Targeting Anabolic Drugs For Accelerated Fracture Repair

Abstract

The targeted delivery of growth factors, vasoactive peptides and other representative anabolic peptide drugs from different signaling cascades to bone fracture for accelerated healing is disclosed herein.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims priority to U.S. Provisional Patent Application No. 62/678,016, filed on May 30, 2018. This application is incorporated herein by reference in its entirety for all purposes.

FIELD OF THE INVENTION

[0002] Aspects of the present disclosure relate to the materials and methods for treating bone fractures and bone defects.

BACKGROUND

[0003] Src tyrosine kinase plays a crucial role in bone metabolism: despite its ubiquitous expression profile, the only apparent phenotypical abnormality in a Sarcoma-knockout (Src-KO) mouse strain was osteopetrosis. Although Src inhibitors inhibit both the formation and activity of osteoblasts (OBs) in vitro, the number of osteoclasts (OCs) derived from Src-KO mice were actually elevated in Src-KO mice, measuring more than twice that in wild-type (WT) mice. Also, a marked increase in both osteoblast number and activity was observed in vivo in Src-KO mice. These results confirm that the osteopetrosis phenotype of Src-KO mice was not a result of reduced osteoclast formation, but rather of boosted osteoblast activity as well as reduced osteoclast function. Moreover, osteoblasts derived from Src-KO mice demonstrated unremarkable morphological features compared to those harvested from WT mice, and were able to fully regulate normal osteoclast differentiation via the receptor activator of nuclear factor kappa-B ligand/receptor activator of nuclear factor kappa-B/osteoprotegerin (RANKL/RANK/OPG) pathway. Thus, this bone-resorption defect should be easily alleviated by restoring normal Src functionality in osteoclasts, reducing potential risks on the musculoskeletal system involved in long-term use of Src inhibitors for fracture healing.

[0004] Broadly, peptide anabolic drugs include different categories of protein or the fragments thereof. They are represented by bone morphogenetic protein pathway signaling peptides including P4, bone forming peptide (BFP) and peptide from Bone morphogenetic protein 9 (pBMP9); insulin-like growth factor (IGF) derived peptides including mechano-growth factor (MGF) and Preptin; bone stimulatory neuropeptides including Substance P and vasoactive intestinal peptide (VIP); and peptides enhancing vascular functions, including C-type Natriuretic peptide (CNP), thrombin fragment or targeted prothrombin peptide (TP508) and VIP. Each of these peptides may have its own unique mechanism working to regulate bone growth, as will be outlined in the detailed description.

[0005] Current clinical treatment of fractures generally does not include the use of site-specific anabolic drugs. In fact, the only drugs approved for clinical use on such fractures are bone morphogenic protein (BMP)-2 (approved for use only in tibial trauma) and BMP-7 (discontinued), which are applied locally and generally used in the treatment of open long bone fractures and spinal fusions. The need for broader application of anabolic drugs to treat bone maladies such as osteoporotic fractures with efficacy is evident.

[0006] Therefore, it is desirable to have a fracture treatment drug that is administered systemically yet targets the fracture site with evident efficacy.

SUMMARY

[0007] A first aspect of the present disclosure includes at least one compound of the formula X-Y-Z, or a pharmaceutically acceptable salt thereof, or a metabolite thereof, wherein X is at least one agent that improves bone density, mechanical strength, bone deposition, or quality; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z. In some aspects, X is at least one agent that enhances the activity or one agent that improves bone density, mechanical strength, bone deposition or otherwise promotes bone healing and/or growth. Consistent with some of these aspects, Z is at least one negatively charged oligopeptide or an equivalent thereof that binds to hydroxyapatite and/or raw bone.

[0008] The second aspect includes the compound according to the first aspect, wherein when X is a polypeptide, any polypeptide having at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and/or 100% identity to X can be used to practice the invention.

[0009] In some aspects, Y is at least one polypeptide comprising at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and/or 100% sequence identity to amino acid residues 35-40, 35-41, 35-42, 35-43, 35-44, 35-45, 35-46, 35-47, 35-48, 35-49, 35-50, 35-51, 35-52, 35-55, 35-84, 41-44, 41-45, 41-46, 41-47, 41-48, 41-49, 41-50, and/or 41-84 of a full length parathyroid hormone related peptide or parathyroid hormone, and/or at least one Cathepsin K sensitive polypeptide.

[0010] In some aspects, Z is at least one polypeptide comprising about 4 or more, from about 4 to about 100, from about 4 to about 50, from 4 to about 20, from about 4 to about 15, from about 4 to about 10 acidic amino acid residues, polyphosphate, 2-aminohexanedioic (aminoadipic) acid or derivatives thereof, and/or alendronate or derivatives thereof. In some aspects, Z is at least one polypeptide comprising about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, and/or 30 acidic amino acid residues, polyphosphate, 2-aminohexanedioic acid or derivatives thereof, and/or alendronate or derivatives thereof. In some aspects, Z is at least one negatively charged oligopeptide or an equivalent thereof that binds to hydroxyapatite and/or raw bone.

[0011] The targeted delivery strategy recited in some aspects of the invention enable the delivery of Src inhibitors specifically to bone fracture surfaces thereby facilitating fracture healing. This in vivo efficacy is shown by the acceleration of fracture healing observed using the Src inhibitors Dasatinib and E738.

[0012] In addition to Src inhibitors, a group of peptides targeted specifically to the fracture surfaces also demonstrates an enhanced ability to facilitate fracture healing. These peptides include osteopontin derived fragments such as osteopontin-derived peptide (ODP), collagen binding motif (CBM); BMP fragments such as P4, BFP, pBMP7; IGF fragments such as MGF and Preptin; neuropeptides such as Substance P and VIP; Vasoconstrictive fragments such as CNP, TP508 and VIP; and other anabolic drugs such as osteogenic growth peptide (OGP).

[0013] The in vivo efficacy of these peptides for accelerated fracture healing are demonstrated herein. All peptide conjugates are produced by solid phase synthesis.

[0014] Some aspects of this disclosure include compounds comprising: a compound of the formula X-Y-Z, wherein X is at least one agent that modulates bone growth, such as activity of Src tyrosine kinase; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof. In some aspects, Z is at least one polypeptide comprising 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and/or 20 acidic amino acid residues. In some aspects, X is selected from the group consisting of Dasatinib and E738. In some aspects, Y is a releasable linker selected from disulfide; ester; or protease specific amide bond. In some aspects, Y is a nonreleasable bond selected from carbon-carbon bond; or amide bond.

[0015] In some aspects, this disclosure includes a compound of the formula X-Y-Z, wherein X is at least one peptide or a fragment thereof that modulates activity of bone and cartilage formation; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof. In some aspects, Y is a releasable linker selected from disulfide; ester; or protease specific amide bond. In some aspects, Y is a nonreleasable bond selected from carbon-carbon bond; or amide bond. In some aspects, Y is a peptide belonging to the natural sequence of Z. In some aspects, Y is a polyethylene glycol (PEG) linker. In some aspects Y is a PEG linker comprised of 2-8 oxyethylene units. In some aspects, Z comprises at least 10 aspartic or glutamic acids conjugated to X. In some aspects, Z comprises at least 20 aspartic or glutamic acids conjugated to X. In some aspects, the compound may be produced by solid phase synthesis.

[0016] In some aspects, X is a bone anabolic peptide derived from BMP. In some aspects, X is a bone anabolic peptide derived from IGF. In some aspects, X is a bone anabolic peptide derived from a neuropeptide. In some aspects, X is a bone anabolic peptide that improves vascular function and/or vascularization. In some aspects, X is osteogenic growth peptide (OGP). In some aspects, the peptide is BFP, P4, or pBMP9. In some aspects, the peptide is MGF or Preptin. In some aspects, the peptide is Substance P or VIP. In some aspects, the peptide is TP508, VIP, or CNP. Unless indicated otherwise, the invention may be practiced by combining any X with any Z and optionally any suitable linking group Y. [0017] 1. A compound comprising: [0018] a compound of the formula X-Y-Z, wherein [0019] X is at least one agent that modulates activity selected from the group consisting of: Bone Morphogenic Protein(s) (BMP), Insulin Like Growth Factors (IGF), fibroblast growth factors, peptide, hormones, hormone releasing agents, lactoferrin, Ghrelin, c-Jun N-terminal kinase 3 agonists (JNK3 agonists), vasoactive peptide(s), any growth factor, and any active portion of any growth factor; [0020] Z is at least one bone-targeting molecule; and [0021] Y is an optional linker that joins and/or links X and Z; [0022] or a pharmaceutically acceptable salt thereof, or a metabolite thereof. [0023] 2. The compound according to claim 1, wherein [0024] Z is at least one polypeptide comprising 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and/or 20 acidic amino acid residues. [0025] 3. The compound according to claims, 1-2 wherein Z includes multiple aspartates and/or multiple glutamates. [0026] 4. The compound according to claim 3, wherein Z is comprised of at least one polypeptide selected from the group consisting of: at least 5 aspartic acids, at least 5 glutamic acids, at least 10 aspartic acids, at least 10 glutamic acids, at least 20 aspartic acids, at least 20 glutamic acids. [0027] 5. The compounds according to claims 1-4, wherein Z is selected from the group consisting of: a polypeptide comprising 10 aspartic acid residues (SEQ ID NO. 23) and a polypeptide comprising 10 glutamic acid residues (SEQ ID NO. 24). [0028] 6. The compound according to claims 1-4, wherein Z is selected from the group consisting of: 4 or more acidic amino acid residues, polyphosphate, aminohexanedioic acid or derivatives thereof, and/or alendronate or derivatives thereof. [0029] 7. The compound according to claims 1-6, wherein Y is selected from the group consisting of: releasable linkers and non-releasable linkers. [0030] 8. The compound according to claim 7, wherein the releasable linker includes at least one of the following groups: a disulphide, an ester, or a Protease specific amide bond. [0031] 9. The compound according to claim 7, the non-releasable linker includes at least one of the following groups; a carbon-carbon bond, or an amide. [0032] 10. The compound according to claims 1-6, wherein Y is polyethylene glycol (PEG). [0033] 11. The compound according to claim 10, wherein the PEG linker is comprised of 2-8 oxyethylene units. [0034] 12. The compound according to claims 1-6, wherein Y is a peptide belonging to the natural sequence of Z. [0035] 13. The compound according to claims, 1-9, wherein the BMP is at least one compound selected from the group consisting of: P4 (BMP2), BFP (BMP7), pBMP9 (BMP9), and B2A (BMP2/TGF beta). [0036] 14. The compound according to claims, 1-9, wherein the Insulin Like Growth Factor is at least one compound selected from the group consisting of: Preptin (IGF-II), and Mechano Growth Factor (MGF) (IGF-1). [0037] 15. The compound according to claims, 1-9, wherein the Fibroblast Growth Factor, is at least one compound selected from the group consisting of: Fibroblast Growth Factor 2 (F119) and F2A. [0038] 16. The compound according to claims, 1-9, wherein the Osteogenic peptide is histone h4. [0039] 17. The compound according to claims, 1-9, wherein X is selected from the group consisting of: parathyroid hormone-related protein (PTHrP) [107-139], and Osteogenic peptide. [0040] 18. The compound according to claims, 1-9, wherein the JNK3 agonist is, JNK3, or Annexin 1. [0041] 19. The compound according to claims, 1-9, wherein the Vasoactive peptide is at least one compound selected from the group consisting of: C-Type Natriuretic peptide (CNP), Thrombin peptide (TP508), VEGF mimetic (QK) and platelet derived growth factor 2A (P2A). [0042] 20. Use of a compound according to any of claims 1-19, for the manufacture of a medicament for therapeutic application. [0043] 21. A method of treating a patient, comprising the step of administering at least one dose of a compound according to claims 1-9.

[0044] These and other features, aspects and advantages of the present disclosure will become better understood with reference to the following figures, associated descriptions and claims.

BRIEF DESCRIPTION OF THE DRAWINGS

[0045] FIG. 1 depicts the bone volume divided by total volume of the 100 thickest micro computed tomography (CT) slices of the fracture callus bone density ("BV/TV") using a Dasatinib and targeted Dasatinib conjugate (both 10 .mu.mol/kg). Both were subcutaneously dosed daily to fracture-bearing Notre Dame breed (ND4) of Swiss Webster mice. Bone density of the fracture callus from the targeted Dasatinib group is twice as dense as the saline group, and 50% denser than the free Dasatinib group.

[0046] FIG. 2 depicts BV/TV and Trabecular Thickness using targeted E738 conjugate (1 .mu.mol/kg), subcutaneously dosed every-other-day to fracture-bearing Charles River's breed (CFW) of Swiss Webster mice. Targeted E738 conjugate significantly improved the bone density and trabecular thickness at the fracture callus.

[0047] FIG. 3 depicts structures for Dasatinib and E738.

[0048] FIG. 4 depicts structures for targeted conjugates of Dasatinib and E738.

[0049] FIG. 5 depicts peak load of Fractured Femurs after 2 weeks.

[0050] FIG. 6 depicts BV/TV two weeks after fractured femur received various concentration of Preptin D10 treatment.

[0051] FIG. 7 depicts TbTh (the trabecular thickness of the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of Preptin D10 treatment.

[0052] FIG. 8 depicts BV (the overall bone volume of the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of Preptin D10 treatment.

[0053] FIG. 9 depicts BV/TV two weeks after fractured femur received various concentration of OGP D10.

[0054] FIG. 10 depicts TbTh two weeks after fractured femur received various concentration of OGP D10.

[0055] FIG. 11 depicts TbSp (the spacing between the trabecula in the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of OGP D10.

[0056] FIG. 12 depicts BV/TV two weeks after fractured femur received various concentration of BFP D10.

[0057] FIG. 13 depicts TbSp two weeks after fractured femur received various concentration of BFP D10.

[0058] FIG. 14A depicts BV/TV four weeks after a fractured femur received various concentration of substance P4 mini peg D10 (P4 D10); FIG. 14B depicts the max load of substance P4 D10 four weeks after a fractured femur received the max load of substance P4 D10.

[0059] FIG. 15 depicts BV/TV four weeks after fractured femur received various concentration of Ghrelin D10.

[0060] FIG. 16 depicts BV four weeks after fractured femur received various concentration of pBMP9 D10.

[0061] FIG. 17 depicts BV/TV four weeks after fractured femur received various concentration of pBMP9 D10.

[0062] FIG. 18 depicts BV/TV four weeks after fractured femur received various concentration of CNP D10.

[0063] FIG. 19 depicts BV/TV four weeks after fractured femur received 1 nmol/day of ODP D10.

[0064] FIG. 20 depicts BV/TV three weeks after fractured femur received various concentrations of CBM D10 as compared to a fractured femur that received parathyroid hormone 1-34 (PTH).

[0065] FIG. 21 depicts BV/TV four weeks after fractured femur received various concentrations of P4 D10.

[0066] FIG. 22 depicts BV four weeks after fractured femur received 1 nmol/day of P4 D10.

[0067] FIG. 23 depicts BV/TV four weeks after fractured femur received various concentrations of MGF D10.

[0068] FIG. 24 depicts BV/TV four weeks after fractured femur received various concentrations of TP508_D10.

[0069] FIG. 25 depicts BV/TV four weeks after fractured femur received 1 nmol/day of VIP_D10.

[0070] FIG. 26 depicts TbTh four weeks after fractured femur received 1 nmol/day of VIP_D10.

[0071] FIG. 27 depicts the structure for BMP9 (SEQ ID NO: 14).

[0072] FIG. 28 depicts the structure for Ghrelin D10 (SEQ ID NO: 15).

[0073] FIG. 29 depicts the structure for Preptin D10 (SEQ ID NO: 3).

[0074] FIG. 30 depicts the structure for CNP-D10 (SEQ ID NO: 16).

[0075] FIG. 31 depicts the structure for VIP D10 (SEQ ID NO: 17).

[0076] FIG. 32 depicts the structure for Substance P with 4 mini PEG conjugated to D10 (SEQ ID NO: 18).

[0077] FIG. 33 depicts the structure for CBM D10 (SEQ ID NO: 9).

[0078] FIG. 34 depicts the structure for ODP D10 (SEQ ID NO: 19).

[0079] FIG. 35 structure of B2A_AHX3_e10 (SEQ ID NO: 27).

[0080] FIG. 36. Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.

[0081] FIG. 37. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.

[0082] FIG. 38. Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.

[0083] FIG. 39. Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.

[0084] FIG. 40. Structure of F2A_mp4_e10 (SEQ ID NO: 28).

[0085] FIG. 41. Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10

[0086] FIG. 42. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10.

[0087] FIG. 43. Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10

[0088] FIG. 44. Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10.

[0089] FIG. 45. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.

[0090] FIG. 46. Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.

[0091] FIG. 47. Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.

[0092] FIG. 48. Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.

[0093] FIG. 49. Structure of JNK3_mp4_e10 (SEQ ID NO: 21).

[0094] FIG. 50. Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.

[0095] FIG. 51. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.

[0096] FIG. 52. Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.

[0097] FIG. 53. Work to Fracture (mJ) after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.

[0098] FIG. 54. Structure of Lactoferrin_mp4_e10 (SEQ ID NO: 22).

[0099] FIG. 55. Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.

[0100] FIG. 56. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.

[0101] FIG. 57. Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.

[0102] FIG. 58. Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.

[0103] FIG. 59. Structure of Osteostatin_mp4_(D)E.sub.10 (SEQ ID NO: 23).

[0104] FIG. 60. TbTh measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E.sub.10.

[0105] FIG. 61. Max Load(N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E.sub.10.

[0106] FIG. 62. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E.sub.10.

[0107] FIG. 63. Stiffness (N/mm) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E.sub.10.

[0108] FIG. 64. Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E.sub.10.

[0109] FIG. 65. Structure of P2A-mp4_e10 (SEQ ID NO: 29).

[0110] FIG. 66. Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10

[0111] FIG. 67. Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10.

[0112] FIG. 68. Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10

[0113] FIG. 69. Work to Fracture (mJ) after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10.

[0114] FIG. 70. Structure of Preptin (1-34)_mp4_e10 (SEQ ID NO: 24).

[0115] FIG. 71. Bone Volume/Total Volume measured after treatment with saline, or Preptin (1-34)_mp4_e10_50.times..

[0116] FIG. 72. Bone Volume measured after treatment with saline, or Preptin (1-34)_mp4_e10_50.times..

[0117] FIG. 73. Max Load (N) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50.times..

[0118] FIG. 74. Post Yield Displacement (mm) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50.times..

[0119] FIG. 75. Work to Fracture (mJ) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50.times..

[0120] FIG. 76. Structure of QK_mp4_e10 (SEQ ID NO: 25).

[0121] FIG. 77. Bone Volume measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.

[0122] FIG. 78. Bone Volume/Total Volume measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.

[0123] FIG. 79. Max Load (N) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.

[0124] FIG. 80. Work to Fracture (mJ) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.

[0125] FIG. 81 depicts the structure for Annexin 1 (SEQ ID NO: 26).

[0126] FIG. 82 Max Load (N) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of Annexin 1.

[0127] FIG. 83 Work to Fracture (mJ) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of Annexin 1.

[0128] FIG. 84 depicts the structure for F119 (SEQ ID NO: 20).

BRIEF DESCRIPTION OF THE SEQUENCES

[0129] SEQ ID NO: 1: bone forming peptide conjugated with 10 aspartate acids (BFP D10).

[0130] SEQ ID NO: 2: osteogenic growth peptide conjugated with 10 aspartate acids (OGP D10).

[0131] SEQ ID NO: 3: Preptin conjugated with 10 aspartate acids (Preptin D10).

[0132] SEQ ID NO: 4: substance P with 4 mini PEG linker and conjugated with 10 aspartate acids (substance P 4 mini PEG D10).

[0133] SEQ ID NO: 5: Ghrelin D10 with Ser-3 replaced with diaminopropinoic acid.

[0134] SEQ ID NO: 6: BMP9 D10.

[0135] SEQ ID NO: 7: C-type Natriuretic peptide (CNP) conjugated with 10 aspartate acids (CNP 10).

[0136] SEQ ID NO: 8: Vasoactive intestinal peptide (VIP) conjugated with D10.

[0137] SEQ ID NO: 9: collagen binding motif conjugated with 10 aspartate acids (CBM D10).

[0138] SEQ ID NO: 10: P4 conjugated with 10 aspartate acids (P4 D10).

[0139] SEQ ID NO: 11: Mechano-growth factor conjugated with 10 aspartate acids (MGF D10).

[0140] SEQ ID NO: 12: Thrombin fragment TP508 conjugated with 10 aspartate acids (TP 508 D10).

[0141] SEQ ID NO: 13: Osteopontin-derived peptide conjugated with 10 aspartate acids (ODP D10).

[0142] SEQ ID NO: 14: BMP9 with 10 aspartate acids (BMP9).

[0143] SEQ ID NO: 15: Ghrelin with 10 aspartate acids (Ghrelin D10).

[0144] SEQ ID NO: 16: CNP with 10 aspartate acids (CNP-D10).

[0145] SEQ ID NO: 17: VIP with 10 aspartate acids (VIP D10).

[0146] SEQ ID NO: 18: 4 mini PEG D10.

[0147] SEQ ID NO: 19: ODP with 10 aspartate acids (ODPD10).

[0148] SEQ ID NO: 20: F119 with 10 glutamic acids (F119).

[0149] SEQ ID NO: 21: JNK with 10 glutamic acids (JNK3_mp4_e10).

[0150] SEQ ID NO: 22: Lactoferrin with 10 glutamic acids (Lactoferrin_mp4_e10).

[0151] SEQ ID NO: 23: Osteostatin with 10 glutamic acids (Osteostatin_mp4_(D)E.sub.10).

[0152] SEQ ID NO: 24: Preptin with 10 glutamic acids (Preptin (1-34)_mp4_e10).

[0153] SEQ ID NO: 25: QK with 10 glutamic acids (QK_mp4_e10).

[0154] SEQ ID NO: 26: Annexin 1 with 10 glutamic acids (Annexin 1).

[0155] SEQ ID NO: 27: B2A with 10 glutamic acids (B2A_AHX3_e10).

[0156] SEQ ID NO: 28: F2A with 10 glutamic acids (F2A_mp4_e10).

[0157] SEQ ID NO: 29: P2A with 10 glutamic acids (P2A-mp4_e10).

[0158] SEQ ID NO: 30: Targeting group consisting of a polypeptide, DDDDDDDDDD.

[0159] SEQ ID NO: 31: Targeting group consisting of a polypeptide, EEEEEEEEEE.

DETAILED DESCRIPTION

[0160] While the concepts of the present disclosure are illustrated and described in detail in the figures and the description herein, results in the figures and their description are to be considered as examples and not restrictive in character; it being understood that only the illustrative aspects are shown and described and that all changes and modifications that come within the spirit of the disclosure are desired to be protected.

[0161] Unless defined otherwise, the scientific and technology nomenclatures have the same meaning as commonly understood by a person in the ordinary skill in the art pertaining to this disclosure.

[0162] Aspects of the fracture targeted technology disclosed herein can help both civilians and military personnel. Bone fractures occur at an annual rate of 2.4 per 100 people and cost the US healthcare system approximately $28 billion per year. Of the 6.3 million bone fractures that occur annually in the US, 300,000 result in delayed union or non-union healing. Approximately 887,679 hospitalizations result each year from fractures. Over half (57%) of fractures resulting in hospitalizations occur in persons aged 65 and over. Estimated health care costs are indicated in Table 1, below.

TABLE-US-00001 TABLE 1 Cost without Cost with Fracture Healing time surgery surgery Leg 10-12 weeks) $2,500 $16,000 Hip 12+ weeks $11,500 $66,500 Vertebral (8+ weeks) $5,000-15,000 $50,000-150,000 Arm 6-10 weeks $2,500 $16,000

[0163] Currently, a substantial fraction of national defense outlays is devoted to combat-related medical expenditures, with a significant proportion of these costs devoted to treatment of orthopedic injuries. Indeed, .about.65% of all wounds associated with military conflicts since World War I (WWI) have included orthopedic injuries, and 26% of all injuries to an extremity have involved one or more broken bones. Treatment of bone fractures not only removes a soldier from service for an extended period of time, but also requires the attention of multiple additional personnel to treat, monitor and rehabilitate the injured soldier. Unfortunately, some orthopedic injuries are so severe that resolution of the damage never occurs, and the armed services are then obligated to care for the damaged combatant in perpetuity.

[0164] Fractured bones are not only an adverse consequence of combat, they also constitute a prominent repercussion of military training exercises. During the course of a soldier's schooling, a female recruit will have a 3.4-21% chance of suffering a stress fracture, while a male recruit will have a 1-7.9% probability of experiencing the same injury. While such maladies may at first seem trivial, statistics reveal that they cost the military .about.$34,000 per soldier which totals up to .about.$100 million in aggregate per year. Not surprisingly, many affected recruits eventually leave the military as a consequence of their stress fracture, which results in further expenses arising from wasted recruiting and training efforts. Therapies for fractured bones both within and outside of the military rely almost exclusively on mechanical stabilization of the damaged bone (i.e. use of a cast, pin, rod, or plate, etc.). In fact, the only FDA-approved drug for enhancing fracture repair is a bone anabolic agent that must be applied topically to the fracture surface during surgery. Needless to say, such a therapy is inappropriate when the surgery is not otherwise indicated, can only be administered once (i.e. during the brief period when the fracture surface is exposed), cannot be easily adapted for treatment of multiple fractures, and is never used for therapy of stress fractures. What is critically needed is obviously a systemically administered bone anabolic agent (i.e. as drug that can stimulate rapid bone fracture healing) that will concentrate selectively on the bone fracture surface and induce accelerated bone formation only at the damaged site. Surprisingly, nothing of this sort has ever been described in the literature.

[0165] Recognizing the enormous need for a systemically administered bone fracture-targeted healing agent, peptides and other molecules with structures that home specifically to bone fracture surfaces following intravenous or subcutaneous administration were identified. A second group of bone anabolic agents (for example, both bone growth stimulating hormones and cytokines as well as various low molecular weight bone growth-inducing drugs, etc.), that when linked to one of our bone fracture-homing peptides, would promote accelerated fracture repair, were also identified. Fortunately, several fracture-targeted bone anabolic drugs met all initial requirements for advancement into large animal studies. That is, the targeted conjugates were found to: i) reduce the time for fractured femur repair in mice by roughly half, ii) induce no detectable systemic toxicity at its effective dose, iii) cause no ectopic bone formation at either the injection site or elsewhere), iv) lead to regeneration of bone at the fracture site that was biomechanically stronger than the contralateral (unbroken) femur, and v) result in eventual remodeling of the fractured region into normal cortical bone.

[0166] All in vivo data included herein are from Swiss Webster mice. All mice received an osteotomy on their right femur and received subcutaneous drug administration daily for either 2, 3 or 4 weeks, as indicated, for each compound. 1.times. concentration represents 1 nmol/day, 10.times. represents 10 nmol/day, 100.times. represents 100 nmol/day most studies have an n of 5.

[0167] Aspects of the disclosure include conjugates sometimes written in the form of X-Y-Z, wherein each conjugate includes at least one moiety (X) that has the ability to effect bone growth, development, and/or healing, for example, anabolic agents, and a targeting moiety (Z) which has an affinity for bone and helps to direct the conjugate to bone. In some of these conjugates, the X and Z portions are joined together by a linker region (Y).

[0168] Targeting moieties (Z), many of which are explicit or implicit disclosed herein, have the potential to target bone anabolic agents to bone fractures, ostectomies, and osteotomy sites. The compounds described here are composed of molecules with high affinity towards hydroxyapatite and a bone anabolic agent. Although targeting has been exemplified primarily with acidic oligopeptides, all molecules with affinity towards hydroxyapatite could be attached to a bone anabolic agent to improve fracture repair. These molecules include but are not limited to ranelate, bisphosphonates, tetracyclines, polyphosphates, molecules with multiple carboxylic acids, calcium chelating molecules, metal chelators, acidic amino acid chains of either d or L chirality. Each of the previously listed targeting molecules can be single units, polymers, dendrimers or multiple units. Other molecules can also be substituted for the targeting agent. These include peptides, proteins and manmade molecules that intercalate, bind to, adsorb to, or hybridize with: collagen, the extracellular matrix, heparan sulfate, chondroitin sulfate, keratan sulfate, hyaluronic acid, elastin, fibronectin, laminin, proteoglycans, basement membrane, extracellular polymeric substances, integrins, blood clotting factors, fibrinogen, thrombin, fibrin, and other extracellular macromolecules, It is also possible to target using a combination of the listed targeting molecules.

Definitions

[0169] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art to which this disclosure pertains.

[0170] The term "BV/TV" means the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus.

[0171] The term "TbTh" means the trabecular thickness of the 100 thickest micro CT slices of the fracture callus.

[0172] The term "BV" means the overall bone volume of the 100 thickest micro CT slices of the fracture callus.

[0173] The term "TbSp" means the spacing between the trabecula in the 100 thickest micro CT slices of the fracture callus.

[0174] The term "Peak Load" means a postmortem 4 point bend of the healed femur. Peak load represents the maximum force the healed femur withstood before it refractured.

[0175] The term "D10" at the end of any name represents that the peptide is targeted to bone by a chain of 10 aspartic acids. D10 can be at the N-terminus or C-terminus of the specified peptide.

[0176] The term "E10" or "(D)E10" at the end of any name represents that the peptide is targeted to bone by a chain of 10 (D) glutamic acids.

[0177] The term "P4" means a fragment that represents the knuckle epitope in hBMP-2.

[0178] The term "P-4" corresponds to residues 73-92 of BMP-2 in which Cys-78, Cys-79, and Met-89 are changed to Serine (Ser), Ser, and Threonine (Thr). BMPs are well known regulators of bone and cartilage formation. BMPs bind as dimers to type I and type II Ser/Thr receptor kinases, forming an oligomeric complex that activates intracellular Smad proteins leading to their translocation into the nucleus where they serve as transcription factors to activate different OB differentiation markers (such as Runx2 (transcription factor for osteoblast differentiation)), leading to osteoblastogenesis. BMPs have also been shown to stimulate mesenchymal stem cells (MSC) differentiation to OBs by promoting recruitment of osteoprogenitor cells.

[0179] The term "AHX" in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of 6-(amino)hexanoic acid.

[0180] The term "AHX3" in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of (6-(amino)hexanoic acid).sub.3.

[0181] The term "mp4" in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of 4 minipegs as known as 8-Amino-3,6-Dioxaoctanoic Acid.

[0182] The term "STB" at the end of any name represents that the compound represents a chemically more stable version of its natural version.

[0183] Compounds which effect bone growth and may be used to practice aspects of the present disclosure include but are not limited to the following: growth factors, fragments of growth factors, or synthetic peptides or small molecules that mimic the action of growth factors. Examples of which may include but are not limited to: transforming growth factors(alpha or beta), insulin, insulin-like growth factors, fibroblast growth factor (1-23), erythropoietin, epidermal growth factor, colony-stimulating factors (including macrophage colony-stimulating factor, granulocyte colony-stimulating factor, granulocyte macrophage colony-stimulating factor), bone morphogenetic proteins (BMP) (1-8a, 8b, 10, 11, 15), angiopoietin, vascular endothelial growth factor, megakaryocyte growth and development factor, adrenomedullin, autocrine motility factor, ciliary neurotrophic factor, leukemia inhibitory factor, interleukin(1-7), ephrins(A1-5, B1-3), Foetal Bovine Somatotrophin, glial cell line-derived neurotrophic factor, neurturin, persephin, artemin, growth differentiation factor-9, hepatocyte growth factor, hepatoma-derived growth factor, keratinocyte growth factor, migration-stimulating factor, macrophage-stimulating protein, myostatin, neuregulins(1-4), neurotrophins, brain-derived neurotrophic factor, nerve growth factor, neurotrophin-3, neurotrophin-4, placental growth factor, platelet-derived growth factor, renalase, T-cell growth factor, tumor necrosis factor-alpha, Wnt signaling activators, parathyroid hormone-related peptide, parathyroid hormone, growth differentiation factor, Growth Hormone (GH), thyroid hormone, calcitonin, vitamin D, Apelin, Annexin, Bmp fragments including: OPD (BMP2), P-1(Bmp2), P24(bmp2), P4(BMP) HBD(bmp4), Bone Forming Peptide (BFP), BFP-1(BMP-7), BFP-2(BMP-7), BFP-4(BMP-7), BFP-7 derived peptide, (bmp7), peptide b(BMP-7), BMP-9-derived peptide(bmp-9), pBMP-9(BMP-9), SpBMP-9(BMP-9), BMP2-L51P(BMP2), BMP2 108(BMP2), mBMP (BMP2), osteopromotive domain (OPD) (BMP2), PEP7 (BMP2), AB204(BMP2/ACTIVIN A), AB204-1103Y(BMP2/ACTIVIN A), AB211(BMP2/ACTIVIN A), AB215((BMP2/ACTIVIN A), BMP2/BMP9 chimera BB29, BMP6/BMP7 chimera 80, BMP7-E60K BMP6, THR-123 (BMP7), MB109 (BMP9), GDF5-S94N, GDF5-N445K, GDF5-N445T, GDF5-V453/V456, BMP2/6, BMP2/7, BMP4/7, Casein kinase 2 (CK2), CK2.1, CK2.2, CK2.3; Fibroblast growth factor 2 fragments: F105, F119, F36, F77; Glucagon like peptide, Exendin 4, exenatide, liraglutide, lixisenatide, albiglutide, dulaglutide, semaglutide, taspoglutide, Preptin, E peptide, mechano growth factor, Cathelicidin, Endothelin-1, OGP (osteogenic growth peptide), cyclic OGP10-14, OGP10-14, Ostabolin, Ostabolin-C, ZP2307, TP-508 Chrysalin, PBA2-1c, QK, Amylin, ghrelin, GHRP-6, hexarelin, ipamorelin, amylin, human c peptide, vessel dilator, CNP, BMN 11, Osteoblast activating peptide, fMLF, hepcidin, PSI, Epoxomicin, bortezomib, Carfizmib, oprzomib, Epiregulin, Betacellulin, amphiregulin, Neuregulin, Stem cell factor, Agrin, Ephrin, Glial cell line-derived neurotrophic factor, neurturin, artemin, Angiopoietins SPARC-113, SPARC-118, Osteoactivin, or a molecule stimulates JNK3 upregulation: such as JNK3, and arrestin 3 fragments, or annexin1.

[0184] Still other compounds which effect bone growth and may be used to practice aspects of the present disclosure include but are not limited to an angiogenic factor or a vasoactive compound that either stimulates angiogenesis or hematopoiesis, effects hematopoiesis, is released by or affects cells of a hematopoietic lineage, such as red blood cells, leukocytes, platelets, monocytes, or endothelial cells, or is a protein, peptide or other small molecule release in response to injury to blood vessel, or the full protein, peptide or fragments of such molecules or synthetic or small molecules that mimic their actions. Examples of which may include but are not limited to: VEGF, QK, SPARC 113, VIP, PACAP, Dobutamine, dopamine, isoprenaline, endothelin 1, phenylphrine, adrenaline, terlipressin, Angeotensin II, Ace inhibitors, FGF2, PDGF, Angiopoietin, Hypoxia inducable factors, MMP2, metaloproteases, sokotrasterol sulfate, 0-sitosterol, oversulfated exopolysaccharide, IGF-1fumagillin, Vatanib, Axtinib, Placental growth factor, neuropilin, VE-cadherin, Alpha-v beta 3, afibercept, HIF1A, cediranib, Shingosinel-phosphate, 2 methoxyesterdiol, vandetanib, semanib, ephrin, ramucirumab, TIE1, Platelet activating vactor, Thrombin, TP508, fibrin, fibrinogen, von Willebrand factor, protease-activated receptor, serotonin, platlet activating factor, ATP, ADP, Thromboxane A2, factor X, factor VII, Factor IX, Hangeman factor, factor I, Factor VIII, Vitamin K, platelet factor 4, endothelium derived hyperpolarizing factor, prostaglandins, leukotrienes, notchagonists, LIF, Jagged, and memaquinone.

Bone Growth Modifiers and Delivery Peptides

TABLE-US-00002 [0185] (SEQ ID NO: 1) BFP1D10 DDDDDDDDDDGQGFSYPYKAVFSTQ

[0186] BFP (bone forming Peptide) a fragment of immature BMP7 is a 15-amino acid peptide corresponding to residues 100-115 of the immature form of BMP-7 which like BMP2 is involved in osteogenic differentiation, proliferation, and formation of new bone. This short peptide also induces osteogenesis calcium content in MSCs.

BMP-9

[0187] BMP-9 is also a potent regulator of osteogenesis and chondrogenesis and is a potent inducer of differentiation of osteoblasts. pBMP9 is a 23-residue peptide derived from residues 68-87 of the knuckle epitope of human BMP-9. The mechanism of action of this peptide is likely to involve the small mothers against decapentaplegic (Smad) pathway. The structure of BMP9 is depicted in FIG. 27.

Ghrelin D10

[0188] Ghrelin is a 28-residue peptide hormone synthesized primarily by the gastric fundus in response to fasting, and acts as a ligand of the growth hormone secretagogue (GHS) receptor (GHSR) to promote growth hormone release from the pituitary. Ghrelin stimulation at the GHSR leads to the proliferation of osteoblasts and prevents the apoptosis of osteoblasts through mitogen-activated protein kinase/extracellular signal-regulated kinases (MAPK/ERK) and phosphoinositide 3-kinase/protein kinase B (PKB) (PI3K/AKT) pathways. Ghrelin also stimulates osteoprotegerin (OPG) gene expression, which inhibits the coupling between the osteoclasts and osteoblasts, leading to reduced osteoblast-related osteoclast differentiation. Increased OPG also and decreases osteoclast activity. Ghrelin is only active when the Ser-3 is acylated with octanoic acid. Our construct contains a stabilized version of this where Ser-3 was replaced with diaminopropionic acid. The structure of Ghrelin D10 is depicted in FIG. 28.

Preptin D10

[0189] Preptin is a 34-residue peptide hormone that is secreted by the .beta.-cells of the pancreatic islets. This peptide corresponds to Asp-69 to Leu-102 of the E-peptide of proinsulin-like growth factor-II (pro-IGF-II). Preptin's anabolic effects on bone are exerted through its ability to stimulating osteoblasts s proliferation, differentiation, and promoting their survival. Preptin's proliferative effect is predicted to be facilitated through a G-protein-coupled receptor triggering phosphorylation of p42/44 MAP kinases. Some of preptin's anabolic effects are believed to be due to it stimulating an increase in a known bone anabolic connective tissue growth factor. While the native peptide effects glucose metabolism the first 16 amino acids are important for its anabolic effects and have no effects on glucose metabolism. The structure of Preptin D10 is depicted in FIG. 29.

CNP-D10 is a C-Type Natriuretic Peptide Targeted with D10

[0190] C-Type Natriuretic Peptide (CNP) contains 22 residues stabilized by an intramolecular disulfide linkage between Cys-6 and Cys-22 it functions as a local regulator of vascular tone, possibly due to its strong vasorelaxant properties. CNP also acts on the differentiation and proliferation of OBs, OCs, and chondrocytes via an autocrine/paracrine process through binding to the natriuretic peptide receptor B (NPR-B). CNP activates bone turnover and remodeling. Endochondral ossification is another mechanism of bone formation affecting chondrocytes. It involves the conversion of an initial cartilage template into bone such as long bones and vertebrae. CNP has been shown to be an important anabolic regulator of endochondral ossification. The structure of CNP-D10 is depicted in FIG. 30.

VIP D10 is Vasoactive Intestinal Peptide Targeted with D10

[0191] Vasoactive intestinal peptide (VIP), a neuropeptide that consists of 28 amino acids and originally isolated from porcine intestine. VIP has several effects however its receptors are present on the nerves that rapidly innervate the fracture callus. It has been shown to be an important regulator of bone formation. VIP exerts its biological effects through the G-protein-coupled receptors (VPAC1, VPAC2, and PAC1). Signaling through these receptors also enhanced cell osteoblast differentiation and proliferation. It also increases expressions of collagen type I, osterix (OSX), and alkaline phosphatase (ALP) through signaling at the VPAC2 receptor by triggering an increase in intracellular calcium. VIP also increases the expressions of BMPs and the nuclear presence of Smad1 transcription factor, which can activate various bone-specific genes. VIP also enhances osteoblast proliferation and mineralization through increased gap junction intercellular communication (GJIC) between osteoblasts. VIP also affects the differentiation of osteoclasts thus leading to an increase in bone resorption. The structure of VIP D10 is depicted in FIG. 31.

Substance P with 4 Mini PEG Conjugated to D10

[0192] Substance P is an 11-amino acid long pro-inflammatory neuropeptide belonging to the tachykinin family. Substance P improves mineralization of osteoblasts and the expression of osteogenic markers at late-stage bone formation, by activating neurokinin-1 receptor, a G-protein coupled receptor found in the central and peripheral nervous systems. Also, substance P reduces osteoclastogenesis and bone resorption. Substance P upregulates the expressions of collagen type 1, ALP, Runx2 and osteocalcin in osteoblasts this effect involves the activation of Wnt/.beta.-catenin signaling pathway. Substance P promotes differentiation and migration capability of rat bone marrow MSCs and activates BMP-2 expression in osteoblasts. Some of substance p's anabolic effects are attributed to in human to increases in osteoblast proliferation and mineralization through increased gap junction intercellular communication between osteoblasts. Gap junction intercellular communication has important roles in conveying the anabolic effects of hormones and growth factors and regulating transcription of osteogenic markers. The structure of Substance P with 4 mini PEG conjugated to D10 is depicted in FIG. 32.

CBMD10--is the Collagen Binding Motif of Osteopontin Targeted by D10

[0193] CBM collagen binding motif is the highly conserved 28-residue collagen binding motif (CBM) (residues 150-177) of human osteopontin. Osteopontin, a glycosylated phosphoprotein prominently localized in the extracellular matrix (ECM) of mineralized bone tissue to form a complex with collagen in bone tissue, thereby inducing mineralization of collagen fibrils. CBM enhances osteoblast differentiation of human MSC. CBM causes osteogenic differentiation of human bone marrow MSCs and increases mineralized of bone. CBM works in human MSCs by increasing extracellular Ca.sup.2+ influx, which leads to the activation of CaMKII and the subsequent phosphorylation of ERK1/2, ultimately influencing OB differentiation. The structure of VIP D10 is depicted in FIG. 33.

ODP D10

[0194] Osteopontin-derived peptide (ODP), a 15-residue peptide derived from rat osteopontin. ODP like CBM is a fragment of extracellular protein involved in the mineralization of collagen. ODP enhanced the differentiation and mineralization of MSCs. ODP improves the attachment via receptor mediated attachment and migration of osteoblasts and fibroblasts to the fracture site. ODP improves the proliferation and migration of osteoblasts. Though the signaling pathways are not completely elucidated for this molecule its believed that it works in a similar mechanism as CBM. The structure of ODP D10 is depicted in FIG. 34.

TABLE-US-00003 (SEQ ID NO: 2) OGP-D10 DDDDDDDDDDALKRQGRTLYGFGG

[0195] OGP-targeted Osteogenic growth peptide (OGP) is composed of a 14-AA residue identical to the C-terminus of histone 4 conjugated to an acidic oligopeptide at the N-terminus. Systemic administration of free OGP has been shown to improve fracture repair by improving the mineralization of cartilaginous fracture callus.

TABLE-US-00004 (SEQ ID NO: 11) MGF-DDDDDDDDDDYQPPSTNKNTKSQRRKGSTFEEHK

[0196] Targeted mechano growth factor (MGF) E peptide is a splice variant of insulin-like growth factor I (IGF-I) with a targeting acidic oligopeptide on the N terminus. MGF causes osteoblast proliferation through the MAPK-ERK signaling pathway. Local injections (57 ug/kg) in rabbit bone defects 5 mm demonstrated accelerated healing through osteoblast proliferation.

TABLE-US-00005 (SEQ ID NO: 12) TP508- DDDDDDDDDDAGYKPDEGKRGDACEGDSGGPFV

[0197] Targeted TP-508 is a prothrombin peptide that has been modified on the N-terminus with an acidic oligopeptide. The anabolic portion of TP-508 has been used in clinical trials for repairing foot ulcers. Free TP-508 has a proliferative effect on osteoblasts. Local injections have demonstrated accelerated fracture repair in older rats.

B2A Peptide

[0198] B2A is a synthetic, multidomain peptide with two 19 amino acid branches derived from the region which is similar to the TGF-P/BMP-binding region of fetuin, a member of the cystatin family of protease inhibitors. The 19 amino acid branch acts as a BMP receptor ligand. BMP receptor activation is well known to osteogenic as BMP2 is currently approved to treat bone fractures. However existing strategies rely on the use of a full recombinant human protein. B2A is a dimer peptide that achieves similar levels of BMP receptor activation with a much mass. Bone morphogenetic protein receptor (BMPR) activation is canonically associated with activation of the small mothers against decapentaplegic (Smads) pathway BMPR ligands can, activate non smad signaling via p38, extracellular signal-regulated kinases 1 and 2 (ERK1/2), stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK), and protein kinase B (Akt/PKB). non smad signaling is key in cell survival, nutution and metabolism and migration. B2A has the ability to bind both type I and II receptors for BMP. In the presence of BMP-2, B2A augments osteo-differentiation. In the absence of BMP-2, B2A-induced proliferation, aggrecan synthesis, and collagen accumulation in mesenchymal stem cells. Here by targeting B2A to the fracture, the osteogenic signal that locally applied BMP2 can be specifically localize to allow a much smaller much less invasive to apply form. The structure of B2A is depicted in FIG. 35.

F2A (Growth Factor)

[0199] F2A_mp4_e10 is made up of two copies of the fibroblast growth factor (FGF) receptor targeting sequence from FGF2 branching from a single lysine then 4 minipegs to act a linker and spacer and 10 D glutamic acids to target to the bone. F2A's receptor targeting sequence is YRSRKYSSWYVALKR derived from derived from native FGF-2 (residues from 106 to 120). It has been shown to be nearly as potent as the full native protein at stimulating angiogenesis and osteogenesis in its dimer form. FGF2 is an anabolic growth factor heavily involved in wound healing and tissue repair. It Is both angiogenic and osteogenic. Fgf2 has shown promise as a protein treatment for wound healing. The advantage of F2A e10 is its small size allows for better perfusion and the e10 allows it to chemically home to the damaged tissue site from a noninvasive injection at a distal site. The structure of F2A is depicted in FIG. 40.

F119 (Growth Factor)

[0200] F119 is a heparin binding fragment from growth factor fibroblast growth factor 2. Fibroblast growth factor (FGF)-2 regulates a variety of cellular functions, such as proliferation and differentiation, by binding to cell surface FGF receptors (FGFRs) in the presence of heparin proteoglycans F119 a heprerin binding site for fgf2 which corresponds to 119-135 of fgf2 (F119, KRTGQYKLGSKTGPGQK). F119 interacts with cell-surface heparan sulfate proteoglycans. In addition, osteoblast differentiation, confirmed by ALPase activity and mineralization, is increased by F119. The structure of F119 is depicted in FIG. 84.

c-Jun NH2-terminal Protein Kinases (JNK3)

[0201] The c-Jun NH2-terminal protein kinases (JNKs) belong to the MAPK family. JNKs regulate normal physiological processes of cell proliferation, apoptosis, differentiation, and migration7. JNKs were also implicated in many diseases, from cancer to neurological and immunological disorders recently they were implicated as one of reasons adults bones don't have the same response to mechanical stimuli. It was found that increasing JNK3 activity stimulated more responsiveness to osteoinductive activity Arrestin-3 facilitates INK activation in cells, and a short 25-residue arrestin-3 peptide was identified as the critical JNK3-binding element.sup.2. It was demonstrated that this 25 residue peptide, JNK3, also binds mitogen-activated protein kinase 4 (MKK4), MKK7, and apoptosis signal-regulating kinase 1 (ASK1), which are upstream JNK3-activating kinases. This peptide is sufficient to enhance JNK3 activity in cells. The increases the responsiveness osteogenic signals that occur during bone fracture repair. Thus restoring the regenerative abilities of youth to adults. The structure of JNK3 is depicted in FIG. 49.

Lactoferrin

[0202] Lactoferrin is an iron-binding glycoprotein that belongs to the transferrin family. It is present in breast milk, in epithelial secretions, and in the secondary granules of neutrophils. In healthy subjects lactoferrin circulates at concentrations of 2-7.times.10-6 g/ml. Lactoferrin is a pleiotropic factor with potent antimicrobial and immunomodulatory activities. It has shown that lactoferrin can also promote bone growth. Lactoferrin is stimulatory towards osteoblasts and prevents osteoclastogensis. It has been shown that that lactoferrins interactions with osteoblast like cells is primarily through LRP1, a member of the family of low-density lipoprotein receptor-related proteins that are primarily known as endocytic receptors. Lactoferrin also induces activation of p42/44 MAPK signaling in primary osteoblasts, but the two pathways seem to operate independently as activation of MAPK signaling, but not endocytosis, is necessary for the mitogenic effect of lactoferrin. Lactoferrin is too large to act as a good therapeutic. But several active fragments of lactoferrin have been identified. Lactoferricin which is a loop region from the n terminus of Lactoferrin has been shown to have both antimicrobial and osteogenic effects..sup.4,5, Our targeted compound comes from residues 17-31 from the n terminus followed by a 4 minipeg spacer and linker and 10 D glutamic acids to home it to bone. The structure of lactoferrin is depicted in FIG. 54.

Osteostatin (PTHrP[107-139])

[0203] Osteostatin (PTHrP[107-139]) is a fragment of Parathyroid hormone related protein(PTHrP) that has been reported to be more anabolic than 1-34 of PTHrP. PTHrP is anabolic on bone both because of an inhibitory effect on osteoclast but mostly a stimulatory effect on osteoblasts. Some of its effect is believed to function like PTHrP though WNT signaling and also through interactions with the vascular endothelial growth factor (VEGF) receptor to increase survival of osteoblasts. The structure of osteostatin (PTHrP[107-139]) is depicted in FIG. 59.

P2A (Platelet-Derived Growth Factor (PDGF))

[0204] Platelet-derived growth factors (PDGFs) are mitogens for many cells primary of mesenchymal origin and their involvement in wound healing has lead to the therapeutic use of recombinant human PDGF-BB, one of PDGF family. PDGF are released by plates at the site of fractures are chemotactic and mitogenic for osteoblast lineage cells and osteoblasts and therefore may enhance fracture healing by attracting osteoprogenitor cells to the fracture by chemotaxis and amplifying their quantity by mitogenesis. Further, PDGF-3B upregulates the expression of angiogenic vascular endothelial growth factor (VEGF), a key molecule for bone regeneration. PDGF-BB is approved to accelerate ankle fusion. It was found that a Arg160, Lys161 and Lys162 in PDGF-BB are required for mitogenic activity and high-affinity receptor. It was shown that a chain containing a branched dimer of VRKIEIVRKK derived from residues 153-162 of PDGF-BB was almost as active as the full PDGF-BB. The targeted construct of the present disclosure consists of that cyclized branched dimer of VRKIEIVRKK derived from residues 153-162 of PDGF-BB, with a 4 minipeg spacer and 10 (D) glutamic acid to localize it to the site of the fracture. The structure of P2A is depicted in FIG. 65.

Preptin(1-34)

[0205] Preptin is a 34-residue peptide hormone that is secreted by the .beta.-cells of the pancreatic islets. This peptide corresponds to Asp-69 to Leu-102 of the E-peptide of proinsulin-like growth factor-II (pro-IGF-II). Preptin's anabolic effects on bone are exerted through its ability to stimulating osteoblasts s proliferation, differentiation, and promoting their survival. Preptin's proliferative effect is predicted to be facilitated through a G-protein-coupled receptor triggering phosphorylation of p42/44 MAP kinases. Some of Preptin's anabolic effects are believed to be due to it stimulating an increase in a known bone anabolic connective tissue growth factor. While the native peptide effects glucose metabolism the first 16 amino acids are important for its anabolic effects and have no effects on glucose metabolism. The structure of Preptin(1-34) is depicted in FIG. 70.

QK (Vascular Endothelial Growth Factor (VEGF))

[0206] The vascular endothelial growth factor (VEGF) is the main regulator of angiogenesis. It elicits its proangiogenic activity by binding to two membrane receptors (VEGFR1 and VEGFR2) on the surface of endothelial cells (ECs). The binding of the natural ligand to VEGFR2 induces receptor dimerization and autophosphorylation of the intracellular kinase domain, which activates intracellular pathways ending in proliferation, migration, survival, and definitively triggering of the proangiogenic cellular response. Recently a de novo synthesized VEGF mimetic, named QK that shares the same properties as VEGF. This mimetic is a 15 amino acid peptide which adopts a very stable helical conformation in aqueous solution that resembles the 17-25 .alpha.-helical region of VEGF165, and binds both VEGFR-1 and 2. QK recapitulates all of VEGFs properties of angiogenesis, vasodilation and most importantly wound healing. It is well established that VEGF improves the spread at which a wound heals. The quicker the blood supply is returned to normal the faster the body can repair itself. Full VEGF is difficult to control and use as drug to treat internal damage. But the targeted construct of the present disclosure takes the power of QK and homes it just to the damage site to control the site of angiogenesis to jus the desired region. The construct of the present disclosure is made up of the bone targeting ligand of the present disclosure attached to a mini-peg spacer and then to QK on its N terminus. The structure of QK is depicted in FIG. 76.

Annexin-1

[0207] Annexin-1 is a family of phospholipid-binding proteins found in many tissues including bone marrow.363 The N-terminal fragment of annexin-1, Anx (2-26) is an endogenous ligand agonist of FPR1. Anx (2-26) promotes chemotactic migration and OB differentiation of MSCs via FPR1. The N-formyl peptide receptor (FPR) is a chemoattractant receptor belonging to the G-protein coupled receptor family. It is expressed in human bone marrow derived MSCs and is functionally involved in promoting MSC adhesion to extracellular matrix protein-coated surfaces as well as migration to sites of fracture for tissue regeneration. The structure of Annexin-1 is depicted in FIG. 81.

Material and Methods

Solid Phase Peptide Synthesis

[0208] Unless noted otherwise, the conjugates of the present disclosure are synthesized using the following synthesis. In a solid phase peptide synthesis vial capable of bubbling nitrogen, Wang resin (0.39 mmol/g) was loaded at 0.39 mmol/g with the first amino acid overnight in dichloromethane (DCM) and diisopropyl ethyl amine (DIPEA). The resin was then capped with acetic anhydride and pyridine for 30 minutes, followed by three washes of DCM and dimethylformamide (DMF), respectively. Following each amino acid coupling reaction, fluoroenylmethyloxycarbonyl (Fmoc)-groups were removed by three 10 minute incubations with 20% (v/v) piperidine in DMF. The resin was then washed 3.times. with DMF prior to the next amino acid being added. Each amino acid was added in a 5-fold excess with N,N,N'N'-Tetramethyl-O-(1H-benzotriazol-1-yl)uronium hexafluorophosphate (HBTU) in DIPEA. Upon completion of the synthesis, peptides were cleaved using 95:2.5:2.5 trifluoroacetic acid:water:triisopropylsilane. Cysteine containing peptides were cleaved using 95:2.5:2.5 trifluoroacetic acid:triisopropylsilane:water: and 10 fold tris(2-carboxyethyl)phosphine (TCEP).

Cyclization Method for Disulfide Bridged Cyclic Peptides

[0209] For Amylin(1-8) and CGRP, the standard synthesis of the linear form of the cyclic peptides Fmoc Cystine with Acetamidomethyl protecting group on the sulfur was used. Then, to cyclize the peptide, the Cys(Acm) On-Resin was suspended the linear peptide resin in N,N-dimethylformamide (DMF) (approximately 1 mL/gram of resin). Then, the resin was treated with 10 equiv. of iodine (I2) in DMF/H2O 4:1 (v/v), approximately 1 mL/gram of resin). Then, argon gas was bubbled through the reaction mixture at room temperature for 40 minutes. Then, the resin was filtered and washed 3 times with DMF, 2 times with 2% ascorbic acid in DMF, 5 times with DMF, and 3 times with dichloromethane (DCM). Then, proceeded with normal n terminal fmoc deprotection and cleavage from the resin with normal cleavage solution with no TCEP added to preserve the disulfide bond. The peptides were then as all peptides purified using reverse phase chromatography on an HPLC using a 0-50% 20 mM ammonium acetate:acetonitrile gradient. The product was then identified from the appropriate fraction using LCMS and lyophilized to recover it from the water:acetonitrile mixture. All compounds were dissolved in sterile phosphate buffered saline (PBS) at the appropriate dose concentrations for drug delivery.

General Methods for Obtaining Test Data

[0210] The targeted conjugates were synthesized using standard Fmoc solid-phase peptide synthesis, as described above. To ensure the conjugates' activity, mouse pre osteoblast (MCTC3-E1) cells were treated with the targeted and untargeted compounds for three days at concentrations from 1 pM to 100 nM. After three days of treatment, the cells were harvested, and the ribonucleic acid (RNA) was purified from the cells. Expression levels of ALP, RUNx2, OSX, osteopontin (OPN), collagen 1A (Col-1A), OPG, RANKL, sclerostin gene (SOST), and OC were quantified via quantitative reverse transcription polymerase chain reaction (RT-qPCR). Once the biological activity of the conjugates was confirmed, they were tested in vivo in a fracture model. Aseptic surgical techniques were used to place a 23-gage needle as in intramedullary nail in the femur of anesthetized, 12-week-old Swiss Webster mice for internal fixation before fracture. Femur fractures were induced using a drop weight fracture device from RISystem. The mice received buprenorphine for three days post fracture. The mice were dosed subcutaneously each day for two weeks, three weeks, 4 weeks, or 17 days. Fracture healing was assessed using microCT (Scanco Medical Ag). Morphometric parameters were quantified in the 100 widest slices of the fracture callus. Trabecular thickness (TbTh), trabecular spacing (TbSp), total volume (TV), and volume of calcified callus (BV) were calculated. Fractured femurs were tested for strength in a four-point bend to failure using an Electro Force TestBench (TA Instruments). Lower supports were 10 mm apart on the anterior face of the femur in contact with the proximal and distal diaphysis. Upper supports were 4 mm apart and spanned the entire fracture callus on the diaphysis. Force was applied from the posterior face of the femur with a displacement rate of 0.3 mm/sec. Peak load, yield load, stiffness, displacement post yield, work to fracture, and deformation data were generated. Statistical analysis was performed using a two-way analysis of variance (ANOVA) and a Tukey post-hoc analysis with significance reported at the 95% confidence level. All animal experiments were performed in accordance with protocols approved by Purdue University's Institutional Animal Care and Use Committee (IACUC).

EXAMPLES

Example 1. Targeted Delivery of Src Kinase Inhibitors to Fracture Site for Accelerated Healing

[0211] Example 1 shows representative Src kinase inhibitors Dasatinib and E738 (structures shown in FIGS. 3-4 respectively) effectively increased the bone density of the fracture callus when they are conjugated with acidic aspartic acids. See FIGS. 1-2, where bone density of the fracture callus from the targeted Dasatinib group is twice as dense as the saline group, and 50% denser than the free Dasatinib group; targeted E738 conjugate has significantly improved the bone density and trabecular thickness at the fracture callus. The structure of CBMD10 is depicted in FIG. 33.

Example 2. Representative Anabolic Peptides on Peak Load of Fractured Femurs after Two Weeks

[0212] Example 2 provides the maximum force a representative anabolic peptide induced healed femur can withstand before it refractured. As shown in FIG. 5, bone morphogenetic protein pathway signaling peptide BFP-D10 with 100 nmol/day (100.times.) treatment obtained the maximum peak load, followed by IGF derived peptide of Preptin-D10 100.times., and Osteogenic growth peptide (OGP-D10 100.times.), as compared to PBS.

Example 3. Preptin(1-16) (Preptin D10) Efficacy on Fracture Healing

[0213] Example 3 indicates Preptin D10 effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1.times., 10.times. and 100.times. respectively). The healing was reflected as BV/TV in FIG. 6, TbTh in FIG. 7 and bone volume in FIG. 8, all in a dose dependent manner.

Example 4. OGP D10 Efficacy on Fracture Healing

[0214] Example 4 indicates osteogenic growth peptide conjugate (OGP-D10) effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, and 100 nmol/day, referred as 1.times., and 100.times. respectively). The healing was reflected as BV/TV in FIG. 9, TbTh in FIG. 10 and TbSp in FIG. 11, all in a dose dependent manner.

Example 5. BFP D10 Efficacy on Fracture Healing

[0215] Example 5 indicates bone forming peptide conjugate (BMP-D10) effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1.times., 10.times. and 100.times. respectively). The healing was reflected as BV/TV in FIG. 12, and TbSp in FIG. 13 in a dose dependent manner.

Example 6. Substance P D10 Effect on Fracture Healing

[0216] Example 6 indicates substance P D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1.times., 10.times. and 100.times. respectively). The healing was reflected as BV/TV in FIG. 14A in dose dependent manner. FIG. 14B indicates the peak load of substance P D10 10.times. induced healed femur can withstand between 30-35 Newtons force.

Example 7. Ghrelin-D10 Effect on Fracture Healing

[0217] Example 7 indicates Ghrelin-D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day, 10 nmol/day and 100 nmol/day, referred as 1.times., 10.times. and 100.times. respectively). The healing was reflected as BV/TV in FIG. 15 in dose dependent manner.

Example 8. pBMP9 D10 Effect on Fracture Healing

[0218] Example 8 indicates pBMP9 D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1.times., 10.times. and 100.times. respectively). The healing was reflected as bone volume in FIG. 16 and BV/TV in FIG. 17 in a dose dependent manner.

Example 9. CNP D10 Effect on Fracture Healing

[0219] Example 9 indicates C-Type Natriuretic Peptide conjugate (CNP D10) effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day and 10 nmol/day referred as 1.times. and 10.times. respectively). The healing was reflected as BV/TV in FIG. 18 in a dose dependent manner.

Example 10. ODP D10 Effect on Fracture Healing

[0220] Example 10 indicates osteopontin derived peptide conjugate ODP D10 effect on healing fractured bone after 4 weeks of 1 nmol/day (referred as 1.times.). The healing was reflected as BV/TV in FIG. 19.

Example 11. CBM D10 Effect on Fracture Healing

[0221] Example 11 indicates collagen binding motif of osteopontin conjugate CBM D10 effect on healing fractured bone after 3 weeks of various concentrations application (0.1 nmol/day, 1 nmol/day and 10 nmol/day, referred as 0.1.times., 1.times. and 10.times. respectively). The healing was reflected as BV/TV in FIG. 20 in a dose dependent manner. It is worth noting that the lowest does of CBM D10 has the similar effect of free PTH, an anabolic drug without specific bone targeting.

Example 12. P4 D10 Effect on Fracture Healing

[0222] Example 12 indicates P4 D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day and 10 nmol/day, referred as 1.times. and 10.times. respectively). The healing was reflected as BV/TV in FIG. 21 in a dose dependent manner and bone volume in FIG. 22.

Example 13. MGF D10 Effect on Fracture Healing

[0223] Example 13 indicates mechano growth factor conjugate (MGF D10) effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day and 10 nmol/day, referred as 1.times. and 10.times. respectively). The healing was reflected as BV/TV in FIG. 23 in a dose dependent manner.

Example 14. TP508 D10 Effect on Fracture Healing

[0224] Example 14 indicates thrombin fragment TP508 conjugate TP508 D10 effect on healing fracture after 4 weeks of various concentrations application (1 nmol/day and 10 nmol/day, referred as 1.times. and 10.times. respectively). The healing was reflected as BV/TV in FIG. 24 in a dose dependent manner.

Example 15. VIP D10 Effect on Fracture Healing

[0225] Example 15 indicates vasoactive intestinal peptide conjugate VIP D10 effect on healing fracture after 4 weeks of 1 nmol/day application (1.times.). The healing was reflected as BV/TV in FIG. 25 and TbTh in FIG. 26.

Example 16. B2A_AHX3_e10 Effect on Fracture Healing

[0226] Example 16 indicates B2A (D)E.sub.10 effect on fracture healing. Referring now to FIG. 36, In vivo fracture healing efficacy of B2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.

[0227] Referring now to FIG. 37, in vivo fracture healing efficacy of B2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV/TV--represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0228] Referring now to FIG. 38, in vivo fracture healing efficacy of B2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0229] Referring now to FIG. 39, in vivo fracture healing efficacy of B2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 17. F2A_mp4-e10 Effect on Fracture Healing

[0230] Example 17 indicates F2A (D)E.sub.10 effect on fracture healing. Referring now to FIG. 41, In vivo fracture healing efficacy of F2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.

[0231] Referring now to FIG. 42, in vivo fracture healing efficacy of F2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV/TV--represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0232] Referring now to FIG. 43, in vivo fracture healing efficacy of F2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0233] Referring now to FIG. 44, in vivo fracture healing efficacy of F2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 18. F119: Effect on Fracture Healing

[0234] Example 18 indicates F119 effect on fracture healing. Referring now to FIG. 45, in vivo fracture healing efficacy of F119_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV/TV. BV/TV represents the bone volume of the total volume of 100 thickest micro CT slices of the fracture callus and is a measure of bone density at the site of fracture repair. 1.times., lx and 100.times. are respectively 1 nmol, 10 nmol, and 100 nmol of the conjugate delivered daily by subcutaneous injection. F119_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0235] Referring now to FIG. 46, in vivo fracture healing efficacy of F119_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1.times., 10.times. and 100.times. are respectively 1 nmol, 10 nmol, and 100 nmol of the conjugate delivered daily by subcutaneous injection. F119_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.

[0236] Referring now to FIG. 47, in vivo fracture healing efficacy of F119_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. F119_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0237] Referring now to FIG. 48, in vivo fracture healing efficacy of F119_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. F119_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 19. JNK3_Mp4_e10 Effect on Fracture Healing

[0238] Example 19 indicates JNK3 effect on fracture healing. Referring now to FIG. 50, in vivo fracture healing efficacy of JNK3_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.

[0239] Referring now to FIG. 51, in vivo fracture healing efficacy of JNK3_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV/TV. BV/TV--represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0240] Referring now to FIG. 52, in vivo fracture healing efficacy of JNK3_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0241] Referring now to FIG. 53, in vivo fracture healing efficacy of JNK3_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 20. Lactoferrin_mp4_e10 Effect on Fracture Healing

[0242] Example 20 indicates Lactoferrin effect on fracture healing. Referring now to FIG. 55, in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.

[0243] Referring now to FIG. 56, in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV/TV. BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0244] Referring now to FIG. 57, in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0245] Referring now to FIG. 58, in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 21. Osteostatin: Osteostatin (PTHrP[107-139])_e10 Effect on Fracture Healing

[0246] Example 21 indicates Osteostatin effect of fracture healing. Referring now to FIG. 60, in vivo fracture healing efficacy of Osteostatin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as Tbth. Tbth represents the trabecular thickness of the 100 thickest micro CT slices of the fracture callus and is a measure the quality of the bone at the site of fracture repair. 0.1.times., 1.times. and 10.times. are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. The of Osteostatin_mp4_(D)E.sub.10 conjugate raises bone quality at the fracture calluses three weeks post fracture.

[0247] Referring now to FIG. 61, in vivo fracture healing efficacy of Osteostatin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1.times., 1.times. and 10.times. are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. Osteostatin_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0248] Referring now to FIG. 62, in vivo fracture healing efficacy of Osteostatin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as BV/TV. BV/TV--represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1.times., 1.times. and 10.times. are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. Osteostatin_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0249] Referring now to FIG. 63, in vivo fracture healing efficacy of Osteostatin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as stiffness. Stiffness represents the Youngs modulus of the healed femur as it was measured before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how stiff the bone is at the site of fracture repair. 0.1.times., 1.times. and 10.times. are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. The of Osteostatin_mp4_(D)E.sub.10 conjugate raises bone stiffness at the fracture calluses three weeks post fracture.

[0250] Referring now to FIG. 64, in vivo fracture healing efficacy of Osteostatin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1.times., 1.times. and 10.times. are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. Osteostatin_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 22. P2A-Mp4-e10 Effect on Fracture Healing

[0251] Example 22 indicates P2A effect on fracture healing. Referring now to FIG. 66, In vivo fracture healing efficacy of P2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.

[0252] Referring now to FIG. 67, in vivo fracture healing efficacy of P2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV/TV--represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses three weeks post fracture.

[0253] Referring now to FIG. 68, in vivo fracture healing efficacy of P2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0254] Referring now to FIG. 69, in vivo fracture healing efficacy of P2A_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Example 23. Preptin (1-34) Mp4_e10 Effect on Fracture Healing

[0255] Example 23 indicates Preptin (1-34) effect on fracture healing. Referring now to FIG. 71, in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E.sub.10 conjugate on cluster of differentiation-1 (CD-1) male mice fracture-bearing mice (n=10) after 4 weeks is reflected as BV/TV. BV/TV represents the bone volume of the total volume of 100 thickest micro CT slices of the fracture callus and is a measure of bone density at the site of fracture repair. 50.times. represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E.sub.10 conjugate significantly raises bone density at the fracture calluses four weeks post fracture.

[0256] Referring now to FIG. 72, in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E.sub.10 conjugate on CD-1 male mice fracture-bearing mice (n=10) after 4 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair 50.times. represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34) mp4_(D)E.sub.10 conjugate significantly raises bone mineralization at the fracture calluses four weeks post fracture.

[0257] Referring now to FIG. 73, in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E.sub.10 conjugate on CD-1 Male mice fracture-bearing mice(n=10) after 4 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 50.times. represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E.sub.10 conjugate significantly raises bone strength at the fracture calluses four weeks post fracture.

[0258] Referring now to FIG. 74, in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E.sub.10 conjugate on CD-1 Male mice fracture-bearing mice(n=10) after 4 weeks is reflected as post yield displacement. Post yield displacement represents the total displacement of the healed femur after the yield point has been reached in a postmortem 4 point bend analysis Post yield displacement is a measure of how elastic a material is. 50.times. represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E.sub.10 conjugate significantly reduces the bone brittleness at the fracture calluses four weeks post fracture.

[0259] Referring now to FIG. 75, in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E.sub.10 conjugate on CD-1 Male mice fracture-bearing mice(n=10) after 4 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 50.times. represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E.sub.10 conjugate significantly raises bone strength at the fracture calluses four weeks post fracture.

Example 24. QK_mp4_e10 Effect on Fracture Healing

[0260] Example 24 indicates QK effect on fracture healing. Referring now to FIG. 77, in vivo fracture healing efficacy of QK_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 17 days is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E.sub.10 conjugate raises bone mineralization at the fracture calluses 17 days post fracture.

[0261] Referring now to FIG. 78, in vivo fracture healing efficacy of QK_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 17 days is reflected as BV/TV. BV/TV--represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E.sub.10 conjugate raises bone density at the fracture calluses 17 days post fracture.

[0262] Referring now to FIG. 79, in vivo fracture healing efficacy of QK_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 17 days is reflected as max load (N). Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses 17 days post fracture.

[0263] Referring now to FIG. 80, in vivo fracture healing efficacy of QK_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 17 days is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses 17 days post fracture.

Example 22. Effect of Annexin-1 on Fracture Healing

[0264] Example 22 indicates Annexin-1 effect on fracture healing. Referring now to FIG. 82, in vivo fracture healing efficacy of Annexin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 16 days is reflected as max load (N). Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Max load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. Annexin_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

[0265] Referring now to FIG. 83, in vivo fracture healing efficacy of Annexin_mp4_(D)E.sub.10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 16 days is reflected as work to fracture (mJ). Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in a postmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. Annexin_mp4_(D)E.sub.10 conjugate raises bone strength at the fracture calluses three weeks post fracture.

Sequence CWU 1

1

29125PRTArtificial SequenceBFP D10 1Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Gly Gln Gly Phe Ser Tyr1 5 10 15Pro Tyr Lys Ala Val Phe Ser Thr Gln 20 25224PRTArtificial SequenceOGP D10 2Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Ala Leu Lys Arg Gln Gly1 5 10 15Arg Thr Leu Tyr Gly Phe Gly Gly 20327PRTArtificial SequencePreptin D10 3His Asp Val Ser Thr Ser Gln Ala Val Leu Pro Asp Asp Phe Pro Arg1 5 10 15Tyr Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp 20 25421PRTArtificial Sequencesubstance P 4 mini PEG D10 withMISC_FEATURE(10)..(11)4 mini PEG linker 4Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Arg Pro Lys Pro Gln Gln1 5 10 15Phe Phe Gly Leu Met 20538PRTArtificial SequenceGhrelin D10 with Ser-3 replacementMISC_FEATURE(3)..(3)Ser-3 modified with diaminopropionic acid 5His Gly Ser Phe Leu Ser Pro Glu His Gln Lys Ala Gln Gln Arg Lys1 5 10 15Glu Ser Lys Lys Pro Pro Ala Lys Leu Gln Pro Arg Asp Asp Asp Asp 20 25 30Asp Asp Asp Asp Asp Asp 35633PRTArtificial SequenceBMP9-D10MOD_RES(23)..(24)4 MINI PEG LINKER 6Cys Gly Gly Lys Val Gly Lys Ala Cys Cys Val Pro Thr Lys Leu Ser1 5 10 15Pro Ile Ser Val Leu Tyr Lys Asp Asp Asp Asp Asp Asp Asp Asp Asp 20 25 30Asp733PRTArtificial SequenceCNP D10DISULFID(17)..(33) 7His Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Gly Leu Ser Lys Gly1 5 10 15Cys Phe Gly Leu Lys Leu Asp Arg Ile Gly Ser Met Ser Gly Leu Gly 20 25 30Cys839PRTArtificial SequenceVasoactive intestinal peptide with D10 (VIP D10) 8His His Ser Asp Ala Val Phe Thr Asp Asn Tyr Thr Arg Leu Arg Lys1 5 10 15Gln Met Ala Val Lys Lys Tyr Leu Asn Ser Ile Leu Asn Asp Asp Asp 20 25 30Asp Asp Asp Asp Asp Asp Asp 35939PRTArtificial SequenceCBM D10 9His Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Gly Leu Arg Ser Lys1 5 10 15Ser Lys Lys Phe Arg Arg Pro Asp Ile Gln Tyr Pro Asp Ala Thr Asp 20 25 30Glu Asp Ile Thr Ser His Met 351031PRTArtificial SequenceP4 D10-a BMP2 fragment 10His Lys Ile Pro Lys Ala Ser Ser Val Pro Thr Glu Leu Ser Ala Ile1 5 10 15Ser Thr Leu Tyr Leu Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp 20 25 301134PRTArtificial SequenceMechano-growth factor (MGF) D10, an IGF-I fragment 11Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Tyr Gln Pro Pro Ser Thr1 5 10 15Asn Lys Asn Thr Lys Ser Gln Arg Arg Lys Gly Ser Thr Phe Glu Glu 20 25 30His Lys1233PRTArtificial SequenceTP 508_D10 12Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Ala Gly Tyr Lys Pro Asp1 5 10 15Glu Gly Lys Arg Gly Asp Ala Cys Glu Gly Asp Ser Gly Gly Pro Phe 20 25 30Val1325PRTArtificial SequenceODP-D10MISC_FEATURE(10)..(11)4 mini PEG linker 13Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Val Asp Val Pro Asp1 5 10 15Gly Arg Gly Asp Ser Leu Ala Tyr Gly 20 251431PRTArtificial SequenceBMP9MISC_FEATURE(21)..(22) 14Gly Gly Lys Val Gly Lys Ala Cys Cys Val Pro Thr Lys Leu Ser Pro1 5 10 15Ile Ser Val Leu Tyr Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp 20 25 301535PRTArtificial SequenceGhrelin D10 15Phe Leu Ser Pro Glu His Gln Lys Ala Gln Gln Arg Lys Glu Ser Lys1 5 10 15Lys Pro Pro Ala Lys Leu Gln Pro Arg Asp Asp Asp Asp Asp Asp Asp 20 25 30Asp Asp Asp 351630PRTArtificial SequenceCNP-D10.MISC_FEATURE(15)..(16) 16Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Gly Leu Ser Lys Gly Phe1 5 10 15Gly Leu Lys Leu Asp Arg Ile Gly Ser Met Ser Gly Leu Gly 20 25 301739PRTArtificial SequenceVIP D10 17His His Ser Asp Ala Val Phe Thr Asp Asn Tyr Thr Arg Leu Thr Lys1 5 10 15Gln Met Ala Val Lys Lys Tyr Leu Asn Ser Ile Leu Asn Asp Asp Asp 20 25 30Asp Asp Asp Asp Asp Asp Asp 351811PRTArtificial Sequence4 mini PEG D10 18His Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp1 5 101926PRTArtificial SequenceODPD10MISC_FEATURE(4)..(5)MISC_FEATURE(16)..(17) 19His Ala Ile Ser Leu Tyr Leu Asp Glu Asn Glu Lys Val Val Leu Lys1 5 10 15Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu 20 252028PRTArtificial SequenceF119MISC_FEATURE(18)..(19) 20His Lys Arg Thr Gly Gln Tyr Lys Leu Gly Ser Lys Thr Gly Pro Gly1 5 10 15Gln Lys Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu 20 252136PRTArtificial SequenceJNK3_mp4_e10MISC_FEATURE(26)..(27) 21His Met Gly Glu Lys Pro Gly Thr Arg Val Phe Lys Lys Ser Ser Pro1 5 10 15Asn Cys Lys Leu Thr Val Tyr Leu Gly Lys Glu Glu Glu Glu Glu Glu 20 25 30Glu Glu Glu Glu 352226PRTArtificial SequenceLactoferrin_mp4_e10MISC_FEATURE(16)..(17) 22His Phe Lys Cys Arg Arg Trp Gln Trp Arg Met Lys Lys Leu Gly Ala1 5 10 15Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu 20 252344PRTArtificial SequenceOsteostatin_mp4_(D)E10)MISC_FEATURE(34)..(35) 23His Thr Arg Ser Ala Trp Leu Asp Ser Gly Val Thr Gly Ser Gly Leu1 5 10 15Glu Gly Asp His Leu Ser Asp Thr Ser Thr Thr Ser Leu Glu Leu Asp 20 25 30Ser Arg Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu 35 402442PRTArtificial SequencePreptin (1-34)_mp4_e10MISC_FEATURE(10)..(11) 24Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu Val Arg Gly Ala Ser Gln1 5 10 15Arg Trp Thr Asp Tyr Gln Phe Phe Gly Val Pro Tyr Arg Pro Phe Asp 20 25 30Pro Leu Val Ala Gln Ser Thr Ser Val Asp 35 402525PRTArtificial SequenceQK_mp4_e10MISC_FEATURE(10)..(11) 25Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu Lys Leu Thr Trp Gln Glu1 5 10 15Leu Tyr Gln Leu Lys Tyr Lys Gly Ile 20 252635PRTArtificial SequenceAnnexin 1MISC_FEATURE(25)..(26) 26Ala Met Val Ser Glu Phe Leu Lys Gln Ala Trp Phe Ile Glu Asn Glu1 5 10 15Glu Gln Glu Tyr Val Gln Thr Val Tyr Glu Glu Glu Glu Glu Glu Glu 20 25 30Glu Glu Glu 352726PRTArtificial SequenceB2A_AHX3_e10MISC_FEATURE(4)..(5)MISC_FEATURE(16)..(17) 27His Ala Ile Ser Leu Tyr Leu Asp Glu Asn Glu Lys Val Val Leu Lys1 5 10 15Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu 20 252826PRTArtificial SequenceF2A_mp4_e10MISC_FEATURE(16)..(17) 28His Tyr Arg Ser Arg Lys Tyr Ser Ser Trp Tyr Val Ala Leu Lys Arg1 5 10 15Glu Glu Glu Glu Glu Glu Glu Glu Glu Glu 20 252920PRTArtificial SequenceP2A-mp4_e10MISC_FEATURE(10)..(11) 29Val Arg Lys Ile Glu Ile Val Arg Lys Lys Glu Glu Glu Glu Glu Glu1 5 10 15Glu Glu Glu Glu 20

Claims

1-21. (canceled)

22. A compound having a structure of: X-Y-Z wherein: X is a growth factor, a growth factor fragment, an agent that activates a growth factor receptor, or an agent that activates a mitogen-activated protein kinase (MAPK) pathway; Y is absent or a linker; and Z is a bone-targeting molecule, or a pharmaceutically acceptable salt thereof.

23. The compound of claim 22, wherein Z comprises a polypeptide.

24. The compound of claim 22, wherein Z comprises not less than 4 and not more than 40 amino acid residues.

25. The compound of claim 24, wherein at least one amino acid is aspartic acid or glutamic acid.

26. The compound of claim 22, wherein Z comprises not less than 6 and not more than 20 glutamic acid residues or not less than 6 and not more than 20 aspartic acid residues.

27. The compound of claim 22, wherein Z is 10 D-glutamic acid residues or 10 D-aspartic acid residues.

28. The compound of claim 22, wherein Y is a releasable linker or a non-releasable linker.

29. The compound of claim 28, wherein the releasable linker comprises at least one releasable linker group, each releasable linker group being independently selected from the group consisting of a disulfide (S-S), an ester, and a protease-specific amide bond.

30. The compound of claim 28, wherein the non-releasable linker comprises at least one non-releasable linker group, each non-releasable linker group being independently selected from the group consisting of a carbon-carbon bond, an ether, and an amide.

31. The compound of claim 28, wherein Y comprises one or more ethylene glycol unit.

32. The compound of claim 31, wherein Y comprises 2-8 oxyethylene units.

33. The compound of claim 22, wherein the growth factor is a bone morphogenic protein (BMP), an insulin like growth factor (IGF), or a fibroblast growth factor.

34. The compound of claim 33, wherein the BMP is selected from the group consisting of P4 (BMP2), BFP (BMP7), pBMP9 (BMP9), and B2A (BMP2/TGF beta).

35. The compound of claim 33, wherein the IGF is selected from the group consisting of preptin (IGF-II) and mechano growth factor (MGF) (IGF-1).

36. The compound of claim 33, wherein the fibroblast growth factor is selected from the group consisting of fibroblast growth factor 2 (F119) and F2A.

37. The compound of claim 22, wherein the growth factor fragment is lactoferrin or ghrelin.

38. The compound of claim 37, wherein the agent that activates the MAPK pathway is a c-Jun N-terminal kinase 3 (JNK3) agonist.

39. The compound of claim 38, wherein the JNK3 agonist is selected from the group consisting of JNK3 and Annexin 1.

40. A compound having a structure of: X-Y-Z wherein: X is a vasoactive compound or an angiogenic compound; Y is absent or a linker; and Z is a bone-targeting molecule, or a pharmaceutically acceptable salt thereof.

41. The compound of claim 40, wherein the vasoactive compound or the angiogenic compound is selected from the group consisting of C-type natriuretic peptide (CNP), thrombin peptide (TP508), vascular endothelial growth factor (VEGF) mimetic QK, and platelet derived growth factor 2A (P2A).