the compound and a suitable powder base such as lactose or
starch.
[0277] If the method of the invention comprises oral
administration, compositions can be formulated orally in the form
of tablets, capsules, cachets, gelcaps, solutions, suspensions, and
the like. Tablets or capsules can be prepared by conventional means
with pharmaceutically acceptable excipients such as binding agents
(e.g., pregelatinised maize starch, polyvinylpyrrolidone, or
hydroxypropyl methylcellulose); fillers (e.g., lactose,
microcrystalline cellulose, or calcium hydrogen phosphate);
lubricants (e.g., magnesium stearate, talc, or silica);
disintegrants (e.g., potato starch or sodium starch glycolate); or
wetting agents (e.g., sodium lauryl sulphate). The tablets may be
coated by methods well-known in the art. Liquid preparations for
oral administration may take the form of, but not limited to,
solutions, syrups or suspensions, or they may be presented as a dry
product for constitution with water or other suitable vehicle
before use. Such liquid preparations may be prepared by
conventional means with pharmaceutically acceptable additives such
as suspending agents (e.g., sorbitol syrup, cellulose derivatives,
or hydrogenated edible fats); emulsifying agents (e.g., lecithin or
acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl
alcohol, or fractionated vegetable oils); and preservatives (e.g.,
methyl or propyl-p-hydroxybenzoates or sorbic acid). The
preparations may also contain buffer salts, flavoring, coloring,
and sweetening agents as appropriate. Preparations for oral
administration may be suitably formulated for slow release,
controlled release, or sustained release of a prophylactic or
therapeutic agent(s).
[0278] The method of the invention may comprise pulmonary
administration, e.g., by use of an inhaler or nebulizer, of a
composition formulated with an aerosolizing agent. See, e.g., U.S.
Pat. Nos. 6,019,968; 5,985, 320; 5, 985,309; 5,934,272; 5,874,064;
5,855,913; 5,290,540; and 4,880,078; and PCT Publication Nos. WO
92/19244; WO 97/32572; WO 97/44013; WO 98/31346; and WO 99/66903,
each of which is incorporated herein by reference their entireties.
In a specific embodiment, an antibody of the invention, combination
therapy, and/or composition of the invention is administered using
Alkermes AIR.RTM. pulmonary drug delivery technology (Alkermes,
Inc., Cambridge, Mass.).
[0279] The method of the invention may comprise administration of a
composition formulated for parenteral administration by injection
(e.g., by bolus injection or continuous infusion). Formulations for
injection may be presented in unit dosage form (e.g., in ampoules
or in multi-dose containers) with an added preservative. The
compositions may take such forms as suspensions, solutions or
emulsions in oily or aqueous vehicles, and may contain formulatory
agents such as suspending, stabilizing and/or dispersing agents.
Alternatively, the active ingredient may be in powder form for
constitution with a suitable vehicle (e.g., sterile pyrogen-free
water) before use. The methods of the invention may additionally
comprise of administration of compositions formulated as depot
preparations. Such long acting formulations may be administered by
implantation (e.g., subcutaneously or intramuscularly) or by
intramuscular injection. Thus, for example, the compositions may be
formulated with suitable polymeric or hydrophobic materials (e.g.,
as an emulsion in an acceptable oil) or ion exchange resins, or as
sparingly soluble derivatives (e.g., as a sparingly soluble
salt).
[0280] The methods of the invention encompass administration of
compositions formulated as neutral or salt forms. Pharmaceutically
acceptable salts include those formed with anions such as those
derived from hydrochloric, phosphoric, acetic, oxalic, tartaric
acids, etc., and those formed with cations such as those derived
from sodium, potassium, ammonium, calcium, ferric hydroxides,
isopropylamine, triethylamine, 2-ethylamino ethanol, histidine,
procaine, etc.
[0281] Generally, the ingredients of compositions are supplied
either separately or mixed together in unit dosage form, for
example, as a dry lyophilized powder or water free concentrate in a
hermetically sealed container such as an ampoule or sachette
indicating the quantity of active agent. Where the mode of
administration is infusion, composition can be dispensed with an
infusion bottle containing sterile pharmaceutical grade water or
saline. Where the mode of administration is by injection, an
ampoule of sterile water for injection or saline can be provided so
that the ingredients may be mixed prior to administration.
[0282] In particular, the invention also provides that one or more
of the antibodies, or pharmaceutical compositions, of the invention
is packaged in a hermetically sealed container such as an ampoule
or sachette indicating the quantity of the antibody. In one
embodiment, one or more of the antibodies, or pharmaceutical
compositions of the invention is supplied as a dry sterilized
lyophilized powder or water free concentrate in a hermetically
sealed container and can be reconstituted (e.g., with water or
saline) to the appropriate concentration for administration to a
subject. In one embodiment, one or more of the antibodies or
pharmaceutical compositions of the invention is supplied as a dry
sterile lyophilized powder in a hermetically sealed container at a
unit dosage of at least 5 mg, for example at least 10 mg, at least
15 mg, at least 25 mg, at least 35 mg, at least 45 mg, at least 50
mg, at least 75 mg, or at least 100 mg. The lyophilized antibodies
or pharmaceutical compositions of the invention should be stored at
between 2.degree. C. and 8.degree. C. in its original container and
the antibodies, or pharmaceutical compositions of the invention
should be administered within 1 week, for example within 5 days,
within 72 hours, within 48 hours, within 24 hours, within 12 hours,
within 6 hours, within 5 hours, within 3 hours, or within 1 hour
after being reconstituted. In an alternative embodiment, one or
more of the antibodies or pharmaceutical compositions of the
invention is supplied in liquid form in a hermetically sealed
container indicating the quantity and concentration of the
antibody. In a further embodiment, the liquid form of the
administered composition is supplied in a hermetically sealed
container at least 0.25 mg/ml, for example at least 0.5 mg/ml, at
least 1 mg/ml, at least 2.5 mg/ml, at least 5 mg/ml, at least 8
mg/ml, at least 10 mg/ml, at least 15 mg/ml, at least 25 mg/ml, at
least 50 mg/ml, at least 75 mg/ml or at least 100 mg/ml. The liquid
form should be stored at between 2.degree. C. and 8.degree. C. in
its original container.
[0283] The antibodies of the invention can be incorporated into a
pharmaceutical composition suitable for parenteral administration.
In one aspect, antibodies will be prepared as an injectable
solution containing 0.1-250 mg/ml antibody. The injectable solution
can be composed of either a liquid or lyophilized dosage form in a
flint or amber vial, ampule or pre-filled syringe. The buffer can
be L-histidine (1-50 mM), optimally 5-10 mM, at pH 5.0 to 7.0
(optimally pH 6.0). Other suitable buffers include but are not
limited to, sodium succinate, sodium citrate, sodium phosphate or
potassium phosphate. Sodium chloride can be used to modify the
tonicity of the solution at a concentration of 0-300 mM (optimally
150 mM for a liquid dosage form). Cryoprotectants can be included
for a lyophilized dosage form, principally 0-10% sucrose (optimally
0.5-1.0%). Other suitable cryoprotectants include trehalose and
lactose. Bulking agents can be included for a lyophilized dosage
form, principally 1-10% mannitol (optimally 2-4%). Stabilizers can
be used in both liquid and lyophilized dosage forms, principally
1-50 mM L-Methionine (optimally 5-10 mM). Other suitable bulking
agents include glycine, arginine, can be included as 0-0.05%
polysorbate-80 (optimally 0.005-0.01%). Additional surfactants
include but are not limited to polysorbate 20 and BRIJ surfactants.
The pharmaceutical composition comprising the antibodies of the
invention prepared as an injectable solution for parenteral
administration, can further comprise an agent useful as an
adjuvant, such as those used to increase the absorption, or
dispersion of the antibody. A particularly useful adjuvant is
hyaluronidase, such as Hylenex.RTM. (recombinant human
hyaluronidase). Addition of hyaluronidase in the injectable
solution improves human bioavailability following parenteral
administration, particularly subcutaneous administration. It also
allows for greater injection site volumes (i.e. greater than 1 ml)
with less pain and discomfort, and minimum incidence of injection
site reactions. (See International Appln. Publication No. WO
04/078140 and U.S. Patent Appln. Publication No. US2006104968,
incorporated herein by reference.)
[0284] The compositions of this invention may be in a variety of
forms. These include, for example, liquid, semi-solid and solid
dosage forms, such as liquid solutions (e.g., injectable and
infusible solutions), dispersions or suspensions, tablets, pills,
powders, liposomes and suppositories. The preferred form depends on
the intended mode of administration and therapeutic application.
Compositions can be in the form of injectable or infusible
solutions, such as compositions similar to those used for passive
immunization of humans with other antibodies. In one embodiment,
the antibody is administered by intravenous infusion or injection.
In another embodiment, the antibody is administered by
intramuscular or subcutaneous injection.
[0285] Therapeutic compositions typically must be sterile and
stable under the conditions of manufacture and storage. The
composition can be formulated as a solution, microemulsion,
dispersion, liposome, or other ordered structure suitable to high
drug concentration. Sterile injectable solutions can be prepared by
incorporating the active compound (i.e., a binding protein, e.g. an
antibody, of the present invention) in the required amount in an
appropriate solvent with one or a combination of ingredients
enumerated above, as required, followed by filtered sterilization.
Generally, dispersions are prepared by incorporating the active
compound into a sterile vehicle that contains a basic dispersion
medium and the required other ingredients from those enumerated
above. In the case of sterile, lyophilized powders for the
preparation of sterile injectable solutions, methods of preparation
comprise vacuum drying and spray-drying that yields a powder of the
active ingredient plus any additional desired ingredient from a
previously sterile-filtered solution thereof. The proper fluidity
of a solution can be maintained, for example, by the use of a
coating such as lecithin, by the maintenance of the required
particle size in the case of dispersion and by the use of
surfactants. Prolonged absorption of injectable compositions can be
brought about by including, in the composition, an agent that
delays absorption, for example, monostearate salts and gelatin.
[0286] The antibodies of the present invention can be administered
by a variety of methods known in the art. For many therapeutic
applications, the route/mode of administration may be subcutaneous
injection, intravenous injection or infusion. As will be
appreciated by the skilled artisan, the route and/or mode of
administration will vary depending upon the desired results. In
certain embodiments, the active compound may be prepared with a
carrier that will protect the compound against rapid release, such
as a controlled release formulation, including implants,
transdermal patches, and microencapsulated delivery systems.
Biodegradable, biocompatible polymers can be used, such as ethylene
vinyl acetate, polyanhydrides, polyglycolic acid, collagen,
polyorthoesters, and polylactic acid. Many methods for the
preparation of such formulations are patented or generally known to
those skilled in the art. See, e.g., Sustained and Controlled
Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker,
Inc., New York, 1978.
[0287] In certain embodiments, an antibody of the invention may be
orally administered, for example, with an inert diluent or an
assimilable edible carrier. The antibody (and other ingredients, if
desired) may also be enclosed in a hard or soft shell gelatin
capsule, compressed into tablets, or incorporated directly into the
subject's diet. For oral therapeutic administration, the antibody
may be incorporated with excipients and used in the form of
ingestible tablets, buccal tablets, troches, capsules, elixirs,
suspensions, syrups, wafers, and the like. To administer an
antibody of the invention by other than parenteral administration,
it may be necessary to coat the antibody with, or co-administer the
antibody with, a material to prevent its inactivation.
[0288] Supplementary active compounds can also be incorporated into
the compositions. In certain embodiments, an antibody of the
invention is coformulated with and/or coadministered with one or
more additional therapeutic agents that are useful for treating
disorders or diseases described herein. For example, an anti-RGMa
antibody of the invention may be coformulated and/or coadministered
with one or more additional antibodies that bind other targets
(e.g., antibodies that bind other soluble antigens or that bind
cell surface molecules). Furthermore, one or more antibodies of the
invention may be used in combination with two or more of the
foregoing therapeutic agents. Such combination therapies may
advantageously utilize lower dosages of the administered
therapeutic agents, thus avoiding possible toxicities or
complications associated with the various monotherapies.
[0289] In certain embodiments, an antibody of the invention is
linked to a half-life extending vehicle known in the art. Such
vehicles include, but are not limited to, the Fc domain,
polyethylene glycol, and dextran. Such vehicles are described,
e.g., in U.S. application Ser. No. 09/428,082 and published PCT
Application No. WO 99/25044, which are hereby incorporated by
reference for any purpose.
[0290] In a specific embodiment, nucleic acid sequences comprising
nucleotide sequences encoding an antibody of the invention are
administered to treat, prevent, manage, or ameliorate a disorder or
one or more symptoms thereof by way of gene therapy. Gene therapy
refers to therapy performed by the administration to a subject of
an expressed or expressible nucleic acid. In this embodiment of the
invention, the nucleic acids produce their encoded antibody of the
invention that mediates a prophylactic or therapeutic effect.
[0291] Any of the methods for gene therapy available in the art can
be used according to the present invention. For general reviews of
the methods of gene therapy, see Goldspiel et al., 1993, Clinical
Pharmacy 12:488-505; Wu and Wu, 1991, Biotherapy 3:87-95;
Tolstoshev, 1993, Ann. Rev. Pharmacol. Toxicol. 32:573-596;
Mulligan, Science 260:926-932 (1993); and Morgan and Anderson,
1993, Ann. Rev. Biochem. 62:191-217; May, 1993, TIBTECH
11(5):155-215. Methods commonly known in the art of recombinant DNA
technology which can be used are described in Ausubel et al.
(eds.), Current Protocols in Molecular Biology, John Wiley &
Sons, N Y (1993); and Kriegler, Gene Transfer and Expression, A
Laboratory Manual, Stockton Press, NY (1990). Detailed description
of various methods of gene therapy are disclosed in US20050042664
A1 which is incorporated herein by reference.
[0292] Antibodies of the invention can be used alone or in
combination to treat diseases or conditions associated with neurite
degeneration, such as multiple sclerosis, Alzheimer's disease, Down
syndrome, dementia, Parkinson's disease, a traumatic injury to the
central nervous system, or any other disease or condition
associated with RGMa.
[0293] It should be understood that the antibodies of the invention
can be used alone or in combination with one or more additional
agents, e.g., a therapeutic agent (for example, a small molecule or
biologic), said additional agent being selected by the skilled
artisan for its intended purpose. For example, the additional
therapeutic agent may be an immunosuppressant or an agent that
treats one or more symptoms associated with multiple sclerosis. The
additional drug may be a beta interferon. Beta interferons, such as
Avonex, Betaseron, Extavia and Rebif, may slow the rate at which
multiple sclerosis symptoms worsen over time. The additional agent
may be Glatiramer (Copaxone), which may block the immune system's
attack on myelin. The additional agent may be Fingolimod (Gilenya),
which may trap immune cells in lymph nodes. The additional agent
may be Natalizumab (Tysabri), which may interfere with the movement
of potentially damaging immune cells from the bloodstream to the
brain and spinal cord. The additional drug may be Mitoxantrone
(Novantrone), which is an immunosuppressant drug.
[0294] The additional therapeutic agent can be a "cognitive
enhancing drug," which is a drug that improves impaired human
cognitive abilities of the brain (namely, thinking, learning, and
memory). Cognitive enhancing drugs work by altering the
availability of neurochemicals (e.g., neurotransmitters, enzymes,
and hormones), by improving oxygen supply, by stimulating nerve
growth, or by inhibiting nerve damage. Examples of cognitive
enhancing drugs include a compound that increases the activity of
acetylcholine such as, but not limited to, an acetylcholine
receptor agonist (e.g., a nicotinic .alpha.-7 receptor agonist or
allosteric modulator, an .alpha.4.beta.2 nicotinic receptor agonist
or allosteric modulators), an acetylcholinesterase inhibitor (e.g.,
donepezil, rivastigmine, and galantamine), a butyrylcholinesterase
inhibitor, an N-methyl-D-aspartate (NMDA) receptor antagonist
(e.g., memantine), an activity-dependent neuroprotective protein
(ADNP) agonist, a serotonin 5-HT1A receptor agonist (e.g.,
xaliproden), a 5-HT4 receptor agonist, a 5-HT6 receptor antagonist,
a serotonin 1A receptor antagonist, a histamine H3 receptor
antagonist, a calpain inhibitor, a vascular endothelial growth
factor (VEGF) protein or agonist, a trophic growth factor, an
anti-apoptotic compound, an AMPA-type glutamate receptor activator,
a L-type or N-type calcium channel blocker or modulator, a
potassium channel blocker, a hypoxia inducible factor (HIF)
activator, a HIF prolyl 4-hydroxylase inhibitor, an
anti-inflammatory agent, an inhibitor of amyloid A.beta. peptide or
amyloid plaque, an inhibitor of tau hyperphosphorylation, a
phosphodiesterase 5 inhibitor (e.g., tadalafil, sildenafil), a
phosphodiesterase 4 inhibitor, a monoamine oxidase inhibitor, or
pharmaceutically acceptable salt thereof. Specific examples of such
cognitive enhancing drugs include, but are not limited to,
cholinesterase inhibitors such as donepezil (Aricept.RTM.),
rivastigmine (Exelon.RTM.), galanthamine (Reminyl.RTM.),
N-methyl-D-aspartate antagonists such as memantine (Namenda.RTM.).
At least one cognitive enhancing drug can be administered
simultaneously with the antibodies of the present invention or
sequentially with the antibodies of the present invention (and in
any order) including those agents currently recognized, or in the
future being recognized, as useful to treat the disease or
condition being treated by an antibody of the present invention).
Additionally, it is believed that the combinations described herein
may have additive or synergistic effects when used in the
abovedescribed treatment. The additional agent also can be an agent
that imparts a beneficial attribute to the therapeutic composition,
e.g., an agent that affects the viscosity of the composition.
[0295] It should further be understood that the combinations are
those combinations useful for their intended purpose. The agents
set forth above are for illustrative purposes and not intended to
be limiting. The combinations can comprise an antibody and at least
one additional agent selected from the lists below. The combination
can also include more than one additional agent, e.g., two or three
additional agents if the combination is such that the formed
composition can perform its intended function.
[0296] The pharmaceutical compositions may include a
"therapeutically effective amount" or a "prophylactically effective
amount" of an antibody. A "therapeutically effective amount" refers
to an amount effective, at dosages and for periods of time
necessary, to achieve the desired therapeutic result. A
therapeutically effective amount of the antibody may be determined
by a person skilled in the art and may vary according to factors
such as the disease state, age, sex, and weight of the individual,
and the ability of the antibody to elicit a desired response in the
individual. A therapeutically effective amount is also one in which
toxic or detrimental effects, if any, of the antibody are
outweighed by the therapeutically beneficial effects. A
"prophylactically effective amount" refers to an amount effective,
at dosages and for periods of time necessary, to achieve the
desired prophylactic result. Typically, since a prophylactic dose
is used in subjects prior to or at an earlier stage of disease, the
prophylactically effective amount will be less than the
therapeutically effective amount.
[0297] Dosage regimens may be adjusted to provide the optimum
desired response (e.g., a therapeutic or prophylactic response).
For example, a single bolus may be administered, several divided
doses may be administered over time or the dose may be
proportionally reduced or increased as indicated by the exigencies
of the therapeutic situation. It is especially advantageous to
formulate parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage. Dosage unit form as used
herein refers to physically discrete units suited as unitary
dosages for the mammalian subjects to be treated; each unit
containing a predetermined quantity of active compound calculated
to produce the desired therapeutic effect in association with the
required pharmaceutical carrier. The specification for the dosage
unit forms are dictated by and directly dependent on (a) the unique
characteristics of the active compound and the particular
therapeutic or prophylactic effect to be achieved, and (b) the
limitations inherent in the art of compounding such an active
compound for the treatment of sensitivity in individuals.
[0298] An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of the antibody is a dose of
between 0.1 and 200 mg/kg, for example between 0.1 and 10 mg/kg.
The therapeutically or prophylactically effective amount of the
antibody may be between 1 and 200 mg/kg, 10 and 200 mg/kg, 20 and
200 mg/kg, 50 and 200 mg/kg, 75 and 200 mg/kg, 100 and 200 mg/kg,
150 and 200 mg/kg, 50 and 100 mg/kg, 5 and 10 mg/kg, or 1 and 10
mg/kg. It is to be noted that dosage values may vary with the type
and severity of the condition to be alleviated. Further, the
antibody dose may be determined by a person skilled in the art and
may vary according to factors such as the disease state, age, sex,
and weight of the individual, and the ability of the antibody to
elicit a desired response in the individual. The dose is also one
in which toxic or detrimental effects, if any, of the antibody are
outweighed by the therapeutically beneficial effects. It is to be
further understood that for any particular subject, specific dosage
regimens should be adjusted over time according to the individual
need and the professional judgment of the person administering or
supervising the administration of the compositions, and that dosage
ranges set forth herein are exemplary only and are not intended to
limit the scope or practice of the claimed composition.
4. Method of Treating, Preventing, Modulating or Attenuating a
Disease Associated with Neurite Degeneration
[0299] In any subject, an assessment may be made as to whether the
subject has a neurite degenerative disorder. The assessment may
indicate an appropriate course of therapy, such as preventative
therapy, maintenance therapy, or modulative therapy. Accordingly,
provided herein is a method of treating, preventing, modulating, or
attenuating a disease/disorder of neurite degeneration. The
antibody may be administered to a subject in need thereof. The
antibody may be administered in a therapeutically effective
amount.
[0300] In general, the dosage of administered antibodies will vary
depending upon such factors as the patient's age, weight, height,
sex, general medical condition and previous medical history.
Typically, it is desirable to provide the recipient with a dosage
of antibody component, immunoconjugate or fusion protein which is
in the range of from about 1 pg/kg to 10 mg/kg (amount of
agent/body weight of patient), although a lower or higher dosage
also may be administered as circumstances dictate. Dosage regimens
may be adjusted to provide the optimum desired response (e.g., a
therapeutic or prophylactic response). For example, a single bolus
may be administered, several divided doses may be administered over
time or the dose may be proportionally reduced or increased as
indicated by the exigencies of the therapeutic situation. It is
especially advantageous to formulate parenteral compositions in
dosage unit form for ease of administration and uniformity of
dosage. Dosage unit form as used herein refers to physically
discrete units suited as unitary dosages for the mammalian subjects
to be tested; each unit containing a predetermined quantity of
active compound calculated to produce the desired therapeutic
effect in association with the required pharmaceutical carrier. The
specification for the dosage unit forms of the present invention
are dictated by and directly dependent on (a) the unique
characteristics of the active compound and the particular
therapeutic or prophylactic effect to be achieved and (b) the
limitations inherent in the art of compounding such an active
compound for the treatment of sensitivity in individuals.
[0301] An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of an antibody or antibody
portion of the invention is 0.1-20 mg/kg, more preferably 0.5-10
mg/kg. It is to be noted that dosage values may vary with the type
and severity of the condition to be alleviated. It is to be further
understood that for any particular subject, specific dosage
regimens should be adjusted over time according to the individual
need and the professional judgment of the person administering or
supervising the administration of the compositions, and that dosage
ranges set forth herein are exemplary only and are not intended to
limit the scope or practice of the claimed composition.
[0302] Administration of antibodies to a patient can be
intravenous, intraarterial, intraperitoneal, intramuscular,
subcutaneous, intrapleural, intrathecal, intraocular, intravitreal,
by perfusion through a regional catheter, or by direct
intralesional injection. When administering therapeutic proteins by
injection, the administration may be by continuous infusion or by
single or multiple boluses. Intravenous injection provides a useful
mode of administration due to the thoroughness of the circulation
in rapidly distributing antibodies. The antibody may be
administered orally, for example, with an inert diluent or an
assimilable edible carrier. The antibody and other ingredients, if
desired, may be enclosed in a hard or soft shell gelatin capsule,
compressed into tablets, buccal tablets, troches, capsules,
elixirs, sspensions, syrups, wafers, and the like.
[0303] Anti-RGMa antibodies may be administered at low protein
doses, such as 20 milligrams to 2 grams protein per dose, given
once, or repeatedly, parenterally. Alternatively, the antibodies
may be administered in doses of 20 to 1000 milligrams protein per
dose, or 20 to 500 milligrams protein per dose, or 20 to 100
milligrams protein per dose.
[0304] The antibodies may be administered alone or they may be
conjugated to liposomes, and can be formulated according to known
methods to prepare pharmaceutically useful compositions, whereby
the antibodies are combined in a mixture with a pharmaceutically
acceptable carrier. A "pharmaceutically acceptable carrier" may be
tolerated by a recipient patient. Sterile phosphate-buffered saline
is one example of a pharmaceutically acceptable carrier. Other
suitable carriers are well known to those in the art. See, for
example, REMINGTON'S PHARMACEUTICAL SCIENCES, 19th Ed. (1995).
[0305] For purposes of therapy, antibodies are administered to a
patient in a therapeutically effective amount in a pharmaceutically
acceptable carrier. A "therapeutically effective amount" is one
that is physiologically significant. The antibody is
physiologically significant if its presence results in a detectable
change in the physiology of a recipient patient. In the present
context, the antibody may be physiologically significant if its
presence results in, for example, decreased interferon-.gamma.
(INF-.gamma.), interleukin-2 (IL-2), IL-4 and/or IL-17 secretion
from CD4.sup.+ T cells. An agent is physiologically significant if
its presence results in, for example, reduced proliferative
responses and/or pro-inflammatory cytokine expression in peripheral
blood mononuclear cells (PBMCs).
[0306] Additional treatment methods may be employed to control the
duration of action of an antibody in a therapeutic application.
Control release preparations can be prepared through the use of
polymers to complex or adsorb the antibody. For example,
biocompatible polymers include matrices of poly(ethylene-co-vinyl
acetate) and matrices of a polyanhydride copolymer of a stearic
acid dimer and sebacic acid. Sherwood et al., Bio/Technology
10:1446 (1992). The rate of release of an antibody from such a
matrix depends upon the molecular weight of the protein, the amount
of antibody within the matrix, and the size of dispersed particles.
Saltzman et al., Biophys. J. 55:163 (1989); Sherwood et al., supra.
Other solid dosage forms are described in REMINGTON'S
PHARMACEUTICAL SCIENCES, 19th ed. (1995).
[0307] a. Neurite Degenerative Disorders/Diseases
[0308] The neurite disorder/disease may be any disease or disorder
in which there is neurite damage and compromised synaptic function.
This damage and compromised function may result from nerves lacking
sufficient myelination and/or axon transection. The neurite
degenerative disorder or disease may be multiple sclerosis,
Alzheimer's disease, Parkinson's disease, amyotrophic lateral
sclerosis and other motoneuron diseases, huntington's disease,
Tay-Sachs disease, Niemann-Pick disease, Gaucher's disease,
Hurler's syndrome, idiopathic inflammatory demyelinating diseases,
vitamin B12 deficiency, central pontine myelinolysis, tabes
dorsalis, transverse myelitis, Devic's disease, progressive
multifocal leukoencephalopathy, optic neuritis and other
retinopathies associated with neurite degeneration, such as
glaucoma, diabetic neuropathy and age-dependent macular
degeneration, traumatic injury to the central nervous system, or
leukodystrophies for example. The neurite degenerative disorder or
disease may result from nerve fibers lacking sufficient wrapping of
layers of tissue composed of a fat (lipoprotein) called myelin.
These layers form the myelin sheath. The myelin sheath may enable
electrical impulses to be conducted along the nerve fiber with
speed and accuracy. When the myelin sheath is damaged or is
missing, nerves do not conduct electrical impulses normally.
Sometimes, as a result of the damaged or missing myelin sheath, the
nerve fibers may also be damaged.
[0309] Young infants may normally lack mature myelin sheaths. As a
result, their movements are jerky, uncoordinated, and awkward. As
myelin sheaths develop, movements become smoother, more purposeful,
and more coordinated. However, myelin sheaths do not develop
normally in children with certain diseases, such as Tay-Sachs
disease, Niemann-Pick disease, Gaucher's disease, and Hurler's
syndrome.
[0310] In adults, the myelin sheath can be destroyed by stroke,
inflammation, immune disorders, metabolic disorders, and
nutritional deficiencies (such as a lack of vitamin B12). Poisons,
drugs (such as the antibiotic ethambutol), and excessive use of
alcohol can damage or destroy the myelin sheath. If the sheath is
able to repair and regenerate itself, normal nerve function may
return. However, if the sheath is severely damaged, the underlying
nerve fiber can die. Because nerve fibers in the central nervous
system (brain and spinal cord) rarely regenerate, such damage is
irreversible.
[0311] Some neurite degenerative disorders that cause demyelination
affect mainly the central nervous system. Others affect mainly
nerves in other parts of the body. Neurite degenerative disorders
that cause demyelination in the central nervous system and have no
known cause are called primary demyelinating disorders. Multiple
sclerosis is the most common of these disorders.
[0312] (1) Multiple Sclerosis
[0313] The clinical course of MS may be divided into four major
categories (or subtypes): relapsing remitting (RRMS), secondary
progressive (SPMS), primary progressive (PMS) and progressive
relapsing (PRMS). Patients who have clinical relapses every few
months or years with intervening periods of clinically stability
define RRMS. RRMS may be twice more common in females than males in
the second or third decade of life. In contrast to RRMS, patients
with SPMS display progressive deterioration between relapses. RRMS
patients may convert to SPMS over time characterized by a gradual
decline in neurological function. Approximately 15% of MS patients
have PPMS characterized by late onset and an unrelenting
deterioration of neurological function from disease onset. Benign
MS is arbitrarily defined as those RRMS patients who after more
than 15 years following initial diagnosis are still mobile and show
only mild deficits (Expanded Disability Status Scale [EDSS]).
Typically, these patients show little or no progression after their
initial attack and require no therapeutic intervention; however, it
is not possible to diagnose this form of MS until 5 years from MS
onset.
[0314] (2) Parkinson's Disease
[0315] Parkinson's disease is widespread throughout the Western
hemisphere and was first reported by physician James Parkinson in
1817. Parkinson's disease may be first detected as a tremor in a
limb, and may ultimately progress to include three other
manifestations: (i) rigidity, which is characterized by "cog wheel"
like movement and "lead pipe" rigidity; (ii) bradykinesia or
slowness in movement, and (iii) postural instability associated
with a stooped stance and an impaired gait. These altered movements
are features of a motor dysfunction, but in addition there can also
be a mental impairment in as many as 40% of all Parkinson's
patients.
[0316] Parkinson's disease may be caused by a deficient state of
levodopamine in the brain. More specifically, levodopamine may
induce dyskinesis in Parkinson's patients and result of denervation
of the substantia nigra. To date, medical science has not found a
substrate that would allow an injectable form of levodopa to reach
the brain and successfully cross the blood brain barrier. The
current dopamine replacement therapy is aimed at either direct
replacement or mimicking the action at the dopamine receptor sites
in the brain. While the levodopa therapy may create some beneficial
changes initially, those changes may wane over time, and produce
other problems such as severe sleep disturbance, dyskinesias, and
constant nausea. Medical approaches to Parkinson's disease include
surgical destruction of the tissue of the brain and the insertion
of microelectrodes (deep brain electrical stimulation) to affected
portions of the brain. The insertion of electrodes has the
advantage of being reversible. These interventions, however, are
generally transient and neither produces a permanent change in the
Parkinsonian state nor reverses the effects of the disease.
[0317] Parkinson's disease may be a multifactor, neurodegenerative
disorder, which evolves due to excessive oxidation. The substantia
nigra is susceptible to oxidative damage which supports this theory
of the formation of Parkinson's disease. Abnormalities of the
oxidative phosphorylation impair the mitochondria of the substantia
nigra, and intensify free radical generation.
[0318] (3) Injury from Reactive Oxygen Species (Free Radicals)
[0319] Reactive oxygen species (ROS) may attack several types of
tissues and chronic exposure to ROS may attenuate various
biological functions and increase the risk of several types of
serious disorders, including neurite degenerative disorders and
diseases. ROS can attack neurons and induce cell death. For
example, treatment of neurons with low concentrations of hydrogen
peroxide may induce neurite injury by influencing detrimental
changes in neurite morphology, sometimes called neurite beading.
Neurite beading may be one of the early events of neuronal
degeneration prior to induction of death of hydrogen
peroxide-treated neurons.
[0320] (4) Alzheimer's Disease
[0321] Alzheimer's disease (AD) is the major cause of dementia in
the elderly. Although rare genetic forms of AD exist, most patients
are classified as having sporadic AD, since no family history is
usually identified. Pathologically, AD is characterized by neuronal
and synaptic degeneration with an increased number of senile
plaques and neurofibrillary tangles compared to non-demented
individuals of comparable age.
[0322] The senile plaques, characteristic of Alzheimer's disease,
are composed of a central core of aggregated beta-amyloid, a
breakdown product of amyloid precursor protein (APP). The
neurofibrillary tangles are insoluble intracellular thread-like
structures made up of a hyperphosphorylated form of a protein
called tau, which is associated with microtubules.
[0323] Post-mortem slices of brain tissue of victims of Alzheimer's
disease exhibit the presence of amyloid in the form of
proteinaceous extracellular cores of the neuritic plaques that are
characteristic of AD. The amyloid cores of these neuritic plaques
are composed of a protein called .beta.-amyloid that is arranged in
a predominately beta-pleated sheet configuration. Mori et al.,
Journal of Biological Chemistry 267: 17082 (1992); Kirschner et
al., PNAS 83: 503 (1986). Neuritic plaques are an early and
invariant aspect of the disease. Mann et al., J. Neurol. Sci. 89:
169; Mann, Mech. Ageing Dev. 31: 213 (1985); Terry et al., J.
Neuropathol. Exp. Neurol 46: 262 (1987).
[0324] The initial deposition of A.beta. may occur before clinical
symptoms are noticeable. The currently recommended "minimum
microscopic criteria" for the diagnosis of AD is based on the
number of neuritic plaques found in brain. Khachaturian, Arch.
Neurol., supra (1985). Unfortunately, assessment of neuritic plaque
counts must be delayed until after death.
[0325] Amyloid-containing neuritic plaques are a prominent feature
of selective areas of the brain in AD as well as Down's Syndrome
and in persons homozygous for the apolipoprotein E4 allele who are
very likely to develop AD. Corder et al., Science 261: 921 (1993);
Divry, P., J. Neurol. Psych. 27: 643-657 (1927); Wisniewski et al.,
in Zimmerman, H. M. (ed.): PROGRESS IN NEUROPATHOLOGY (Grune and
Stratton, N.Y. 1973) pp. 1-26. Brain amyloid is readily
demonstrated by staining brain sections with thioflavin S or Congo
red. Puchtler et al., J. Histochem. Cytochem. 10: 35 (1962). Congo
red stained amyloid is characterized by a dichroic appearance,
exhibiting a yellow-green polarization color. The dichroic binding
is the result of the beta-pleated sheet structure of the amyloid
proteins. Glenner, G. N. Eng. J. Med. 302: 1283 (1980). A detailed
discussion of the biochemistry and histochemistry of amyloid can be
found in Glenner, N. Eng. J. Med., 302: 1333 (1980).
[0326] (5) Traumatic Injury to Central Nervous System
[0327] The incidence of traumatic brain injury (TBI) in the United
States is conservatively estimated to be more than 2 million
persons annually with approximately 500,000 hospitalizations. Of
these, about 70,000 to 90,000 head injury survivors are permanently
disabled.
[0328] Neural pathways in the central nervous system of a subject
are at risk if neurons are subjected to mechanical or chemical
trauma or to neuropathic degeneration sufficient to put neurons at
risk of dying. A host of neuropathies, some of which affect only a
subpopulation or a system of neurons in the peripheral or central
nervous systems have been identified to date. The neuropathies,
which may affect the neurons themselves or the associated glial
cells, may result from cellular metabolic dysfunction, infection,
exposure to toxic agents, autoimmunity dysfunction, malnutrition or
ischemia. In some cases the cellular dysfunction is thought to
induce cell death directly. In other cases, the neuropathy may
induce sufficient tissue necrosis to stimulate the body's
immune/inflammatory system and the mechanisms of the body's immune
response to the initial neural injury then destroys the neurons and
the pathway defined by these neurons.
[0329] b. Subject
[0330] The subject may be a mammal, which may be a human. The
subject may have, or be at risk of developing a neurite
degenerative disorder or disease. The subject may already be
undergoing treatment for a neurite degenerative disorder or
disease.
5. Method of Diagnosis
[0331] Provided herein is a method for determining whether a
subject has neurite degenerative disease or disorder. The level of
membrane associated RGMa may be measured and compared to a level of
RGMa in a control sample. The control sample may be from a normal
tissue. An altered level of RGMa as compared to the control may
indicate that the subject has a neurite degenerative disease or
disorder. For example, an increased level of RGMa, as compared to a
normal control, may indicate that the subject has a neurite
degenerative disease or disorder. The level of RGMa may be measured
using the herein described antibodies.
[0332] a. Sample
[0333] The sample may be any tissue sample from the subject. The
sample may comprise protein from the subject. The sample may be
blood serum, plasma, or a tissue biopsy. The sample may be used
directly as obtained from the subject or following pretreatment to
modify a characteristic of the sample. Pretreatment may include
extraction, concentration, inactivation of interfering components,
and/or the addition of reagents.
[0334] Any cell type, tisse, or bodily fluid may be utilized to
obtain a sample. Such cell types, tissues, and fluid may include
sections of tissues such as biopsy and autopsy samples, frozen
sections taken for histologic purposes, blood, plasma, serum
sputum, stool, tears, mucus, saliva, hair, and skin. Cell types and
tissues may also include lymph fluid, ascetic fluid, gynecological
fluid, urine, peritoneal fluid, cerebrospinal fluid, a fluid
collected by vaginal rinsing, or a fluid collected by vaginal
flushing. A tissue or cell type may be provided by removing a
sample of cells from an animal, but can also be accomplished by
using previously isolated cells (e.g. isolated by another person,
at another time, and/or for another purpose). Archival tissues,
such as those having treatment or outcome history, may also be
used. Protein purification may not be necessary.
[0335] b. RGMa Detection
[0336] The presence or amount of RGMa present in a body sample may
be readily determined by, for example, mass spectrometry,
immunoassays or immunohistochemistry (e.g. with sections from
tissue biopsies) using the herein described antibodies (monoclonal
or polyclonal) or fragments thereof against RGMa. Anti-RGMa
antibodies and fragments thereof can be produced as described
above. Other methods of detection include those described in, for
example, U.S. Pat. Nos. 6,143,576; 6,113,855; 6,019,944; 5,985,579;
5,947,124; 5,939,272; 5,922,615; 5,885,527; 5,851,776; 5,824,799;
5,679,526; 5,525,524; and 5,480,792, each of which is hereby
incorporated by reference in its entirety.
[0337] (1) Immunoassay
[0338] RGMa, and/or peptides thereof, may be analyzed using an
immunoassay. The presence or amount of RGMa can be determined using
the herein described antibodies and detecting specific binding to
RGMa. For example, the antibody, or fragment thereof, may
specifically bind to a polypeptide comprising SEQ ID NO:65, or a
fragment thereof. The antibody, or fragment thereof, may
specifically bind to a polypeptide comprising SEQ ID NO:66, or a
fragment thereof.
[0339] Any immunoassay may be utilized. The immunoassay may be an
enzyme-linked immunoassay (ELISA), radioimmunoassay (RIA), a
competitive inhibition assay, such as forward or reverse
competitive inhibition assays, a fluorescence polarization assay,
or a competitive binding assay, for example. The ELISA may be a
sandwich ELISA. Specific immunological binding of the antibody to
the RGMa can be detected via direct labels, such as fluorescent or
luminescent tags, metals and radionuclides attached to the antibody
or via indirect labels, such as alkaline phosphatase or horseradish
peroxidase.
[0340] The use of immobilized antibodies or fragments thereof may
be incorporated into the immunoassay. The antibodies may be
immobilized onto a variety of supports, such as magnetic or
chromatographic matrix particles, the surface of an assay plate
(such as microtiter wells), pieces of a solid substrate material,
and the like. An assay strip can be prepared by coating the
antibody or plurality of antibodies in an array on a solid support.
This strip can then be dipped into the test biological sample and
then processed quickly through washes and detection steps to
generate a measurable signal, such as a colored spot.
[0341] (a) Sandwich ELISA
[0342] The Sandwich ELISA measures the amount of antigen between
two layers of antibodies (i.e. capture and a detection antibody).
The RGMa to be measured may contain at least two antigenic sites
capable of binding to antibody. Either monoclonal or polyclonal
antibodies may be used as the capture and detection antibodies in
the sandwich ELISA.
[0343] Generally, at least two antibodies are employed to separate
and quantify RGMa or RGMa fragment in a test sample. More
specifically, the at least two antibodies bind to certain epitopes
of RGMa or RGMa fragment forming an immune complex which is
referred to as a "sandwich". One or more antibodies can be used to
capture the RGMa or RGMa fragment in the test sample (these
antibodies are frequently referred to as a "capture" antibody or
"capture" antibodies) and one or more antibodies is used to bind a
detectable (namely, quantifiable) label to the sandwich (these
antibodies are frequently referred to as the "detection" antibody
or "detection" antibodies). In a sandwich assay, both antibodies
binding to their epitope may not be diminished by the binding of
any other antibody in the assay to its respective epitope. In other
words, antibodies may be selected so that the one or more first
antibodies brought into contact with a test sample suspected of
containing RGMa or RGMa fragment do not bind to all or part of an
epitope recognized by the second or subsequent antibodies, thereby
interfering with the ability of the one or more second detection
antibodies to bind to the RGMa or RGMa fragment.
[0344] The antibodies may be used as a first antibody in said
immunoassay. Preferably, the antibody immunospecifically binds to
epitopes comprising at least three contiguous (3) amino acids of
SEQ ID NOs:65, 66 or 74. In addition to the antibodies of the
present invention, said immunoassay may comprise a second antibody
that immunospecifically binds to epitopes having an amino acid
sequence comprising at least three contiguous (3) amino acids of
SEQ ID NO:65, 66 or 74, wherein the contiguous (3) amino acids to
which the second antibody binds is different from the contiguous
(3) amino acids to which the first antibody binds.
[0345] In a preferred embodiment, a test sample suspected of
containing RGMa or RGMa fragment can be contacted with at least one
first capture antibody (or antibodies) and at least one second
detection antibodies either simultaneously or sequentially. In the
sandwich assay format, a test sample suspected of containing RGMa
or RGMa fragment is first brought into contact with the at least
one first capture antibody that specifically binds to a particular
epitope under conditions which allow the formation of a first
antibody-RGMa complex. If more than one capture antibody is used, a
first multiple capture antibody-RGMa complex is formed. In a
sandwich assay, the antibodies, preferably, the at least one
capture antibody, are used in molar excess amounts of the maximum
amount of RGMa or RGMa fragment expected in the test sample. For
example, from about 5 .mu.g/ml to about 1 mg/ml of antibody per ml
of microparticle coating buffer may be used.
[0346] Optionally, prior to contacting the test sample with the at
least one first capture antibody, the at least one first capture
antibody can be bound to a solid support which facilitates the
separation the first antibody-RGMa complex from the test sample.
Any solid support known in the art can be used, including but not
limited to, solid supports made out of polymeric materials in the
forms of wells, tubes or beads. The antibody (or antibodies) can be
bound to the solid support by adsorption, by covalent bonding using
a chemical coupling agent or by other means known in the art,
provided that such binding does not interfere with the ability of
the antibody to bind RGMa or RGMa fragment. Moreover, if necessary,
the solid support can be derivatized to allow reactivity with
various functional groups on the antibody. Such derivatization
requires the use of certain coupling agents such as, but not
limited to, maleic anhydride, N-hydroxysuccinimide and
1-ethyl-3-(3-dimethylaminopropyl)carbodiimide.
[0347] After the test sample suspected of containing RGMa or RGMa
fragment is brought into contact with the at least one first
capture antibody, the test sample is incubated in order to allow
for the formation of a first capture antibody (or multiple
antibody)-RGMa complex. The incubation can be carried out at a pH
of from about 4.5 to about 10.0, at a temperature of from about
2.degree. C. to about 45.degree. C., and for a period from at least
about one (1) minute to about eighteen (18) hours, from about 2-6
minutes, or from about 3-4 minutes.
[0348] After formation of the first/multiple capture antibody-RGMa
complex, the complex is then contacted with at least one second
detection antibody (under conditions which allow for the formation
of a first/multiple antibody-RGMa-second antibody complex). If the
first antibody-RGMa complex is contacted with more than one
detection antibody, then a first/multiple capture
antibody-RGMa-multiple antibody detection complex is formed. As
with first antibody, when the at least second (and subsequent)
antibody is brought into contact with the first antibody-RGMa
complex, a period of incubation under conditions similar to those
described above is required for the formation of the first/multiple
antibody-RGMa-second/multiple antibody complex. Preferably, at
least one second antibody contains a detectable label. The
detectable label can be bound to the at least one second antibody
prior to, simultaneously with or after the formation of the
first/multiple antibody-RGMa-second/multiple antibody complex. Any
detectable label known in the art can be used.
[0349] (b) Forward Competitive Inhibition
[0350] In a forward competitive format, an aliquot of labeled RGMa,
RGMa fragment or RGMa variant thereof of a known concentration is
used to compete with RGMa or RGMa fragment in a test sample for
binding to RGMa antibody (such as an antibody of the present
invention).
[0351] In a forward competition assay, an immobilized antibody
(such as an antibody of the present invention) can either be
sequentially or simultaneously contacted with the test sample and a
labeled RGMa, RGMa fragment or RGMa variant thereof. The RGMa
peptide, RGMa fragment or RGMa variant can be labeled with any
detectable label, including those detectable labels discussed above
in connection with the anti-RGMa antibodies. In this assay, the
antibody can be immobilized on to a solid support. Alternatively,
the antibody can be coupled to an antibody, such as an antispecies
antibody, that has been immobilized on to a solid support, such as
a microparticle.
[0352] The labeled RGMa peptide, RGMa fragment or RGMa variant, the
test sample and the antibody are incubated under conditions similar
to those described above in connection with the sandwich assay
format. Two different species of antibody-RGMa complexes may then
be generated. Specifically, one of the antibody-RGMa complexes
generated contains a detectable label while the other antibody-RGMa
complex does not contain a detectable label. The antibody-RGMa
complex can be, but does not have to be, separated from the
remainder of the test sample prior to quantification of the
detectable label. Regardless of whether the antibody-RGMa complex
is separated from the remainder of the test sample, the amount of
detectable label in the antibody-RGMa complex is then quantified.
The concentration of RGMa or RGMa fragment in the test sample can
then be determined by comparing the quantity of detectable label in
the antibody-RGMa complex to a standard curve. The standard curve
can be generated using serial dilutions of RGMa or RGMa fragment of
known concentration, by mass spectrometry, gravimetrically and by
other techniques known in the art.
[0353] The antibody-RGMa complex can be separated from the test
sample by binding the antibody to a solid support, such as the
solid supports discussed above in connection with the sandwich
assay format, and then removing the remainder of the test sample
from contact with the solid support.
[0354] (c) Reverse Competition Assay
[0355] In a reverse competition assay, an immobilized RGMa peptide,
RGMa fragment or RGMa variant thereof can either be sequentially or
simultaneously contacted with a test sample and at least one
labeled antibody. Preferably, the antibody specifically binds to an
epitope having an amino acid sequence comprising at least three
contiguous (3) amino acids of SEQ ID NO:65 or 66. The RGMa peptide,
RGMa fragment or RGMa variant can be bound to a solid support, such
as the solid supports discussed above in connection with the
sandwich assay format. The RGMa peptide fragment may have an amino
acid sequence that contains SEQ ID NO:65 or 66.
[0356] The immobilized RGMa peptide, RGMa peptide fragment or RGMa
variant thereof, test sample and at least one labeled antibody are
incubated under conditions similar to those described above in
connection with the sandwich assay format. Two different species
RGMa-antibody complexes are then generated. Specifically, one of
the RGMa-antibody complexes generated is immobilized and contains a
detectable label while the other RGMa-antibody complex is not
immobilized and contains a detectable label. The non-immobilized
RGMa-antibody complex and the remainder of the test sample are
removed from the presence of the immobilized RGMa-antibody complex
through techniques known in the art, such as washing. Once the
non-immobilized RGMa antibody complex is removed, the amount of
detectable label in the immobilized RGMa-antibody complex is then
quantified. The concentration of RGMa or RGMa fragment in the test
sample can then be determined by comparing the quantity of
detectable label in the RGMa-complex to a standard curve. The
standard curve can be generated using serial dilutions of RGMa or
RGMa fragment of known concentration, by mass spectrometry,
gravimetrically and by other techniques known in the art.
[0357] (d) Fluorescence Polarization
[0358] In a fluorescence polarization assay, an antibody or
functionally active fragment thereof may first contacted with an
unlabeled test sample suspected of containing RGMa or a RGMa
fragment thereof to form an unlabeled RGMa-antibody complex. The
unlabeled RGMa-antibody complex is then contacted with a
fluorescently labeled RGMa, RGMa fragment or RGMa variant thereof.
The labeled RGMa, RGMa fragment or RGMa variant competes with any
unlabeled RGMa or RGMa fragment in the test sample for binding to
the antibody or functionally active fragment thereof. The amount of
labeled RGMa-antibody complex formed is determined and the amount
of RGMa in the test sample determined via use of a standard
curve.
[0359] The antibody used in a fluorescence polarization assay
specifically binds to an epitope having an amino acid sequence
comprising at least three (3) amino acids from SEQ ID NO:65 or SEQ
ID NO:66 or SEQ ID NO:74.
[0360] The antibody, labeled RGMa peptide, RGMa peptide fragment or
RGMa variant thereof and test sample and at least one labeled
antibody may be incubated under conditions similar to those
described above in connection with the sandwich immunoassay.
[0361] Alternatively, an antibody or functionally active fragment
thereof may be simultaneously contacted with a fluorescently
labeled RGMa, RGMa fragment or RGMa variant thereof and an
unlabeled test sample suspected of containing RGMa or RGMa fragment
thereof to form both labeled RGMa-antibody complexes and unlabeled
RGMa-antibody complexes. The amount of labeled RGMa-antibody
complex formed is determined and the amount of RGMa in the test
sample determined via use of a standard curve.
[0362] Alternatively, an antibody or functionally active fragment
thereof is first contacted with a fluorescently labeled RGMa, RGMa
fragment or RGMa variant thereof to form a labeled RGMa-antibody
complex. The labeled BNP-antibody complex is then contacted with an
unlabeled test sample suspected of containing RGMa or an RGMa
fragment thereof. Any unlabeled RGMa or RGMa fragment in the test
sample competes with the labeled RGMa, RGMa fragment or RGMa
variant for binding to the antibody or functionally active fragment
thereof. The amount of labeled RGMa-antibody complex formed is
determined the amount of RGMa in the test sample determined via use
of a standard curve. The antibody used in this immunoassay
specifically binds to an epitope having an amino acid sequence
comprising at least three contiguous (3) amino acids of SEQ ID
NOs:65, 66 or 74.
[0363] (e) Mass Spectrometry
[0364] Mass spectrometry (MS) analysis may be used alone or in
combination with other methods. Other methods include immunoassays
and those described above to detect specific polynucleotides. The
mass spectrometry method may be used to determine the presence
and/or quantity of one or more biomarkers. MS analysis may comprise
matrix-assisted laser desorption/ionization (MALDI) time-of-flight
(TOF) MS analysis, such as, for example, directed--spot MALDI-TOF
or liquid chromatography MALDI-TOF mass spectrometry analysis. In
some embodiments, the MS analysis comprises electrospray ionization
(ESI) MS, such as liquid chromatography (LC) ESI-MS. Mass analysis
can be accomplished using commercially-available spectrometers.
Methods for utilizing MS analysis, including MALDI-TOF MS and
ESI-MS, to detect the presence and quantity of biomarker peptides
in biological samples may be used. See, for example, U.S. Pat. Nos.
6,925,389; 6,989,100; and 6,890,763 for guidance, each of which is
incorporated herein by reference.
[0365] c. Control
[0366] It may be desirable to include a control sample. The control
sample may be analyzed concurrently with the sample from the
subject as described above. The results obtained from the subject
sample can be compared to the results obtained from the control
sample. Standard curves may be provided, with which assay results
for the biological sample may be compared. Such standard curves
present levels of marker as a function of assay units, i.e.
fluorescent signal intensity, if a fluorescent label is used. Using
samples taken from multiple donors, standard curves can be provided
for control levels of the RGMa in normal tissue, as well as for
"at-risk" levels of the RGMa in tissue taken from donors, who may
have one or more of the characteristics set forth above.
6. Kit
[0367] Provided herein is a kit, which may be used for treating or
diagnosing a subject. The kit may comprise the antibody and a means
for administering the antibody. The kit can further comprise
instructions for using the kit and conducting the analysis,
monitoring, or treatment.
[0368] The kit may also comprise one or more containers, such as
vials or bottles, with each container containing a separate
reagent. The kit may further comprise written instructions, which
may describe how to perform or interpret an analysis, monitoring,
treatment, or method described herein.
[0369] The present invention has multiple aspects, illustrated by
the following non-limiting examples.
EXAMPLES
Example 1
Anti-RGMa Human Monoclonal Antibody Production and Isolation
[0370] Using PROfusion mRNA display technology, pooled human
spleen, tonsil, PBMC and lymph node antibody libraries were
selected through eight rounds against RGMa antigens: 100 nM
biotin-labeled human or rat RGMa. PROfusion technology is described
in U.S. Patent Application Publication Nos: 20100099103 and
20100105569, the contents each of which are herein incorporated by
reference. Selected sc-Fv fragments were reformatted into fully
human IgGs. Following screening of IgGs in RGMa-based ELISAs,
AE12-1 through AE12-8 were identified as positive binders to human
and rat RGMa.
[0371] Antibodies AE12-13, AE12-15, AE12-20, AE12-21, AE12-23, and
AE12-24 are fully human anti-RGMa antibodes identified from large
naive human scFv yeast libraries selected against human RGMa using
standard yeast display technologies. 2 rounds of Magnetic-activated
cell sorting (MACS) and 4 rounds of Fluorescence-activated cell
sorting (FACS) were performed on the libraries using 100 nM
biotinylated human RGMa as the selection antigen. For the last
round of sorting, cells were also negatively selected against a
human RGMc-Fc antigen. Selected sc-Fv fragments were reformatted
into fully human IgGs. Following screening of IgGs in human RGMa
ELISA, AE12-13, -15, -20, -21, -23, and -24 were identified as
positive binders to human RGMa. AE12-13, AE12-15 and AE12-23 also
cross-reacted to human RGMc as evaluated by ELISA.
Example 2
Antibody Characterization
[0372] The 8 PROfusion mAbs (AE12-1, AE12-2, AE12-3, AE12-4,
AE12-5, AE12-6, AE12-7, and AE12-8), were tested by direct binding
ELISAs to examine binding to human RGMa (hRGMa) and rat RGMa and
cross-reactivity to hRGMc. hRGMa competition ELISA was employed to
test if any of these mAbs would compete h5F9.23 for binding to
hRGMa. h5F9.23 is a humanized anti-RGMa lead mAb derived from rat
hybridoma and known to bind the N-terminal domain of RGMa. H5F9.23
has the following sequences:
TABLE-US-00009 VH h5F9.23 151 EVQLVESGGGLVQPGGSLRLSCAASGFT
FSNYGMNWIRQAPGKGLEWIGMIYYDSS EKHYADSVKGRFTISRDNSKNTLYLQMN
SLRAEDTAVYYCAKGTTPDYWGQGTMVT VSS VL h5F9.23 152
DVVLTQSPLSLPVTLGQPASISCRSSQS LEYSDGYTFLEWFQQRPGQSPRLLIYEV
SNRFSGVPDRFSGSGSGTDFTLKISRVE AEDVGVYYCFQATHDPLTFGQGTKLEIK R VH
h5F9.23 CDR-H1 153 NYGMN VH h5F9.23 CDR-H2 154 MIYYDSSEKHYADSVKG VH
h5F9.23 CDR-H3 155 GTTPDY VL h5F9.23 CDR-L1 156 RSSQSLEYSDGYTFLE VL
h5F9.23 CDR-L2 157 EVSNRFS VL h5F9.23 CDR-L3 158 FQATHDPLT
Neogenin or BMP-2/BMP-4 competition ELISA was employed to determine
if these mAbs would block hRGMa binding to its receptor neogenin or
BMP-2/BMP-4.
[0373] Based on ELISA data, all 8 PROfusion mAbs bound to human and
rat RGMa (Table 3). For RGMc binding in ELISA, 3 mAbs (AE12-6, -7
and -8) showed binding to hRGMc, AE12-4 showed weak binding at high
concentrations, and the other 4 mAbs (AE12-1, -2, -3 and -5) showed
no binding to hRGMc at concentrations up to 100 nM. In hRGMa
competition ELISA, AE12-1, AE12-3 and AE12-6 were able to compete
with h5F9.23 in binding to hRGMa, suggesting that the binding
epitopes of these 3 mAbs are near or overlap with h5F9.23 epitope.
Dot blotting assay with hRGMa fragments showed that AE12-1 and
AE12-6 bound the N-terminal fragment, AE12-2 and AE12-4 bound the
C-terminal fragment, and the other 4 Abs did not show any
detectable binding signal. For blocking hRGMa binding to neogenin
in competition ELISA, only AE12-5 and AE12-6 showed blocking
activity comparative to or better than h5F9.23, AE12-1 and AE12-4
showed weak inhibition, and AE12-2, -3, -7, and -8 showed no
inhibition at concentrations up to 100 nM. In BMP-2/BMP-4
competition ELISA, only AE12-1, AE12-4 and AE12-6 blocked hRGMa
binding to BMP-2/BMP-4.
[0374] The PROfusion mAbs were further tested in cell-based binding
assays for their ability to block hRGMa binding to neuronal cells.
In MSD-based cell binding assay in which cells were incubated with
biotinylated hRGMa-Fc at room temperature and the hRGMa binding was
detected by streptavidin-Sulfo-Tag, only AE12-1 and AE12-6 blocked
hRGMa binding to human SH-SY5Y neuronal cells, similar to h5F9.23
(Table 3).
[0375] However, in a high content screening (HCS) assay, in which
cells were incubated with hRGMa-Fc at 37.degree. C. and the hRGMa
binding was detected by Cy3-labeled anti-Fc Ab and calculated with
high content fluorescent image analysis, only AE12-6 among
PROfusion antibodies showed strong inhibition on RGMa binding to
both SH-SY5Y neuronal cells and rat hippocampal primary neurons
(Table 3, FIGS. 13A-13B). FIGS. 13C-13F show, AE12-15 and AE12-23,
the antibodies derived from naive human scFv yeast libraries,
inhibited hRGMa binding to cells.
[0376] The BMP responsive element (BRE) was constructed using
overlapping oligos based on the sequence described by Korchynskyi
and ten Dijke (J. Biol. Chem. 2002, 277:4883), and cloned into a
basic luciferase reporter vector pGL4.27 [luc2P/minP/Hygro]
(Promega) to generate a BRE luciferase reporter construct. RGM
family members (RGMa, RGMb and RGMc) are coreceptors for BMP
signaling. Both RGMa and RGMc BMP reporter assays were established
by cotransfection of 293HEK cells with BMP reporter plasmid and
RGMa or RGMc expression plasmid, and used to screen mAbs for
neutralizing activity towards RGMa and RGMc. In RGMa BMP reporter
assay, AE12-1 and AE12-6 neutralized RGMa activity, consistent with
data from MSD-based cell binding assay (Table 3). In the RGMc BMP
reporter assay, AE12-6 neutralized RGMc activity, whereas AE12-1
did not. Thus, AE12-1 is a neutralizing mAb specific to RGMa.
[0377] The PROfusion mAbs were further tested for their ability to
neutralize RGMa in a chemotaxis assay with SH-SY5Y neuronal cells.
In this assay, RGMa acts as a repulsive molecule to inhibit cell
chemotaxis. AE12-1 showed strong neutralizing activity towards
hRGMa (Table 3). AE12-4 and AE12-6 showed some neutralizing
activity.
[0378] AE12-1 was tested in neurite outgrowth assay with human
SH-SY5Y neuronal cells. In this assay, RGMa, either full-length or
N-terminal fragment, inhibits neurite outgrowth. Consistent with
its functional activity in RGMa BMP reporter assay and chemotaxis
assay, AE12-1 exhibited strong neutralizing activity towards either
full-length hRGMa or N-terminal fragment (Table 3).
[0379] BIAcore analysis of AE12-1 on hRGMc and human, cynomolgus
(cyno) monkey and rat RGMa demonstrated that AE12-1 did not bind
hRGMc but exhibited good cross-reactivity to human, cyno and rat
RGMa with comparable affinity. See Table 4.
TABLE-US-00010 TABLE 3 Clone.fwdarw. AE12-1 AE12-2 AE12-3 AE12-4
AE12-5 AE12-6 AE12-7 AE12-8 h5F9.23 hRGMa ++ ++ ++ + + ++ + + ++
binding (ELISA) Rat RGMa ++ ++ ++ + + ++ + + ++ binding (ELISA)
hRGMc-His - - - +/- - ++ + + ++ ELISA Compete with + - + - - + - -
h5F9.23 for binding to hRGMa (ELISA) Mapping N C .sup.aNeg C
.sup.aNeg N .sup.aNeg .sup.aNeg N hRGMa fragments Compete with +/-
- - +/- ++ +++ - - ++ biot-hRGMa- Fc for binding to neo-His (ELISA)
.sup.b Block ++ - - - - ++ - - ++ hRGMa-Fc binding to SH- SY5Y
cells (MSD) .sup.c Block .sup.d(-) - - - + +++ - - ++ hRGMa-Fc
binding to SH- SY5Y cells (HCS) Compete with ++ - - ++ - ++ - - ++
FL-RGMa-Fc for binding to BMP-2 (ELISA) Compete with ++ - - ++ - ++
.sup.e? - ++ FL-RGMa-Fc for binding to BMP-4 (ELISA) Neutralize ++
- - - - ++ - - ++ hRGMa in RGMa BMP reporter assay Neutralize - - -
- - ++ - - ++ hRGMc in RGMc BMP reporter assay Neuralize +++ - -
.sup.f+ - + - - ++ hRGMa in Chemotaxis with SH-SY5Y cells
Neutralize ++ ++ hRGMa in neurite outgrowth assay
[0380] With respect to Table 3, "Neg" corresponds to negative
binding with all fragments tested in dot blotting. ".sup.bMSD"
corresponds to using biotinylated hRGMa-Fc complexed with
streptavidin-Sulfo-Tag, and incubation with cells at room
temperature (RT). ".sup.cHCS" corresponds to using hRGMa-Fc
complexed with Cy3-labeled anti-Fc Ab, and inbation with cells at
37.degree. C. ".sup.dAE12-1" corresponds to a dramatically enhanced
RGMa-Fc binding to cells, in contrast to inhibiting biotin-RGMa-Fc
binding to SH-SY5Y cells by MSD. ".sup.e?" corresponds to data that
is inconclusive for AE12-7. ".sup.fAE12-4"--the concentration of
AE12-4 in the chemotaxis assay is inversely correlated with
neutralizing activity.
[0381] In a BMP-responsive reporter assay in which RGMa or RGMc
enhances BMP signaling by interacting with BMPs, an antibody
comprising SEQ ID NOs:1 and 5 (AE12-1) blocked RGMa activity but
not RGMc activity, consistent with its functional antagonism and
binding specificity for RGMa.
[0382] FIGS. 13A-F and 14A-H illustrate the neutralizing effects of
the specified antibodies on RGMa binding to neuronal cells using a
live cell binding assay on SH-SY5Y cells and rat hippocampal
primary neurons. Fc-tagged RGMa and Cy3-labeled anti-Fc antibodies
are complexed at 4.degree. C. for 60 minutes, followed by an
incubation of the complex with a blocking antibody at room
temperature for 10 minutes. The RGMa-Cy3+ antibody complex is then
added to cells together with Hoechsts 33342 for 30 minutes at
37.degree. C. to allow binding onto the cells. The cell are then
washed twice in culture medium and fixed with PFH. Cell imaging is
performed with the BD Pathway and images analyzed with the
Definiens Architect software.
[0383] As mentioned above, AE12-6, AE12-15, and AE12-23 blocked
binding of RGMa to SH-SY5Y cells and primary neurons. See FIGS.
13A-F. In the HCS assay, AE12-1 did not inhibit binding of RGMa on
SH-SY5Y cells. See FIGS. 14A-H. The highest concentrations of
AE12-1 enhanced RGMa-Fc binding to cells, whereas in the lower
concentrations the levels were equal to control RGMa binding
levels. This is in contrast to inhibiting biotin-RGMa-Fc binding to
SH-SY5Y cells by MSD (MSD corresponds to using biotinylated
hRGMa-Fc complexed with streptavidin-Sulfo-Tag, and incubation with
cells at room temperature). The difference between the MSD and the
HCS assay may be due to different assay conditions.
[0384] FIGS. 15A-C show the neutralization effects on RGMa
repulsion by r5F9 (control), AE12-1, and AE12-6 in a neurite
outgrowth assay. 6500 rat hippocampal primary neurons per well were
plated on poly-1-lysine coated 96-well imaging plates. The cells
were treated for 24 hours with RGMa fragment 47-127 of SEQ ID NO:65
(SEQ ID NO:139) in combination with anti-RGMa antibodies. The cells
were fixed and stained with BIII-tubulin using a neurite outgrowth
kit protocol from Millipore. Images were acquired with a BD Pathway
and were analyzed with Definiens Architect to measure the neurite
outgrowth per neuron.
Example 3
Antibody Variants and Binding Data
[0385] Table 4 shows that by substituting for the Cys residue in
AE12-1 VL CDR3 (SEQ ID NO:8), one can generate variants having
improved affinity to hRGMa. See SEQ ID NOs:67-73. For example, see
Table 4, wherein antibody clone AE12-1-Y showed at least a 10-fold
increased affinity to hRGMa and AE12-1-F showed a 5-fold increased
affinity to hRGMa. Others showed comparable affinity as the
parental AE12-1. All variants blocked hRGMa binding to SH-SY5Y
cells in MSD-based cell binding assay, neutralized RGMa but not
RGMc activity in BMP reporter assays, and exhibited high thermal
stability and good solubility in preformulation studies.
TABLE-US-00011 TABLE 4 Ab AE12-1 AE12-1-F AE12-1-H AE12-1-L
AE12-1-V AE12-1-I AE12-1-K AE12-1-Y hRGMa binding (ELISA) ++ ++ ++
++ ++ +++ +++ +++ Cyno RGMa binding (ELISA) ++ +++ +++ +++ +++ +++
+++ +++ hRGMa-His ka (M-1s-1) 3.1 .times. 10.sup.4 2.7 .times.
10.sup.4 3.2 .times. 10.sup.4 3.8 .times. 10.sup.4 2.5 .times.
10.sup.4 .sup. 3 .times. 10.sup.4 3.4 .times. 10.sup.4 2.2 .times.
10.sup.4 kd (s-1) 2.3 .times. 10.sup.-4 3.9 .times. 10.sup.-5 1.2
.times. 10.sup.-4 2.5 .times. 10.sup.-4 1.5 .times. 10.sup.-4 1.3
.times. 10.sup.-4 3.0 .times. 10.sup.-4 1.3 .times. 10.sup.-5 Kd
(nM) 7.3 1.4 3.8 6.6 5.9 4.5 8.8 0.6 Cyno RGMa-His ka (M-1s-1) 1.9
.times. 10.sup.5 4.4 .times. 10.sup.4 4.7 .times. 10.sup.4 6.2
.times. 10.sup.4 1.1 .times. 10.sup.5 9.9 .times. 10.sup.4 5.1
.times. 10.sup.4 .sup. 4 .times. 10.sup.4 kd (s-1) 1.7 .times.
10.sup.-3 2.5 .times. 10.sup.-4 6.3 .times. 10.sup.-4 6.7 .times.
10.sup.-4 9.9 .times. 10.sup.-4 8.7 .times. 10.sup.-4 4.7 .times.
10.sup.-4 .sup. 2 .times. 10.sup.-4 Kd (nM) 8.8 5.4 13.4 10.1 9.2
8.9 9.3 4.9 Rat RGMa-His ka (M-1s-1) 2.6 .times. 10.sup.4 2.6
.times. 10.sup.4 2.9 .times. 10.sup.4 3.2 .times. 10.sup.4 2.2
.times. 10.sup.5 2.8 .times. 10.sup.4 1.6 .times. 10.sup.4 1.4
.times. 10.sup.4 kd (s-1) 4.8 .times. 10.sup.-4 1.4 .times.
10.sup.-4 2.5 .times. 10.sup.-4 3.9 .times. 10.sup.-4 3.2 .times.
10.sup.-4 3.2 .times. 10.sup.-4 2.8 .times. 10.sup.-4 6.9 .times.
10.sup.-5 Kd (nM) 19 5.2 8.6 12 15 12 17 5 hRGMc-His BIAcore
binding - - - - - - - - Block hRGMa-Fc binding to SH-SY5Y cells ++
++ ++ ++ ++ ++ ++ ++ (MSD) Neutralize RGMa in BRE luc assay ++ ++
++ ++ ++ ++ ++ ++ Neutralize RGMc in BRE luc assay - - - - - - - -
Tier 1 solubility/stability ++ ++ ++ ++ ++ ++ ++ ++
Example 4
Neurite Outgrowth
[0386] As shown in FIGS. 1, 2 and 15A-C, AE12-1 compeletely
neutralized full length hRGMa and a fragment of hRGMa, as shown on
SH-SY5Y cells and rat hippocampal primary neurons. This fragment of
hRGMa corresponds to amino acids 47-127 of SEQ ID NO:65 as shown
here: PCKI LKCNSEFWSA TSGSHAPASD DTPEFCAALR SYALCTRRTA RTCRGDLAYH
SAVHGIEDLM SQHNCSKDGP TSQPRLR (SEQ ID NO:139).
[0387] Further neurite outgrowth experiments were performed to
assess the effects of AE12-1 as well as AE12-1 variants, wherein
the antibody comprises SEQ ID NOs:1 and 5, or 2-4 and 6-8, wherein
the Cys residue of SEQ ID NO:8 is substituted for another amino
acid, or wherein the Cys residue at position 91 of SEQ ID NO:5 is
substituted with another amino acid (i.e. AE12-1-F, AE12-1-H,
AE12-1-L, AE12-1-V, AE12-1-I, AE12-1-K, and AE12-1-Y). See FIGS.
9A-B, 10A-B, 11A-B, and 12A-B, wherein inhibition by the described
antibody (24 hours incubation) on neurite outgrowth of SH-SY5Y
cells treated with FL hRGMa are shown.
Example 5
In Vivo Studies
[0388] As shown in FIGS. 3 and 4, AE12-1 enhanced regenerative
growth of retinal ganglion cell axons perilesionally (0-500 .mu.m)
(n=3-5 rats/group). See FIG. 3. Antibody AE12-1 also enhanced
regenerative growth of retinal ganglion cell axons into areas
further away from the lesion (500-1000 .mu.m) (n=3-5
rats/group).
Example 6
Rat Optic Nerve Crush Experiments
[0389] AE12-1 was active in rat optic nerve crush experiments. See
FIGS. 8A-C. A unilateral optic nerve crush lesion was done in male
Wistar rats, 2-4 mm behind the eye. Rats were followed for 6 weeks
(8 groups, n=6) and antibodies were administered once per week
intravenously at either 10 mg/kg, 1 mg/kg, or 0.1 mg/kg. The hlgG1
control was administered intravenously, once per week at 10 mg/kg
(n=6 rats). In AE12-1 treated rats regenerating fibers were able to
grow beyond the optic nerve crush lesion, whereas in control
antibody hIgG1-treated rats, regenerating fibers accumulate at the
lesion due to their inability to overcome the lesions. See FIGS.
8A-C.
Example 7
Epitope Mapping of Human RGMa (hRGMa) with Monoclonal Antibody
AE12-1
[0390] Epitope mapping studies were undertaken for monoclonal
antibody AE12-1. Data suggested that the epitope for AE12-1 is
located in the N-terminal region of RGMa. Several constructs of
hRGMa were employed to attempt to determine the epitope for AE12-1.
These constructs included:
[0391] pelB-M-[RGMA(47-168)]-6His ("6His" disclosed as SEQ ID NO:
148) (E. coli) produced recombinantly. Antigen is 0.41 mg/mL in
ChemTag #16211, 5100 buffer, pH8, 25 mM Tris, 100 mM NaCl, 1 mM
DTT, 10% (v/v) glycerol. Sequence of this first antigen construct
is:
TABLE-US-00012 (SEQ ID NO: 75) MKYLL PTAAA GLLLL AAQPA MAMPC KILKC
NSEFW SATSG SHAPA SDDTP EFCAA LRSYA LCTRR TARTC RGDLA YHSAV HGIED
LMSQH NCSKD GPTSQ PRLRT LPPAG DSQER SDSPE ICHYE KSFHK HSATP NYTHC
GLFGD HHHHHH.
[0392] [IgK-leader]-AttB1-[hRGMA(47-422)]-AttB2-MYC-6His ("6His"
disclosed as SEQ ID NO: 148) produced recombinantly, 0.85 mg/ml in
PBS. Sequence of this second antigen construct is:
TABLE-US-00013 (SEQ ID NO: 76) METDT LLLWV LLLWV PGSTG DAAQP ARRAR
RTKLG TELGS TSPVW WNSAD ITSLY KKAGS PCKIL KCNSE FWSAT SGSHA PASDD
TPEFC AALRS YALCT RRTAR TCRGD LAYHS AVHGI EDLMS QHNCS KDGPT SQPRL
RTLPP AGDSQ ERSDS PEICH YEKSF HKHSA TPNYT HCGLF GDPHL RTFTD RFQTC
KVQGA WPLID NNYLN VQVTN TPVLP GSAAT ATSKL TIIFK FNQEC VDQKV YQAEM
DELPA AFVDG SKNGG DKHGA NSLKI TEKVS GQHVE IQAKY IGTTI VVRQV GRYLT
FAVRM PEEVV NAVED WDSQG LYLCL RGCPL NQQID FQAFH TNAEG TGARR LAAAS
PAPTA PETFP YETAV AKCKE KLPVE DLYYQ ACVFD LLTTG DVNFT LAAYY ALEDV
KMLHS NKDKL HLYER TRDLP GNPAF LYKVV ISSTV AAARG GPEQK LISEE DLNSA
VDHHH HHH.
[0393] [IgK-leader]-AttB1-[hRGMA(47-168)]-Xa-[hlgG L Fc (257-481)]
(mammalian construct), produced recombinantly, 1.18 mg/mL, in PBS.
Sequence of this third antigen construct is:
TABLE-US-00014 (SEQ ID NO: 77) METDT LLLWV LLLWV PGSTG DAAQP ARRAR
RTKLP CKILK CNSEF WSATS GSHAP ASDDT PEFCA ALRSY ALCTR RTART CRGDL
AYHSA VHGIE DLMSQ HNCSK DGPTS QPRLR TLPPA GDSQE RSDSP EICHY EKSFH
KHSAT PNYTH CGLFG DLNSA DIEGR MDPPC PAPEL LGGPS VFLFP PKPKD TLMIS
RTPEV TCVVV DVSHE DPEVK FNWYV DGVEV HNAKT KPREE QYNST YRVVS VLTVL
HQDWL NGKEY KCKVS NKALP APIEK TISKA KGQPR EPQVY TLPPS REEMT KNQVS
LTCLV KGFYP SDIAV EWESN GQPEN NYKTT PPVLD SDGSF FLYSK LTVDK SRWQQ
GNVFS CSVMH EALHN HYTQK SLSLS PGK.
[0394] All of the antigens used contain the amino acid sequence of
RGMa (47-168), wherein the numbering used to identify sequence
positions correspond to the numbering of the parent protein. The
sequence of hRGMa (47-168) is:
TABLE-US-00015 (SEQ ID NO: 78) PCKI LKCNS EFWSA TSGSH APASD DTPEF
CAALR SYALC TRRTA RTCRG DLAYH SAVHG IEDLM SQHNC SKDGP TSQPR LRTLP
PAGDS QERSD SPEIC HYEKS FHKHS ATPNY THCGL FGD.
[0395] The buffers used for excising the epitopes were as
follows:
Buffer A: 100 mM NaHCO.sub.3, 500 mM NaCl, pH 8;
Buffer B: 100 mM NaHCO.sub.3, 100 mM NaCl, pH 8;
Buffer C: 100 mM NaOAc, 500 mM NaCl, pH 4; and
Buffer D: 100 mM Tris-HCl, 500 mM NaCl, pH 8.
[0396] The monoclonal antibody was immobilized as follows. Twenty
milligrams of CNBr-activated Sepharose beads (GE Healthcare,
Uppsala Sweden) was weighed into a compact reaction column (USB
Corp., Cleveland, Ohio) with a 35 .mu.m frit and washed 3 times
with 200 .mu.l of 1 mM HCl, followed by washing 3 times with 200
.mu.l of Buffer A.
[0397] Approximately 5-6 nmol of the AE12-1 mAb solution was
dialyzed against PBS using a 10,000 MWCO Slide-A-Lyzer mini
dialysis unit (Pierce, Rockford, Ill.) for approximately 40 minutes
to remove the histidine buffer which would interfere with antibody
binding to Sepharose. The dialyzed mAb solution was added to the
activated resin and allowed to mix on a rotator (Mix-All Laboratory
Tube Mixer, Torrey Pines Scientific, San Marcos, Calif.) for 4
hours at room temperature. After binding, the resin flow-through
was collected, and the resin was washed three times with 200 .mu.l
Buffer A. The resin was suspended in 200 .mu.l of Buffer D, and
rotated at room temperature for 1 hour to block excess binding
sites in the resin. The Buffer D solution was flushed out and the
resin was washed alternately with 200 .mu.l of Buffer C and Buffer
D (low/high pH washing), a total of three times each. The resin was
washed three times with 200 .mu.l of Buffer B, to make it ready for
coupling with antigen.
[0398] Immobilized AE12-1 monoclonal antibody was coupled to hRGMa.
Compact reaction columns (CRC) were prepared for the antigen
coupling by washing the 35 .mu.m frit of the CRC three times with
200 .mu.l of Buffer B. The resin with the bound antibody was mixed
gently to re-suspend the resin homogeneously, and 50 .mu.l of the
resin was placed in each prepared CRC. The resin was washed three
times with 200 .mu.l Buffer B. Approximately 1.5 nmol of hRGMa
antigen was added to the resin with enough Buffer B to make a total
volume of at least 200 .mu.l. Prior to antigen coupling, the E.
coli produced antigen was dialyzed against PBS buffer for
approximately 30 minutes using a 3500 MWCO Slide-A-Lyzer
mini-dialysis unit to remove DTT from the antigen buffer. The
antigen/resin mixture was allowed to mix on a rotator for 4 hours
at room temperature. The flow-through (FT) was collected, and the
resin was washed three times with 200 .mu.l of Buffer B.
[0399] The epitopes were excised using trypsin and endoproteinase
Asp-N. The resin containing the immobilized antibody/antigen
complex was suspended in 200 .mu.l of Buffer B. A vial with 20 of
trypsin (Promega, Madison, Wis.) was dissolved in 100 .mu.l of the
resuspension buffer (50 mM HOAc), for a concentration of 0.2
.mu.g/.mu.l, and a 2 .mu.g vial of endoproteinase Asp-N(Roche) was
dissolved in 50 .mu.l water (0.04 .mu.g/.mu.l). The antigen
cleavages were performed with 1:100 ratios (w/w) enzyme:antigen.
The reaction proceeded for 4-6 hours with rotation at room
temperature.
[0400] After digestion, the FT was collected and the resin was
washed twice with 200 .mu.l of Buffer B, with collection of each
wash separately (Wash 1 and 2), 200 .mu.l of Buffer A (Wash 3), and
then 200 .mu.l of Buffer B (Wash 4). The antigen peptides that were
bound to the antibody were eluted from the resin with three 200
.mu.l aliquots of 2% formic acid, and each elution was collected
separately (Elution 1, 2 and 3). The Elution1 fraction was analyzed
by mass spectrometry (LC-MS/MS) to determine the epitope
region.
[0401] The Elution 1 fractions that were collected after digestion
were analyzed by LC-ESI-MS/MS (positive ion) using an Agilent
(Santa Clara, Calif.) 1100 capillary HPLC loading pump and 1200
nano-HPLC gradient pump, with a Chip Cube (40 nL enrichment column,
75 .mu.m.times.43 mm analytical column, C8 ZORBAX chip) interfaced
to an Agilent 6510 QTOF MS. Injections of up to 7 .mu.l were used,
and MS/MS was performed on the top 3 ions meeting the specified MS
signal criteria.
[0402] Initial MS analysis of the epitope excison fractions
(Elution 1) indicated the presence of large peptide species that
could not be matched to expected proteolytic peptides due to the
likely presence of disulfide linked peptides. To reduce disulfide
bonds, 10 .mu.l aliquots were pH adjusted to pH.about.8 using
diluted NaOH, and reduced in 5 mM dithiothreitol (DTT) at
37.degree. C. for 30 minutes before re-analysis by MS. Some
fractions required denaturation to achieve reduction, in which case
the aliquot was diluted in an equal volume of 8M guanidine
hydrochloride, 100 mM Tris (pH 8) before addition of DTT.
[0403] LC-ESI-MS/MS analysis of all Elution 1 fractions of the
enzymatic digest of AE12-1 mAb coupled with the various constructs
of hRGMa indicated the presence of several large peptide species
with molecular weights in the range of 8.5-12 kDa. The masses and
fragmentation of the large species were not sufficient to identify
the peptides. In order to identify the eptitope peptides, reduction
of the disulfide bonds was necessary. In all cases, the MS signal
intensity of the peptides decreased significantly after reduction,
in some cases being undetectable unless reduced in the presence of
a denaturant.
[0404] After reduction of the Elution 1 fraction with DTT, the
fractions were reanalyzed by LC-MS/MS. In the excision experiment
using E. coli produced hRGMa, most of the peaks observed in the ion
chromatogram were single charged species, many related to polymers
or other additives. Two peptides were identified as being related
to the hRGMa construct used. See FIGS. 5A-B. The first was a
peptide with a monoisotopic molecular weight of 2420.2 Da. The
molecular weight of the peptide and the masses of a few fragments
observed in the MS/MS spectra (not shown) are consistent with the
sequence PCKILKCNSEFWSATSGSHAPAS (hRGMa 47-69) (SEQ ID NO:79)
although the assignment was inconsistent with the enzyme
specificity. The second potential epitope peptide with a
monoisotopic molecular weight of 2551.2 Da revealed only 2-3
identifiable MS/MS fragments that were consistent with the sequence
MPCKILKCNSEFWSATSGSHAPAS (SEQ ID NO:80). The enzyme specificity was
not consistent; however, since the molecular weight of the starting
antigen did not match the calculated mass of the full sequence, it
is possible that the antigen has N-terminal heterogeneity that
would account for the apparent inconsistent enzyme specificity.
[0405] Using the second antigen construct no peptides could be
observed in the MS spectrum after DTT reduction. MS analysis after
reduction under denaturing conditions did reveal peptides among the
singly charged, background ions. Four peptides from the antigen
were identified in the denatured and reduced E1 fraction. The first
antigen-related peptide had a monoisotopic molecular weight of
2763.3 Da, which, along with the MS/MS fragmentation, was
consistent with the sequence KAGSPCKILKCNSEFWSATSGSHAPAS (SEQ ID
NO:81) (hRGMa 47-69 with 4 additional N-terminal residues). The
spectra associated with this peptide are shown in FIGS. 6A and 6B.
A very low intensity peptide signal in the same spectrum (MW 2878.4
Da; +4 at m/z 720.84, marked with an asterisk in FIG. 6A) was
consistent with the sequence KAGSPCKILKCNSEFWSATSGSHAPPASD (SEQ ID
NO:82). A peptide of MW 2635.2, shown in FIGS. 7A-B, was consistent
with the sequence AGSPCKILKCNSEFWSATSGSHAPPAS (SEQ ID NO:90). An
additional peptide at m/z 688.82 (most abundant isotope, +4 charge
state), marked with an asterisk in FIGS. 7A-B, co-eluted with the
MW 2635.2 peptide. The limited MS/MS data obtained on this low
intensity component was consistent with the sequence
AGSPCKILKCNSEFWSATSGSHAPPASD (SEQ ID NO:83) (MW 2750.3 Da).
[0406] The third construct of hRGMa was used to try to confirm the
eptiope with AE12-1. In the Elution 1 fraction that was
DTT-reduced, very little reduction was observed, but one peptide
could be identified as being related to hRGMa antigen and
consistent with the results from the other antigen constructs. The
peptide was observed at m/z 691.60 (+4 charge state), giving it a
monoisotopic molecular weight of 2762.4 Da. Limited MS/MS data
obtained for this peptide (not shown) suggests the sequence as
TKLPCKILKCNSEFWSATSGSHAPAS (SEQ ID NO:84). Other peptides that were
observed in the MS spectrum that could be assigned as being related
to the region of hRGMa (47-168) included DSPEICHYEK (SEQ ID NO:85);
GDLAYHSAVHGIE (SEQ ID NO:86); DLAYHSAVHGIE (SEQ ID NO:87); and
DDTPEFCAALR (SEQ ID NO:88).
[0407] In the Elution 1 fractions (trypsin/Asp-N digestion) from
the epitope excision experiment of hRGMa bound to AE12-1, the
peptide hRGMa (47-69) was identified from three constructs of
antigen. The peptide identified as the epitope for hRGMa with
AE12-1 is: PCKILKCNSEFWSATSGSHAPAS (hRGMa 47-69) (SEQ ID
NO:79).
Example 8
Toxicology Studies
[0408] Because iron accumulation in hepatocytes and the decrease of
iron in the spleen may result from RGMc neutralization, the
toxicokinetics and tolerability of the herein described
RGMa-selective monoclonal antibodies were studied. The studies are
expected to show that iron accumulation in hepatocytes and iron
depletion in the spleen will not occur when the RGMa-selective
monoclonal antibodies are administered to Sprague-Dawley rats.
Example 9
RGMa-Selective Monoclonal Antibodies AE12-1 and AE12-1Y, Like
Humanized Monoclonal Antibody 5F9, Induce Regeneration of Crushed,
Damaged Optic Nerve Axons in a Rat Model of Optic Nerve Injury
[0409] The Optic Nerve Crush (also referred to as "Optic Nerve
Injury") model provides an animal model to test various substances
that stimulate regeneration of the optic nerve fibers and reduce
the massive cell death of retinal ganglion cells.
[0410] The experiments were carried out in adult male Wistar rats
obtained from Charles River (D) Laboratories (Germany). The animals
are kept in single cages on a 12:12 hour light/dark cycle with food
and water ad libitum. The optic nerve crush is always performed
only at the left eye by minimal anterior surgery as described in P.
Monnier et al., J. Neurosci., 31:10494-10505 (2011), the contents
of which are herein incorporated by reference, and follows human
anterior visual surgical methods. Before and during the operation,
the procedure animals are anesthetized by inhalation anesthesia
using Sevoflurane (Abbott GmbH Co. & KG, Delkenheim, Germany)
and are fixed on the operation table by using jaw clamp and
adhesive tape for the limbs. A drop in body temperature is
prevented by mounting animals on a heating pad. For anterior crush
surgery of the rat optic nerve, the left eye is carefully freed of
ligament and connective tissue. As a first step, a microsurgical
cut (2-3 mm) of the adjacent tissue in the outer corner of the eye
is performed. As a next step, the optic nerve is exposed by using a
pair of forceps to move to the side the eye muscles and lacrimal
gland, thus sparing it. As a further step, the meninges were
longitudinally opened by using microscissors to expose the optic
nerve. This results in a higher mobility of the eye and enables
lateral rotation of the eye and access to its left optic nerve. The
optic nerve is injured approximately 1-3 mm behind the eye, using a
pair of forceps set to provide a fixed maximum pressure for 10-20
seconds. Special care is taken not to damage the vascular supply to
the eye.
[0411] After minimal invasive surgery, the animals are placed on
paper towels in the clean cage placed on the warmer to control the
body temperature until they start to move. An ointment which
contains antibiotic (Gentamytrex, Dr. Mann Pharma) is applied onto
the eye to avoid bacterial infection and drying-out of the
sclera.
[0412] Carprofen (Rimadyl, 5 mg/kg) is applied intraperitoneally
for postoperative pain therapy directly after surgery and then
twice per day for a 3 day period. The animals are observed and
controlled regularly for several hours directly after surgery and
in the next 2-4 days to make sure that all the animals survived and
recovered from anesthesia and surgery.
[0413] The above described modified anterior optic nerve crush
approach has significant advantages in comparison with the standard
optic nerve crush procedure which originates from the posterior
part of the eye. Specifically, in the procedure described herein,
no large open wounds are generated which require suturing and the
infection risk of the very small wounds is significantly reduced.
In addition, as a result of the lower time required for the crush
(the above described anterior method is approximately 3 times
faster than the posterior method known in the art) animals suffer
less and are thus less stressed. Moreover, the amount of pain
suffered by the animals is significantly reduced and animals
recover at a much rates and much more quickly.
Systemic Administration of Antibodies
[0414] For systemic antibody delivery, male Wistar rats were
treated systemically intravenously, (iv) with a humanized RGMa and
RGMc-blocking 5F9 antibody (h5F9) (n=8 animals) (humanized antibody
5F9 is described in U.S. Patent Publication No. 2010/0028340, the
contents of which are herein incorporated by reference), with an
RGMa-selective, human antibody, AE12-1, described herein, and with
a closely related RGMa mAb, AE12-1Y, also described herein and with
a human isotope control antibody (hIgG) (n=8 animals). Rats were
injected once per week intraveneously with 10 mg/kg of antibody
given and injections were started immediately after optic nerve
crush. All rats received 5 injections and animals were euthanized 6
weeks after crush injury. Experimenters were blinded and tissue
isolation, processing, preparation of sections and quantitative
analysis was done as described in P. Monnier et al., J. Neurosci.,
31:10494-10505 (2011) and Koeberle et al., Neuroscience,
169:495-504 (2010), the contents of each of which are herein
incorporated by reference. Composite images of rat optic nerves
were prepared, the crush site was identified and GAP-43 positive
fibers extending beyond the crush site for 500 .mu.m were counted.
As shown in FIG. 16, all three RGMa antibodies--h5F9, AE12-1 and
AE12-1Y induced significant regenerative growth beyond the crush
site, in contrast to control animals treated with hIgG.
Example 10
RGMa-Selective Monoclonal Antibodies AE12-1 and AE12-1Y Like
Humanized Antibody 5F9, Protect the Retinal Nerve Fiber Layer
(RNLF) from Degeneration
[0415] In order to observe protection of RNLF degeneration, a new
laboratory assay method was used. This method is based on
explanting and analyzing adult rat retina from the eyes of rats
with optic nerve crush and systemically treated with antibody 5F9,
AE12-1, AE2-1Y and control antibody, human IgG. This method is an
adaptation of the methods described by P. Monnier et al., J.
Neurosci., 31:10494-10505 (2011) and Koeberle et al., Neuroscience,
169:495-504 (2010). P. Monnier et al., J. Neurosci., 31:10494-10505
(2011) and Koeberle et al., Neuroscience, 169:495-504 (2010). Adult
male Wistar rates obtained from Charles River Laboratories
(Germany) were injected once per week intraveneously with 10 mg/kg
of antibody given and injections were started immediately after
optic nerve crush. All rats received 5 injections and animals were
euthanized 6 weeks after crush injury.
Retina Preparation and Immunofluorescent Staining:
[0416] Animals were deep anesthetized with Sevoflurane (8%; Abbott
GmbH Co. & KG, Delkenheim, Germany), then immediately
sacrificed by opening the ribcage and perfused with 4%
paraformaldehyde (PFA) solution through the left heart ventricle.
The eyes were dissected with the connective tissue adjusted and
placed in 4% PFA until preparation of retina takes place.
[0417] The preparation of the retina was performed in Hank's
Balanced Salt Solution (HBSS, Magnesium- and Calcium-free;
Invitrogen, #14170070). The eye was fixed at the connective tissue
by tweezers and a round cut was made in sclera just around the
cornea.
The half-sphere of retina was cut in four points, opened and spread
on a gray nitrocellulose membrane (Sartorius, #13006-50-N). If
necessary, the membrane with retina on it was allowed to air dry
for 5-10 seconds Thereafter, the retina on membrane was placed in
10% neutral phosphate-buffered formaldehyde solution (pH 7.3;
Fisher Scientific, #F/1520/21) at +4.degree. C. until
immunofluorescent staining was performed. Staining is performed
according to the protocol described below.
[0418] The retina preparation was washed with TBS, followed by
blocking and permeabilization with 5% BSA, 1% Triton X-100 in TBS
for 30 minutes and then washed again with TBS. Primary antibodies,
namely, monoclonal Ab TUJ-1, a mouse anti- III Tubulin Ab, AbCam,
#ab14545; 1:500 dilution, in TBS, 5% BSA, was added for 1 hour at
room temperature in the dark followed by washing with TBS, 0.1%
Tween 20. Next, a secondary antibody, namely, Donkey anti-mouse
Cy3; Jackson ImmunoResearch (Dianova) 715-165-151, 1:1000 dilution,
and Bisbenzimid (50 .mu.g/ml 1:100 dilution in TBS, 5% BSA) were
added for 1 hour at room temperature in the dark followed by
washing with TBS, 0.1% Tween 20, and the subsequent washing with
desalted H.sub.2O. The preparation was then mounted with
Fluoromount G and stored at +4.degree. C. in the dark.
Quantitative Analysis of the Protective Effect of RGMa Antibodies
on the Retinal Nerve Fiber Layer in the Eye (the RNFL)
[0419] Using the Axiovision software, randomly selected images
(n=12) of each retina were chosen and the number of nerve fibers
determined for each image. For these experiments, 5-8 retinae with
crushed optic nerves were used for each group: the h5F9 MAb group,
the hIgG control MAb group and the AE12.1 and AE12-1Y MAb groups.
Data analysis and statistical analysis was performed using the
GraphPad prism program.
[0420] The results are illustrated in FIG. 17. Specifically, a
significantly higher number of nerve fiber bundles is observed in
retinae of animals systemically treated with RGMa antibodies of the
present invention when compared to hIgG control antibody treated
animals.
Example 11
RGMa Antibodies Accelerate Functional Recovery in a Focal Spinal
Experimental Autoimmune Encephalomyelitis (EAE) Model
[0421] Kerschensteiner et al. (Am. J. Pathol. 164: 1455-69, 2004)
developed a focal, localized EAE model where large inflammatory
lesions are not spread randomly in spinal cord, brain and optic
nerve but can be selectively induced in either in the spinal cord
or in other brain areas. Using this focal or targeted EAE model,
large inflammatory lesions, very similar to MS spinal cord lesions,
are induced in the dorsal columns of the spinal cord, affecting the
corticospinal tract. In this model, rats are first immunized with
the myelin protein MOG. Two to three weeks after immunization, MOG
antibody titers were determined and animals with a positive immune
response were injected with a cytokine mixture (TNF.alpha. 250 ng,
IFNg 150 U) locally at thoracical level 8 (T8). Within one week
after cytokine injection, the rats developed hindlimb motor
defects, tail paralysis and gait disturbances reaching an EAE score
of 2.5. Four weeks after cytokine injection, this score improved to
an EAE score of 1 (Kerschensteiner et al., Am. J. Pathol. 164:
1455-69, 2004).
[0422] Female Lewis rats were injected subcutaneously with 75 .mu.l
of MOG (75 .mu.g, 1-125 aa, BlueSky Biotech, Worcester, Mass.)
dissolved in saline and then emulsified with 75 .mu.l of Incomplete
Freund's Adjuvans (IFA, Sigma, #F5506). Right before injection and
then every 7-8.sup.th day, blood samples were taken from animals to
analyze the samples for MOG antibodies.
[0423] Two or three weeks after MOG immunization, blood was
collected from immunized rats and an ELISA was performed to detect
MOG-specific antibodies. Immunization results in induction of MOG
antibodies in more than 90% of immunized rats. In this strain
however, MOG antibody induction did not result in any disease
symptoms. Lewis rats only developed motor deficits after local
injection of 2 inflammatory cytokines (TNF a, IFNg) into the
thoracical spinal cord at thoracical level 8 (T8).
[0424] For cytokine injection, rats were subject to Inhalation
anesthesia with Sevoflurane (8%; Abbott GmbH Co. & KG,
Delkenheim, Germany) and a laminectomy was performed by a standard
procedure. Specifically, the skin on the back of the rat was shaved
and disinfected with 70% of ethanol, then the shaved area was wiped
with the prodine and a 2-3 cm cut was made with scalpel starting
approx. from T3-4 till T11-12. The superficial fat was separated
with fine scissors from the muscles and the muscles were cut by the
middle line along the spine from one side. The gap between T8 and
T9 was located and T8 was cleared from adjacent tissue. A
microdrill was used to make a round hole approximately 1-2 mm in
diameter in T8 and small tipped forceps were used to remove the
periosteum and any bone fragments. Next, the dura mater was removed
with micro scissors and a stereotactic injection was done with a
very thin glass capillary connected to a 10 .mu.l Hamilton syringe
with Luer Tip (LT) and filled in with the mineral oil (Sigma
Aldrich).
[0425] Using an automatic injector, the capillary was filled with 3
.mu.l of cytokine mixture in PBS or just PBS with traces of Evans
blue. A four times (4.times.) higher dose of TNF.alpha. (1000 ng)
and the same dose of IFN.gamma. (150 U) was used as reported by
Kerschensteiner et al. (2004). The four times higher dose resulted
in a significant extension of the recovery process in vehicle or
control treated rats.
[0426] In the next step, a glass capillary was inserted to a depth
of 0.7 mm and 2 .mu.l of the cytokine mixture were injected in the
middle of spinal cord at (T8) during a 5 minute-period using an
automatic injector. After applying Lidocaine and closing the wound,
rats were treated with an analgesic drug Rimadyl (directly after
surgery and daily for another 3-4 days). Rats were then placed in a
clean page on paper towels and were kept in the warmth until they
awoke.
[0427] Rats developed first symptoms within one week after cytokine
injection. Antibody treatment was started on day 7 or 8 after
cytokine application. A hIgG control antibody and several different
RGMa antibodies (namely, AE12-1, AE12-1Y and humanized 5F9.23
(h5f9.23 which is described in U.S. Patent Publication No.
2010/0028340)) were used and rats were treated once per week via
the intravenous route. EAE scoring was done daily and scores were
documented. Individuals conducting the experiments were blinded for
the different treatment groups. After a period of 27-29 days post
cytokine administration, the animals were killed, spinal cords were
isolated and analyzed for expression of the following proteins:
GAP-43 (regeneration marker), CD68 (inflammatory marker for
activated microglia cells and macrophages) and MPB (myelin basic
protein, a marker for remyelination or preserved myelin tracts).
The area of these markers was measured, analyzed and statistically
evaluated using one way ANOVA and Bonferroni significance test. As
shown in FIG. 18, all three RGMa antibodies accelerated functional
recovery in the spinal tEAE model.
[0428] In the spinal tEAE model, all RGMa antibodies showed very
similar regeneration- and neuroprotection stimulating activity. The
RGMa-selective antibodies AE12-1 and AE12-1Y showed similar
activity compared with h5F9.23, which neutralizes both RGMa and
RGMc. Neutralization of RGMc does not seem to be required for
efficacy. Therefore, to better understand the mechanism of action
of all three RGMa mAbs in the focal spinal EAE model, several
markers were evaluated in serial sections of spinal cords of
antibody treated rats AE12-1Y, AE12-1 and h5F9.23 increased the
regeneration area (GAP-43), the remyelination area (myelin basic
protein (MBP)) and decreased the inflammatory CD68 (CD68-positive)
area around the spinal lesion site (See, FIGS. 19A-C).
[0429] The RGMa-selective antibody AE12-1Y-QL was tested to
determine what doses of this antibody are active in this spinal
tEAE model. Specifically, 4 different antibody doses (namely,
(0.01, 0.1, 1, 10 mg/k were given IV systemically once per week to
the rats. AE12-1Y-QL showed significant activity at 0.1, 1 and 10
mg/kg (FIG. 20). However, a dose of 0.01 mg/kg did not show
efficacy.
Sequence CWU 1
1
1581120PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 1Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Thr Ser His 20 25 30Gly Ile Ser Trp Val Arg Gln Ala Pro
Gly Gln Gly Leu Asp Trp Met 35 40 45Gly Trp Ile Ser Pro Tyr Ser Gly
Asn Thr Asn Tyr Ala Gln Lys Leu 50 55 60Gln Gly Arg Val Thr Met Thr
Thr Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Val Gly
Ser Gly Pro Tyr Tyr Tyr Met Asp Val Trp Gly Gln 100 105 110Gly Thr
Leu Val Thr Val Ser Ser 115 12025PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 2Ser His Gly Ile Ser1
5317PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 3Trp Ile Ser Pro Tyr Ser Gly Asn Thr Asn Tyr Ala
Gln Lys Leu Gln1 5 10 15Gly411PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 4Val Gly Ser Gly Pro Tyr Tyr
Tyr Met Asp Val1 5 105109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 5Gln Ser Ala Leu Thr Gln
Pro Arg Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Val Thr Ile Ser
Cys Thr Gly Thr Ser Ser Ser Val Gly Asp Ser 20 25 30Ile Tyr Val Ser
Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Leu Tyr
Asp Val Thr Lys Arg Pro Ser Gly Val Pro Asp Arg Phe 50 55 60Ser Gly
Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75
80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Thr
85 90 95Asp Thr Leu Phe Gly Gly Gly Thr Lys Val Thr Val Leu 100
105614PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 6Thr Gly Thr Ser Ser Ser Val Gly Asp Ser Ile Tyr
Val Ser1 5 1077PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 7Asp Val Thr Lys Arg Pro Ser1
589PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 8Cys Ser Tyr Ala Gly Thr Asp Thr Leu1
59115PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 9Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Thr Ser Tyr 20 25 30Asp Ile Asn Trp Val Arg Gln Ala Thr
Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Trp Met Asn Pro Asn Ser Gly
Asn Thr Gly Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr
Arg Asn Thr Ser Ile Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Thr
Ser Leu Ser Val Trp Gly Gln Gly Thr Leu Val Thr 100 105 110Val Ser
Ser 115105PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 10Ser Tyr Asp Ile Asn1 51117PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 11Trp
Met Asn Pro Asn Ser Gly Asn Thr Gly Tyr Ala Gln Lys Phe Gln1 5 10
15Gly126PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 12Ser Thr Ser Leu Ser Val1 513106PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
13Ser Tyr Glu Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln1
5 10 15Thr Ala Ser Ile Thr Cys Ser Gly Asp Lys Leu Gly Asp Lys Tyr
Ala 20 25 30Cys Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val
Ile Tyr 35 40 45Gln Asp Ser Lys Arg Pro Ser Gly Ile Pro Lys Arg Phe
Ser Gly Ser 50 55 60Asn Ser Gly Asp Thr Ala Thr Leu Thr Ile Ser Gly
Thr Gln Ala Met65 70 75 80Asp Glu Ala Asp Tyr Tyr Cys Gln Ala Trp
Asp Ser Ser Thr Gly Val 85 90 95Phe Gly Pro Gly Thr Lys Val Thr Val
Leu 100 1051411PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 14Ser Gly Asp Lys Leu Gly Asp Lys Tyr
Ala Cys1 5 10157PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 15Gln Asp Ser Lys Arg Pro Ser1
5169PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 16Gln Ala Trp Asp Ser Ser Thr Gly Val1
517126PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 17Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Asp Asp Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Val Ile Ser Tyr Asp Gly Ser
Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Arg
Val Tyr Ser Ser Gly Lys Glu Gly Tyr Tyr Tyr Gly 100 105 110Met Asp
Val Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser 115 120
125185PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 18Asp Tyr Ala Met His1 51917PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 19Val
Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly2017PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 20Glu Arg Val Tyr Ser Ser Gly Lys Glu Gly Tyr Tyr
Tyr Gly Met Asp1 5 10 15Val21111PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 21Gln Ser Gly Leu Thr
Gln Pro Pro Ser Val Ser Ala Ala Pro Gly Gln1 5 10 15Arg Val Thr Ile
Ser Cys Thr Gly Ser Gly Ser Asn Ile Gly Ala Gly 20 25 30Tyr Gly Val
His Trp Tyr Gln Gln Leu Pro Ala Thr Ala Pro Lys Ile 35 40 45Leu Ile
Tyr Gly Asp Tyr Asn Arg Pro Ser Gly Val Pro Asp Arg Phe 50 55 60Ser
Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Thr Gly Leu65 70 75
80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Asn Ser
85 90 95Leu Arg Gly Val Leu Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
100 105 1102214PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 22Thr Gly Ser Gly Ser Asn Ile Gly Ala
Gly Tyr Gly Val His1 5 10237PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 23Gly Asp Tyr Asn Arg Pro
Ser1 52411PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 24Gln Ser Tyr Asp Asn Ser Leu Arg Gly Val Leu1 5
1025117PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 25Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val
Val Gln Pro Gly Thr1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Pro Phe Ser Ser Tyr 20 25 30Gly Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Ala Ile Ser Gly Asp Gly Ile
Leu Lys Tyr Tyr Thr Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Asn
Leu Ser Gly Glu Asp Thr Gly Leu Tyr Tyr Cys 85 90 95Ala Arg Asn Tyr
Asp Asn Ser Leu Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr
Val Ser Ser 115265PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 26Ser Tyr Gly Met His1
52717PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 27Ala Ile Ser Gly Asp Gly Ile Leu Lys Tyr Tyr Thr
Asp Ser Val Lys1 5 10 15Gly288PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 28Asn Tyr Asp Asn Ser Leu Asp
Tyr1 529111PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 29Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser
Ala Ser Leu Gly Ala1 5 10 15Ser Val Lys Val Thr Cys Thr Leu Ser Ser
Gly His Ser Ala Tyr Ala 20 25 30Ile Ala Trp His Gln Gln Gln Pro Glu
Lys Gly Pro Arg Tyr Leu Met 35 40 45Lys Val Asn Ser Asp Gly Ser His
Asn Lys Gly Asp Gly Val Pro Asp 50 55 60Arg Phe Ser Gly Ser Ser Ser
Gly Ala Glu Arg Tyr Leu Ile Ile Ser65 70 75 80Gly Leu Gln Ser Glu
Asp Glu Ala Asp Tyr Tyr Cys Gln Thr Trp Gly 85 90 95Pro Gly Ile Arg
Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105
1103012PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 30Thr Leu Ser Ser Gly His Ser Ala Tyr Ala Ile
Ala1 5 103111PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 31Val Asn Ser Asp Gly Ser His Asn Lys
Gly Asp1 5 10329PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 32Gln Thr Trp Gly Pro Gly Ile Arg Val1
533120PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 33Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Val Ser Gly
His Ser Leu Ser Glu Leu 20 25 30Thr Ile His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Met 35 40 45Gly Gly Phe Asp Pro Glu Asp Gly
Arg Gly Thr Tyr Ala Pro Asn Phe 50 55 60Arg Gly Arg Val Thr Met Thr
Glu Asp Thr Ser Thr Asp Thr Ala Tyr65 70 75 80Met Glu Leu Ser Gly
Leu Arg Ser Glu Asp Ala Ala Val Tyr Tyr Cys 85 90 95Ala Thr Leu Leu
Gly Glu Tyr Asp Ser Tyr Phe Asp Leu Trp Gly Arg 100 105 110Gly Thr
Leu Val Thr Val Ser Ser 115 120345PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 34Glu Leu Thr Ile His1
53517PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 35Gly Phe Asp Pro Glu Asp Gly Arg Gly Thr Tyr Ala
Pro Asn Phe Arg1 5 10 15Gly3611PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 36Leu Leu Gly Glu Tyr Asp Ser
Tyr Phe Asp Leu1 5 1037107PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 37Asp Val Val Met Thr Gln
Ser Pro Asp Phe Gln Ser Val Thr Pro Glu1 5 10 15Asp Lys Val Thr Ile
Thr Cys Arg Ala Ser Gln Ser Ile Gly Ser Cys 20 25 30Leu His Trp Tyr
Gln Gln Lys Pro Asp Gln Ser Pro Lys Leu Leu Ile 35 40 45Lys Tyr Ala
Ser Gln Ser Ile Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Leu Glu Ala65 70 75
80Glu Asp Ala Ala Thr Tyr Tyr Cys His Gln Ser Ser Ser Leu Pro Tyr
85 90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys 100
1053811PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 38Arg Ala Ser Gln Ser Ile Gly Ser Cys Leu His1 5
10397PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 39Tyr Ala Ser Gln Ser Ile Ser1 5409PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 40His
Gln Ser Ser Ser Leu Pro Tyr Thr1 541120PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
41Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Asn
Tyr 20 25 30Asp Ile Ala Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Met 35 40 45Gly Trp Met Asn Pro Asp Ser Gly Asn Thr Gly Phe Val
Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Ala Thr Ser Asn Thr Asp Ile
Thr Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Thr Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Arg Phe Gly Ser Gly Tyr
Asp Leu Asp His Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser
Ser 115 120425PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 42Asn Tyr Asp Ile Ala1
54317PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 43Trp Met Asn Pro Asp Ser Gly Asn Thr Gly Phe Val
Gln Lys Phe Lys1 5 10 15Gly4411PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 44Asp Arg Phe Gly Ser Gly Tyr
Asp Leu Asp His1 5 1045108PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 45Ser Tyr Glu Leu Thr Gln
Pro Pro Ser Val Ser Val Ala Pro Gly Gln1 5 10 15Thr Ala Arg Ile Thr
Cys Gly Gly Asn Asn Ile Gly Ser Lys Ser Val 20 25 30His Trp Tyr Gln
Gln Lys Pro Gly Gln Ala Pro Val Leu Val Val Tyr 35 40 45Asp Asp Ser
Asp Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55 60Asn Ser
Gly Asn Thr Ala Thr Leu Thr Ile Ser Arg Val Glu Ala Gly65 70 75
80Asp Glu Ala Asp Tyr Tyr Cys Gln Val Trp Gly Ser Ser Ser Asp His
85 90 95Tyr Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu 100
1054611PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 46Gly Gly Asn Asn Ile Gly Ser Lys Ser Val His1 5
10477PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 47Asp Asp Ser Asp Arg Pro Ser1 54811PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 48Gln
Val Trp Gly Ser Ser Ser Asp His Tyr Val1 5 1049117PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
49Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Ser Ser Ser
Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Glu Ser Thr Tyr Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Val Glu Asp
Thr Ala Ile Tyr Tyr Cys 85 90 95Ala Arg Gln Gly Tyr Gly Ala His Asp
Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser
115505PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 50Ser Tyr Ala Met Thr1 55117PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
peptide 51Gly Ile Ser Gly Ser Gly Glu Ser Thr Tyr Tyr Ala Asp Ser
Val Lys1 5 10 15Gly528PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 52Gln Gly Tyr Gly Ala His Asp
Tyr1 553110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 53Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser
Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ala Ser
Ser Asn Val Gly Ser Asn 20 25 30Arg Val Asn Trp Tyr Gln Gln Phe Pro
Gly Met Ala Pro Lys Leu Leu 35 40 45Ile Tyr Ser Asn Asn Gln Arg Pro
Ser Gly Val Pro Asp Arg Phe Ser 50 55 60Gly Ser Lys Ser Gly Thr Ser
Ala Ser Leu Ala Ile Ser Gly Leu Gln65 70 75 80Ser Glu Asp Glu Ala
Asp Tyr Tyr Cys Ala Ala Trp Asp Asp Ser Leu 85 90 95Asn Gly Tyr Val
Phe Gly Thr Gly Thr Lys Val Thr Val Leu 100 105
1105413PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 54Ser Gly Ala Ser Ser Asn Val Gly Ser Asn Arg Val
Asn1 5 10557PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 55Ser Asn Asn Gln Arg Pro Ser1
55611PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 56Ala Ala Trp Asp Asp Ser Leu Asn Gly Tyr Val1 5
1057126PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 57Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu
Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Asp Asp Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Leu Ile Ser Trp Asp Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Lys Asp Ile
Pro Lys Val Gly Gly Tyr Ser Tyr Gly Tyr Gly Ala 100 105 110Leu Gly
Tyr Trp Gly Gln Gly Thr Pro Val Thr Val Ser Ser 115 120
125585PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 58Asp Tyr Ala Met His1 55917PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 59Leu
Ile Ser Trp Asp Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly6017PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 60Asp Ile Pro Lys Val Gly Gly Tyr Ser Tyr Gly Tyr
Gly Ala Leu Gly1 5 10 15Tyr61108PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 61Ser Tyr Glu Leu Thr
Gln Pro Pro Ser Val Ser Val Ala Pro Gly Gln1 5 10 15Thr Ala Arg Ile
Thr Cys Gly Gly Asn Asn Ile Gly Asp Ile Ser Val 20 25 30His Trp Tyr
Gln Gln Lys Ser Gly Gln Ala Pro Met Leu Val Val His 35 40 45Asp Asp
Ser Asp Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55 60Asn
Ser Gly Ser Ser Ala Thr Leu Thr Ile Ser Arg Val Glu Ala Gly65 70 75
80Asp Glu Ala Asp Tyr His Cys Gln Val Trp Asp Ser Gly Ser Gly His
85 90 95His Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu 100
1056211PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 62Gly Gly Asn Asn Ile Gly Asp Ile Ser Val His1 5
10637PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 63Asp Asp Ser Asp Arg Pro Ser1 56411PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 64Gln
Val Trp Asp Ser Gly Ser Gly His His Val1 5 1065450PRTHomo sapiens
65Met Gln Pro Pro Arg Glu Arg Leu Val Val Thr Gly Arg Ala Gly Trp1
5 10 15Met Gly Met Gly Arg Gly Ala Gly Arg Ser Ala Leu Gly Phe Trp
Pro 20 25 30Thr Leu Ala Phe Leu Leu Cys Ser Phe Pro Ala Ala Thr Ser
Pro Cys 35 40 45Lys Ile Leu Lys Cys Asn Ser Glu Phe Trp Ser Ala Thr
Ser Gly Ser 50 55 60His Ala Pro Ala Ser Asp Asp Thr Pro Glu Phe Cys
Ala Ala Leu Arg65 70 75 80Ser Tyr Ala Leu Cys Thr Arg Arg Thr Ala
Arg Thr Cys Arg Gly Asp 85 90 95Leu Ala Tyr His Ser Ala Val His Gly
Ile Glu Asp Leu Met Ser Gln 100 105 110His Asn Cys Ser Lys Asp Gly
Pro Thr Ser Gln Pro Arg Leu Arg Thr 115 120 125Leu Pro Pro Ala Gly
Asp Ser Gln Glu Arg Ser Asp Ser Pro Glu Ile 130 135 140Cys His Tyr
Glu Lys Ser Phe His Lys His Ser Ala Thr Pro Asn Tyr145 150 155
160Thr His Cys Gly Leu Phe Gly Asp Pro His Leu Arg Thr Phe Thr Asp
165 170 175Arg Phe Gln Thr Cys Lys Val Gln Gly Ala Trp Pro Leu Ile
Asp Asn 180 185 190Asn Tyr Leu Asn Val Gln Val Thr Asn Thr Pro Val
Leu Pro Gly Ser 195 200 205Ala Ala Thr Ala Thr Ser Lys Leu Thr Ile
Ile Phe Lys Asn Phe Gln 210 215 220Glu Cys Val Asp Gln Lys Val Tyr
Gln Ala Glu Met Asp Glu Leu Pro225 230 235 240Ala Ala Phe Val Asp
Gly Ser Lys Asn Gly Gly Asp Lys His Gly Ala 245 250 255Asn Ser Leu
Lys Ile Thr Glu Lys Val Ser Gly Gln His Val Glu Ile 260 265 270Gln
Ala Lys Tyr Ile Gly Thr Thr Ile Val Val Arg Gln Val Gly Arg 275 280
285Tyr Leu Thr Phe Ala Val Arg Met Pro Glu Glu Val Val Asn Ala Val
290 295 300Glu Asp Trp Asp Ser Gln Gly Leu Tyr Leu Cys Leu Arg Gly
Cys Pro305 310 315 320Leu Asn Gln Gln Ile Asp Phe Gln Ala Phe His
Thr Asn Ala Glu Gly 325 330 335Thr Gly Ala Arg Arg Leu Ala Ala Ala
Ser Pro Ala Pro Thr Ala Pro 340 345 350Glu Thr Phe Pro Tyr Glu Thr
Ala Val Ala Lys Cys Lys Glu Lys Leu 355 360 365Pro Val Glu Asp Leu
Tyr Tyr Gln Ala Cys Val Phe Asp Leu Leu Thr 370 375 380Thr Gly Asp
Val Asn Phe Thr Leu Ala Ala Tyr Tyr Ala Leu Glu Asp385 390 395
400Val Lys Met Leu His Ser Asn Lys Asp Lys Leu His Leu Tyr Glu Arg
405 410 415Thr Arg Asp Leu Pro Gly Arg Ala Ala Ala Gly Leu Pro Leu
Ala Pro 420 425 430Arg Pro Leu Leu Gly Ala Leu Val Pro Leu Leu Ala
Leu Leu Pro Val 435 440 445Phe Cys 45066122PRTHomo sapiens 66Pro
Cys Lys Ile Leu Lys Cys Asn Ser Glu Phe Trp Ser Ala Thr Ser1 5 10
15Gly Ser His Ala Pro Ala Ser Asp Asp Thr Pro Glu Phe Cys Ala Ala
20 25 30Leu Arg Ser Tyr Ala Leu Cys Thr Arg Arg Thr Ala Arg Thr Cys
Arg 35 40 45Gly Asp Leu Ala Tyr His Ser Ala Val His Gly Ile Glu Asp
Leu Met 50 55 60Ser Gln His Asn Cys Ser Lys Asp Gly Pro Thr Ser Gln
Pro Arg Leu65 70 75 80Arg Thr Leu Pro Pro Ala Gly Asp Ser Gln Glu
Arg Ser Asp Ser Pro 85 90 95Glu Ile Cys His Tyr Glu Lys Ser Phe His
Lys His Ser Ala Thr Pro 100 105 110Asn Tyr Thr His Cys Gly Leu Phe
Gly Asp 115 120679PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 67Phe Ser Tyr Ala Gly Thr Asp Thr Leu1
5689PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 68His Ser Tyr Ala Gly Thr Asp Thr Leu1
5699PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 69Leu Ser Tyr Ala Gly Thr Asp Thr Leu1
5709PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 70Val Ser Tyr Ala Gly Thr Asp Thr Leu1
5719PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 71Ile Ser Tyr Ala Gly Thr Asp Thr Leu1
5729PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 72Lys Ser Tyr Ala Gly Thr Asp Thr Leu1
5739PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 73Tyr Ser Tyr Ala Gly Thr Asp Thr Leu1
57423PRTHomo sapiens 74Pro Cys Lys Ile Leu Lys Cys Asn Ser Glu Phe
Trp Ser Ala Thr Ser1 5 10 15Gly Ser His Ala Pro Ala Ser
2075151PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 75Met Lys Tyr Leu Leu Pro Thr Ala Ala Ala Gly
Leu Leu Leu Leu Ala1 5 10 15Ala Gln Pro Ala Met Ala Met Pro Cys Lys
Ile Leu Lys Cys Asn Ser 20 25 30Glu Phe Trp Ser Ala Thr Ser Gly Ser
His Ala Pro Ala Ser Asp Asp 35 40 45Thr Pro Glu Phe Cys Ala Ala Leu
Arg Ser Tyr Ala Leu Cys Thr Arg 50 55 60Arg Thr Ala Arg Thr Cys Arg
Gly Asp Leu Ala Tyr His Ser Ala Val65 70 75 80His Gly Ile Glu Asp
Leu Met Ser Gln His Asn Cys Ser Lys Asp Gly 85 90 95Pro Thr Ser Gln
Pro Arg Leu Arg Thr Leu Pro Pro Ala Gly Asp Ser 100 105 110Gln Glu
Arg Ser Asp Ser Pro Glu Ile Cys His Tyr Glu Lys Ser Phe 115 120
125His Lys His Ser Ala Thr Pro Asn Tyr Thr His Cys Gly Leu Phe Gly
130 135 140Asp His His His His His His145 15076478PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
76Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1
5 10 15Gly Ser Thr Gly Asp Ala Ala Gln Pro Ala Arg Arg Ala Arg Arg
Thr 20 25 30Lys Leu Gly Thr Glu Leu Gly Ser Thr Ser Pro Val Trp Trp
Asn Ser 35 40 45Ala Asp Ile Thr Ser Leu Tyr Lys Lys Ala Gly Ser Pro
Cys Lys Ile 50 55 60Leu Lys Cys Asn Ser Glu Phe Trp Ser Ala Thr Ser
Gly Ser His Ala65 70 75 80Pro Ala Ser Asp Asp Thr Pro Glu Phe Cys
Ala Ala Leu Arg Ser Tyr 85 90 95Ala Leu Cys Thr Arg Arg Thr Ala Arg
Thr Cys Arg Gly Asp Leu Ala 100 105 110Tyr His Ser Ala Val His Gly
Ile Glu Asp Leu Met Ser Gln His Asn 115 120 125Cys Ser Lys Asp Gly
Pro Thr Ser Gln Pro Arg Leu Arg Thr Leu Pro 130 135 140Pro Ala Gly
Asp Ser Gln Glu Arg Ser Asp Ser Pro Glu Ile Cys His145 150 155
160Tyr Glu Lys Ser Phe His Lys His Ser Ala Thr Pro Asn Tyr Thr His
165 170 175Cys Gly Leu Phe Gly Asp Pro His Leu Arg Thr Phe Thr Asp
Arg Phe 180 185 190Gln Thr Cys Lys Val Gln Gly Ala Trp Pro Leu Ile
Asp Asn Asn Tyr 195 200 205Leu Asn Val Gln Val Thr Asn Thr Pro Val
Leu Pro Gly Ser Ala Ala 210 215 220Thr Ala Thr Ser Lys Leu Thr Ile
Ile Phe Lys Phe Asn Gln Glu Cys225 230 235 240Val Asp Gln Lys Val
Tyr Gln Ala Glu Met Asp Glu Leu Pro Ala Ala 245 250 255Phe Val Asp
Gly Ser Lys Asn Gly Gly Asp Lys His Gly Ala Asn Ser 260 265 270Leu
Lys Ile Thr Glu Lys Val Ser Gly Gln His Val Glu Ile Gln Ala 275 280
285Lys Tyr Ile Gly Thr Thr Ile Val Val Arg Gln Val Gly Arg Tyr Leu
290 295 300Thr Phe Ala Val Arg Met Pro Glu Glu Val Val Asn Ala Val
Glu Asp305 310 315 320Trp Asp Ser Gln Gly Leu Tyr Leu Cys Leu Arg
Gly Cys Pro Leu Asn 325 330 335Gln Gln Ile Asp Phe Gln Ala Phe His
Thr Asn Ala Glu Gly Thr Gly 340 345 350Ala Arg Arg Leu Ala Ala Ala
Ser Pro Ala Pro Thr Ala Pro Glu Thr 355 360 365Phe Pro Tyr Glu Thr
Ala Val Ala Lys Cys Lys Glu Lys Leu Pro Val 370 375 380Glu Asp Leu
Tyr Tyr Gln Ala Cys Val Phe Asp Leu Leu Thr Thr Gly385 390 395
400Asp Val Asn Phe Thr Leu Ala Ala Tyr Tyr Ala Leu Glu Asp Val Lys
405 410 415Met Leu His Ser Asn Lys Asp Lys Leu His Leu Tyr Glu Arg
Thr Arg 420 425 430Asp Leu Pro Gly Asn Pro Ala Phe Leu Tyr Lys Val
Val Ile Ser Ser 435 440 445Thr Val Ala Ala Ala Arg Gly Gly Pro Glu
Gln Lys Leu Ile Ser Glu 450 455 460Glu Asp Leu Asn Ser Ala Val Asp
His His His His His His465 470 47577388PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
77Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1
5 10 15Gly Ser Thr Gly Asp Ala Ala Gln Pro Ala Arg Arg Ala Arg Arg
Thr 20 25 30Lys Leu Pro Cys Lys Ile Leu Lys Cys Asn Ser Glu Phe Trp
Ser Ala 35 40 45Thr Ser Gly Ser His Ala Pro Ala Ser Asp Asp Thr Pro
Glu Phe Cys 50 55 60Ala Ala Leu Arg Ser Tyr Ala Leu Cys Thr Arg Arg
Thr Ala Arg Thr65 70 75 80Cys Arg Gly Asp Leu Ala Tyr His Ser Ala
Val His Gly Ile Glu Asp 85 90 95Leu Met Ser Gln His Asn Cys Ser Lys
Asp Gly Pro Thr Ser Gln Pro 100 105 110Arg Leu Arg Thr Leu Pro Pro
Ala Gly Asp Ser Gln Glu Arg Ser Asp 115 120 125Ser Pro Glu Ile Cys
His Tyr Glu Lys Ser Phe His Lys His Ser Ala 130 135 140Thr Pro Asn
Tyr Thr His Cys Gly Leu Phe Gly Asp Leu Asn Ser Ala145 150 155
160Asp Ile Glu Gly Arg Met Asp Pro Pro Cys Pro Ala Pro Glu Leu Leu
165 170 175Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu 180 185 190Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser 195 200 205His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val Glu 210 215 220Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr225 230 235 240Tyr Arg Val Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 245 250 255Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 260 265 270Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 275 280
285Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val
290 295 300Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val305 310 315 320Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro 325 330 335Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr 340 345 350Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val 355 360 365Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 370 375 380Ser Pro Gly
Lys38578122PRTHomo sapiens 78Pro Cys Lys Ile Leu Lys Cys Asn Ser
Glu Phe Trp Ser Ala Thr Ser1 5 10 15Gly Ser His Ala Pro Ala Ser Asp
Asp Thr Pro Glu Phe Cys Ala Ala 20 25 30Leu Arg Ser Tyr Ala Leu Cys
Thr Arg Arg Thr Ala Arg Thr Cys Arg 35 40 45Gly Asp Leu Ala Tyr His
Ser Ala Val His Gly Ile Glu Asp Leu
Met 50 55 60Ser Gln His Asn Cys Ser Lys Asp Gly Pro Thr Ser Gln Pro
Arg Leu65 70 75 80Arg Thr Leu Pro Pro Ala Gly Asp Ser Gln Glu Arg
Ser Asp Ser Pro 85 90 95Glu Ile Cys His Tyr Glu Lys Ser Phe His Lys
His Ser Ala Thr Pro 100 105 110Asn Tyr Thr His Cys Gly Leu Phe Gly
Asp 115 1207923PRTHomo sapiens 79Pro Cys Lys Ile Leu Lys Cys Asn
Ser Glu Phe Trp Ser Ala Thr Ser1 5 10 15Gly Ser His Ala Pro Ala Ser
208024PRTHomo sapiens 80Met Pro Cys Lys Ile Leu Lys Cys Asn Ser Glu
Phe Trp Ser Ala Thr1 5 10 15Ser Gly Ser His Ala Pro Ala Ser
208127PRTHomo sapiens 81Lys Ala Gly Ser Pro Cys Lys Ile Leu Lys Cys
Asn Ser Glu Phe Trp1 5 10 15Ser Ala Thr Ser Gly Ser His Ala Pro Ala
Ser 20 258229PRTHomo sapiens 82Lys Ala Gly Ser Pro Cys Lys Ile Leu
Lys Cys Asn Ser Glu Phe Trp1 5 10 15Ser Ala Thr Ser Gly Ser His Ala
Pro Pro Ala Ser Asp 20 258328PRTHomo sapiens 83Ala Gly Ser Pro Cys
Lys Ile Leu Lys Cys Asn Ser Glu Phe Trp Ser1 5 10 15Ala Thr Ser Gly
Ser His Ala Pro Pro Ala Ser Asp 20 258426PRTHomo sapiens 84Thr Lys
Leu Pro Cys Lys Ile Leu Lys Cys Asn Ser Glu Phe Trp Ser1 5 10 15Ala
Thr Ser Gly Ser His Ala Pro Ala Ser 20 258510PRTHomo sapiens 85Asp
Ser Pro Glu Ile Cys His Tyr Glu Lys1 5 108613PRTHomo sapiens 86Gly
Asp Leu Ala Tyr His Ser Ala Val His Gly Ile Glu1 5 108712PRTHomo
sapiens 87Asp Leu Ala Tyr His Ser Ala Val His Gly Ile Glu1 5
108811PRTHomo sapiens 88Asp Asp Thr Pro Glu Phe Cys Ala Ala Leu
Arg1 5 108926PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 89Ala Gly Ser Pro Cys Lys Ile Leu Lys
Cys Asn Ser Glu Phe Trp Ser1 5 10 15Ala Thr Ser Gly Ser His Ala Pro
Ala Ser 20 259027PRTHomo sapiens 90Ala Gly Ser Pro Cys Lys Ile Leu
Lys Cys Asn Ser Glu Phe Trp Ser1 5 10 15Ala Thr Ser Gly Ser His Ala
Pro Pro Ala Ser 20 2591117PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 91Glu Val Gln Leu Gln Glu
Ser Gly Ala Gly Leu Leu Lys Pro Ser Glu1 5 10 15Thr Leu Ser Leu Thr
Cys Ala Val Tyr Gly Gly Ser Phe Ser Gly Tyr 20 25 30Tyr Trp Ser Trp
Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile
Asn His Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60Ser Arg
Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe Ser Leu65 70 75
80Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Arg Asp Asp Gly Ala Gly Val Phe Asp Leu Trp Gly Arg Gly Thr
Leu 100 105 110Val Thr Val Ser Ser 115925PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 92Gly
Tyr Tyr Trp Ser1 59316PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 93Glu Ile Asn His Ser Gly Ser
Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10 15949PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 94Asp
Asp Gly Ala Gly Val Phe Asp Leu1 595108PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
95Asp Ile Gln Leu Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Gly Val Thr Ile Thr Cys Gln Ala Ser Gln Asp Ile Ser Asn
Tyr 20 25 30Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Asp Ala Ser Asn Leu Glu Thr Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Phe Phe Thr Leu Thr Ile Asn
Asn Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Ser Gly Asn Thr Pro Trp 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Asn Arg 100 1059611PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 96Gln Ala Ser Gln Asp Ile Ser
Asn Tyr Leu Asn1 5 10977PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 97Asp Ala Ser Asn Leu Glu
Thr1 5989PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 98Gln Gln Ser Gly Asn Thr Pro Trp Thr1
599123PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 99Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Glu Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Thr Asp Tyr 20 25 30Tyr Ile Gln Trp Val Arg Gln Ala Pro
Gly His Gly Leu Glu Trp Met 35 40 45Gly Trp Ile Asn Pro Lys Thr Gly
Gly Thr Asn Tyr Leu Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Met Thr
Arg Asp Thr Ser Thr Arg Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Asp Asp Thr Ala Phe Tyr Tyr Cys 85 90 95Val Arg Glu Asp
Met Asn Thr Val Leu Ala Thr Ser Trp Phe Asp Pro 100 105 110Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 115 1201005PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 100Asp
Tyr Tyr Ile Gln1 510117PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 101Trp Ile Asn Pro Lys Thr
Gly Gly Thr Asn Tyr Leu Gln Lys Phe Gln1 5 10
15Gly10214PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 102Glu Asp Met Asn Thr Val Leu Ala Thr Ser Trp
Phe Asp Pro1 5 10103109PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 103Ser Tyr Glu Leu Thr
Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln1 5 10 15Thr Ala Arg Ile
Thr Cys Ser Gly Asn Gln Leu Gly His Lys Phe Ala 20 25 30Ser Trp Tyr
Gln Gln Lys Pro Gly Gln Ser Pro Val Val Val Ile Tyr 35 40 45Glu Asp
Lys Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55 60Asn
Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln Ala Met65 70 75
80Asp Glu Ala Asp Tyr Tyr Cys Gln Val Trp Asp Val Ile Thr Asp His
85 90 95Tyr Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly 100
10510411PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 104Ser Gly Asn Gln Leu Gly His Lys Phe Ala Ser1 5
101057PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 105Glu Asp Lys Lys Arg Pro Ser1
510611PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 106Gln Val Trp Asp Val Ile Thr Asp His Tyr Val1 5
10107121PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 107Glu Val Gln Leu Val Gln Ser Gly Ser Glu
Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser Cys Lys Thr Ser
Gly Tyr Thr Phe Thr Asn Ser 20 25 30Ala Ile His Trp Val Arg Gln Ala
Pro Gly Gln Arg Leu Glu Trp Met 35 40 45Gly Trp Ile Asn Ala Gly Asn
Gly Asn Thr Lys Tyr Ser Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Ile
Thr Arg Asp Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser
Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Trp Ala
Tyr Cys Gly Gly Asp Cys Tyr Ser Leu Asp Tyr Trp Gly 100 105 110Gln
Gly Thr Leu Val Thr Val Ser Ser 115 1201085PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 108Asn
Ser Ala Ile His1 510917PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 109Trp Ile Asn Ala Gly Asn
Gly Asn Thr Lys Tyr Ser Gln Lys Phe Gln1 5 10
15Gly11012PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 110Ala Tyr Cys Gly Gly Asp Cys Tyr Ser Leu Asp
Tyr1 5 10111108PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 111Asp Ile Gln Val Thr Gln Ser Pro
Ser Ser Leu Ala Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys
Gln Ala Ser Gln Asp Ile Ser Asn Tyr 20 25 30Leu Asn Trp Tyr Gln Gln
Arg Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn
Leu Glu Thr Gly Val Pro Pro Arg Phe Ser Gly 50 55 60Asp Gly Ser Gly
Thr His Phe Ser Phe Thr Ile Thr Asn Val Gln Pro65 70 75 80Glu Asp
Val Gly Thr Tyr Tyr Cys Gln Gln Tyr Asp Ser Leu Pro Leu 85 90 95Thr
Phe Gly Gln Gly Thr Arg Leu Glu Ile Lys Arg 100
10511211PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 112Gln Ala Ser Gln Asp Ile Ser Asn Tyr Leu Asn1 5
101137PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 113Asp Ala Ser Asn Leu Glu Thr1
51149PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 114Gln Gln Tyr Asp Ser Leu Pro Leu Thr1
5115126PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 115Glu Val Gln Leu Leu Glu Ser Gly Gly Asp
Leu Val Arg Pro Gly Gly1 5 10 15Ser Leu Arg Leu Thr Cys Glu Gly Ser
Gly Phe Asn Phe Phe Thr Gln 20 25 30Thr Ile His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Ser Ile Ser Ser Asp Ser
Asn Tyr Ile Tyr His Ala Asp Ser Leu 50 55 60Lys Gly Arg Phe Thr Val
Ser Arg Asp Asn Ala Gln Asp Ser Val Phe65 70 75 80Leu Gln Met Asn
Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp
Ile Leu Leu Glu Pro Leu Ala Pro His Tyr Tyr Tyr Gly 100 105 110Leu
Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115 120
1251165PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 116Thr Gln Thr Ile His1 511717PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 117Ser
Ile Ser Ser Asp Ser Asn Tyr Ile Tyr His Ala Asp Ser Leu Lys1 5 10
15Gly11817PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 118Asp Ile Leu Leu Glu Pro Leu Ala Pro His Tyr
Tyr Tyr Gly Leu Asp1 5 10 15Val119108PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
119Asp Ile Gln Val Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Pro Ile Ser Thr
Tyr 20 25 30Val Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Asp Ala Ser Thr Leu Glu Ile Gly Val Pro Ser Arg
Ile Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln
Tyr Asp Asn Phe Pro Leu 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Asp
Ile Lys Arg 100 10512011PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 120Arg Ala Ser Gln Pro Ile
Ser Thr Tyr Val Asn1 5 101217PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 121Asp Ala Ser Thr Leu Glu
Ile1 51229PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 122Gln Gln Tyr Asp Asn Phe Pro Leu Thr1
5123117PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 123Glu Val Gln Leu Gln Glu Ser Gly Pro Gly
Leu Val Lys Pro Ser Glu1 5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser
Gly Gly Ser Ile Ser Gly Tyr 20 25 30Tyr Trp Ser Trp Ile Arg Gln Ser
Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile Phe His Thr Gly
Arg Thr Tyr Tyr Asn Pro Ser Leu Arg 50 55 60Ser Arg Leu Thr Ile Ser
Val Asp Thr Ser Lys Asn Gln Phe Ser Leu65 70 75 80Lys Leu Ser Ser
Leu Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95Arg Asp Ser
Ala Phe Gly Ser Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val
Thr Val Ser Ser 1151245PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 124Gly Tyr Tyr Trp Ser1
512516PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 125Glu Ile Phe His Thr Gly Arg Thr Tyr Tyr Asn
Pro Ser Leu Arg Ser1 5 10 151269PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 126Asp Ser Ala Phe Gly Ser
Phe Asp Tyr1 5127108PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 127Asp Ile Arg Val Thr Gln Ser Pro
Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys
Gln Ala Asn Glu Asp Ile Ser Ile Tyr 20 25 30Leu Asn Trp Tyr Gln Gln
Arg Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn
Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly
Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp
Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr His Thr Tyr Pro Phe 85 90 95Thr
Phe Gly Gly Gly Thr Lys Val Asp Ile Lys Arg 100
10512811PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 128Gln Ala Asn Glu Asp Ile Ser Ile Tyr Leu Asn1 5
101297PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 129Asp Ala Ser Asn Leu Glu Thr1
51309PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 130Gln Gln Tyr His Thr Tyr Pro Phe Thr1
5131120PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 131Glu Val Gln Leu Gln Glu Ser Gly Pro Gly
Leu Val Lys Pro Ser Glu1 5 10 15Thr Leu Ser Leu Thr Cys Asn Val Ser
Gly Gly Ser Ile Ser Ser Tyr 20 25 30Tyr Trp Ser Trp Ile Arg Gln Pro
Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Asn Ile Tyr Tyr Ser Gly
Ser Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60Ser Arg Val Thr Ile Ser
Val Asp Thr Ser Lys Ser Gln Phe Ser Leu65 70 75 80Lys Leu Ser Ser
Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95Arg Ala Leu
Asp Phe Trp Ser Gly Gln Tyr Phe Asp Tyr Trp Gly Gln 100 105 110Gly
Thr Leu Val Thr Val Ser Ser 115 1201325PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 132Ser
Tyr Tyr Trp Ser1 513316PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 133Asn Ile Tyr Tyr Ser Gly
Ser Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10 1513412PRTArtificial
SequenceDescription of Artificial
Sequence Synthetic peptide 134Ala Leu Asp Phe Trp Ser Gly Gln Tyr
Phe Asp Tyr1 5 10135108PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 135Asp Ile Val Met Thr
Gln Thr Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr
Ile Thr Cys Gln Ala Ser Gln Asp Ile Ser Asp Tyr 20 25 30Leu Asn Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp
Ala Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Gly Leu Gln Pro65 70 75
80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Ile Pro Pro
85 90 95Thr Phe Gly Pro Gly Thr Arg Leu Glu Ile Lys Arg 100
10513611PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 136Gln Ala Ser Gln Asp Ile Ser Asp Tyr Leu Asn1 5
101377PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 137Asp Ala Ser Thr Leu Glu Ser1
51389PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 138Gln Gln Ser Tyr Ser Ile Pro Pro Thr1
513981PRTHomo sapiens 139Pro Cys Lys Ile Leu Lys Cys Asn Ser Glu
Phe Trp Ser Ala Thr Ser1 5 10 15Gly Ser His Ala Pro Ala Ser Asp Asp
Thr Pro Glu Phe Cys Ala Ala 20 25 30Leu Arg Ser Tyr Ala Leu Cys Thr
Arg Arg Thr Ala Arg Thr Cys Arg 35 40 45Gly Asp Leu Ala Tyr His Ser
Ala Val His Gly Ile Glu Asp Leu Met 50 55 60Ser Gln His Asn Cys Ser
Lys Asp Gly Pro Thr Ser Gln Pro Arg Leu65 70 75
80Arg140330PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 140Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr
Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn
Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro
Ala Pro Glu Ala Ala Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120
125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235
240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys 325 330141330PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 141Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro
Cys 100 105 110Pro Ala Pro Glu Ala Ala Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro 115 120 125Lys Pro Lys Asp Gln Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp
Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200
205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315
320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325
330142330PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 142Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr
Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn
Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro
Ala Pro Glu Ala Ala Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120
125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235
240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Leu His
Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys 325 330143330PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 143Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro
Cys 100 105 110Pro Ala Pro Glu Ala Ala Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro 115 120 125Lys Pro Lys Asp Gln Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp
Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200
205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser
Cys Ser Val Leu His Glu Ala Leu His Asn His Tyr Thr305 310 315
320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325
330144215PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 144Gln Ser Ala Leu Thr Gln Pro Arg Ser Val
Ser Gly Ser Pro Gly Gln1 5 10 15Ser Val Thr Ile Ser Cys Thr Gly Thr
Ser Ser Ser Val Gly Asp Ser 20 25 30Ile Tyr Val Ser Trp Tyr Gln Gln
His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Leu Tyr Asp Val Thr Lys
Arg Pro Ser Gly Val Pro Asp Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly
Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp
Glu Ala Asp Tyr Tyr Cys Val Ser Tyr Ala Gly Thr 85 90 95Asp Thr Leu
Phe Gly Gly Gly Thr Lys Val Thr Val Leu Gly Gln Pro 100 105 110Lys
Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu 115 120
125Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro
130 135 140Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro Val
Lys Ala145 150 155 160Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser
Asn Asn Lys Tyr Ala 165 170 175Ala Ser Ser Tyr Leu Ser Leu Thr Pro
Glu Gln Trp Lys Ser His Arg 180 185 190Ser Tyr Ser Cys Gln Val Thr
His Glu Gly Ser Thr Val Glu Lys Thr 195 200 205Val Ala Pro Thr Glu
Cys Ser 210 215145450PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 145Glu Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val
Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser His 20 25 30Gly Ile Ser
Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Asp Trp Met 35 40 45Gly Trp
Ile Ser Pro Tyr Ser Gly Asn Thr Asn Tyr Ala Gln Lys Leu 50 55 60Gln
Gly Arg Val Thr Met Thr Thr Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Val Gly Ser Gly Pro Tyr Tyr Tyr Met Asp Val Trp Gly
Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly
Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser
Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu
Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser
Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser
Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200
205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp
210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Ala Ala
Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Gln Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315
320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn
Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly
Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Leu His 420 425 430Glu
Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440
445Gly Lys 450146215PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 146Gln Ser Ala Leu Thr Gln Pro Arg
Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Val Thr Ile Ser Cys Thr
Gly Thr Ser Ser Ser Val Gly Asp Ser 20 25 30Ile Tyr Val Ser Trp Tyr
Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Leu Tyr Asp Val
Thr Lys Arg Pro Ser Gly Val Pro Asp Arg Phe 50 55 60Ser Gly Ser Lys
Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala
Glu Asp Glu Ala Asp Tyr Tyr Cys Tyr Ser Tyr Ala Gly Thr 85 90 95Asp
Thr Leu Phe Gly Gly Gly Thr Lys Val Thr Val Leu Gly Gln Pro 100 105
110Lys Ala Ala Pro Ser Val
Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu 115 120 125Gln Ala Asn Lys
Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro 130 135 140Gly Ala
Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro Val Lys Ala145 150 155
160Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala
165 170 175Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser
His Arg 180 185 190Ser Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr
Val Glu Lys Thr 195 200 205Val Ala Pro Thr Glu Cys Ser 210
215147450PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 147Glu Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Ser His 20 25 30Gly Ile Ser Trp Val Arg Gln Ala
Pro Gly Gln Gly Leu Asp Trp Met 35 40 45Gly Trp Ile Ser Pro Tyr Ser
Gly Asn Thr Asn Tyr Ala Gln Lys Leu 50 55 60Gln Gly Arg Val Thr Met
Thr Thr Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser
Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Val
Gly Ser Gly Pro Tyr Tyr Tyr Met Asp Val Trp Gly Gln 100 105 110Gly
Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120
125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala
130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His
Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln
Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys
Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Ala Ala Gly Gly225 230 235
240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Gln Leu Met Ile
245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr
Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360
365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Leu His 420 425 430Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly Lys
4501486PRTArtificial SequenceDescription of Artificial Sequence
Synthetic 6xHis tag 148His His His His His His1 51495PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 149Asp
Asp Asp Asp Lys1 51506PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 150Ala Asp Asp Asp Asp Lys1
5151115PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 151Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Tyr 20 25 30Gly Met Asn Trp Ile Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Met Ile Tyr Tyr Asp Ser
Ser Glu Lys His Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly
Thr Thr Pro Asp Tyr Trp Gly Gln Gly Thr Met Val Thr 100 105 110Val
Ser Ser 115152113PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 152Asp Val Val Leu Thr Gln Ser Pro
Leu Ser Leu Pro Val Thr Leu Gly1 5 10 15Gln Pro Ala Ser Ile Ser Cys
Arg Ser Ser Gln Ser Leu Glu Tyr Ser 20 25 30Asp Gly Tyr Thr Phe Leu
Glu Trp Phe Gln Gln Arg Pro Gly Gln Ser 35 40 45Pro Arg Leu Leu Ile
Tyr Glu Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg
Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Phe Gln Ala 85 90 95Thr
His Asp Pro Leu Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys 100 105
110Arg1535PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 153Asn Tyr Gly Met Asn1 515417PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 154Met
Ile Tyr Tyr Asp Ser Ser Glu Lys His Tyr Ala Asp Ser Val Lys1 5 10
15Gly1556PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 155Gly Thr Thr Pro Asp Tyr1 515616PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 156Arg
Ser Ser Gln Ser Leu Glu Tyr Ser Asp Gly Tyr Thr Phe Leu Glu1 5 10
151577PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 157Glu Val Ser Asn Arg Phe Ser1
51589PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 158Phe Gln Ala Thr His Asp Pro Leu Thr1 5
* * * * *