U.S. patent application number 16/864891 was filed with the patent office on 2021-07-01 for smyd inhibitors.
The applicant listed for this patent is EPIZYME, INC.. Invention is credited to Megan Alene Cloonan Foley, Darren Martin HARVEY, Kevin Wayne KUNTZ, James Edward John MILLS, Lorna Helen MITCHELL, Michael John MUNCHHOF.
Application Number | 20210198252 16/864891 |
Document ID | / |
Family ID | 1000005004360 |
Filed Date | 2021-07-01 |
United States Patent
Application |
20210198252 |
Kind Code |
A1 |
Foley; Megan Alene Cloonan ;
et al. |
July 1, 2021 |
SMYD INHIBITORS
Abstract
The present disclosure provides carboxamides and sulfonamides
having Formula (I): and the pharmaceutically acceptable salts and
solvates thereof, wherein A, Y, B, X, and Z are defined as set
forth in the specification. The present disclosure is also directed
to the use of compounds of Formula (I) to treat a disorder
responsive to the blockade of SMYD proteins such a SMYD3 or SMYD2.
Compounds of the present disclosure are especially useful for
treating cancer. ##STR00001##
Inventors: |
Foley; Megan Alene Cloonan;
(Somerville, MA) ; KUNTZ; Kevin Wayne; (Woburn,
MA) ; MILLS; James Edward John; (Kent, GB) ;
MITCHELL; Lorna Helen; (Cambridge, MA) ; MUNCHHOF;
Michael John; (Salem, CT) ; HARVEY; Darren
Martin; (Acton, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
EPIZYME, INC. |
Cambridge |
MA |
US |
|
|
Family ID: |
1000005004360 |
Appl. No.: |
16/864891 |
Filed: |
May 1, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16269338 |
Feb 6, 2019 |
|
|
|
16864891 |
|
|
|
|
15510586 |
Mar 10, 2017 |
10266526 |
|
|
PCT/US15/49221 |
Sep 9, 2015 |
|
|
|
16269338 |
|
|
|
|
62048773 |
Sep 10, 2014 |
|
|
|
62146799 |
Apr 13, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07D 417/14 20130101;
C07D 277/56 20130101; C07D 403/12 20130101; C07D 213/81 20130101;
C07D 209/08 20130101; C07D 403/14 20130101; C07D 205/04 20130101;
C07D 249/04 20130101; C07D 241/26 20130101; C07D 451/04 20130101;
C07D 261/10 20130101; C07D 401/12 20130101; C07D 275/03 20130101;
C07D 211/34 20130101; C07D 263/34 20130101; C07C 271/18 20130101;
C07D 401/14 20130101; C07D 413/12 20130101; C07D 233/90 20130101;
C07D 237/24 20130101; C07D 231/14 20130101; C07D 213/82
20130101 |
International
Class: |
C07D 451/04 20060101
C07D451/04; C07D 213/81 20060101 C07D213/81; C07D 213/82 20060101
C07D213/82; C07D 231/14 20060101 C07D231/14; C07D 233/90 20060101
C07D233/90; C07D 401/12 20060101 C07D401/12; C07D 241/26 20060101
C07D241/26; C07D 249/04 20060101 C07D249/04; C07D 261/10 20060101
C07D261/10; C07D 263/34 20060101 C07D263/34; C07D 275/03 20060101
C07D275/03; C07D 209/08 20060101 C07D209/08; C07D 277/56 20060101
C07D277/56; C07C 271/18 20060101 C07C271/18; C07D 205/04 20060101
C07D205/04; C07D 211/34 20060101 C07D211/34; C07D 237/24 20060101
C07D237/24; C07D 401/14 20060101 C07D401/14; C07D 403/12 20060101
C07D403/12; C07D 403/14 20060101 C07D403/14; C07D 413/12 20060101
C07D413/12; C07D 417/14 20060101 C07D417/14 |
Claims
1. A compound having Formula I: ##STR01322## or a pharmaceutically
acceptable salt or hydrate thereof, wherein: A is selected from the
group consisting of 1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl,
1-pyrazolyl, 2-(1,2,3,4-tetrahydroquinolinyl),
2-benzo[d]imidazolyl, 2-benzo[d]thiazolyl, 2-chromenyl-4-one,
2-furanyl, 2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl,
2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl,
2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl,
2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl,
3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl),
3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl,
3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one,
3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl,
4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine,
4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl,
4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl,
5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one),
5-(2,2-difluorobenzo[d][1,3]dioxolyl),
5-(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2-b]pyrrolyl,
5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl,
5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-ene,
5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl,
5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl,
5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl,
6-(1,2,3,4-tetrahydronaphthalenyl),
6-(3,4-dihydroquinolinyl-2(1H)-one),
6-(3,4-dihydroquinoxalinyl-2(1H)-one),
6-(4,5-dihydropyridazinyl-3(2H)-one),
6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl,
6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl,
6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl,
6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl,
6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one,
7-(3,4-dihydroquinolinyl-2(1H)-one),
7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one,
7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one,
cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole,
1-butanyl-imidazole, sec-butylcyclopropane,
2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl
1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide, each of which is
optionally substituted with one, two, or three substituents
independently selected from the group consisting of halo, hydroxy,
alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, C.sub.1-6 alkyl, haloalkyl,
hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally
substituted C.sub.3-12 cycloalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 5- to 14-membered
heteroaryl, optionally substituted 4- to 14-membered heterocyclo,
aralkyl, --N(H)C(.dbd.O)R.sup.6, --C(.dbd.O)R.sup.7, and
--S(.dbd.O).sub.2R.sup.8; Y is selected from the group consisting
of --C(R.sup.5a)(R.sup.5b)C(.dbd.O)--, --C(.dbd.O)--, and
--S(.dbd.O).sub.2--; B is selected from the group consisting of
C.sub.1-10 alkylenyl, optionally substituted C.sub.3-12
cycloalkylenyl, optionally substituted C.sub.6-14 arylenyl,
optionally substituted 4- to 14-membered heterocyclenyl, and
--C(H)R.sup.1R.sup.2, with the proviso that B is not optionally
substituted pyrrolidinenyl; X is selected from the group consisting
of --N(R.sup.3)--, --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.3)--, --N(R.sup.3)S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2C(R.sup.4)(H)--, --C(.dbd.O)--,
--C(.dbd.O)N(R.sup.3)--, --N(R.sup.3)C(.dbd.O)--, --C(.dbd.O)O--,
--OC(.dbd.O)--, --C(.dbd.O)C(R.sup.4)(H)N(R.sup.3)--,
--N(R.sup.3)C(.dbd.O)C(R.sup.4)(H)--, and
--C(.dbd.O)C(R.sup.4)(H)--; or X is absent; Z is selected from the
group consisting of hydrogen, optionally substituted C.sub.1-6
alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl,
(cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl,
(hydroxy)(aryl)alkyl, (aralkylamino)alkyl,
(hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 4- to 14-membered
heterocyclo, optionally substituted 5- to 14-membered heteroaryl,
optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl; or Z is --CH(R.sup.9a)(R.sup.9b); R.sup.9a is
selected from the group consisting of hydrogen, C.sub.1-6 alkyl,
fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, alkoxyalkyl, optionally substituted C.sub.6-14
aryl, optionally substituted 4- to 14-membered heterocyclo,
optionally substituted 5- to 14-membered heteroaryl, optionally
substituted C.sub.3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;
R.sup.9b is selected from the group consisting of optionally
substituted C.sub.6-14 aryl, optionally substituted 4- to
14-membered heterocyclo, optionally substituted 5- to 14-membered
heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl,
and (heteroaryl)alkyl; R.sup.1 is selected from the group
consisting of hydrogen, C.sub.1-6 alkyl, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, alkoxyalkyl,
aryloxyalkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted 4- to 14-membered heterocyclo, optionally
substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; R.sup.2
is selected from the group consisting of C.sub.1-6 alkyl,
optionally substituted C.sub.3-12 cycloalkyl, optionally
substituted C.sub.6-14 aryl, optionally substituted 5- to
14-membered heteroaryl, optionally substituted 4- to 14-membered
heterocyclo, and (heteroaryl)alkyl; R.sup.3 is selected from the
group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.4 is
selected from the group consisting of hydrogen, C.sub.1-4 alkyl,
hydroxy, amino, alkylamino, dialkylamino, cycloalkylamino,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, and
hydroxyalkyl; R.sup.5a is selected from the group consisting of
hydrogen and C.sub.1-4 alkyl; R.sup.5b is selected from the group
consisting of hydrogen, C.sub.1-4 alkyl, and 4- to 14-membered
heterocyclo; R.sup.6 is C.sub.1-4 alkyl; R.sup.7 is C.sub.1-4
alkyl; and R.sup.8 is selected from the group consisting of
C.sub.1-4 alkyl, amino, alkylamino, and dialkylamino, wherein
--X--Z is attached to any available carbon or nitrogen atom of B,
Rt, or R.sup.2, with the proviso that said compound having Formula
I is not
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)benzamide.
2-6. (canceled)
7. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula II: ##STR01323## wherein X is
absent and Z is (amino)alkyl.
8. (canceled)
9. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula III, Formula IV, or Formula V:
##STR01324## wherein R.sup.10a, R.sup.10b, R.sup.11a, and R.sup.11b
are each independently selected from the group consisting of
hydrogen and C.sub.1-4 alkyl.
10. The compound of claim 9, or a pharmaceutically acceptable salt
or hydrate thereof, wherein X is --N(R.sup.3)C(.dbd.O)-- and Z is
(amino)alkyl.
11. (canceled)
12. (canceled)
13. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula VI, Formula VII, or Formula
VIII: ##STR01325## wherein R.sup.12a, R.sup.12b, R.sup.13a, and
R.sup.13b are each independently selected from the group consisting
of hydrogen and C.sub.1-4 alkyl.
14. The compound of claim 13, or a pharmaceutically acceptable salt
or hydrate thereof, wherein; X is selected from the group
consisting of --C(.dbd.O)C(R.sup.4)(H)--, --C(.dbd.O)--, and
--S(.dbd.O).sub.2--; R.sup.4 is selected from the group consisting
of hydrogen and amino; and Z is selected from the group consisting
of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(heterocyclo)alkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, aralkyl, and
(heteroaryl)alkyl.
15. (canceled)
16. (canceled)
17. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula IX, Formula X, or Formula XI:
##STR01326## wherein R.sup.1 is selected from the group consisting
of hydrogen, C.sub.1-6 alkyl, alkoxycarbonyl, and optionally
substituted C.sub.6-14 aryl.
18-26. (canceled)
27. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein Y is --C(.dbd.O)--.
28. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A is selected from the group consisting
of 1,2,4-triazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-indolyl,
2-thiazolyl, 3-(1,2,4-oxadiazolyl), 3-isothiazolyl,
5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one),
5-(2,2-difluorobenzo[d][1,3]dioxolyl),
5-benzo[d]oxazolyl-2(3H)-one, 5-indolinyl-2-one,
6-benzo[b][1,4]oxazinyl-3-one, and 6-isoquinolinyl.
29. The compound of claim 28, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A is 2-indolyl.
30. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein Y is --C(.dbd.O)-- and A is
2-indolyl.
31. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula XIV: ##STR01327##
32-44. (canceled)
45. A compound having Formula XII: ##STR01328## or a
pharmaceutically acceptable salt or hydrate thereof, wherein:
A.sup.1 is selected from the group consisting of 1,2,3-triazolyl,
1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl, 1-pyrazolyl,
2-(1,2,3,4-tetrahydroquinolinyl), 2-benzo[d]imidazolyl,
2-benzo[d]thiazolyl, 2-chromenyl-4-one, 2-furanyl,
2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl,
2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl,
2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl,
2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl,
3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl),
3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl,
3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one,
3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl,
4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine,
4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl,
4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl,
5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one),
5-(2,2-difluorobenzo[d][1,3]dioxolyl),
5-(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2-b]pyrrolyl,
5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl,
5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-ene,
5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl,
5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl,
5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl,
6-(1,2,3,4-tetrahydronaphthalenyl),
6-(3,4-dihydroquinolinyl-2(1H)-one),
6-(3,4-dihydroquinoxalinyl-2(1H)-one),
6-(4,5-dihydropyridazinyl-3(2H)-one),
6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl,
6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl,
6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl,
6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl,
6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one,
7-(3,4-dihydroquinolinyl-2(1H)-one),
7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one,
7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one,
cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole,
1-butanyl-imidazole, sec-butylcyclopropane,
2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl
1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide, each of which is
optionally substituted with one, two, or three substituents
independently selected from the group consisting of halo, hydroxy,
alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, C.sub.1-6 alkyl, haloalkyl,
hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally
substituted C.sub.3-12 cycloalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 5- to 14-membered
heteroaryl, optionally substituted 4- to 14-membered heterocyclo,
and aralkyl; B.sup.1 is selected from the group consisting of
optionally substituted C.sub.3-12 cycloalkylenyl and optionally
substituted 4- to 14-membered heterocyclenyl, X.sup.1 is selected
from the group consisting of --N(R.sup.3a)--, --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.3a)--, --N(R.sup.3a)S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2C(R.sup.4a)(H)--, --C(.dbd.O)--,
--C(.dbd.O)N(R.sup.3a)--, --N(R.sup.3a)C(.dbd.O)--, --C(.dbd.O)O--,
--OC(.dbd.O)--, --C(.dbd.O)C(R.sup.4a)(H)N(R.sup.3a)--,
--N(R.sup.3a)C(.dbd.O)C(R.sup.4a)(H)--, and
--C(.dbd.O)C(R.sup.4a)(H)--; or X.sup.1 is absent; Z.sup.1 is
selected from the group consisting of hydrogen, optionally
substituted C.sub.1-6-alkyl, fluoroalkyl, hydroxyalkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl, optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl; R.sup.3a is selected
from the group consisting of hydrogen and C.sub.1-4 alkyl; and
R.sup.4a is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, hydroxy, amino, alkylamino, and dialkylamino.
46-50. (canceled)
51. A compound having Formula XII: ##STR01329## or a
pharmaceutically acceptable salt or hydrate thereof, wherein:
X.sup.2 is selected from the group consisting of --N(R.sup.3b)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2N(R.sup.3b)--,
--N(R.sup.3b)S(.dbd.O).sub.2--, --S(.dbd.O).sub.2C(R.sup.4b)(H)--,
--C(.dbd.O)--, --C(.dbd.O)N(R.sup.3b)--, --N(R.sup.3b)C(.dbd.O)--,
--C(.dbd.O)O--, --OC(.dbd.O)--,
--C(.dbd.O)C(R.sup.4b)(H)N(R.sup.3b)--,
--N(R.sup.3b)C(.dbd.O)C(R.sup.4b)(H)--, and
--C(.dbd.O)C(R.sup.4b)(H)--; or X is absent; Z.sup.2 is selected
from the group consisting of hydrogen, optionally substituted
C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl,
(heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl,
(amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl,
(hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 4- to 14-membered
heterocyclo, optionally substituted 5- to 14-membered heteroaryl
optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl; R.sup.1a is selected from the group consisting
of hydrogen, C.sub.1-6 alkyl, and optionally substituted C.sub.6-14
aryl; R.sup.3b is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl; and R.sup.4b is selected from the group
consisting of hydrogen, C.sub.1-4 alkyl, hydroxy, amino,
alkylamino, and dialkylamino.
52-56. (canceled)
57. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, selected from the group consisting of:
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)nicotinamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)isonicotinamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)pyrazine-2-carboxamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1H-pyrazole-3-carboxami-
de;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-methyl-1H-pyrazole-
-5-carboxamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-methyl-1H-pyrazole-4--
carboxamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-methyl-1H-imidazole-4-
-carboxamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-(cyclopropylmethyl)pi-
peridine-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H-pyrazole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-ethylisoxazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H-imidazole-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-ethyloxazole-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5-ethylisothiazole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-ethylbenzamide;
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-7-
-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-
-carboxamide; N-((1r,4r)-4-aminocyclohexyl)-3-ethylbenzamide;
N-((1r,4r)-4-aminocyclohexyl)-5-ethylnicotinamide;
3-acetyl-N-((1r,4r)-4-aminocyclohexyl)benzamide;
3-acetamido-N-((1r,4r)-4-aminocyclohexyl)benzamide;
N-((1r,4r)-4-aminocyclohexyl)-3-propionamidobenzamide;
N-((1r,4r)-4-aminocyclohexyl)-3-(hydroxymethyl)benzamide;
N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-3-methyl-1H-pyrazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-methyl-1-phenyl-1H-pyrazole-5-carboxamide-
;
N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamid-
e;
1-ethyl-3-methyl-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-5-carboxa-
mide;
3-methyl-1-phenyl-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-5-car-
boxamide;
1-benzyl-3-methyl-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-5-
-carboxamide;
N-(4-(aminomethyl)phenyl)-6-hydroxypyridazine-3-carboxamide;
N-(4-(aminomethyl)phenyl)-1-methyl-3-(trifluoromethyl)-1H-pyrazole-5-carb-
oxamide;
N-(4-(aminomethyl)phenyl)-1-ethyl-3-methyl-1H-pyrazole-5-carboxam-
ide;
N-(4-(aminomethyl)phenyl)-3-methyl-1-phenyl-1H-pyrazole-5-carboxamide-
;
N-((1r,4r)-4-aminocyclohexyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide-
; N-((1r,4r)-4-aminocyclohexyl)-4-ethylpicolinamide;
2-oxo-N-(piperidin-4-yl)-1,2,3,4-tetrahydroquinoxaline-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoxaline-6-carboxamide;
2-oxo-N-(phenyl(piperidin-4-yl)methyl)indoline-5-carboxamide;
5-amino-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-3-carboxamide;
3-oxo-N-(piperidin-4-yl)-3,4-dihydroquinoxaline-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydro-1H-pyrrolo[2,3-b]pyridine-
-5-carboxamide;
3-amino-N-((1r,4r)-4-aminocyclohexyl)-1-methyl-H-pyrazole-5-carboxamide;
N-(1-(L-tyrosyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;
2-oxo-N-(piperidin-4-yl)indoline-5-carboxamide;
N-(1-(L-tryptophyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;
N-(4-(aminomethyl)phenyl)-4-propionyl-1H-pyrrole-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-butylcyclopropane-1-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5-ethylthiophene-2-carboxamide;
5-ethyl-N-(phenyl(piperidin-4-yl)methyl)thiophene-2-carboxamide;
N-(4-(aminomethyl)phenyl)-5-ethylthiophene-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-4H-furo[3,2-b]pyrrole-5-carboxamid-
e; 2-methyl-N-(piperidin-4-yl)-4H-furo[3,2-b]pyrrole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-ethylthiazole-5-carboxamide;
2-ethyl-N-(phenyl(piperidin-4-yl)methyl)thiazole-5-carboxamide;
N-(4-(aminomethyl)phenyl)-2-ethylthiazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-cyclopropylbutanamide;
3-cyclopropyl-N-(phenyl(piperidin-4-yl)methyl)butanamide;
4-acetyl-N-((1r,4r)-4-aminocyclohexyl)-1H-pyrrole-2-carboxamide;
4-acetyl-N-(piperidin-4-yl)-1H-pyrrole-2-carboxamide;
4-acetyl-N-(4-(aminomethyl)phenyl)-1H-pyrrole-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-hydroxy-1-methyl-1H-pyrazole-5-carboxamid-
e;
2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-pyrrolo[2,3-b]pyridine-5-carbox-
amide;
3-hydroxy-1-methyl-N-(piperidin-4-yl)-1H-pyrazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-1,2,3,4-tetrahydroquinoxaline-6-carbo-
xamide; N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-6-carboxamide;
N-(1-(L-tyrosyl)piperidin-4-yl)-2-oxoindoline-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-ca-
rboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-1,2,3,4-tetrahydroquinoline-
-6-carboxamide;
6-amino-N-((1r,4r)-4-aminocyclohexyl)-2-naphthamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoline-6-carboxamide;
N-(phenyl(piperidin-4-yl)methyl)-4-propionyl-1H-pyrrole-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(ethylsulfonyl)propanamide;
N-((1r,4r)-4-aminocyclohexyl)-5-((dimethylamino)methyl)furan-2-carboxamid-
e; 2-amino-N-(phenyl(piperidin-4-yl)methyl)oxazole-4-carboxamide;
N-(4-(aminomethyl)phenyl)-2-methyl-4H-furo[3,2-b]pyrrole-5-carboxamide;
N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2-oxoindoline-5-carboxamide;
N-(1-(L-tryptophyl)piperidin-4-yl)-1-methyl-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-8-methoxy-3-oxo-3,4-dihydro-2H-benzo[b][1,4-
]oxazine-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide;
N-(1-(1-(D-alanyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide;
N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2-oxoindoline-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-5-carboxam-
ide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-6-carb-
oxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-1,2,3,4-tetrahydroquinoline-7-
-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-1,2,3,4-tetrahydroquinoline-
-7-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H-benzo[d]imid-
azole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenzo[d]oxazole--
6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-2H-chromene-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-1,2,3,4-tetrahydroquinoline-
-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-amino-2-naphthamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-8-methoxy-3-oxo-3,4-dihydro-2H-be-
nzo[b][1,4]oxazine-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-hydroxyquinoxaline-6-carboxamid-
e; 2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide;
(S)-2-oxo-N-(pyrrolidin-3-ylmethyl)indoline-5-carboxamide;
N-((1-(L-tyrosyl)piperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;
N-((1-(L-tryptophyl)piperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;
ethyl
2-(1-(L-alanyl)piperidin-4-yl)-2-(2-oxoindoline-5-carboxamido)aceta-
te;
N-((4-hydroxypiperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;
N-(4-aminobutyl)-2-oxoindoline-5-carboxamide;
(S)--N-(4-(2-aminopropanamido)butyl)-2-oxoindoline-5-carboxamide;
ethyl 5-(((1r,4r)-4-aminocyclohexyl)amino)-5-oxopentanoate;
2-methyl-N-(phenyl(piperidin-4-yl)methyl)-3-(pyrrolidin-1-yl)propanamide;
2-methyl-N-(phenyl(piperidin-4-yl)methyl)-4H-furo[3,2-b]pyrrole-5-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-2-ethylpyrrolidine-2-carboxamide;
N-((1-(L-alanyl)-4-hydroxypiperidin-4-yl)methyl)-2-oxoindoline-5-carboxam-
ide;
N-((1-(L-alanyl)-4-fluoropiperidin-4-yl)methyl)-2-oxoindoline-5-carbo-
xamide;
(R)--N-(4-(2-aminopropanamido)butyl)-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-8-
-carboxamide; N-((1r,4r)-4-aminocyclohexyl)-5-bromonicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-5-chloronicotinamide;
N-((1r,4r)-4-aminocyclohexyl)benzo[d]thiazole-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoline-7-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyquinoline-7-carboxamide;
N-((4-methylpiperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;
ethyl 2-(2-oxoindoline-5-carboxamido)-2-(piperidin-4-yl)acetate;
6-amino-N-((1r,4r)-4-aminocyclohexyl)nicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-7-fluoro-2-hydroxyquinoline-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-chloro-5-(4H-1,2,4-triazol-4-yl)benzamide-
; N-((1r,4r)-4-aminocyclohexyl)-4H-1,2,4-triazole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(pyridin-3-yl)acetamide;
N-(4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;
ethyl
4-((2-oxoindoline-5-carboxamido)methyl)piperidine-4-carboxylate;
ethyl
1-(L-alanyl)-4-((2-oxoindoline-5-carboxamido)methyl)piperidine-4-carboxyl-
ate;
N--(((S)-1-(D-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxam-
ide;
N--(((S)-1-(L-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxam-
ide;
N--(((R)-1-(L-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxam-
ide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(5-methyl-1,2,4-oxadia-
zol-3-yl)benzamide;
N-((1r,4r)-4-aminocyclohexyl)-4-(5-methyl-1,2,4-oxadiazol-3-yl)benzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)isonicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isonicotinamide;
N-((1r,4r)-4-aminocyclohexyl)isonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)nicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)nicotinamide;
N-((1r,4r)-4-aminocyclohexyl)nicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)pyrimidine-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrimidine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[d][1,3]dioxole-5-carboxamide-
;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[d][1,3]dioxole-5-carbo-
xamide;
N-((1r,4r)-4-aminocyclohexyl)benzo[d][1,3]dioxole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(methylsulfonyl)benzamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(methylsulfonyl)benzamide;
N-((1r,4r)-4-aminocyclohexyl)-3-(methylsulfonyl)benzamide;
3-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrazine-2-carboxamid-
e; 3-amino-N-((1r,4r)-4-aminocyclohexyl)pyrazine-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-[1,1'-biphenyl]-4-carboxamid-
e; N-((1r,4r)-4-aminocyclohexyl)-[1,1'-biphenyl]-4-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-sulfamoylbenzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-fluoronicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-fluoronicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-5-fluoronicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-indole-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-benzo[d]imidazole-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)quinoline-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)quinoline-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)quinoline-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isoquinoline-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)isoquinoline-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(1H-indol-3-yl)acetamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(1H-indol-3-ylacetamide;
3-amino-N-((1r,4r)-4-(2-(6-methoxynaphthalen-2-yl)propanamido)cyclohexyl)-
propanamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(6-methoxynaphthalen-2-yl)propanamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)isoquinoline-1-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-indazole-3-carboxamide;
N-((1r,4r)-4-(3-aminobutanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-(2-aminoacetamido)cyclohexyl)-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-(2-aminopropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;
N-((1-(L-alanyl)-4-methylpiperidin-4-yl)methyl)-2-oxoindoline-5-carboxami-
de;
N--(((R)-1-(D-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxami-
de;
N-(4-(3-amino-N-methylpropanamido)cyclohexyl)-2-oxoindoline-5-carboxam-
ide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(5-methyl-1,2,4-oxadiazol-3-
-yl)benzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5-dimethyl-1H-pyrazole-4-carbox-
amide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3,5-dimethyl-1H-pyrazo-
le-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3,5-dimethyl-1H-pyrazole-4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methylpyrimidine-5-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methylpyrimidine-5-carboxa-
mide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methylpyrazine-2-carboxami-
de; N-((1r,4r)-4-aminocyclohexyl)-5-methylpyrazine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-aminoisonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-aminopyrazine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-[1,1'-biphenyl]-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-sulfamoylbenzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-hydroxypyridazine-3-carboxamide-
; N-((1r,4r)-4-aminocyclohexyl)-1H-indole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-benzo[d]imidazole-6-carboxamid-
e;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)isoquinoline-6-carboxamide;
N-((1r,4r)-4-(2-(1H-indol-3-yl)acetamido)cyclohexyl)-3-aminopropanamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isoquinoline-1-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)isoquinoline-1-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-fluoro-1H-indole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyquinoline-4-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxyquinoline-4-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoline-4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5,6,7,8-tetrahydronaphthalene-2-c-
arboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5,6,7,8-tetrahydronaphthalen-
e-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5,6,7,8-tetrahydronaphthalene-2-carboxamide-
; N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)pyrazine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4-fluorophenyl)acetamide;
3-amino-N-((1r,4r)-4-(2-(4-fluorophenyl)acetamido)cyclohexyl)propanamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(4-fluorophenyl)acetamide;
4-((1-(1-(L-alanyl)piperidin-4-yl)ethyl)carbamoyl)pyridine 1-oxide;
4-(((1r,4r)-4-aminocyclohexyl)carbamoyl)pyridine 1-oxide;
4-amino-N-((1r,4r)-4-aminocyclohexyl)quinoline-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminoquinoline-6-carboxamide;
(R)-2-oxo-N-(pyrrolidin-3-ylmethyl)indoline-5-carboxamide;
N-(4-(2-amino-N-methylacetamido)cyclohexyl)-2-oxoindoline-5-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methylpyrazine-2-carboxami-
de;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4-bromo-3,5-dimethyl-1H-pyr-
azol-1-yl)propanamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(3-methyl-5-oxo-4,5-dihydro-11H-
-pyrazol-1-yl)benzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-indazole-6-carboxamid-
e; N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methoxy-2-naphthamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methoxyquinoline-4-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methoxyquinoline-4-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-2-methoxyquinoline-4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-oxo-4H-chromene-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-hydroxyquinoline-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(4H-1,2,4-triazol-4-yl)benzamid-
e;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(pyrrolidin-1-yl)benzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[d]thiazole-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-chloro-1H-indole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-chloro-1H-indole-2-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H-indole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-indole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-5-carboxamide;
5-((1-(1-(L-alanyl)piperidin-4-yl)ethyl)carbamoyl)benzo[c][1,2,5]oxadiazo-
le 1-oxide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[c][1,2,5]oxadiazole-5-carbox-
amide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)quinoxaline-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)imidazo[2,1-b]thiazole-6-carboxami-
de;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(1H-imidazol-1-yl)butanamide-
; N-((1r,4r)-4-aminocyclohexyl)-5-fluoro-1H-indole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-benzo[d]imidazole-2-carboxamid-
e;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-indole-2-carboxamid-
e;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-indole-2-carbo-
xamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-indole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyisonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyisonicotinamide;
N-((1r,4r)-4-aminocyclohexyl)picolinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrazine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-imidazole-2-carboxami-
de;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-methylisonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-methylnicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methylnicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methylnicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-methylisothiazole-4-carboxamide-
;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-pyrazole-3-carboxami-
de;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(tert-butyl)-1-methyl-1H-pyr-
azole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methoxypyrazine-2-carboxamide;
(1r,4S)--N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminocyclohexane-1-car-
boxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-chloro-2-(trifluoromet-
hyl)benzamide;
4-(((1r,4r)-4-(3-aminopropanamido)cyclohexyl)carbamoyl)pyridine
1-oxide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-fluoropicolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2-difluorobenzo[d][1,3]dioxole--
4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-fluoroisonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)pyrimidine-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-hydroxypyridazine-3-carbox-
amide;
N-((1r,4r)-4-aminocyclohexyl)-6-hydroxypyridazine-3-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-6-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4,6-dimethyl-2-oxo-1,2-dihydropyr-
idine-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-indazole-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-6-methoxy-2-naphthamide;
N-((1r,4r)-4-aminocyclohexyl)-4-oxo-4H-chromene-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-(4H-1,2,4-triazol-4-yl)benzamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(pyrrolidin-1-yl)benzamide-
; N-((1r,4r)-4-aminocyclohexyl)-4-(pyrrolidin-1-yl)benzamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[d]thiazole-6-carboxamid-
e; N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2-difluorobenzo[d][1,3]dioxole--
5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxam-
ide;
5-(((1r,4r)-4-aminocyclohexyl)carbamoyl)benzo[c][1,2,5]oxadiazole
1-oxide;
N-((1r,4r)-4-aminocyclohexyl)benzo[c][1,2,5]oxadiazole-5-carboxa-
mide;
4-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)nicotinamide;
4-amino-N-((1r,4r)-4-aminocyclohexyl)nicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-indole-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyisonicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyisonicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-hydroxynicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-6-hydroxynicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)picolinamide;
N-(4-(3-aminopropanamido)cyclohexyl)picolinamide;
N-((1r,4r)-4-aminocyclohexyl)pyrazine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(tert-butyl)-1-(3-methylbenzyl)-
-1H-pyrazole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-7-methyl-1H-indole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methoxypicolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methoxypyrazine-2-carboxamide;
(1r,4r)-4-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)cyclohexane-1-
-carboxamide;
(1r,4r)-4-amino-N-((1r,4r)-4-aminocyclohexyl)cyclohexane-1-carboxamide;
(2S,4S)--N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-fluoropyrrolidine-2-ca-
rboxamide;
(3R)--N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1,2,3,4-tetrahydr-
oisoquinoline-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2,2-difluorobenzo[d][1,3]dioxole-4-carboxam-
ide; N-((1r,4r)-4-aminocyclohexyl)-3-fluoroisonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)thiazole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-hydroxypicolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-oxo-1,4,5,6-tetrahydropyridazin-
e-3-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indazole-3-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(3,5-difluorophenyl)acetamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(pyridin-3-yl)acetamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(pyrimidin-5-yl)acetamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(1H-imidazol-1-yl)acetamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)imidazo[2,1-b]thiazole-6-carb-
oxamide;
N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1-b]thiazole-6-carboxamide-
;
N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1-b]thiazole-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-methylpyrimidine-5-carboxamide;
2-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isonicotinamide;
2-amino-N-((1r,4r)-4-aminocyclohexyl)isonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-sulfamoylbenzamide;
N-((1r,4r)-4-aminocyclohexyl)-4,6-dimethyl-2-oxo-1,2-dihydropyridine-3-ca-
rboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-indazo-
le-6-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methoxy-2-naphthamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-oxo-4H-chromene-2-carboxam-
ide;
N-((1r,4r)-4-aminocyclohexyl)-4-hydroxyquinoline-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(4H-1,2,4-triazol-4-yl)ben-
zamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2,2-difluorobenzo[d][-
1,3]dioxole-5-carboxamide;
5-(((1r,4r)-4-(3-aminopropanamido)cyclohexyl)carbamoyl)benzo[c][1,2,5]oxa-
diazole 1-oxide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[c][1,2,5]oxadiazole-5-c-
arboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-(1H-imidazol-1-yl)butanamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(6-methoxynaphthalen-2-yl)propa-
namide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-fluoro-1H-indole-2--
carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-benzo[d]imidazole-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-imidazole-2-carboxamide;
(1r,4r)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)bicyclo[2.2.1]hept-5-ene-2-
-carboxamide; N-((1r,4r)-4-aminocyclohexyl)-4-methylnicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(tert-butyl)-1-(3-methylbe-
nzyl)-1H-pyrazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)-1-(3-methylbenzyl)-1H-pyrazo-
le-5-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-7-methyl-1H-indole-2-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-7-methyl-1H-indole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methylnicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-5-methylnicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-6-methylnicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-methylisothiazole-4-carbox-
amide;
N-((1r,4r)-4-aminocyclohexyl)-3-methylisothiazole-4-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-pyrazole-3-carbo-
xamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-pyrazole-3-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(tert-butyl)-1-methyl-1H-p-
yrazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)-1-methyl-1H-pyrazole-5-carbo-
xamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methoxypicolinamide-
; N-((1r,4r)-4-aminocyclohexyl)-6-methoxypicolinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methoxypyrazine-2-carboxam-
ide; N-((1r,4r)-4-aminocyclohexyl)-6-methoxypyrazine-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-aminopicolinamide;
N-((1r,4r)-4-aminocyclohexyl)-4-chloro-2-(trifluoromethyl)benzamide;
N-((1r,4r)-4-aminocyclohexyl)thiazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-indole-3-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-hydroxypicolinamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(3,5-difluorophenyl)acetamide;
3-amino-N-((1r,4r)-4-(2-(pyridin-3-yl)acetamido)cyclohexyl)propanamide;
3-amino-N-((1r,4r)-4-(2-(pyrimidin-5-yl)acetamido)cyclohexyl)propanamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(pyrimidin-5-yl)acetamide;
N-((1r,4r)-4-(2-(1H-imidazol-1-yl)acetamido)cyclohexyl)-3-aminopropanamid-
e; N-((1r,4r)-4-aminocyclohexyl)benzo[d]thiazole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-6-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-benzo[d]imidazole-5-carbo-
xamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-methoxy-1H-indole-3-carb-
oxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-methoxy-1H-indole--
3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-methoxy-1H-indole-3-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)quinoxaline-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-benzo[d]imidazole-2-carbo-
xamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(1H-imidazol-1-yl)b-
utanamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxyisonicoti-
namide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-hydroxynicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-methylisonicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-3-methylisonicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-methylnicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methylnicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methoxypyrazine-2-carboxam-
ide; N-((1r,4r)-4-aminocyclohexyl)-5-methoxypyrazine-2-carboxamide;
6-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)picolinamide;
6-amino-N-((1r,4r)-4-aminocyclohexyl)picolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-aminonicotinamide;
6-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)nicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-6-fluoropicolinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-fluoroisonicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-3-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methylisonicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methylisonicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-2-methylisonicotinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[d]thiazole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methylthiazole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methylthiazole-2-carboxami-
de; N-((1r,4r)-4-aminocyclohexyl)-5-methylthiazole-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxoindoline-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-4-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4,6-dimethyl-2-oxo-1,2-dihyd-
ropyridine-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-(3-methyl-5-oxo-4,5-dihydro-1H-pyrazol-1--
yl)benzamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-hydroxyquinoline-2-carboxa-
mide; N-((1r,4r)-4-aminocyclohexyl)quinoxaline-2-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(1H-pyrrolo[3,2-b]pyridin-3-yl)-
acetamide;
N-((1r,4r)-4-(2-(1H-pyrrolo[3,2-b]pyridin-3-yl)acetamido)cycloh-
exyl)-3-aminopropanamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(1H-pyrrolo[3,2-b]pyridin-3-ylacetamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxynicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxynicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxynicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-H-imidazole-2-carbo-
xamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-pyrazole-5-car-
boxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-pyrazol-
e-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-pyrazole-5-carboxamide;
(1R,4R)--N-((1r,4R)-4-(3-aminopropanamido)cyclohexyl)bicyclo[2.2.1]hept-5-
-ene-2-carboxamide;
(1r,4r)-N-((1r,4R)-4-aminocyclohexyl)bicyclo[2.2.1]hept-5-ene-2-carboxami-
de; N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-aminopicolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminopyrimidine-5-carboxamide;
4-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrimidine-5-carboxam-
ide; 4-amino-N-((1r,4r)-4-aminocyclohexyl)pyrimidine-5-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-fluoropicolinamide;
N-((1r,4r)-4-aminocyclohexyl)-5-hydroxypicolinamide;
N-((1r,4r)-4-aminocyclohexyl)-6-oxo-1,4,5,6-tetrahydropyridazine-3-carbox-
amide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indazole-3-carboxam-
ide; N-((1r,4r)-4-aminocyclohexyl)-2-(1H-imidazol-1-yl)acetamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[d]thiazole-2-carboxamid-
e; (1r,4r)-4-amino-N-(2-oxoindolin-5-yl)cyclohexane-1-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-5-sulfonamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-4-carboxamide;
3-amino-N-((1r,4r)-4-(2-(4-bromo-3,5-dimethyl-1H-pyrazol-1-yl)propanamido-
)cyclohexyl)propanamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(3-methyl-5-oxo-4,5-dihydr-
o-1H-pyrazol-1-yl)benzamide;
(2R,4S)--N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-hydroxypyrrolidine-2-c-
arboxamide;
(2R,4S)--N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-hydroxypyrrolidin-
e-2-carboxamide;
(2R,4S)--N-((1r,4r)-4-aminocyclohexyl)-4-hydroxypyrrolidine-2-carboxamide-
;
(R)--N-((1r,4r)-4-aminocyclohexyl)-1,2,3,4-tetrahydroquinoline-2-carboxa-
mide;
5-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)picolinamide;
5-amino-N-((1r,4r)-4-aminocyclohexyl)picolinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-chloro-2-(trifluoromethyl)-
benzamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2,2-difluorobenzo[-
d][1,3]dioxole-4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5-dihydroxy-2-naphthamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)thiazole-5-carboxamide;
3-amino-N-((1r,4r)-4-(2-(3,5-difluorophenyl)acetamido)cyclohexyl)propanam-
ide; 5-acetamido-N-((1r,4r)-4-aminocyclohexyl)picolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)imidazo[1,2-b]pyridazine-2-carboxa-
mide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)imidazo[1,2-b]pyridazine-
-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2-b]pyridazine-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-(2-oxoindolin-5-yl)acetamide;
3-amino-N-((1r,4r)-4-((2-oxoindoline)-5-sulfonamido)cyclohexyl)propanamid-
e;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methyl-3-oxo-3,4-dihydro-2H-b-
enzo[b][1,4]oxazine-6-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methyl-3-oxo-3,4-dihydro-2-
H-benzo[b][1,4]oxazine-6-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]-
oxazine-6-carboxamide;
N-((1R,4r)-4-((R)-3-aminobutanamido)cyclohexyl)-2-oxoindoline-5-carboxami-
de;
N-((1r,4r)-4-aminocyclohexyl)-2-(4-bromo-3,5-dimethyl-1H-pyrazol-1-yl)-
propanamide;
N-((1r,4r)-4-aminocyclohexyl)-4-(1H-1,2,4-triazol-1-yl)benzamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxyquinoline-3-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-2-(3-(trifluoromethyl)phenyl)acetamide-
;
3-amino-N-((1r,4r)-4-aminocyclohexyl)-2-methylquinoline-4-carboxamide;
(3R)--N-(4-aminocyclohexyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-3,5-dihydroxy-2-naphthamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-acetamidopicolinamide;
5-acetamido-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)picolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-cyclopropyl-1,2,4-oxadiazole-3--
carboxamide;
3-amino-N-((1r,4r)-4-(2-(2-oxoindolin-5-yl)acetamido)cyclohexyl)propanami-
de;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(2-oxoindolin-5-yl)acetamide-
;
(1r,4r)-4-(3-aminopropanamido)-N-(2-oxoindolin-5-yl)cyclohexane-1-carbox-
amide;
3-amino-N-(2,2-dimethyl-3-((2-oxoindoline)-5-sulfonamido)propyl)pro-
panamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-oxoisoindoline-5-carbo-
xamide;
N-((1r,4r)-4-aminocyclohexyl)-2,3-dioxoindoline-5-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(1H-1,2,4-triazol-1-yl)benzamid-
e;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(1H-1,2,4-triazol-1-yl)b-
enzamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyquinoline-3-car-
boxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoline-3-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(3-(trifluoromethyl)phenyl)acet-
amide;
3-amino-N-((1r,4r)-4-(2-(3-(trifluoromethyl)phenyl)acetamido)cycloh-
exyl)propanamide;
3-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methylquinoline-4--
carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3,5-dihydroxy-2-naphthamide;
N-((1r,4r)-4-aminocyclohexyl)-3-hydroxypicolinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-oxo-1,4,5,6-tetrahydropyri-
dazine-3-carboxamide;
(E)-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(1H-imidazol-4-yl)acry-
lamide;
N-((1r,4r)-4-aminocyclohexyl)-5-cyclopropyl-1,2,4-oxadiazole-3-car-
boxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-cyclopropyl-1,2,4-
-oxadiazole-3-carboxamide;
2-amino-N-(2,2-dimethyl-3-((2-oxoindoline)-5-sulfonamido)propyl)acetamide-
; N-((1r,4r)-4-aminocyclohexyl)-1-oxoisoindoline-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,3-dioxoindoline-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-amino-2-methylquinoline-4-carbo-
xamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindoline-5-c-
arboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-chloro-2-oxoindoline-5-car-
boxamide;
N-((1r,4r)-4-aminocyclohexyl)-6-chloro-2-oxoindoline-5-carboxami-
de;
N-((1r,4r)-4-aminocyclohexyl)-4-hydroxypyrimidine-5-carboxamide;
(E)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(1H-imidazol-4-yl)acrylamid-
e;
(E)-N-((1r,4r)-4-aminocyclohexyl)-3-(1H-imidazol-4-yl)acrylamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-pyrazolo[3,4-c]pyridine-5-carb-
oxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-pyrazolo[3,4-c]pyridine-5-carbox-
amide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-fluorobenzo[d]thiazole-2--
carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-fluorobenzo[d]thiazole-2-c-
arboxamide;
N-((1r,4r)-4-aminocyclohexyl)-6-fluorobenzo[d]thiazole-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-imidazole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-oxoisoindoline-5-carboxami-
de;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2,3-dioxoindoline-5-carbo-
xamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-7-carbo-
xamide; N-(4-aminocyclohexyl)-2-oxoindoline-7-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-1,2,4-triazole-5-carboxamide;
3-amino-N-((1r,4r)-4-aminocyclohexyl)-1H-1,2,4-triazole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-hydroxypyrimidine-5-carboxamide-
;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-hydroxypyrimidine-5-carbo-
xamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-hydroxypicolinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-hydroxypicolinamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-hydroxynicotinamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-hydroxynicotinamide;
N-((1r,4r)-4-aminocyclohexyl)-5-hydroxynicotinamide;
N-(4-aminocyclohexyl)-1H-imidazole-4-carboxamide;
N-(4-(3-aminopropanamido)cyclohexyl)-1H-imidazole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methyl-1H-indole-5-carboxa-
mide;
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H-indole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1H-imidazole-4-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H-imidazole-5-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4H-1,2,4-triazole-3-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4H-1,2,4-triazole-3-carboxam-
ide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-chloro-1H-pyrazole-3-carbox-
amide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-chloro-1H-pyrazole-3-
-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-pyrazolo[3,4-c]pyridine-5-
-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-oxo-4,5-dihydro-1H-1,2,4-t-
riazole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazole-3-carbo-
xamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)thiazolo[5,4-c]pyridin-
e-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)thiazolo[5,4-c]pyridine-2-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5-ethyl-1H-1,2,4-triazole-3-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-ethyl-4H-1,2,4-triazole-3--
carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-imidazole-4-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methyl-1H-indole-5-carboxamide;
N-((1R,4r)-4-((1r,4R)-4-aminocyclohexane-1-carboxamido)cyclohexyl)-1H-1,2-
,4-triazole-5-carboxamide;
N-((1r,4r)-4-(4-aminobutanamido)cyclohexyl)-4H-1,2,4-triazole-3-carboxami-
de;
N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H-1,2,4-triazole-3-carboxamide-
;
N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H-imidazole-4-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methyl-4H-1,2,4-triazole-3-
-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-1,2,4-triazole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H-pyrazole-3-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazo-
le-3-carboxamide;
N-(1-(2-(piperidin-4-yl)acetyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carbox-
amide;
N-((1r,4r)-4-aminocyclohexyl)-3-iodo-1H-1,2,4-triazole-5-carboxamid-
e;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-methyl-1H-1,2,4-triazole-5-ca-
rboxamide;
N-((1r,4r)-4-aminocyclohexyl)-5-methyl-11H-1,2,4-triazole-3-car-
boxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)thiazolo[5,4-c]pyridine-2-
-carboxamide;
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-ethylthiazole-2-carboxamide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-ethylthiazole-2-carboxamid-
e; N-((1r,4r)-4-aminocyclohexyl)-5-ethylthiazole-2-carboxamide;
N-(1-((1r,4r)-4-aminocyclohexane-1-carbonyl)piperidin-4-yl)-4H-1,2,4-tria-
zole-3-carboxamide;
N-(1-(3-aminopropanoyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carboxamide;
(.+-.)-trans-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)-
benzamide;
(.+-.)-cis-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperid-
in-4-yl)benzamide;
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydro-1H-pyrrolo[2,3-c]pyridine-
-5-carboxamide;
N-(1-(4-aminobutanoyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-N-methyl-1H-1,2,4-triazole-5-carboxamide;
N-((1r,4r)-4-aminocyclohexyl)-4-methyl-1H-imidazole-2-carboxamide;
(.+-.)-trans-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)benzam-
ide;
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)benz-
amide;
N-((1r,4r)-4-aminocyclohexyl)-6-bromo-2-hydroxyquinoline-3-carboxam-
ide;
N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-bromo-2-hydroxyquinoli-
ne-3-carboxamide;
(.+-.)-cis-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)be-
nzamide;
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)-
-[1,1'-biphenyl]-4-carboxamide;
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)-3-ethyl-
benzamide;
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-y-
l)benzamide;
(.+-.)-trans-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)-
benzamide;
2-amino-N-((1r,4r)-4-aminocyclohexyl)-1H-imidazole-4-carboxamid- e;
(.+-.)-trans-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)-3-e-
thylbenzamide;
N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2-a]pyrimidine-3-carboxamide;
N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]-
octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-6-fluoro-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-(((1-methylpiperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3-
.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;
N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-2--
oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-(((1-(3-hydroxypropyl)piperidin-4-yl)methyl)sulfonyl)-8-a-
zabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-6--
chloro-2-oxoindoline-5-carboxamide;
N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]-
octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;
N-((2S)-1-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-2-methylpiperidin-4-yl-
)-2-oxoindoline-5-carboxamide;
6-chloro-N-((1R,3r,5S)-8-(((1-(3-hydroxypropyl)piperidin-4-yl)methyl)sulf-
onyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
6-chloro-N-((1R,3r,5S)-8-((4-(methylamino)piperidin-1-yl)sulfonyl)-8-azab-
icyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-(benzylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.-
2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((2S,4S)-1-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-2-methylpiperidin-4-
-yl)-6-chloro-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-(methylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.-
2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
2-oxo-N-((1R,3r,5S)-8-((piperidin-3-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1-
]octan-3-yl)indoline-5-carboxamide;
N-((1R,3R,5S)-8-(((1s,4S)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]-
octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-(benzylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.-
2.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-(dimethylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[-
3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
6-chloro-N-((1R,3r,5S)-8-((4-(dimethylamino)piperidin-1-yl)sulfonyl)-8-az-
abicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
6-chloro-2-oxo-N-((1R,3r,5S)-8-(((1-(4,4,4-trifluorobutyl)piperidin-4-yl)-
methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;
6-chloro-2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicy-
clo[3.2.1]octan-3-yl)indoline-5-carboxamide;
2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1-
]octan-3-yl)indoline-5-carboxamide;
6-chloro-2-oxo-N-((1R,3S,5S)-8-((((S)-piperidin-3-yl)methyl)sulfonyl)-8-a-
zabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;
N-((2S,4S)-2-methyl-1-((piperidin-4-ylmethyl)sulfonyl)piperidin-4-yl)-2-o-
xoindoline-5-carboxamide;
6-chloro-2-oxo-N-((1R,3R,5S)-8-((((R)-piperidin-3-yl)methyl)sulfonyl)-8-a-
zabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;
2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1-
]octan-3-yl)-2,3-dihydrobenzo[d]oxazole-6-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-6-bromo-2-oxoindoline-5-carboxamide;
N-((3S)-1-((4-aminopiperidin-1-yl)sulfonyl)-3-methylpiperidin-4-yl)-6-chl-
oro-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-6-chloro-1-methyl-2-oxoindoline-5-carboxamide;
N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5--
ethylisothiazole-3-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-6-methyl-2-oxoindoline-5-carboxamide;
N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5--
cyclopropyl-1,3,4-thiadiazole-2-carboxamide;
N-((3R,4R)-1-((4-aminopiperidin-1-yl)sulfonyl)-3-methylpiperidin-4-yl)-6--
chloro-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-5-ethylisothiazole-3-carboxamide;
1-methyl-2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicy-
clo[3.2.1]octan-3-yl)indoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-8-azabicyclo[3.2-
.1]octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-8-azabicyclo[3.2-
.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;
6-chloro-2-oxo-N-((1R,3r,5S)-8-((2-(pyrrolidin-1-yl)ethyl)sulfonyl)-8-aza-
bicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;
2-oxo-N-((1R,3r,5S)-8-((2-(pyrrolidin-1-yl)ethyl)sulfonyl)-8-azabicyclo[3-
.2.1]octan-3-yl)indoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-5-ethylpyridazine-3-carboxamide;
6-chloro-1-methyl-2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)--
8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-5-cyclopropyl-1,3,4-thiadiazole-2-carboxamide;
N-((2S,4S')-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-
-ethylpyridazine-3-carboxamide;
2-oxo-N-(1-((piperidin-4-ylmethyl)sulfonyl)piperidin-4-yl)indoline-5-carb-
oxamide;
N-(1-((3-aminopropyl)sulfonyl)piperidin-4-yl)-6-chloro-2-oxoindol-
ine-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3--
yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;
N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]-
octan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;
N-(1-((3-aminopropyl)sulfonyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide-
;
(R)-2-methyl-3-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-az-
abicyclo[3.2.1]octan-3-yl)-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxami-
de;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]o-
ctan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;
N-((1R,3R,5S)-8-(((1r,4R)-4-(benzylamino)cyclohexyl)sulfonyl)-8-azabicycl-
o[3.2.1]octan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;
2,2-difluoro-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicycl-
o[3.2.1]octan-3-yl)benzo[d][1,3]dioxole-5-carboxamide;
N-((2S,4R)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5--
ethylisothiazole-3-carboxamide;
2,2-difluoro-N-((1R,3r,5S)-8-(((1-methylpiperidin-4-yl)methyl)sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl)benzo[d][1,3]dioxole-5-carboxamide;
N-((2S,4R)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5--
cyclopropyl-1,3,4-thiadiazole-2-carboxamide;
N-((2S,4S)-1-((4-acetamidophenyl)sulfonyl)-2-methylpiperidin-4-yl)-2-oxoi-
ndoline-5-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-5-cyclopropyl-1H-pyrazole-3-carboxamide;
N-((3R,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-3-methylpiperidin-4-yl)-6--
chloro-2-oxoindoline-5-carboxamide;
3-ethyl-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2-
.1]octan-3-yl)benzamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-7-carboxamide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa-
n-3-yl)-1-cyclopropyl-1H-pyrazole-4-carboxamide;
N-((1R,3R,5S)-8-((1r,4R)-4-aminocyclohexane-1-carbonyl)-8-azabicyclo[3.2.-
1]octan-3-yl)-2-oxoindoline-5-carboxamide;
N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-1--
cyclopropyl-1H-pyrazole-4-carboxamide;
N-((2S)-1-((1r,4S)-4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)-
-6-chloro-2-oxoindoline-5-carboxamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-6-chloro-2-oxoindoline--
5-carboxamide;
N-((2S,4S)-1-((1r,4S)-4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4--
yl)-2-oxoindoline-5-carboxamide;
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-2-oxoindoline-5-carboxa-
mide;
N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1-
]octan-3-yl)-3-cyclopropylisoxazole-5-carboxamide;
5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]pyridazine-3-carboxamide;
5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3-yl}pyridazine-3-carboxa-
mide;
5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3-yl}pyridazine-3-ca-
rboxamide;
N-{1-[(5-chloro-1-methyl-1H-imidazol-4-yl)methyl]azetidin-3-yl}-
-5-cyclopropylpyridazine-3-carboxamide;
5-cyclopropyl-N-{1-[1-(2,5-dichlorophenyl)ethyl]azetidin-3-yl}pyridazine--
3-carboxamide;
5-cyclopropyl-N-(1-{1-[3-(2-hydroxyethoxy)-2-methoxyphenyl]ethyl}azetidin-
-3-yl)pyridazine-3-carboxamide;
N-(1-benzylazetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;
N-(1-{1-[2-chloro-3-(2-hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-5-cyclop-
ropylpyridazine-3-carboxamide;
5-cyclopropyl-N-(1-ethylazetidin-3-yl)pyridazine-3-carboxamide;
5-cyclopropyl-N-[1-(propan-2-yl)piperidin-3-yl]pyridazine-3-carboxamide;
N-(5-hydroxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)-3-(methylamino)cyc-
lohexane-1-carboxamide;
N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)-5-cyclopropylpyridazine-
-3-carboxamide;
5-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H-imidazol-4-yl]methyl}azetidin-3-
-ylpyridazine-3-carboxamide;
N-[1-(azetidin-3-yl)ethyl]-5-cyclopropylpyridazine-3-carboxamide;
5-cyclopropyl-N-{1-[1-(propan-2-yl)azetidin-3-yl]ethyl}pyridazine-3-carbo-
xamide;
5-cyclopropyl-N-{1-[(1S)-1-(2-methoxyphenyl)ethyl]azetidin-3-yl}py-
ridazine-3-carboxamide;
5-cyclopropyl-N-{1-[(1R)-1-(2-methoxyphenyl)ethyl]azetidin-3-yl}pyridazin-
e-3-carboxamide;
N-{1-[1-(2-chloro-3-methoxyphenyl)ethyl]azetidin-3-yl}-5-cyclopropylpyrid-
azine-3-carboxamide;
5-cyclopropyl-N-{1-[1-(4-methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-c-
arboxamide;
5-cyclopropyl-N-{1-[1-(2,3-dimethoxyphenyl)ethyl]azetidin-3-yl}pyridazine-
-3-carboxamide;
N-{1-[(1S)-1-(3-chlorophenyl)propyl]azetidin-3-yl}-5-cyclopropylpyridazin-
e-3-carboxamide;
5-cyclopropyl-N-[3-(dimethylamino)propyl]pyridazine-3-carboxamide;
5-cyclopropyl-N-[2-(dimethylamino)ethyl]pyridazine-3-carboxamide;
5-cyclopropyl-N-(1-(1-methylpiperidin-2-yl)ethyl)pyridazine-3-carboxamide-
;
1-cyclopropyl-N-(1-isopropylazetidin-3-yl)-1H-imidazole-4-carboxamide;
5-cyclopropyl-N-(1-(1-(3-methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3-c-
arboxamide;
5-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)pyridazine-3-carboxamide;
5-cyclopropyl-N-(8-methyl-8-azabicyclo[3.2.1]octan-3-yl)pyridazine-3-carb-
oxamide;
5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H-imidazole-2-car-
boxamide;
5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3-yl}-1H-imidazo-
le-2-carboxamide;
5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3-yl}-1H-imidazole-2-carb-
oxamide;
5-cyclopropyl-N-[1-(propan-2-yl)piperidin-4-yl]pyridazine-3-carbo-
xamide;
5-cyclopropyl-N-(1-methylpiperidin-4-yl)pyridazine-3-carboxamide;
5-cyclopropyl-N-(1-methylpiperidin-3-yl)pyridazine-3-carboxamide;
1-cyclopropyl-N-(1-isopropylazetidin-3-yl)-1H-imidazole-4-carboxamide;
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opyl-1H-imidazole-2-carboxamide;
5-cyclopropyl-N-(1-(4-((1-methyl-1H-pyrazol-4-yl)methoxy)benzyl)azetidin--
3-yl)pyridazine-3-carboxamide;
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylpyridazine-3-carboxamide;
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opylpicolinamide;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylpyrida-
zine-3-carboxamide;
5-cyclopropyl-N-(1-(1-(3-methoxyphenyl)ethyl)azetidin-3-ylpyridazine-3-ca-
rboxamide;
N-(1-(4-((1H-pyrazol-1-yl)methyl)benzyl)azetidin-3-yl-5-cyclopr-
opylpyridazine-3-carboxamide;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylisoxaz-
ole-3-carboxamide;
5-cyclopropyl-N-(1-(1-(4-methoxyphenylethyl)azetidin-3-yl)pyridazine-3-ca-
rboxamide; 4-cyclopropyl-N-(1-isopropylazetidin-3-yl)picolinamide;
4-cyclopropyl-N-(1-(1-(2,5-dichlorophenyl)ethyl)azetidin-3-yl)picolinamid-
e;
N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl-4-cyclo-
propylpicolinamide;
N-(1-(1-(2-chloro-3-methoxyphenyl)ethyl)azetidin-3-yl)-5-cyclopropylpyrid-
azine-3-carboxamide;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicoli-
namide;
N-(1-(4-(benzyloxy)benzyl)azetidin-3-yl-4-cyclopropylpicolinamide;
5-cyclopropyl-N-(1-(1-methylpiperidin-2-ylethyl)pyridazine-3-carboxamide;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1H-im-
idazole-2-carboxamide;
5-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)pyridazine-3-carboxamide;
4-cyclopropyl-N-(1-(1-(2,3-dimethoxyphenylethyl)azetidin-3-yl)picolinamid-
e;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3-
,4-thiadiazole-2-carboxamide;
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopr-
opyl-1H-imidazole-4-carboxamide;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3,4-
-oxadiazole-2-carboxamide;
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-im-
idazole-4-carboxamide;
5-cyclopropyl-N-((1R,3s,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl)pyrida-
zine-3-carboxamide;
5-cyclopropyl-N-((1R,3r,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl)pyrida-
zine-3-carboxamide; and
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opyl-1,3,4-oxadiazole-2-carboxamide.
58. (canceled)
59. A pharmaceutical composition comprising the compound of claim
1, or a pharmaceutically acceptable salt or solvate thereof, and a
pharmaceutically acceptable carrier.
60. A method of treating a patient comprising administering to the
patient a therapeutically effective amount of the compound of claim
1, or a pharmaceutically acceptable salt or hydrate thereof,
wherein the patient has cancer.
61. The method of claim 60, wherein the cancer is selected from the
group consisting of adrenal cancer, acinic cell carcinoma, acoustic
neuroma, acral lentigious melanoma, acrospiroma, acute eosinophilic
leukemia, acute erythroid leukemia, acute lymphoblastic leukemia,
acute megakaryoblastic leukemia, acute monocytic leukemia, acute
promyelocytic leukemia, adenocarcinoma, adenoid cystic carcinoma,
adenoma, adenomatoid odontogenic tumor, adenosquamous carcinoma,
adipose tissue neoplasm, adrenocortical carcinoma, adult T-cell
leukemia/lymphoma, aggressive NK-cell leukemia, AIDS-related
lymphoma, alveolar rhabdomyosarcoma, alveolar soft part sarcoma,
ameloblastic fibroma, anaplastic large cell lymphoma, anaplastic
thyroid cancer, angioimmunoblastic T-cell lymphoma, angiomyolipoma,
angiosarcoma, astrocytoma, atypical teratoid rhabdoid tumor, B-cell
chronic lymphocytic leukemia, B-cell prolymphocytic leukemia,
B-cell lymphoma, basal cell carcinoma, biliary tract cancer,
bladder cancer, blastoma, bone cancer, Brenner tumor, Brown tumor,
Burkitt's lymphoma, breast cancer, brain cancer, carcinoma,
carcinoma in situ, carcinosarcoma, cartilage tumor, cementoma,
myeloid sarcoma, chondroma, chordoma, choriocarcinoma, choroid
plexus papilloma, clear-cell sarcoma of the kidney,
craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer,
colorectal cancer, Degos disease, desmoplastic small round cell
tumor, diffuse large B-cell lymphoma, dysembryoplastic
neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine
gland neoplasm, endodermal sinus tumor, enteropathy-associated
T-cell lymphoma, esophageal cancer, fetus in fetu, fibroma,
fibrosarcoma, follicular lymphoma, follicular thyroid cancer,
ganglioneuroma, gastrointestinal cancer, germ cell tumor,
gestational choriocarcinoma, giant cell fibroblastoma, giant cell
tumor of the bone, glial tumor, glioblastoma multiforme, glioma,
gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell
tumor, gynandroblastoma, gallbladder cancer, gastric cancer, hairy
cell leukemia, hemangioblastoma, head and neck cancer,
hemangiopericytoma, hematological malignancy, hepatoblastoma,
hepatosplenic T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's
lymphoma, invasive lobular carcinoma, intestinal cancer, kidney
cancer, laryngeal cancer, lentigo maligna, lethal midline
carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer,
lymphangioma, lymphangiosarcoma, lymphoepithelioma, lymphoma, acute
lymphocytic leukemia, acute myelogeous leukemia, chronic
lymphocytic leukemia, liver cancer, small cell lung cancer,
non-small cell lung cancer, MALT lymphoma, malignant fibrous
histiocytoma, malignant peripheral nerve sheath tumor, malignant
triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma,
mast cell leukemia, mediastinal germ cell tumor, medullary
carcinoma of the breast, medullary thyroid cancer, medulloblastoma,
melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic
urothelial carcinoma, mixed Mullerian tumor, mucinous tumor,
multiple myeloma, muscle tissue neoplasm, mycosis fungoides, myxoid
liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma,
neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma,
ocular cancer, oligoastrocytoma, oligodendroglioma, oncocytoma,
optic nerve sheath meningioma, optic nerve tumor, oral cancer,
osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid
cancer, paraganglioma, pinealoblastoma, pineocytoma, pituicytoma,
pituitary adenoma, pituitary tumor, plasmacytoma, polyembryoma,
precursor T-lymphoblastic lymphoma, primary central nervous system
lymphoma, primary effusion lymphoma, preimary peritoneal cancer,
prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma
periotonei, renal cell carcinoma, renal medullary carcinoma,
retinoblastoma, rhabdomyoma, rhabdomyosarcoma, Richter's
transformation, rectal cancer, sarcoma, Schwannomatosis, seminoma,
Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring
cell carcinoma, skin cancer, small blue round cell tumors, small
cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart,
spinal tumor, splenic marginal zone lymphoma, squamous cell
carcinoma, synovial sarcoma, Sezary's disease, small intestine
cancer, squamous carcinoma, stomach cancer, T-cell lymphoma,
testicular cancer, thecoma, thyroid cancer, transitional cell
carcinoma, throat cancer, urachal cancer, urogenital cancer,
urothelial carcinoma, uveal melanoma, uterine cancer, verrucous
carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer,
Waldenstrom's macroglobulinemia, Warthin's tumor, and Wilms'
tumor.
62-67. (canceled)
68. A kit comprising the compound of claim 1, or a pharmaceutically
acceptable salt or hydrate thereof, and instructions for
administering the compound, or a pharmaceutically acceptable salt
or hydrate thereof, to a patient having cancer.
69. (canceled)
70. A method of treating a SMYD protein mediated disorder
comprising administering to a subject in need thereof a compound of
claim 1, or a pharmaceutically acceptable salt or hydrate thereof
in an effective amount to treat the SMYD protein mediated disorder.
Description
BACKGROUND OF THE INVENTION
Field of the Invention
[0001] The present disclosure provides carboxamides and
sulfonamides as SMYD protein inhibitors, such as SMYD3 and SMYD2
inhibitors, and therapeutic methods of treating conditions and
diseases wherein inhibition of SMYD proteins such as SMYD3 and
SMYD2 provides a benefit.
Background
[0002] Epigenetic regulation of gene expression is an important
biological determinant of protein production and cellular
differentiation and plays a significant pathogenic role in a number
of human diseases. Epigenetic regulation involves heritable
modification of genetic material without changing its nucleotide
sequence. Typically, epigenetic regulation is mediated by selective
and reversible modification (e.g., methylation) of DNA and proteins
(e.g., histones) that control the conformational transition between
transcriptionally active and inactive states of chromatin. These
covalent modifications can be controlled by enzymes such as
methyltransferases (e.g., SMYD proteins such as SMYD3 and SMYD2),
many of which are associated with genetic alterations that can
cause human disease, such as proliferative disorders. Thus, there
is a need for the development of small molecules that are capable
of inhibiting the activity of SMYD proteins such as SMYD3 and
SMYD2.
BRIEF SUMMARY OF THE INVENTION
[0003] In one aspect, the present disclosure provides carboxamido
and sulfonamide compounds represented by Formulae I-XVIII below,
and the pharmaceutically acceptable salts and solvates thereof,
collectively referred to herein as "Compounds of the
Disclosure."
[0004] In another aspect, the present disclosure provides a
Compound of the Disclosure and one or more pharmaceutically
acceptable carriers.
[0005] In another aspect, the present disclosure provides a method
of inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a
mammal, comprising administering to the mammal an effective amount
of at least one Compound of the Disclosure.
[0006] In another aspect, the present disclosure provides methods
for treating a disease, disorder, or condition, e.g., cancer,
responsive to inhibition of SMYD proteins, such as SMYD3 or SMYD2,
or both, comprising administering a therapeutically effective
amount of a Compound of the Disclosure.
[0007] In another aspect, the present disclosure provides the use
of Compounds of the Disclosure as inhibitors of SMYD3.
[0008] In another aspect, the present disclosure provides the use
of Compounds of the Disclosure as inhibitors of SMYD2.
[0009] In another aspect, the present disclosure provides the use
of Compounds of the Disclosure as inhibitors of SMYD proteins.
[0010] In another aspect, the present disclosure provides a
pharmaceutical composition for treating a disease, disorder, or
condition responsive to inhibition of SMYD proteins, such as SMYD3
or SMYD2, or both, wherein the pharmaceutical composition comprises
a therapeutically effective amount of a Compound of the Disclosure
in a mixture with one or more pharmaceutically acceptable
carriers.
[0011] In another aspect, the present disclosure provides Compounds
of the Disclosure for use in treating cancer in a mammal, e.g.,
breast, cervical, colon, kidney, liver, head and neck, skin,
pancreatic, ovary, esophageal, lung, and prostate cancer.
[0012] In another aspect, the present disclosure provides a
Compound of the Disclosure for use in the manufacture of a
medicament for treating cancer in a mammal.
[0013] In another aspect, the present disclosure provides kit
comprising a Compound of the Disclosure.
[0014] Additional embodiments and advantages of the disclosure will
be set forth, in part, in the description that follows, and will
flow from the description, or can be learned by practice of the
disclosure. The embodiments and advantages of the disclosure will
be realized and attained by means of the elements and combinations
particularly pointed out in the appended claims.
[0015] It is to be understood that both the foregoing summary and
the following detailed description are exemplary and explanatory
only, and are not restrictive of the invention as claimed.
DETAILED DESCRIPTION OF THE INVENTION
[0016] One aspect of the present disclosure is based on the use of
Compounds of the Disclosure as inhibitors of SMYD proteins. In view
of this property, the Compounds of the Disclosure are useful for
treating diseases, disorders, or conditions, e.g., cancer,
responsive to inhibition of SMYD proteins.
[0017] One aspect of the present disclosure is based on the use of
Compounds of the Disclosure as inhibitors of SMYD3. In view of this
property, the Compounds of the Disclosure are useful for treating
diseases, disorders, or conditions, e.g., cancer, responsive to
inhibition of SMYD3.
[0018] One aspect of the present disclosure is based on the use of
Compounds of the Disclosure as inhibitors of SMYD2. In view of this
property, the Compounds of the Disclosure are useful for treating
diseases, disorders, or conditions, e.g., cancer, responsive to
inhibition of SMYD2.
[0019] In one embodiment, Compounds of the Disclosure are compounds
having Formula I:
##STR00002##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0020] A is selected from the group consisting of 1,2,3-triazolyl,
1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl, 1-pyrazolyl,
2-(1,2,3,4-tetrahydroquinolinyl), 2-benzo[d]imidazolyl,
2-benzo[d]thiazolyl, 2-chromenyl-4-one, 2-furanyl,
2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl,
2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl,
2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl,
2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl,
3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl),
3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl,
3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one,
3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl,
4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine,
4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl,
4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl,
5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one),
5-(2,2-difluorobenzo[d][1,3]dioxolyl),
5-(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2-b]pyrrolyl,
5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl,
5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-ene,
5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl,
5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl,
5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl,
6-(1,2,3,4-tetrahydronaphthalenyl),
6-(3,4-dihydroquinolinyl-2(1H)-one),
6-(3,4-dihydroquinoxalinyl-2(1H)-one),
6-(4,5-dihydropyridazinyl-3(2H)-one),
6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl,
6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl,
6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl,
6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl,
6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one,
7-(3,4-dihydroquinolinyl-2(1H)-one),
7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one,
7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one,
cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole,
1-butanyl-imidazole, sec-butylcyclopropane,
2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl
1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide,
[0021] each of which is optionally substituted with one, two, or
three substituents independently selected from the group consisting
of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C.sub.1-6
alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl,
(cycloalkyl)alkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 5-
to 14-membered heteroaryl, optionally substituted 4- to 14-membered
heterocyclo, aralkyl, --N(H)C(.dbd.O)Re, --C(.dbd.O)R.sup.7, and
--S(.dbd.O).sub.2R.sup.8;
[0022] Y is selected from the group consisting of
--C(R.sup.5a)(R.sup.5b)C(.dbd.O)--, --C(.dbd.O)--, and
--S(.dbd.O).sub.2--;
[0023] B is selected from the group consisting of C.sub.1-10
alkylenyl, optionally substituted C.sub.3-12 cycloalkylenyl,
optionally substituted C.sub.6-14 arylenyl, optionally substituted
4- to 14-membered heterocyclenyl, and --C(H)R.sup.1R.sup.2,
[0024] with the proviso that B is not optionally substituted
pyrrolidinenyl;
[0025] X is selected from the group consisting of --N(R.sup.3)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2N(R.sup.3)--,
--N(R.sup.3)S(.dbd.O).sub.2--, --S(.dbd.O).sub.2C(R.sup.4)(H)--,
--C(.dbd.O)--, --C(.dbd.O)N(R.sup.3)--, --N(R.sup.3)C(.dbd.O)--,
--C(.dbd.O)O--, --OC(.dbd.O)--,
--C(.dbd.O)C(R.sup.4)(H)N(R.sup.3)--,
--N(R.sup.3)C(.dbd.O)C(R.sup.4)(H)--, and
--C(.dbd.O)C(R.sup.4)(H)--; or X is absent, i.e., Z forms a bond
with B;
[0026] Z is selected from the group consisting of hydrogen,
optionally substituted C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl, optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl; or
[0027] Z is --CH(R.sup.9a)(R.sup.9b);
[0028] R.sup.9a is selected from the group consisting of hydrogen,
C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, alkoxyalkyl, optionally
substituted C.sub.6-14 aryl, optionally substituted 4- to
14-membered heterocyclo, optionally substituted 5- to 14-membered
heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl,
and (heteroaryl)alkyl;
[0029] R % is selected from the group consisting of optionally
substituted C.sub.6-14 aryl, optionally substituted 4- to
14-membered heterocyclo, optionally substituted 5- to 14-membered
heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl,
and (heteroaryl)alkyl;
[0030] R.sup.1 is selected from the group consisting of hydrogen,
C.sub.1-6 alkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, hydroxyalkyl, alkoxyalkyl, aryloxyalkyl,
optionally substituted C.sub.3-12 cycloalkyl, optionally
substituted 4- to 14-membered heterocyclo, optionally substituted
C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl;
[0031] R.sup.2 is selected from the group consisting of C.sub.1-6
alkyl, optionally substituted C.sub.3-12 cycloalkyl, optionally
substituted C.sub.6-14 aryl, optionally substituted 5- to
14-membered heteroaryl, optionally substituted 4- to 14-membered
heterocyclo, and (heteroaryl)alkyl;
[0032] R.sup.3 is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl; and
[0033] R.sup.4 is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, hydroxy, amino, alkylamino, dialkylamino,
cycloalkylamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, and hydroxyalkyl.
[0034] R.sup.5a is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl;
[0035] R.sup.5b is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, and 4- to 14-membered heterocyclo;
[0036] R.sup.6 is C.sub.1-4 alkyl,
[0037] R.sup.7 is C.sub.1-4 alkyl; and
[0038] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino,
[0039] wherein --X--Z is attached to any available carbon or
nitrogen atom of B, R.sup.1, or R.sup.2, e.g., when R.sup.2 is
C.sub.1-6 alkyl, e.g., ethyl, a hydrogen atom of that ethyl group
is replaced with --X--Z to give --CH.sub.2CH.sub.2--X--Z or
##STR00003##
[0040] when R.sup.2 is optionally substituted C.sub.3-12
cycloalkyl, e.g., cyclohexyl, a hydrogen atom of the cyclohexyl
group is replaced with --X--Z to give:
##STR00004##
[0041] when R.sup.2 is optionally substituted 4- to 14-membered
heterocyclo, e.g., piperidinyl, the hydrogen atom attached to the
piperidinyl nitrogen atom is replaced with --X--Z to give:
##STR00005##
or
[0042] when R.sup.2 is optionally substituted C.sub.6-14 aryl,
e.g., phenyl, a hydrogen atom on that phenyl group is replaced with
--X--Z to give:
##STR00006##
[0043] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein Z is selected
from the group consisting of hydrogen, optionally substituted
C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl,
(heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl,
(amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl,
(hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 4- to 14-membered
heterocyclo, optionally substituted 5- to 14-membered heteroaryl,
optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl.
[0044] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein X is
absent.
In another embodiment, Compounds of the Disclosure are compounds
having Formula I, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, wherein X is absent; B is
optionally substituted 4- or 6- to 14-membered heterocyclenyl; and
Z is selected from the group consisting of hydrogen, optionally
substituted C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl, optionally
substituted C.sub.6-14 aryl, optionally substituted 4- to
14-membered heterocyclo, optionally substituted 5- to 14-membered
heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl,
and (heteroaryl)alkyl.
[0045] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is optionally
substituted 4- or 6- to 14-membered heterocyclenyl; X is absent;
and Z is --CH(R.sup.9a)(R.sup.9b).
[0046] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is optionally
substituted 4- or 6- to 14-membered heterocyclenyl; X is absent;
and Z is --CH(R.sup.9a)(R.sup.9b), wherein:
[0047] R.sup.9a is selected from the group consisting of hydrogen,
C.sub.1-6 alkyl, and optionally substituted C.sub.3-12 cycloalkyl;
and
[0048] R.sup.9b is selected from the group consisting of optionally
substituted C.sub.6-14 aryl, optionally substituted 5- to
14-membered heteroaryl, optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl.
[0049] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is C.sub.1-10
alkylenyl. In another embodiment, X is selected from the group
consisting of --N(R.sup.3)C(.dbd.O)C(R.sup.4)(H)-- and
--N(R.sup.3)C(.dbd.O)--. In another embodiment, Z is selected from
the group consisting of C.sub.1-6 alkyl and (amino)alkyl.
[0050] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is optionally
substituted C.sub.6-14 arylenyl. In another embodiment, B is
divalent form of optionally substituted phenyl.
[0051] In another embodiment, Compounds of the Disclosure are
compounds having Formula H:
##STR00007##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein X is absent and Z is (amino)alkyl; and A
and Y are as defined above in connection with Formula I.
[0052] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is optionally
substituted C.sub.3-12 cycloalkylenyl.
[0053] In another embodiment, Compounds of the Disclosure are
compounds having Formula III, Formula IV, or Formula V:
##STR00008##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein R.sup.10a, R.sup.10b, R.sup.11a, and
R.sup.11b are each independently selected from the group consisting
of hydrogen and C.sub.1-4 alkyl; and A, Y, X, and Z are as defined
above in connection with Formula I. In another embodiment, X is
--N(R.sup.3)C(.dbd.O)-- and Z is (amino)alkyl. In another
embodiment, X is --N(R.sup.3)-- and Z is hydrogen.
[0054] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is optionally
substituted 4- to 14-membered heterocyclenyl.
[0055] In another embodiment, Compounds of the Disclosure are
compounds having Formula VI, Formula VII, or Formula VIII:
##STR00009##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein R.sup.12a, R.sup.12b, R.sup.13a, and
R.sup.13b are each independently selected from the group consisting
of hydrogen and C.sub.1-4 alkyl; and A, Y, X, and Z are as defined
above in connection with Formula I. In another embodiment, X is
selected from the group consisting of --C(.dbd.O)C(R.sup.4)(H)--,
--C(.dbd.O)--, and --S(.dbd.O).sub.2--; and R.sup.4 is selected
from the group consisting of hydrogen and amino. In another
embodiment, Z is selected from the group consisting of
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(heterocyclo)alkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, aralkyl, and
(heteroaryl)alkyl.
[0056] In another embodiment, Compounds of the Disclosure are
compounds having Formula VI, Formula VII, or Formula VIII, and the
pharmaceutically acceptable salts or solvates, e.g., hydrates,
thereof, wherein R.sup.12a, R.sup.12b, R.sup.13a, and R.sup.13b are
each independently selected from the group consisting of hydrogen
and C.sub.6-14 alkyl; A is 5-indolinyl-2-one that is optionally
substituted with one or two substituents selected from the group
consisting of halo, hydroxy, alkoxy, amino, alkylamino,
dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl.
C.sub.1-6 alkyl, haloalkyl, and hydroxyalkyl; Y is --C(.dbd.O)--; X
is --S(.dbd.O).sub.2--; and Z is as defined above in connection
with Formula I. In another embodiment. A is
6-chloro-5-indolinyl-2-one, i.e.,
##STR00010##
[0057] In another embodiment, Z is selected from the group
consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(heterocyclo)alkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, aralkyl, and
(heteroaryl)alkyl.
[0058] In another embodiment. Compounds of the Disclosure are
compounds having Formula I. and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein B is
--C(H)R.sup.1R.sup.2. In this embodiment, a hydrogen atom of
R.sup.1 and R.sup.2 is replaced with --X--Z.
[0059] In another embodiment, Compounds of the Disclosure are
compounds having Formula IX, Formula X, or Formula XI:
##STR00011##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof. In another embodiment, R.sup.1 is selected from
the group consisting of hydrogen, C.sub.1-6 alkyl, alkoxycarbonyl,
and optionally substituted C.sub.6-14 aryl. In another embodiment,
R.sup.1 is selected from the group consisting of hydrogen and
methyl. In another embodiment, X is --C(.dbd.O)C(R.sup.4)(H)-- and
R.sup.4 is amino. In another embodiment, X is selected from the
group consisting of:
##STR00012##
In another embodiment, Z is C.sub.1-6 alkyl. In another embodiment,
Z is methyl.
[0060] In another embodiment, Compounds of the Disclosure are
compounds having any one of Formula I-XI, and the pharmaceutically
acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is
--C(R.sup.5a)(R.sup.5b)C(.dbd.O)--. In another embodiment, R.sup.5a
and R.sup.5b are each independently selected from the group
consisting of hydrogen and methyl.
[0061] In another embodiment, Compounds of the Disclosure are
compounds having any one of Formula I-XI, and the pharmaceutically
acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is
--S(.dbd.O).sub.2--.
[0062] In another embodiment, Compounds of the Disclosure are
compounds having any one of Formula I-XI, and the pharmaceutically
acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is
--C(.dbd.O)--.
[0063] In another embodiment, Compounds of the Disclosure are
compounds having any one of Formula I-XI, and the pharmaceutically
acceptable salts or solvates, e.g., hydrates, thereof, wherein A is
selected from the group consisting of 1,2,3-triazolyl,
1,2,4-triazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-indolyl,
2-thiazolyl, 3-(1,2,4-oxadiazolyl), 3-isothiazolyl,
5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one),
5-(2,2-difluorobenzo[d][1,3]dioxolyl),
5-benzo[d]oxazolyl-2(3H)-one, 5-indolinyl-2-one,
6-benzo[b][1,4]oxazinyl-3-one, and 6-isoquinolinyl.
[0064] In another embodiment, Compounds of the Disclosure are
compounds having any one of Formula I-XI, and the pharmaceutically
acceptable salts or solvates, e.g., hydrates, thereof, wherein A is
5-indolinyl-2-one.
[0065] In another embodiment, Compounds of the Disclosure are
compounds having Formula XII:
##STR00013##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0066] A.sup.1 is selected from the group consisting of
1,2,3-triazolyl, 1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl,
1-pyrazolyl, 2-(1,2,3,4-tetrahydroquinolinyl),
2-benzo[d]imidazolyl, 2-benzo[d]thiazolyl, 2-chromenyl-4-one,
2-furanyl, 2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl,
2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl,
2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl,
2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl,
3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl),
3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl,
3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one,
3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl,
4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine,
4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl,
4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl,
5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one),
5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one),
5-(2,2-difluorobenzo[d][1,3]dioxolyl),
5-(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2-b]pyrrolyl,
5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl,
5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-ene,
5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl,
5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl,
5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl,
6-(1,2,3,4-tetrahydronaphthalenyl),
6-(3,4-dihydroquinolinyl-2(1H)-one),
6-(3,4-dihydroquinoxalinyl-2(1H)-one),
6-(4,5-dihydropyridazinyl-3(2H)-one),
6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl,
6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl,
6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl,
6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl,
6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one,
7-(3,4-dihydroquinolinyl-2(1H)-one),
7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one,
7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one,
cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole,
1-butanyl-imidazole, sec-butylcyclopropane,
2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl
1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide,
[0067] each of which is optionally substituted with one, two, or
three substituents independently selected from the group consisting
of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C.sub.1-6
alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl,
(cycloalkyl)alkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 5-
to 14-membered heteroaryl, optionally substituted 4- to 14-membered
heterocyclo, and aralkyl;
[0068] B.sup.1 is selected from the group consisting of optionally
substituted C.sub.3-12 cycloalkylenyl and optionally substituted 4-
to 14-membered heterocyclenyl;
[0069] X.sup.1 is selected from the group consisting of
--N(R.sup.3a)--, --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.3a)--, --N(R.sup.3a)S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2C(R.sup.4a)(H)--, --C(.dbd.O)--,
--C(.dbd.O)N(R.sup.3a)--, --N(R.sup.3a)C(.dbd.O)--, --C(.dbd.O)O--,
--OC(.dbd.O)--, --C(.dbd.O)C(R.sup.4a)(H)N(R.sup.3a)--,
--N(R.sup.3a)C(.dbd.O)C(R.sup.4a)(H)--, and
--C(.dbd.O)C(R.sup.4a)(H)--; or X.sup.1 is absent, i.e., Z.sup.1
forms a bond with B.sup.1;
[0070] Z is selected from the group consisting of hydrogen,
optionally substituted C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl, optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl;
[0071] R.sup.3a is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl; and
[0072] R.sup.4a is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, hydroxy, amino, alkylamino, and dialkylamino.
[0073] In another embodiment, Compounds of the Disclosure are
compounds having Formula XII, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A.sup.1 is 5-indolinyl-2-one. In
another embodiment, B.sup.1 is optionally substituted C.sub.3-12
cycloalkylenyl. In another embodiment, X.sup.1 is selected from the
group consisting of --S(.dbd.O).sub.2-- and --C(.dbd.O)--. In
another embodiment, Z.sup.1 is selected from the group consisting
of (amino)alkyl, (alkylamino)alkyl, and (dialkylamino)alkyl.
[0074] In another embodiment, Compounds of the Disclosure are
compounds having Formula XIII:
##STR00014##
or a pharmaceutically acceptable salt or hydrate thereof,
wherein
[0075] X.sup.2 is selected from the group consisting of
--N(R.sup.3b)--, --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.3b)--, --N(R.sup.3b)S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2C(R.sup.4b)(H)--, --C(.dbd.O)--,
--C(.dbd.O)N(R.sup.3b)--, --N(R.sup.3b)C(.dbd.O)--, --C(.dbd.O)O--,
--OC(.dbd.O)--, --C(.dbd.O)C(R.sup.4b)(H)N(R.sup.3b)--,
--N(R.sup.3b)C(.dbd.O)C(R.sup.4b)(H)--, and
--C(.dbd.O)C(R.sup.4b)(H)--; or X is absent, i.e., Z.sup.2 forms a
bond with the nitrogen atom;
[0076] Z.sup.2 is selected from the group consisting of hydrogen,
optionally substituted C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl;
[0077] R.sup.1a is selected from the group consisting of hydrogen,
C.sub.1-6 alkyl, and optionally substituted C.sub.6-14 aryl;
[0078] R.sup.3b is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl; and
[0079] R.sup.4b is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, hydroxy, amino, alkylamino, and dialkylamino.
[0080] In another embodiment, Compounds of the Disclosure are
compounds having Formula XIII, or a pharmaceutically acceptable
salt or hydrate thereof, wherein X.sup.2 is selected from the group
consisting of --S(.dbd.O).sub.2-- and --C(.dbd.O)--. In another
embodiment, Z.sup.2 is selected from the group consisting of
(amino)alkyl, (alkylamino)alkyl, and (dialkylamino)alkyl. In
another embodiment, X.sup.2 is absent; and Z.sup.2 is hydrogen. In
another embodiment, R.sup.1a is selected from the group consisting
of hydrogen and methyl.
[0081] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein Y is
--C(.dbd.O)-- and A is selected from the group consisting of
5-indolinyl-2-one and 1,2,3-triazolyl.
[0082] In another embodiment, Compounds of the Disclosure are
compounds having Formula XIV:
##STR00015##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein A, X, and Z are as defined above in
connection with Formula I. In another embodiment, X is selected
from the group consisting of S(.dbd.O).sub.2-- and
--S(.dbd.O).sub.2C(R.sup.4)(H)--. In another embodiment, X is
--S(.dbd.O).sub.2--. In another embodiment, X is
--S(.dbd.O).sub.2CH.sub.2--. In another embodiment, Z is selected
from the group consisting of optionally substituted C.sub.6-14
aryl, optionally substituted 4- to 14-membered heterocyclo, and
optionally substituted C.sub.3-12 cycloalkyl. In another
embodiment, Z is optionally substituted 4- to 14-membered
heterocyclo. In another embodiment, Z is an optionally substituted
piperidinyl, wherein the nitrogen atom is attached to X or the
4-carbon atom is attached to X. In another embodiment, A is
5-indolinyl-2-one that is optionally substituted with one or two
substituents selected from the group consisting of halo, hydroxy,
alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, C.sub.1-6 alkyl, haloalkyl,
and hydroxyalkyl. In another embodiment, A is
6-chloro-5-indolinyl-2-one, i.e.,
##STR00016##
[0083] In another embodiment, a Compound of the Disclosure is
N-((1R,3r,5S)-8-((4-(benzylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.-
2.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide or
6-chloro-2-oxo-N-((1R,3r,5S)-8-(((1-(4,4,4-trifluorobutyl)piperidin-4-yl)-
methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide,
and the pharmaceutically acceptable salts or solvates. e.g.,
hydrates, thereof.
[0084] It will be understood by those of ordinary skill in the art
that compounds having Formula XIV can be drawn in various ways,
e.g.,
##STR00017##
[0085] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates. e.g., hydrates, thereof, wherein A is
1,2,3-triazolyl which may be optionally substituted with one
substituent, and Y is --C(.dbd.O)--.
[0086] In another embodiment. Compounds of the Disclosure are
compounds having having Formula XV:
##STR00018##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0087] R is selected from the group consisting of C.sub.1-6 alkyl
and C.sub.3-12 cycloalkyl;
[0088] B is optionally substituted 4- or 6- to 14-membered
heterocyclenyl, e.g., B is:
##STR00019##
(wherein the nitrogen atom is attached to --X--Z); and
[0089] X and Z are as defined above in connection with Formula I.
In another embodiment, X is absent. In another embodiment, Z is
selected from the group consisting of hydrogen, C.sub.1-6 alkyl,
C.sub.3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl, or Z is
--CH(R.sup.9a)(R.sup.9b). In another embodiment, Z is selected from
the group consisting of aralkyl and (heteroaryl)alkyl. In another
embodiment, Z is (heteroaryl)alkyl that is substituted with an
aralkyl, e.g.,
##STR00020##
or (heteroaryl)alkyl, e.g.,
##STR00021##
In another embodiment, Compounds of the Disclosure are compounds
having having Formula XVI:
##STR00022##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0090] R'' is selected from the group consisting of C.sub.1-6 alkyl
and C.sub.3-12 cycloalkyl;
[0091] B is optionally substituted 4- or 6- to 14-membered
heterocyclenyl, e.g., B is:
##STR00023##
(wherein the nitrogen atom is attached to --X--Z); and
[0092] X and Z are as defined above in connection with Formula I.
In another embodiment, X is absent. In another embodiment, Z is
selected from the group consisting of hydrogen, C.sub.1-6 alkyl,
C.sub.3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl, or Z is
--CH(R.sup.9a)(R.sup.9b). In another embodiment, Z is selected from
the group consisting of aralkyl and (heteroaryl)alkyl. In another
embodiment, Z is (heteroaryl)alkyl that is substituted with an
aralkyl, e.g.,
##STR00024##
or (heteroaryl)alkyl, e.g.,
##STR00025##
[0093] In another embodiment, Compounds of the Disclosure are
compounds having having Formula XVII:
##STR00026##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein A, X, and Z are as defined above in
connection with Formula I. In another embodiment, X is absent. In
another embodiment, Z is selected from the group consisting of
hydrogen. C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl, or Z is --CH(R.sup.9a)(R.sup.9b). In another
embodiment, Z is selected from the group consisting of aralkyl and
(heteroaryl)alkyl. In another embodiment, Z is aralkyl. In another
embodiment, Z is (heteroaryl)alkyl. In another embodiment, Z is
(heteroaryl)alkyl that is substituted with an aralkyl e.g.,
##STR00027##
or (heteroaryl)alkyl, e.g.,
##STR00028##
[0094] In another embodiment, Compounds of the Disclosure are
compounds having having Formula XVIII:
##STR00029##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0095] R''' is selected from the group consisting of aralkyl and
(heteroaryl)alkyl; and
[0096] A is as defined above in connection with Formula I. In
another embodiment. A is selected from the group consisting of
1,2,3-triazolyl, 3-pyridazinyl, 2-pyridyl, and 2-imidazolyl, each
of which is optionally substituted with one substituent selected
from the group consisting of C.sub.1-6 alkyl and C.sub.3-6
cycloalkyl. In another embodiment, A is selected from the group
consisting of:
##STR00030##
In another embodiment, R''' is aralkyl. In another embodiment, R'''
is (heteroaryl)alkyl. In another embodiment, R''' is benzyl wherein
the phenyl group is optionally substituted with one or two
substituents, e.g., --CH.sub.2(4-Cl-Ph), --CH.sub.2(3-Cl-Ph), and
--CH.sub.2(4-CF.sub.3-Ph).
[0097] In another embodiment, Compounds of the Disclosure are
compounds of Table 1, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof. The chemical names of the compounds of
Table 1 are provided in Table 1A.
[0098] In another embodiment, Compounds of the Disclosure are
compounds of Table 3, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof. The chemical names of the compounds of
Table 3 are provided in Table 3A.
[0099] In another embodiment, Compounds of the Disclosure are
compounds of Table 4, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof. The chemical names of the compounds of
Table 4 are provided in Table 4A.
[0100] In another embodiment, Compounds of the Disclosure are
compounds of Table 5, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof.
[0101] In another embodiment, Compounds of the Disclosure are
compounds of Table 6, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof. The chemical names of the compounds of
Table 6 are provided in Table 6A.
[0102] In another embodiment, Compounds of the Disclosure are
compounds of Tables 1, 1A, 3, 3A, 4, 4A, 5, 6 and 6A, and the
pharmaceutically acceptable salts or solvates, e.g., hydrates,
thereof, or different pharmaceutically acceptable salt thereof.
[0103] In another embodiment, Compounds of the Disclosure are
compounds selected from the group consisting of: [0104]
rel-N-{1-[(1S)-1-[2-chloro-3-(2-hydroxyethoxy)phenyl]ethyl]azetidin-3-yl}-
-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide; [0105]
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylpyridazine-3-carboxamide; [0106]
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opylpicolinamide; [0107]
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopr-
opyl-1H-1,2,3-triazole-4-carboxamide; [0108]
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opyl-1H-imidazole-2-carboxamide; and [0109]
1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin--
3-yl)-1H-1,2,3-triazole-4-carboxamide, and the pharmaceutically
acceptable salts or solvates, e.g., hydrates, thereof.
[0110] It should be appreciated that the Compounds of the
Disclosure in certain embodiments are the free base, various salts,
and hydrate forms, and are not limited to the particular salt
listed in Tables 1 and 3-6.
TABLE-US-00001 TABLE 1 Cpd. No. Structure Salt Form 3 ##STR00031##
None 4 ##STR00032## None 5 ##STR00033## None 6 ##STR00034## None 7
##STR00035## 8 ##STR00036## None 9 ##STR00037## None 10
##STR00038## None 11 ##STR00039## HCl 12 ##STR00040## None 13
##STR00041## HCl 14 ##STR00042## HCl 15 ##STR00043## HCl 16
##STR00044## HCl 17 ##STR00045## HCl 18 ##STR00046## TFA 19
##STR00047## TFA 20 ##STR00048## TFA 21 ##STR00049## TFA 22
##STR00050## TFA 23 ##STR00051## HCl 24 ##STR00052## HCl 25
##STR00053## HCl 26 ##STR00054## HCl 27 ##STR00055## HCl 28
##STR00056## HCl 29 ##STR00057## HCl 30 ##STR00058## HCl 31
##STR00059## HCl 32 ##STR00060## HCl 33 ##STR00061## HCl 34
##STR00062## HCl 35 ##STR00063## HCl 36 ##STR00064## HCl 37
##STR00065## HCl 38 ##STR00066## None 39 ##STR00067## None 40
##STR00068## HCl 42 ##STR00069## HCl 43 ##STR00070## HCl 44
##STR00071## TFA 45 ##STR00072## TFA 46 ##STR00073## TFA 47
##STR00074## HCl 48 ##STR00075## HCl 49 ##STR00076## HCl 50
##STR00077## HCl 51 ##STR00078## TFA 52 ##STR00079## HCl 53
##STR00080## HCl 54 ##STR00081## HCl 55 ##STR00082## HCl 56
##STR00083## HCl 57 ##STR00084## HCl 58 ##STR00085## HCl 59
##STR00086## HCl 60 ##STR00087## HCl 61 ##STR00088## HCl 62
##STR00089## HCl 63 ##STR00090## HCl 64 ##STR00091## HCl 65
##STR00092## HCl 66 ##STR00093## HCl 67 ##STR00094## HCl 68
##STR00095## HCl 69 ##STR00096## TFA 70 ##STR00097## TFA 71
##STR00098## TFA 72 ##STR00099## TFA 73 ##STR00100## HCl 74
##STR00101## HCl 75 ##STR00102## HCl 76 ##STR00103## HCl 77
##STR00104## HCl 78 ##STR00105## HCl 79 ##STR00106## HCl 80
##STR00107## HCl 81 ##STR00108## TFA 82 ##STR00109## TFA 83
##STR00110## TFA 84 ##STR00111## TFA 85 ##STR00112## HCl 86
##STR00113## HCl 87 ##STR00114## HCl 88 ##STR00115## TFA 89
##STR00116## TFA 90 ##STR00117## TFA 91 ##STR00118## TFA 92
##STR00119## TFA 93 ##STR00120## HCl 94 ##STR00121## HCl 95
##STR00122## HCl 96 ##STR00123## HCl 97 ##STR00124## HCl 98
##STR00125## HCl 99 ##STR00126## TFA 100 ##STR00127## HCl 101
##STR00128## HCl 102 ##STR00129## HCl 103 ##STR00130## TFA 104
##STR00131## TFA 105 ##STR00132## TFA 106 ##STR00133## TFA 107
##STR00134## TFA 108 ##STR00135## HCl 109 ##STR00136## HCl 110
##STR00137## HCl 111 ##STR00138## HCl 112 ##STR00139## TFA 113
##STR00140## HCl 114 ##STR00141## TFA 115 ##STR00142## TFA 116
##STR00143## TFA 117 ##STR00144## TFA 118 ##STR00145## TFA 119
##STR00146## HCl 120 ##STR00147## TFA 121 ##STR00148## HCOOH 122
##STR00149## TFA 123 ##STR00150## TFA 125 ##STR00151## TFA 126
##STR00152## TFA 127 ##STR00153## TFA
129 ##STR00154## TFA 130 ##STR00155## TFA 131 ##STR00156## HCOOH
132 ##STR00157## TFA 133 ##STR00158## TFA 134 ##STR00159## TFA 135
##STR00160## TFA 136 ##STR00161## HCl 137 ##STR00162## HCl 138
##STR00163## HCl 139 ##STR00164## HCl 140 ##STR00165## HCl 141
##STR00166## HCl 142 ##STR00167## HCl 143 ##STR00168## HCl 144
##STR00169## HCl 145 ##STR00170## HCl 146 ##STR00171## HCl 147
##STR00172## HCl 148 ##STR00173## HCl 149 ##STR00174## HCl 150
##STR00175## HCl 151 ##STR00176## HCl 152 ##STR00177## HCl 153
##STR00178## HCl 154 ##STR00179## HCl 155 ##STR00180## HCl 156
##STR00181## HCl 157 ##STR00182## HCl 158 ##STR00183## HCl 159
##STR00184## HCl 160 ##STR00185## HCl 161 ##STR00186## HCl 162
##STR00187## HCl 163 ##STR00188## HCl 164 ##STR00189## HCl 165
##STR00190## HCl 166 ##STR00191## HCl 167 ##STR00192## HCl 168
##STR00193## HCl 169 ##STR00194## TFA 170 ##STR00195## TFA 171
##STR00196## TFA 172 ##STR00197## TFA 173 ##STR00198## TFA 174
##STR00199## TFA 175 ##STR00200## TFA 176 ##STR00201## HCOOH 177
##STR00202## TFA 178 ##STR00203## TFA 179 ##STR00204## HCl 180
##STR00205## HCl 181 ##STR00206## None 182 ##STR00207## None 183
##STR00208## None 184 ##STR00209## HCl 185 ##STR00210## TFA 186
##STR00211## TFA 187 ##STR00212## HCl 188 ##STR00213## HCl 189
##STR00214## HCl 190 ##STR00215## HCl 191 ##STR00216## HCl 192
##STR00217## HCl 193 ##STR00218## HCl 194 ##STR00219## HCl 195
##STR00220## HCl 196 ##STR00221## TFA 197 ##STR00222## TFA 198
##STR00223## TFA 199 ##STR00224## HCl 200 ##STR00225## TFA 201
##STR00226## TFA 202 ##STR00227## HCl 203 ##STR00228## HCl 204
##STR00229## HCl 205 ##STR00230## HCl 206 ##STR00231## HCl 207
##STR00232## HCl 208 ##STR00233## TFA 209 ##STR00234## HCl 210
##STR00235## HCl 211 ##STR00236## TFA 212 ##STR00237## TFA 213
##STR00238## TFA 214 ##STR00239## TFA 215 ##STR00240## HCl 216
##STR00241## TFA 217 ##STR00242## TFA 218 ##STR00243## TFA 219
##STR00244## TFA 220 ##STR00245## TFA 221 ##STR00246## TFA 222
##STR00247## TFA 223 ##STR00248## TFA 224 ##STR00249## TFA 225
##STR00250## TFA 226 ##STR00251## TFA 227 ##STR00252## TFA 228
##STR00253## TFA 229 ##STR00254## HCl 230 ##STR00255## HCl 231
##STR00256## HCl 232 ##STR00257## HCl 233 ##STR00258## HCl 234
##STR00259## HCl 235 ##STR00260## HCl 236 ##STR00261## TFA 237
##STR00262## TFA 238 ##STR00263## TFA 239 ##STR00264## TFA 241
##STR00265## TFA 242 ##STR00266## None 243 ##STR00267## TFA 244
##STR00268## HCl 245 ##STR00269## HCl 246 ##STR00270## HCl 247
##STR00271## TFA 248 ##STR00272## None 249 ##STR00273## TFA 250
##STR00274## TFA 251 ##STR00275## HCl 252 ##STR00276## HCl 253
##STR00277## TFA 254 ##STR00278## TFA
255 ##STR00279## TFA 256 ##STR00280## TFA 257 ##STR00281## TFA 258
##STR00282## TFA 259 ##STR00283## TFA 260 ##STR00284## TFA 261
##STR00285## TFA 262 ##STR00286## HCl 263 ##STR00287## TFA 264
##STR00288## HCl 265 ##STR00289## TFA 266 ##STR00290## TFA 267
##STR00291## TFA 268 ##STR00292## TFA 269 ##STR00293## HCl 270
##STR00294## HCl 271 ##STR00295## HCl 272 ##STR00296## HCl 273
##STR00297## TFA 274 ##STR00298## TFA 275 ##STR00299## TFA 276
##STR00300## TFA 277 ##STR00301## TFA 278 ##STR00302## TFA 279
##STR00303## TFA 280 ##STR00304## TFA 281 ##STR00305## HCl 283
##STR00306## HCl 284 ##STR00307## TFA 285 ##STR00308## HCl 286
##STR00309## TFA 287 ##STR00310## TFA 288 ##STR00311## None 289
##STR00312## None 290 ##STR00313## None 291 ##STR00314## None 292
##STR00315## None 293 ##STR00316## None 294 ##STR00317## HCl 295
##STR00318## TFA 296 ##STR00319## HCl 297 ##STR00320## HCl 298
##STR00321## HCl 299 ##STR00322## TFA 300 ##STR00323## TFA 301
##STR00324## TFA 302 ##STR00325## TFA 303 ##STR00326## HCl 304
##STR00327## HCl 305 ##STR00328## TFA 306 ##STR00329## TFA 307
##STR00330## TFA 308 ##STR00331## HCl 309 ##STR00332## TFA 310
##STR00333## TFA 311 ##STR00334## TFA 312 ##STR00335## TFA 313
##STR00336## TFA 314 ##STR00337## TFA 315 ##STR00338## TFA 316
##STR00339## TFA 317 ##STR00340## HCl 318 ##STR00341## HCl 319
##STR00342## TFA 320 ##STR00343## None 321 ##STR00344## HCl 322
##STR00345## None 323 ##STR00346## TFA 324 ##STR00347## TFA 325
##STR00348## HCl 326 ##STR00349## HCl 327 ##STR00350## HCl 328
##STR00351## None 329 ##STR00352## HCl 330 ##STR00353## HCl 331
##STR00354## HCl 332 ##STR00355## HCl 333 ##STR00356## None 334
##STR00357## None 335 ##STR00358## None 336 ##STR00359## None 337
##STR00360## None 338 ##STR00361## TFA 339 ##STR00362## None 340
##STR00363## HCl 341 ##STR00364## TFA 342 ##STR00365## TFA 343
##STR00366## TFA 344 ##STR00367## HCl 345 ##STR00368## HCl 346
##STR00369## HCl 347 ##STR00370## HCl 348 ##STR00371## TFA 349
##STR00372## TFA 350 ##STR00373## TFA 351 ##STR00374## HCl 352
##STR00375## HCl 353 ##STR00376## HCl 354 ##STR00377## HCl 355
##STR00378## HCl 356 ##STR00379## HCl 357 ##STR00380## None 358
##STR00381## TFA 359 ##STR00382## TFA 360 ##STR00383## None 361
##STR00384## TFA 362 ##STR00385## TFA 363 ##STR00386## TFA 364
##STR00387## TFA 365 ##STR00388## TFA 366 ##STR00389## TFA 367
##STR00390## TFA 368 ##STR00391## HCl 369 ##STR00392## HCl 370
##STR00393## TFA 371 ##STR00394## TFA 372 ##STR00395## TFA 373
##STR00396## TFA 374 ##STR00397## TFA 375 ##STR00398## TFA 376
##STR00399## TFA 378 ##STR00400## HCl 379 ##STR00401## TFA 380
##STR00402## None 381 ##STR00403## TFA 382 ##STR00404## TFA
383 ##STR00405## TFA 384 ##STR00406## TFA 385 ##STR00407## TFA 386
##STR00408## TFA 387 ##STR00409## TFA 388 ##STR00410## None 389
##STR00411## TFA 390 ##STR00412## HCl 391 ##STR00413## TFA 392
##STR00414## TFA 393 ##STR00415## TFA 394 ##STR00416## None 395
##STR00417## HCl 396 ##STR00418## TFA 397 ##STR00419## TFA 398
##STR00420## TFA 399 ##STR00421## HCl 400 ##STR00422## HCl 401
##STR00423## TFA 402 ##STR00424## TFA 403 ##STR00425## TFA 404
##STR00426## None 405 ##STR00427## None 406 ##STR00428## TFA 407
##STR00429## TFA 408 ##STR00430## TFA 409 ##STR00431## HCl 410
##STR00432## HCl 411 ##STR00433## HCl 412 ##STR00434## TFA 413
##STR00435## TFA 414 ##STR00436## TFA 415 ##STR00437## TFA 416
##STR00438## TFA 417 ##STR00439## TFA 418 ##STR00440## TFA 419
##STR00441## TFA 420 ##STR00442## TFA 421 ##STR00443## TFA 422
##STR00444## TFA 423 ##STR00445## TFA 424 ##STR00446## TFA 425
##STR00447## TFA 426 ##STR00448## TFA 427 ##STR00449## TFA 428
##STR00450## TFA 429 ##STR00451## TFA 430 ##STR00452## HCl 431
##STR00453## TFA 432 ##STR00454## TFA 433 ##STR00455## HCl 434
##STR00456## HCl 435 ##STR00457## HCl 436 ##STR00458## TFA 437
##STR00459## None 438 ##STR00460## TFA 439 ##STR00461## HCl 440
##STR00462## HCl 441 ##STR00463## TFA 442 ##STR00464## HCl 443
##STR00465## HCl 444 ##STR00466## TFA 445 ##STR00467## TFA 446
##STR00468## TFA 447 ##STR00469## TFA 448 ##STR00470## TFA 449
##STR00471## TFA 450 ##STR00472## None 451 ##STR00473## TFA 452
##STR00474## TFA 453 ##STR00475## TFA 454 ##STR00476## TFA 455
##STR00477## None 456 ##STR00478## TFA 457 ##STR00479## TFA 458
##STR00480## None 459 ##STR00481## TFA 460 ##STR00482## TFA 461
##STR00483## TFA 462 ##STR00484## TFA 463 ##STR00485## TFA 464
##STR00486## HCl 465 ##STR00487## TFA 466 ##STR00488## TFA 467
##STR00489## TFA 468 ##STR00490## TFA 469 ##STR00491## TFA 470
##STR00492## TFA 471 ##STR00493## HCl 472 ##STR00494## None 473
##STR00495## TFA 474 ##STR00496## TFA 475 ##STR00497## TFA 476
##STR00498## TFA 477 ##STR00499## TFA 478 ##STR00500## TFA 479
##STR00501## TFA 480 ##STR00502## TFA 481 ##STR00503## TFA 482
##STR00504## TFA 483 ##STR00505## TFA 484 ##STR00506## None 485
##STR00507## None 486 ##STR00508## TFA 487 ##STR00509## TFA 488
##STR00510## TFA 489 ##STR00511## TFA 490 ##STR00512## TFA 491
##STR00513## TFA 492 ##STR00514## None 493 ##STR00515## TFA 494
##STR00516## None 495 ##STR00517## None 496 ##STR00518## TFA 497
##STR00519## TFA 498 ##STR00520## TFA 499 ##STR00521## TFA 500
##STR00522## TFA 501 ##STR00523## TFA 502 ##STR00524## TFA 503
##STR00525## TFA 504 ##STR00526## TFA 505 ##STR00527## TFA 506
##STR00528## TFA 507 ##STR00529## TFA
508 ##STR00530## TFA 509 ##STR00531## TFA 510 ##STR00532## TFA 511
##STR00533## HCl 512 ##STR00534## TFA 513 ##STR00535## None 514
##STR00536## None 515 ##STR00537## TFA 516 ##STR00538## None 517
##STR00539## None 518 ##STR00540## None 519 ##STR00541## TFA 520
##STR00542## TFA 521 ##STR00543## None 522 ##STR00544## None 523
##STR00545## HCl 525 ##STR00546## HCl 527 ##STR00547## TFA 528
##STR00548## TFA 529 ##STR00549## TFA 530 ##STR00550## TFA 531
##STR00551## TFA 532 ##STR00552## TFA 533 ##STR00553## TFA 534
##STR00554## None 535 ##STR00555## None 536 ##STR00556## None 537
##STR00557## None 538 ##STR00558## TFA 539 ##STR00559## None 540
##STR00560## TFA 541 ##STR00561## TFA 542 ##STR00562## None 543
##STR00563## TFA 544 ##STR00564## TFA 545 ##STR00565## TFA 546
##STR00566## TFA 547 ##STR00567## None 548 ##STR00568## TFA 549
##STR00569## TFA 550 ##STR00570## TFA 551 ##STR00571## TFA 552
##STR00572## TFA 553 ##STR00573## TFA 554 ##STR00574## TFA 555
##STR00575## TFA 556 ##STR00576## TFA 557 ##STR00577## HCl 558
##STR00578## HCl 559 ##STR00579## HCl 560 ##STR00580## TFA 561
##STR00581## TFA 562 ##STR00582## TFA 563 ##STR00583## HCl 564
##STR00584## HCl 565 ##STR00585## TFA 566 ##STR00586## TFA 567
##STR00587## HCl 568 ##STR00588## HCl 569 ##STR00589## HCl 570
##STR00590## HCl 571 ##STR00591## HCl 572 ##STR00592## TFA 573
##STR00593## HCl 574 ##STR00594## TFA
TABLE-US-00002 TABLE 3 Cpd. No. Structure Salt Form 575
##STR00595## TFA 576 ##STR00596## None 577 ##STR00597## TFA 578
##STR00598## TFA 579 ##STR00599## HCl 580 ##STR00600## None 581
##STR00601## None 582 ##STR00602## HCl 583 ##STR00603## TFA 584
##STR00604## TFA 585 ##STR00605## TFA 586 ##STR00606## HCl 587
##STR00607## TFA 588 ##STR00608## TFA 589 ##STR00609## HCl 590
##STR00610## None 591 ##STR00611## TFA 592 ##STR00612## TFA 593
##STR00613## None 594 ##STR00614## None 595 ##STR00615## None 596
##STR00616## TFA 597 ##STR00617## HCl 598 ##STR00618## TFA 599
##STR00619## TFA 600 ##STR00620## TFA 601 ##STR00621## HCl 602
##STR00622## None 603 ##STR00623## TFA 604 ##STR00624## TFA 605
##STR00625## HCl 606 ##STR00626## None 607 ##STR00627## HCl 608
##STR00628## TFA 609 ##STR00629## HCl 610 ##STR00630## HCl 611
##STR00631## TFA 612 ##STR00632## TFA 613 ##STR00633## TFA 614
##STR00634## None 615 ##STR00635## None 616 ##STR00636## TFA 617
##STR00637## TFA 618 ##STR00638## HCl 619 ##STR00639## TFA 620
##STR00640## TFA 621 ##STR00641## TFA 622 ##STR00642## TFA 623
##STR00643## None 624 ##STR00644## None 625 ##STR00645## HCl 626
##STR00646## HCl 627 ##STR00647## HCl 628 ##STR00648## HCl 629
##STR00649## None 630 ##STR00650## None 631 ##STR00651## HCl 632
##STR00652## None 633 ##STR00653## None 634 ##STR00654## None 635
##STR00655## HCl 636 ##STR00656## HCl 637 ##STR00657## None 638
##STR00658## TFA 639 ##STR00659## None 640 ##STR00660## TFA 641
##STR00661## None 642 ##STR00662## HCl 643 ##STR00663## None 644
##STR00664## HCl
TABLE-US-00003 TABLE 4 Cpd. No. Structure Salt Form 645
##STR00665## None 646 ##STR00666## None 647 ##STR00667## None 648
##STR00668## None 649 ##STR00669## None 650 ##STR00670## None 651
##STR00671## None 652 ##STR00672## None 657 ##STR00673## None 659
##STR00674## None 660 ##STR00675## None 661 ##STR00676## None 662
##STR00677## None 663 ##STR00678## None 664 ##STR00679## None 665
##STR00680## None 666 ##STR00681## None 667 ##STR00682## None 668
##STR00683## None 669 ##STR00684## None 670 ##STR00685## None 671
##STR00686## None 672 ##STR00687## None 673 ##STR00688## None 674
##STR00689## None 675 ##STR00690## None 676 ##STR00691## None 677
##STR00692## None 678 ##STR00693## None 679 ##STR00694## None 680
##STR00695## None 681 ##STR00696## None 682 ##STR00697## None 683
##STR00698## None 684 ##STR00699## None 685 ##STR00700## None 686
##STR00701## None 687 ##STR00702## None 688 ##STR00703## None 689
##STR00704## None 690 ##STR00705## None 691 ##STR00706## None 692
##STR00707## None 693 ##STR00708## None 694 ##STR00709## None 695
##STR00710## None 696 ##STR00711## None 697 ##STR00712## None 698
##STR00713## None 699 ##STR00714## None 700 ##STR00715## None 701
##STR00716## None 702 ##STR00717## None 703 ##STR00718## None 704
##STR00719## None 705 ##STR00720## None 706 ##STR00721## None 707
##STR00722## None 708 ##STR00723## None 709 ##STR00724## None 710
##STR00725## None 711 ##STR00726## None 712 ##STR00727## None 713
##STR00728## None 714 ##STR00729## None 715 ##STR00730## None 716
##STR00731## None 717 ##STR00732## None 718 ##STR00733## None 719
##STR00734## None 720 ##STR00735## None 721 ##STR00736## None 722
##STR00737## None 723 ##STR00738## None 724 ##STR00739## None 725
##STR00740## None 726 ##STR00741## None 727 ##STR00742## None 728
##STR00743## None 729 ##STR00744## None 730 ##STR00745## None 731
##STR00746## None 732 ##STR00747## None 733 ##STR00748## None 734
##STR00749## None 735 ##STR00750## None 736 ##STR00751## None 737
##STR00752## None 738 ##STR00753## None 739 ##STR00754## None 740
##STR00755## None 741 ##STR00756## None 742 ##STR00757## None 743
##STR00758## None 744 ##STR00759## None 745 ##STR00760## None 746
##STR00761## None 747 ##STR00762## None 748 ##STR00763## None 749
##STR00764## None 750 ##STR00765## None 751 ##STR00766## None 752
##STR00767## None 753 ##STR00768## None 754 ##STR00769## None 755
##STR00770## None 756 ##STR00771## None 757 ##STR00772## None 758
##STR00773## None 759 ##STR00774## None 760 ##STR00775## None 761
##STR00776## None 762 ##STR00777## None 763 ##STR00778## None 764
##STR00779## None 765 ##STR00780## None 766 ##STR00781## None 767
##STR00782## None 768 ##STR00783## None 769 ##STR00784## None 770
##STR00785## None 771 ##STR00786## None 772 ##STR00787## None
773 ##STR00788## None 774 ##STR00789## None 775 ##STR00790## None
776 ##STR00791## None 777 ##STR00792## None 778 ##STR00793## None
779 ##STR00794## None 780 ##STR00795## None 781 ##STR00796## None
782 ##STR00797## None 783 ##STR00798## None 784 ##STR00799## None
785 ##STR00800## None 786 ##STR00801## None 787 ##STR00802## None
788 ##STR00803## None 789 ##STR00804## None 790 ##STR00805## None
791 ##STR00806## None 792 ##STR00807## None 793 ##STR00808## None
794 ##STR00809## None 795 ##STR00810## None 796 ##STR00811## None
797 ##STR00812## None 798 ##STR00813## None 799 ##STR00814## None
800 ##STR00815## None 801 ##STR00816## None 802 ##STR00817## None
803 ##STR00818## None 804 ##STR00819## None 805 ##STR00820## None
806 ##STR00821## None 807 ##STR00822## None 808 ##STR00823## None
809 ##STR00824## None 810 ##STR00825## None 811 ##STR00826## None
812 ##STR00827## None 813 ##STR00828## None 814 ##STR00829## None
815 ##STR00830## None 816 ##STR00831## None 817 ##STR00832## None
818 ##STR00833## None 819 ##STR00834## None 820 ##STR00835## None
821 ##STR00836## None 822 ##STR00837## None 823 ##STR00838## None
824 ##STR00839## None 825 ##STR00840## None 826 ##STR00841## None
827 ##STR00842## None 828 ##STR00843## None 829 ##STR00844## None
830 ##STR00845## None 831 ##STR00846## None 832 ##STR00847## None
833 ##STR00848## None 834 ##STR00849## None 835 ##STR00850## None
836 ##STR00851## None 837 ##STR00852## None 838 ##STR00853## None
839 ##STR00854## None 840 ##STR00855## None 841 ##STR00856## None
842 ##STR00857## None 843 ##STR00858## None 844 ##STR00859## None
845 ##STR00860## None 846 ##STR00861## None 847 ##STR00862## None
848 ##STR00863## None 849 ##STR00864## None 850 ##STR00865## None
851 ##STR00866## None 852 ##STR00867## None 853 ##STR00868## None
854 ##STR00869## None 855 ##STR00870## None 856 ##STR00871## None
857 ##STR00872## None 858 ##STR00873## None 859 ##STR00874## None
860 ##STR00875## None 861 ##STR00876## None 862 ##STR00877## None
863 ##STR00878## None 864 ##STR00879## None 865 ##STR00880## None
866 ##STR00881## None 867 ##STR00882## None 868 ##STR00883## None
869 ##STR00884## None 913 ##STR00885## None 914 ##STR00886## None
915 ##STR00887## None 916 ##STR00888## None 917 ##STR00889## None
918 ##STR00890## None
TABLE-US-00004 TABLE 5 Cpd. No. Structure Chemical Name 870
##STR00891## (R)-1-cyclopropyl-N-(1-(1- (2-methoxyphenyl)ethyl)
azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide 871 ##STR00892##
1-cyclopropyl-N-(1-(5- methoxy-1,2,3,4- tetrahydronaphthalen-1-
yl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide 872 ##STR00893##
1-cyclopropyl-N-(1-(1- methylpiperidin-2-yl)ethyl)-
1H-1,2,3-triazole-4- carboxamide 873 ##STR00894##
5-cyclopropyl-N-(1-(1- methylpiperidin-2- yl)ethyl)pyridazine-3-
carboxamide 874 ##STR00895## N-(1-(2-(4- (benzyloxy)phenyl)propan-
2-yl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
875 ##STR00896## N-(1-(1-(4- (benzyloxy)phenyl)
cyclopropyl)azetidin-3-yl)- 1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 876 ##STR00897## 1-cyclopropyl-N-(1-(4-(1-
hydroxy-2- phenylethyl)benzyl) azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 877 ##STR00898## 1-cyclopropyl-N-(1-(4-
(pyridin-3- ylmethoxy)benzyl)azetidin- 3-yl)-1H-1,2,3-triazole-4-
carboxamide 878 ##STR00899## N-(1-(4-((1,3,4-thiadiazol-2-
yl)methoxy)benzyl)azetidin- 3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide 879 ##STR00900## 1-cyclopropyl-N-(1-
isopropylazetidin-3-yl)-1H- imidazole-4-carboxamide 880
##STR00901## 1-cyclopropyl-N-(3- (dimethylamino)propyl)-1H-
1,2,3-triazole-4-carboxamide 881 ##STR00902##
N-(1-(1-(4-(benzyloxy)-3- methoxyphenyl)ethyl)azetidin-
3-yl)-1-cyclopropyl-1H-1,2,3- triazole-4-carboxamide 882
##STR00903## N-(1-(1-(3-(2-chlorophenyl)- 1H-indazol-5-
yl)ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 883 ##STR00904## 1-cyclopropyl-N-(1-(1-(5-
methoxypyridin-2- yl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 884 ##STR00905##
1-cyclopropyl-N-(1-(1-(2- methyl-2H-indazol-5-
yl)ethyl)azetidin-3-yl)-1H- 1,2,3-triazole-4-carboxamide 885
##STR00906## 5-cyclopropyl-N-(1-(1-(3-
methoxyphenyl)ethyl)azetidin- 3-yl)pyridazine-3- carboxamide 886
##STR00907## N-(1-(1-(5-chloro-2- (difluoromethoxy)phenyl)
ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 887 ##STR00908## 1-cyclopropyl-N-(1-(1-(4-
(phenoxymethyl)phenyl) ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 888 ##STR00909##
N-(1-(1-(3-(2-aminoethoxy)-2- chlorophenyl)ethyl)azetidin-3-
yl)-1-cyclopropyl-1H-1,2,3- triazole-4-carboxamide 889 ##STR00910##
N-(1-(1-(2-chloro-3-(2- (methylamino)ethoxy)
phenyl)ethyl)azetidin-3-yl)- 1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 890 ##STR00911## N-(1-(1-(2-chloro-3-(2-
(dimethylamino)ethoxy) phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3- triazole-4-carboxamide 891 ##STR00912##
N-(1-(1-(2-chloro-3-(2- hydroxypropoxy)phenyl)
ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 892 ##STR00913## N-(1-(1-(2-chloro-3-(2-
hydroxy-2- methylpropoxy)phenyl) ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3- triazole-4-carboxamide 893 ##STR00914##
N-(1-(1-(2-chloro-3-(2,3- dihydroxypropoxy)phenyl)
ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 894 ##STR00915## N-(1-(1-(2-chloro-5-
methoxyphenyl)ethyl) azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4- carboxamide 895 ##STR00916##
N-(1-(1-(5-chloro-2- (trifluoromethyl)phenyl)
ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 896 ##STR00917##
1-cyclopropyl-N-(1-(1-(4-((4- methylbenzyl)oxy)phenyl)
ethyl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide 897
##STR00918## N-(1-(bicyclo[2.2.2]octan-1-
ylmethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 898 ##STR00919## 1-cyclopropyl-N-(1-((4-
methoxybicyclo[2.2.2]octan- 1-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4- carboxamide 899 ##STR00920##
1-cyclopropyl-N-(2,2- dimethyl-1-(1- phenylethyl)azetidin-3-yl)-
1H-1,2,3-triazole-4- carboxamide 900 ##STR00921##
1-cyclopropyl-N-(1- (piperidin-2-yl)ethyl)-1H-
1,2,3-triazole-4-carboxamide 901 ##STR00922## 5-cyclopropyl-N-(1-
(piperidin-2- yl)ethyl)pyridazine-3- carboxamide 902 ##STR00923##
5-cyclopropyl-N-(8-methyl- 8-azabicyclo[3.2.1]octan-3-
yl)pyridazine-3-carboxamide 903 ##STR00924##
1-cyclopropyl-N-(1-(1-(4- (2,2,2- trifluoroethoxy)phenyl)
ethyl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide 904
##STR00925## 1-cyclopropyl-N-(1-(1-(4- (piperidin-4-
ylmethoxy)phenyl)ethyl) azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 905 ##STR00926## 1-cyclopropyl-N-(1-(1-(6-
oxo-1,6-dihydropyridin-3- yl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 906 ##STR00927##
N-(1-(1-(5-chloro-2-(4- fluorophenoxy)phenyl)
ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 907 ##STR00928## N-(1-(1-(4-((4-
acetamidobenzyl)oxy) phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3- triazole-4-carboxamide 908 ##STR00929##
1-cyclopropyl-N-(1-(1-(4- ((phenylamino)methyl)
phenyl)ethyl)azetidin-3-yl)- 1H-1,2,3-triazole-4- carboxamide 909
##STR00930## 1-cyclopropyl-N-(1-(2,2,2- trifluoro-1-(4-
fluorophenyl)ethyl)azetidin- 3-yl)-1H-1,2,3-triazole-4- carboxamide
910 ##STR00931## N-(1-(1-(4-chlorophenyl)-
2,2,2-trifluoroethyl)azetidin- 3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide 911 ##STR00932##
1-cyclopropyl-N-(1-(2,2,2- trifluoro-1-(m-tolyl)ethyl)
azetidin-3-yl)-1H- 1,2,3-triazole-4-carboxamide 912 ##STR00933##
1-cyclopropyl-N-(1-(2,2,2- trifluoro-1-(3-
fluorophenyl)ethyl)azetidin- 3-yl)-1H-1,2,3-triazole-4-
carboxamide
TABLE-US-00005 TABLE 6 Cpd. Salt No. Structure Form 919
##STR00934## none 920 ##STR00935## none 921 ##STR00936## none 922
##STR00937## none 923 ##STR00938## none 924 ##STR00939## none 925
##STR00940## none 926 ##STR00941## none 927 ##STR00942## none 928
##STR00943## none 929 ##STR00944## none 930 ##STR00945## none 931
##STR00946## none 932 ##STR00947## none 933 ##STR00948## none 934
##STR00949## none 935 ##STR00950## none 936 ##STR00951## none 937
##STR00952## none 938 ##STR00953## none 939 ##STR00954## none 940
##STR00955## none 941 ##STR00956## none 942 ##STR00957## none 943
##STR00958## none 944 ##STR00959## none 945 ##STR00960## none 946
##STR00961## none 947 ##STR00962## none 948 ##STR00963## none 949
##STR00964## none 950 ##STR00965## none 951 ##STR00966## none 952
##STR00967## none 953 ##STR00968## none 954 ##STR00969## none 955
##STR00970## none 956 ##STR00971## none 957 ##STR00972## none 958
##STR00973## none 959 ##STR00974## none 960 ##STR00975## none 961
##STR00976## none 962 ##STR00977## none 963 ##STR00978## none 964
##STR00979## none 965 ##STR00980## none 966 ##STR00981## none 967
##STR00982## none 968 ##STR00983## none 969 ##STR00984## none 970
##STR00985## none 971 ##STR00986## none 972 ##STR00987## none 973
##STR00988## none 974 ##STR00989## none 975 ##STR00990## none 976
##STR00991## none 977 ##STR00992## none 978 ##STR00993## none 979
##STR00994## none 980 ##STR00995## none 981 ##STR00996## none 982
##STR00997## none 983 ##STR00998## none 984 ##STR00999## none 985
##STR01000## none 986 ##STR01001## none 987 ##STR01002## none 988
##STR01003## none 989 ##STR01004## none 990 ##STR01005## none 991
##STR01006## none 992 ##STR01007## none 993 ##STR01008## none 994
##STR01009## none 995 ##STR01010## none 996 ##STR01011## none 997
##STR01012## none 998 ##STR01013## none 999 ##STR01014## none 1000
##STR01015## none 1001 ##STR01016## none 1002 ##STR01017## none
1003 ##STR01018## none 1004 ##STR01019## none 1005 ##STR01020##
none 1006 ##STR01021## none 1007 ##STR01022## none 1008
##STR01023## none 1009 ##STR01024## none 1012 ##STR01025## none
1017 ##STR01026## none 1020 ##STR01027## none 1021 ##STR01028##
none 1022 ##STR01029## none 1023 ##STR01030## none 1024
##STR01031## none 1025 ##STR01032## none 1026 ##STR01033## none
1028 ##STR01034## none
TABLE-US-00006 TABLE 1A SMYD3 SMYD3 Biochem Cell Cpd. LCMS
IC.sub.50 IC.sub.50 No. Chemical Name M + H (.mu.M)* (.mu.M)* 3
N-(1-((4- 403.2 >100 acetamidophenyl)sulfonyl)piperidin-4-
yl)nicotinamide 4 N-(1-((4- 403.2 >100
acetamidophenyl)sulfonyl)piperidin-4- yl)isonicotinamide 5
N-(1-((4- 404.2 >100 acetamidophenyl)sulfonyl)piperidin-4-
yl)pyrazine-2-carboxamide 6 N-(1-((4- 392.3 >100
acetamidophenyl)sulfonyl)piperidin-4-yl)- 1H-pyrazole-3-carboxamide
7 N-(1-((4- 406.3 >100
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
methyl-1H-pyrazole-5-carboxamide 8 N-(1-((4- 406.3 >100
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
methyl-1H-pyrazole-4-carboxamide 9 N-(1-((4- 406.3 60.5
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
methyl-1H-imidazole-4-carboxamide 10 N-(1-((4- 433.2 16.98
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 11
N-((1r,4r)-4-aminocyclohexyl)-1- 250 15.37
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 12 N-(1-((4- 463 45.94
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
(cyclopropylmethyl)piperidine-4- carboxamide 13
N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H- 237.1 112.37
pyrazole-3-carboxamide 14 N-((1r,4r)-4-aminocyclohexyl)-3- 238.15
104.43 ethylisoxazole-5-carboxamide 15
N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H- 237.1 56.59
imidazole-4-carboxamide 16 N-((1r,4r)-4-aminocyclohexyl)-2- NA
128.43 ethyloxazole-4-carboxamide 17
N-((1r,4r)-4-aminocyclohexyl)-5- 254.1 13.52
ethylisothiazole-3-carboxamide 18 N-((1r,4r)-4-aminocyclohexyl)-4-
247.1 125.3 ethylbenzamide 19
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4- 289.9 102.25
dihydro-2H-benzo[b][1,4]oxazine-7- carboxamide 20
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4- 289.8 16.03
dihydro-2H-benzo[b][1,4]oxazine-6- carboxamide 21
N-((1r,4r)-4-aminocyclohexyl)-3- 247.3 57.46 ethylbenzamide 22
N-((1r,4r)-4-aminocyclohexyl)-5- 247.9 31.29 ethylnicotinamide 23
3-acetyl-N-((1r,4r)-4- 261.2 91.55 aminocyclohexyl)benzamide 24
3-acetamido-N-((1r,4r)-4- 276.2 80.28 aminocyclohexyl)benzamide 25
N-((1r,4r)-4-aminocyclohexyl)-3- 290.2 84.27 propionamidobenzamide
26 N-((1r,4r)-4-aminocyclohexyl)-3- 248.9 86.01
(hydroxymethyl)benzamide 27
N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-3- 251.2 101.58
methyl-1H-pyrazole-5-carboxamide 28
N-((1r,4r)-4-aminocyclohexyl)-3-methyl-1- 299.25 110.89
phenyl-1H-pyrazole-5-carboxamide 29
N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3- 313.2 13.99
methyl-1H-pyrazole-5-carboxamide 30
1-ethyl-3-methyl-N-(phenyl(piperidin-4- 327.15 69.19
yl)methyl)-1H-pyrazole-5-carboxamide 31
3-methyl-1-phenyl-N-(phenyl(piperidin-4- 375.2 56.66
yl)methyl)-1H-pyrazole-5-carboxamide 32
1-benzyl-3-methyl-N-(phenyl(piperidin-4- 389.25 91.27
yl)methyl)-1H-pyrazole-5-carboxamide 33
N-(4-(aminomethyl)phenyl)-6- 228.05 130.63
hydroxypyridazine-3-carboxamide (-NH.sub.2) 34
N-(4-(aminomethyl)phenyl)-1-methyl-3- 282.1 153.36
(trifluoromethyl)-1H-pyrazole-5- (-NH.sub.2) carboxamide 35
N-(4-(aminomethyl)phenyl)-1-ethyl-3- 242.05 124.89
methyl-1H-pyrazole-5-carboxamide (-NH.sub.2) 36
N-(4-(aminomethyl)phenyl)-3-methyl-1- 290.15 123.93
phenyl-1H-pyrazole-5-carboxamide (-NH.sub.2) 37
N-((1r,4r)-4-aminocyclohexyl)-3-ethyl-1- 251.34 59.91
methyl-1H-pyrazole-5-carboxamide 38
N-((1r,4r)-4-aminocyclohexyl)-4- 248 20.5 ethylpicolinamide 39
2-oxo-N-(piperidin-4-yl)-1,2,3,4- 274.9 23.86
tetrahydroquinoxaline-6-carboxamide 40
N-((1r,4r)-4-aminocyclohexyl)-2- 274.1 2.84
oxoindoline-5-carboxamide 42 N-((1r,4r)-4-aminocyclohexyl)-2- 274.2
3.31 oxoindoline-5-carboxamide 43 N-((1r,4r)-4-aminocyclohexyl)-2-
287 60.36 hydroxyquinoxaline-6-carboxamide 44
2-oxo-N-(phenyl(piperidin-4- 350.25 14.08
yl)methyl)indoline-5-carboxamide 45
5-amino-N-(phenyl(piperidin-4-yl)methyl)- 300.25 137.24
1H-pyrazole-3-carboxamide 46 3-oxo-N-(piperidin-4-yl)-3,4- 272.9
63.74 dihydroquinoxaline-6-carboxamide 47
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 274.8 11.94
dihydro-1H-pyrrolo[2,3-b]pyridine-5- carboxamide 48
3-amino-N-((1r,4r)-4-aminocyclohexyl)-1- 237.9 117.12
methyl-1H-pyrazole-5-carboxamide 49
N-(1-(L-tyrosyl)piperidin-4-yl)-2- 423.3 0.86
oxoindoline-5-carboxamide 50 2-oxo-N-(piperidin-4-yl)indoline-5-
260.2 12.15 carboxamide 51 N-(1-(L-tryptophyl)piperidin-4-yl)-2-
446.4 0.69 oxoindoline-5-carboxamide 52
N-(4-(aminomethyl)phenyl)-4-propionyl-1H- 272.2 107.67
pyrrole-2-carboxamide 53 N-((1r,4r)-4-aminocyclohexyl)-2- 239.3
121.58 butylcyclopropane-1-carboxamide 54
N-((1r,4r)-4-aminocyclohexyl)-5- 253.4 49.88
ethylthiophene-2-carboxamide 55 5-ethyl-N-(phenyl(piperidin-4-
329.2 116.27 yl)methyl)thiophene-2-carboxamide 56
N-(4-(aminomethyl)phenyl)-5- 261.1 138.14
ethylthiophene-2-carboxamide 57
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-4H- 261.7 134.08
furo[3,2-b]pyrrole-5-carboxamide 58
2-methyl-N-(piperidin-4-yl)-4H-furo[3,2- 248.1 76.14
b]pyrrole-5-carboxamide 59 N-((1r,4r)-4-aminocyclohexyl)-2- 254.5
184.11 ethylthiazole-5-carboxamide 60
2-ethyl-N-(phenyl(piperidin-4- 330.3 149.92
yl)methyl)thiazole-5-carboxamide 61
N-(4-(aminomethyl)phenyl)-2-ethylthiazole- 261.9 113.72
5-carboxamide 62 N-((1r,4r)-4-aminocyclohexyl)-3- 225.6 155.29
cyclopropylbutanamide 63 3-cyclopropyl-N-(phenyl(piperidin-4- 301.3
131.22 yl)methyl)butanamide 64
4-acetyl-N-((1r,4r)-4-aminocyclohexyl)-1H- 250.2 134.14
pyrrole-2-carboxamide 65 4-acetyl-N-(piperidin-4-yl)-1H-pyrrole-2-
236 45.83 carboxamide 66 4-acetyl-N-(4-(aminomethyl)phenyl)-1H-
258.2 60.87 pyrrole-2-carboxamide 67
N-((1r,4r)-4-aminocyclohexyl)-3-hydroxy-1- 238.8 129.1
methyl-1H-pyrazole-5-carboxamide 68
2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H- 261 86.06
pyrrolo[2,3-b]pyridine-5-carboxamide 69
3-hydroxy-1-methyl-N-(piperidin-4-yl)-1H- 225 19.72
pyrazole-5-carboxamide 70 N-((1r,4r)-4-aminocyclohexyl)-3-oxo- 289
77.47 1,2,3,4-tetrahydroquinoxaline-6-carboxamide 71
N-((1r,4r)-4-aminocyclohexyl)-2- 274.2 89.26
oxoindoline-6-carboxamide 72 N-(1-(L-tyrosyl)piperidin-4-yl)-2-
423.5 35.48 oxoindoline-6-carboxamide 73
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 275.1 13.7
dihydro-1H-benzo[d]imidazole-5- carboxamide 74
N-((1r,4r)-4-aminocyclohexyl)-2-oxo- NA 65.8
1,2,3,4-tetrahydroquinoline-6-carboxamide 75
6-amino-N-((1r,4r)-4-aminocyclohexyl)-2- 284.15 62.5 naphthamide 76
N-((1r,4r)-4-aminocyclohexyl)-2- 286.2 115.32
hydroxyquinoline-6-carboxamide 77
N-(phenyl(piperidin-4-yl)methyl)-4- 340.2 10.04
propionyl-1H-pyrrole-2-carboxamide 78
N-((1r,4r)-4-aminocyclohexyl)-2- 263.4 35.19
(ethylsulfonyl)propanamide 79 N-((1r,4r)-4-aminocyclohexyl)-5- 266
38.86 ((dimethylamino)methyl)furan-2- carboxamide 80
2-amino-N-(phenyl(piperidin-4- 301.4 97.11
yl)methyl)oxazole-4-carboxamide 81
N-(4-(aminomethyl)phenyl)-2-methyl-4H- 270.4 25.9
furo[3,2-b]pyrrole-5-carboxamide 82
N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2- 437.3 8.7
oxoindoline-5-carboxamide 83
N-(1-(L-tryptophyl)piperidin-4-yl)-1-methyl- 460.3 12.94
2-oxoindoline-5-carboxamide 84
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-2- 288.2 16.66
oxoindoline-5-carboxamide 85
N-((1r,4r)-4-aminocyclohexyl)-8-methoxy-3- NA 184.09
oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6- carboxamide 86
N-(1-(1-(1-alanyl)piperidin-4-yl)ethyl)-2- 359.25 1.43
oxoindoline-5-carboxamide 87
N-(1-(1-(D-alanyl)piperidin-4-yl)ethyl)-2- 359.2 9.37
oxoindoline-5-carboxamide 88
N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2- 193.28
oxoindoline-6-carboxamide 89
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 258.89 140.17
dihydrobenzo[d]oxazole-5-carboxamide (-NH.sub.2) 90
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 276.15 9.76
dihydrobenzo[d]oxazole-6-carboxamide 91
N-((1r,4r)-4-aminocyclohexyl)-2-oxo- 288.15 89.47
1,2,3,4-tetrahydroquinoline-7-carboxamide 92
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 373.2 49.95
oxo-1,2,3,4-tetrahydroquinoline-7- carboxamide 93
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 360.25 6.76
oxo-2,3-dihydro-1H-benzo[d]imidazole-5- carboxamide 94
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 361.25 3.94
oxo-2,3-dihydrobenzo[d]oxazole-6- carboxamide 95
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 372.3 149.61
oxo-2H-chromene-6-carboxamide 96
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 373.3 192.59
oxo-1,2,3,4-tetrahydroquinoline-6- carboxamide 97
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 369.3 145.77
amino-2-naphthamide 98 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-8-
405.25 150.97 methoxy-3-oxo-3,4-dihydro-2H-
benzo[b][1,4]oxazine-6-carboxamide 99
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 372.3 35.73
hydroxyquinoxaline-6-carboxamide 100
2-oxo-N-(piperidin-4-ylmethyl)indoline-5- 274.1 20.04 carboxamide
101 (S)-2-oxo-N-(pyrrolidin-3-ylmethyl)indoline- 260.1 25.36
5-carboxamide 102 N-((1-(L-tyrosyl)piperidin-4-yl)methyl)-2- 437.45
1.86 oxoindoline-5-carboxamide 103
N-((1-(L-tryptophyl)piperidin-4-yl)methyl)- 460.25 2.74
2-oxoindoline-5-carboxamide 104 ethyl
2-(1-(L-alanyl)piperidin-4-yl)-2-(2- 417.3 1.51
oxoindoline-5-carboxamido)acetate 105
N-((4-hydroxypiperidin-4-yl)methyl)-2- 290.2 40.39
oxoindoline-5-carboxamide 106 N-(4-aminobutyl)-2-oxoindoline-5-
248.2 13.42 carboxamide 107 (S)-N-(4-(2-aminopropanamido)butyl)-2-
319.3 13.95 oxoindoline-5-carboxamide 108 ethyl
5-(((1r,4r)-4-aminocyclohexyl)amino)- 257.3 92.19 5-oxopentanoate
109 2-methyl-N-(phenyl(piperidin-4-yl)methyl)- 330.5 79.04
3-(pyrrolidin-1-yl)propanamide 110
2-methyl-N-(phenyl(piperidin-4-yl)methyl)- 338.7 82.75
4H-furo[3,2-b]pyrrole-5-carboxamide 111
N-((1r,4r)-4-aminocyclohexyl)-2- 240.1 149.59
ethylpyrrolidine-2-carboxamide 112
N-((1-(L-alanyl)-4-hydroxypiperidin-4- 361.15 3.04
yl)methyl)-2-oxoindoline-5-carboxamide 113
N-((1-(L-alanyl)-4-fluoropiperidin-4- 363.25 3.86
yl)methyl)-2-oxoindoline-5-carboxamide
114 (R)-N-(4-(2-aminopropanamido)butyl)-2- 319.15 22.28
oxoindoline-5-carboxamide 115
N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4- 290 61.18
dihydro-2H-benzo[b][1,4]oxazine-8- carboxamide 116
N-((1r,4r)-4-aminocyclohexyl)-5- 296.13/298.13 51 bromonicotinamide
117 N-((1r,4r)-4-aminocyclohexyl)-5- 254.2 86.99 chloronicotinamide
118 N-((1r,4r)-4- 276.2 139.34 aminocyclohexyl)benzo[d]thiazole-6-
carboxamide 119 N-((1r,4r)-4-aminocyclohexyl)-2- 115.79
hydroxyquinoline-7-carboxamide 120
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 371.2 86.89
hydroxyquinoline-7-carboxamide 121
N-((4-methylpiperidin-4-yl)methyl)-2- 288.15 65.69
oxoindoline-5-carboxamide 122 ethyl
2-(2-oxoindoline-5-carboxamido)-2- 346.3 42.26
(piperidin-4-yl)acetate 123 6-amino-N-((1r,4r)-4- 235 107.83
aminocyclohexyl)nicotinamide 125
N-((1r,4r)-4-aminocyclohexyl)-7-fluoro-2- 304.7 91.68
hydroxyquinoline-4-carboxamide 126
N-((1r,4r)-4-aminocyclohexyl)-2-chloro-5- 320.1 31.99
(4H-1,2,4-triazol-4-yl)benzamide 127
N-((1r,4r)-4-aminocyclohexyl)-4H-1,2,4- 210.1 16.44
triazole-3-carboxamide 129
N-((1r,4r)-4-aminocyclohexyl)-2-(pyridin-3- 234.1 >100
yl)acetamide 130 N-(4-(3-aminopropanamido)cyclohexyl)-2- 345.1 0.29
oxoindoline-5-carboxamide 131 ethyl 4-((2-oxoindoline-5- 346.2
56.28 carboxamido)methyl)piperidine-4- carboxylate 132 ethyl
1-(L-alanyl)-4-((2-oxoindoline-5- 417.2 0.94
carboxamido)methyl)piperidine-4- carboxylate 133
N-(((S)-1-(D-alanyl)pyrrolidin-3-yl)methyl)- 331.15 10.67
2-oxoindoline-5-carboxamide 134
N-(((S)-1-(L-alanyl)pyrrolidin-3-yl)methyl)- 331.15 10.2
2-oxoindoline-5-carboxamide 135
N-(((R)-1-(L-alanyl)pyrrolidin-3-yl)methyl)- 331.1 13.62
2-oxoindoline-5-carboxamide 136 N-((1r,4r)-4-(3- 372.2 >100
aminopropanamido)cyclohexyl)-4-(5-methyl-
1,2,4-oxadiazol-3-yl)benzamide 137
N-((1r,4r)-4-aminocyclohexyl)-4-(5-methyl- 301.1 46.61
1,2,4-oxadiazol-3-yl)benzamide 138 N-(1-(1-(L-alanyl)piperidin-4-
305.2 >100 yl)ethyl)isonicotinamide 139 N-((1r,4r)-4-(3- 291.2
>100 aminopropanamido)cyclohexyl)isonicotinamide 140
N-((1r,4r)-4- 220.2 >100 aminocyclohexyl)isonicotinamide 141
N-(1-(1-(L-alanyl)piperidin-4- 305.2 >100 yl)ethyl)nicotinamide
142 N-((1r,4r)-4-(3- 291.2 >100
aminopropanamido)cyclohexyl)nicotinamide 143
N-((1r,4r)-4-aminocyclohexyl)nicotinamide 220.2 >100 144
N-(1-(1-(L-alanyl)piperidin-4- 306.2 >100
yl)ethyl)pyrimidine-2-carboxamide 145 N-((1r,4r)-4-(3- 292.2
>100 aminopropanamido)cyclohexyl)pyrimidine- 2-carboxamide 146
N-(1-(1-(L-alanyl)piperidin-4- 348.2 >100
yl)ethyl)benzo[d][1,3]dioxole-5-carboxamide 147 N-((1r,4r)-4-(3-
334.2 98.15 aminopropanamido)cyclohexyl)benzo[d][1,3]
dioxole-5-carboxamide 148 N-((1r,4r)-4- 263.1 >100
aminocyclohexyl)benzo[d][1,3]dioxole-5- carboxamide 149
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 382.2 >100
(methylsulfonyl)benzamide 150 N-((1r,4r)-4-(3- 368.2 >100
aminopropanamido)cyclohexyl)-3- (methylsulfonyl)benzamide 151
N-((1r,4r)-4-aminocyclohexyl)-3- 297.1 >100
(methylsulfonyl)benzamide 152 3-amino-N-((1r,4r)-4-(3- 307.2
>100 aminopropanamido)cyclohexyl)pyrazine-2- carboxamide 153
3-amino-N-((1r,4r)-4- 236.2 >100
aminocyclohexyl)pyrazine-2-carboxamide 154 N-((1r,4r)-4-(3- 366.1
37.31 aminopropanamido)cyclohexyl)-[1,1'- biphenyl]-4-carboxamide
155 N-((1r,4r)-4-aminocyclohexyl)-[1,1'- 295.1 79.21
biphenyl]-4-carboxamide 156 N-((1r,4r)-4-(3- 369.2 >100
aminopropanamido)cyclohexyl)-4- sulfamoylbenzamide 157
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 323.2 >100
fluoronicotinamide 158 N-((1r,4r)-4-(3- 309.2 >100
aminopropanamido)cyclohexyl)-5- fluoronicotinamide 159
N-((1r,4r)-4-aminocyclohexyl)-5- 238.2 >100 fluoronicotinamide
160 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-6- 258.2 >100
carboxamide 161 N-((1r,4r)-4-aminocyclohexyl)-1H- 259.2 >100
benzo[d]imidazole-6-carboxamide 162 N-(1-(1-(L-alanyl)piperidin-4-
355.2 >100 yl)ethyl)quinoline-2-carboxamide 163 N-((1r,4r)-4-(3-
341.2 >100 aminopropanamido)cyclohexyl)quinoline-2- carboxamide
164 N-((1r,4r)-4-aminocyclohexyl)quinoline-2- 270.2 >100
carboxamide 165 N-((1r,4r)-4-(3- 341.2 15.52
aminopropanamido)cyclohexyl)isoquinoline- 6-carboxamide 166
N-((1r,4r)-4-aminocyclohexyl)isoquinoline- 270.2 20.7 6-carboxamide
167 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 357.3 >100
(1H-indol-3-yl)acetamide 168 N-((1r,4r)-4-aminocyclohexy
l)-2-(1H-indol- 272.2 >100 3-yl)acetamide 169
3-amino-N-((1r,4r)-4-(2-(6- 398.3 >100 methoxynaphthalen-2-
yl)propanamido)cyclohexyl)propanamide 170
N-((1r,4r)-4-aminocyclohexyl)-2-(6- 327.3 76.38
methoxynaphthalen-2-yl)propanamide 171
N-(1-(1-(L-alanyl)piperidin-4- 355.3 >100
yl)ethyl)isoquinoline-1-carboxamide 172
N-((1r,4r)-4-aminocyclohexyl)-1H-indazole- 259 >100
3-carboxamide 173 N-((1r,4r)-4-(3- 259.3 0.11
aminobutanamido)cyclohexyl)-2- oxoindoline-5-carboxamide 174
N-((1r,4r)-4-(2-aminoacetamido)cyclohexyl)- 331.2 0.63
2-oxoindoline-5-carboxamide 175 N-((1r,4r)-4-(2- 345.3 0.42
aminopropanamido)cyclohexyl)-2- oxoindoline-5-carboxamide 176
N-((1-(L-alanyl)-4-methylpiperidin-4- 359.1 3.52
yl)methyl)-2-oxoindoline-5-carboxamide 177
N-(((R)-1-(D-alanyl)pyrrolidin-3-yl)methyl)- 331.15 19.78
2-oxoindoline-5-carboxamide 178 N-(4-(3-amino-N- 359.3 3.4
methylpropanamido)cyclohexyl)-2- oxoindoline-5-carboxamide 179
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(5- 386.2 >100
methyl-1,2,4-oxadiazol-3-yl)benzamide 180
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5- 322.3 >100
dimethyl-1H-pyrazole-4-carboxamide 181 N-((1r,4r)-4-(3- 308.2
>100 aminopropanamido)cyclohexyl)-3,5-
dimethyl-1H-pyrazole-4-carboxamide 182
N-((1r,4r)-4-aminocyclohexyl)-3,5-dimethyl- 237.1 >100
1H-pyrazole-4-carboxamide 183
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 320.2 >100
methylpyrimidine-5-carboxamide 184 N-((1r,4r)-4-(3- 306.3 35.78
aminopropanamido)cyclohexyl)-2- methylpyrimidine-5-carboxamide 185
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 320.3 >100
methylpyrazine-2-carboxamide 186 N-((1r,4r)-4-aminocyclohexyl)-5-
235.2 >100 methylpyrazine-2-carboxamide 187
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 320.3 >100
aminoisonicotinamide 188 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-
321.2 >100 aminopyrazine-2-carboxamide 189
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-[1,1'- 380.3 >100
biphenyl]-4-carboxamide 190 N-((1r,4r)-4-aminocyclohexyl)-4- 298.2
>100 sulfamoylbenzamide 191
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 322.2 >100
hydroxypyridazine-3-carboxamide 192
N-((1r,4r)-4-aminocyclohexyl)-1H-indole-5- 258.2 >100
carboxamide 193 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 344.3
>100 benzo[d]imidazole-6-carboxamide 194
N-(1-(1-(L-alanyl)piperidin-4- 355.2 >100
yl)ethyl)isoquinoline-6-carboxamide 195
N-((1r,4r)-4-(2-(1H-indol-3- 343.2 >100
yl)acetamido)cyclohexyl)-3- aminopropanamide 196 N-((1r,4r)-4-(3-
341.2 >100 aminopropanamido)cyclohexyl)isoquinoline-
1-carboxamide 197 N-((1r,4r)-4-aminocyclohexyl)isoquinoline- 270.2
>100 1-carboxamide 198
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 361.2 41.66
fluoro-1H-indole-2-carboxamide 199
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 371.3 >100
hydroxyquinoline-4-carboxamide 200 N-((1r,4r)-4-(3- 357.2 23.31
aminopropanamido)cyclohexyl)-2- hydroxyquinoline-4-carboxamide 201
N-((1r,4r)-4-aminocyclohexyl)-2- 286.2 >100
hydroxyquinoline-4-carboxamide 202
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 358.3 59
5,6,7,8-tetrahydronaphthalene-2-carboxamide 203 N-((1r,4r)-4-(3-
344.2 11.21 aminopropanamido)cyclohexyl)-5,6,7,8-
tetrahydronaphthalene-2-carboxamide 204
N-((1r,4r)-4-aminocyclohexyl)-5,6,7,8- 273.2 47.43
tetrahydronaphthalene-2-carboxamide 205
N-(1-(1-(L-alanyl)piperidin-4- 306.3 >100
yl)ethyl)pyrazine-2-carboxamide 206
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4- 336.2 >100
fluorophenyl)acetamide 207 3-amino-N-((1r,4r)-4-(2-(4- 322.2
>100 fluorophenyl)acetamido)cyclohexyl)propanamide 208
N-((1r,4r)-4-aminocyclohexyl)-2-(4- 251.2 >100
fluorophenyl)acetamide 209 4-((1-(1-(L-alanyl)piperidin-4- 321.2
>100 yl)ethyl)carbamoyl)pyridine 1-oxide 210 4-(((1r,4r)-4-
236.2 >100 aminocyclohexyl)carbamoyl)pyridine 1- oxide 211
4-amino-N-((1r,4r)-4- 285.15 43.73
aminocyclohexyl)quinoline-6-carboxamide 212
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 370.3 15.16
aminoquinoline-6-carboxamide 213 (R)-2-oxo-N-(pyrrolidin-3- 260.15
17.95 ylmethyl)indoline-5-carboxamide 214 N-(4-(2-amino-N- 345.3
1.25 methylacetamido)cyclohexyl)-2-oxoindoline- 5-carboxamide 215
N-((1r,4r)-4-(3- 306.1 >100 aminopropanamido)cyclohexyl)-5-
methylpyrazine-2-carboxamide 216
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4- 428.2 >100
bromo-3,5-dimethyl-1H-pyrazol-1- yl)propanamide 217
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 385.3 >100
methyl-1-phenyl-1H-1,2,3-triazole-4- carboxamide 218
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(3- 400.3 76.96
methyl-5-oxo-4,5-dihydro-1H-pyrazol-1- yl)benzamide 219
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 358.2 >100
methyl-1H-indazole-6-carboxamide 220
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 384.2 >100
methoxy-2-naphthamide 221
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 385.1 >100
methoxyquinoline-4-carboxamide 222 N-((1r,4r)-4-(3- 371 >100
aminopropanamido)cyclohexyl)-2- methoxyquinoline-4-carboxamide 223
N-((1r,4r)-4-aminocyclohexyl)-2- 300 >100
methoxyquinoline-4-carboxamide 224
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 372.2 >100
oxo-4H-chromene-2-carboxamide 225
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 371.2 >100
hydroxyquinoline-2-carboxamide
226 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 371.2 >100
(4H-1,2,4-triazol-4-yl)benzamide 227
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 373.3 29.17
(pyrrolidin-1-yl)benzamide 228 N-(1-(1-(L-alanyl)piperidin-4- 361.2
>100 yl)ethyl)benzo[d]thiazole-6-carboxamide 229
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 377.2 77.9
chloro-1H-indole-2-carboxamide 230 N-((1r,4r)-4-(3- 363.1 37.47
aminopropanamido)cyclohexyl)-5-chloro- 1H-indole-2-carboxamide 231
N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H- 292.1 91.53
indole-2-carboxamide 232
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 >100
indole-2-carboxamide 233 N-((1r,4r)-4-(3- 329.3 >100
aminopropanamido)cyclohexyl)-1H-indole- 2-carboxamide 234
N-((1r,4r)-4-aminocyclohexyl)-1H-indole-2- 258.2 >100
carboxamide 235 N-((1r,4r)-4-(3- 329.2 13.44
aminopropanamido)cyclohexyl)-1H-indole- 5-carboxamide 236
5-((1-(1-(L-alanyl)piperidin-4- 362.2 >100
yl)ethyl)carbamoyl)benzo[c][1,2,5]oxadiazole 1-oxide 237
N-(1-(1-(L-alanyl)piperidin-4- 346.2 >100
yl)ethyl)benzo[c][1,2,5]oxadiazole-5- carboxamide 238
N-(1-(1-(L-alanyl)piperidin-4- 356.3 >100
yl)ethyl)quinoxaline-2-carboxamide 239
N-(1-(1-(L-alanyl)piperidin-4- 350.2 >100
yl)ethyl)imidazo[2,1-b]thiazole-6- carboxamide 241
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 336.3 82.88
(1H-imidazol-1-yl)butanamide 242
N-((1r,4r)-4-aminocyclohexyl)-5-fluoro-1H- 276 >100
indole-2-carboxamide 243
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 344.2 72.93
benzo[d]imidazole-2-carboxamide 244
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 357.2 >100
methyl-1H-indole-2-carboxamide 245 N-((1r,4r)-4-(3- 343.3 >100
aminopropanamido)cyclohexyl)-1-methyl- 1H-indole-2-carboxamide 246
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 272.2 >100
indole-2-carboxamide 247 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-
320.2 >100 aminonicotinamide 248
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 >100
indole-4-carboxamide 249 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-
321.2 65.86 hydroxyisonicotinamide 250
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 321.2 >100
hydroxyisonicotinamide 251
N-((1r,4r)-4-aminocyclohexyl)picolinamide 220.1 >100 252
N-((1r,4r)-4-(3- 292.1 37.36
aminopropanamido)cyclohexyl)pyrazine-2- carboxamide 253
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 308.2 64.91
methyl-1H-imidazole-2-carboxamide 254
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 319.3 >100
methylisonicotinamide 255
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 319.3 73.38
methylnicotinamide 256 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-
319.3 61.59 methylnicotinamide 257
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 319.3 >100
methylnicotinamide 258 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-
325.3 >100 methylisothiazole-4-carboxamide 259
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 308.3 >100
methyl-1H-pyrazole-3-carboxamide 260
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 364.3 >100
(tert-butyl)-1-methyl-1H-pyrazole-5- carboxamide 261
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 336.2 >100
methoxypyrazine-2-carboxamide 262
(1r,4S)-N-(1-(1-(L-alanyl)piperidin-4- 325.2 >100
yl)ethyl)-4-aminocyclohexane-1- carboxamide 263
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 406.2 >100
chloro-2-(trifluoromethyl)benzamide 264 4-(((1r,4r)-4-(3- 307.2
>100 aminopropanamido)cyclohexyl)carbamoyl)pyridine 1-oxide 265
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 323.2 >100
fluoropicolinamide 266 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2-
384.3 >100 difluorobenzo[d][1,3]dioxole-4-carboxamide 267
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 323.2 >100
fluoroisonicotinamide 268
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 >100
indole-3-carboxamide 269 N-((1r,4r)-4-aminocyclohexyl)pyrimidine-2-
221.1 >100 carboxamide 270 N-((1r,4r)-4-(3- 308.2 >100
aminopropanamido)cyclohexyl)-6- hydroxypyridazine-3-carboxamide 271
N-((1r,4r)-4-aminocyclohexyl)-6- 237.2 >100
hydroxypyridazine-3-carboxamide 272 N-((1r,4r)-4-(3- 329.2 37.25
aminopropanamido)cyclohexyl)-1H-indole- 6-carboxamide 273
N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1- 300.1 >100
phenyl-1H-1,2,3-triazole-4-carboxamide 274
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4,6- 349.3 >100
dimethyl-2-oxo-1,2-dihydropyridine-3- carboxamide 275
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 273 >100
indazole-6-carboxamide 276
N-((1r,4r)-4-aminocyclohexyl)-6-methoxy-2- 299.1 >100
naphthamide 277 N-((1r,4r)-4-aminocyclohexyl)-4-oxo-4H- 287 >100
chromene-2-carboxamide 278
N-((1r,4r)-4-aminocyclohexyl)-4-(4H-1,2,4- 286 >100
triazol-4-yl)benzamide 279 N-((1r,4r)-4-(3- 359.1 43.65
aminopropanamido)cyclohexyl)-4- (pyrrolidin-1-yl)benzamide 280
N-((1r,4r)-4-aminocyclohexyl)-4-(pyrrolidin- 288.1 48.03
1-yl)benzamide 281 N-((1r,4r)-4-(3- 347 28.96
aminopropanamido)cyclohexyl)benzo[d]thiazole- 6-carboxamide 283
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.2 >100
indole-5-carboxamide 284
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2- 384.2 >100
difluorobenzo[d][1,3]dioxole-5-carboxamide 285
N-((1r,4r)-4-aminocyclohexyl)-2,2- 299.2 69.12
difluorobenzo[d][1,3]dioxole-5-carboxamide 286 5-(((1r,4r)-4- 277.1
>100 aminocyclohexyl)carbamoyl)benzo[c][1,2,5] oxadiazole
1-oxide 287 N-((1r,4r)-4- 261 >100
aminocyclohexyl)benzo[c][1,2,5]oxadiazole- 5-carboxamide 288
4-amino-N-((1r,4r)-4-(3- 306.1 >100
aminopropanamido)cyclohexyl)nicotinamide 289 4-amino-N-((1r,4r)-4-
235.2 >100 aminocyclohexyl)nicotinamide 290 N-((1r,4r)-4-(3-
329.2 >100 aminopropanamido)cyclohexyl)-1H-indole- 4-carboxamide
291 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-4- 258.2 >100
carboxamide 292 N-((1r,4r)-4-aminocyclohexyl)-2- 236.2 >100
hydroxyisonicotinamide 293 N-((1r,4r)-4-aminocyclohexyl)-2- 236.1
>100 hydroxyisonicotinamide 294 N-((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)-6- hydroxynicotinamide 295
N-((1r,4r)-4-aminocyclohexyl)-6- 236.2 >100 hydroxynicotinamide
296 N-(1-(1-(L-alanyl)piperidin-4- 305.2 >100
yl)ethyl)picolinamide 297 N-(4-(3- 291.2 44.24
aminopropanamido)cyclohexyl)picolinamide 298
N-((1r,4r)-4-aminocyclohexyl)pyrazine-2- 221.2 >100 carboxamide
299 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 454.3 >100
(tert-butyl)-1-(3-methylbenzyl)-1H-pyrazole- 5-carboxamide 300
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-7- 357.2 >100
methyl-1H-indole-2-carboxamide 301
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 335.2 >100
methoxypicolinamide 302 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-
336.2 >100 methoxypyrazine-2-carboxamide 303
(1r,4r)-4-amino-N-((1r,4r)-4-(3- 311.2 >100
aminopropanamido)cyclohexyl)cyclohexane- 1-carboxamide 304
(1r,4r)-4-amino-N-((1r,4r)-4- 240.1 >100
aminocyclohexyl)cyclohexane-1- carboxamide 305
(2S,4S)-N-(1-(1-(L-alanyl)piperidin-4- 315.2 55.92
yl)ethyl)-4-fluoropyrrolidine-2-carboxamide 306
(3R)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 359.3 48.06
1,2,3,4-tetrahydroisoquinoline-3- carboxamide 307
N-((1r,4r)-4-aminocyclohexyl)-2,2- 299 >100
difluorobenzo[d][1,3]dioxole-4-carboxamide 308
N-((1r,4r)-4-aminocyclohexyl)-3- 238.2 >100
fluoroisonicotinamide 309 N-(1-(1-(L-alanyl)piperidin-4- 311.2
>100 yl)ethyl)thiazole-5-carboxamide 310
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 321.2 >100
hydroxypicolinamide 311 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-
324.2 >100 oxo-1,4,5,6-tetrahydropyridazine-3- carboxamide 312
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 344.2 >100
indazole-3-carboxamide 313
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 354.2 70.71
(3,5-difluorophenyl)acetamide 314
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 319.2 >100
(pyridin-3-yl)acetamide 315
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 320.3 >100
(pyrimidin-5-yl)acetamide 316
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 308.2 >100
(1H-imidazol-1-yl)acetamide 317 N-((1r,4r)-4-(3- 336 >100
aminopropanamido)cyclohexyl)imidazo[2,1- b]thiazole-6-carboxamide
318 N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1- 265 >100
b]thiazole-6-carboxamide 319
N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1- 265.2 >100
b]thiazole-6-carboxamide 320 N-((1r,4r)-4-aminocyclohexyl)-2- 235.1
>100 methylpyrimidine-5-carboxamide 321 2-amino-N-((1r,4r)-4-(3-
306.2 16.59 aminopropanamido)cyclohexyl)isonicotinamide 322
2-amino-N-((1r,4r)-4- 235.1 >100 aminocyclohexyl)isonicotinamide
323 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 383 >100
sulfamoylbenzamide 324 N-((1r,4r)-4-aminocyclohexyl)-4,6-dimethyl-
264.1 >100 2-oxo-1,2-dihydropyridine-3-carboxamide 325
N-((1r,4r)-4-(3- 344.3 >100
aminopropanamido)cyclohexyl)-1-methyl- 1H-indazole-6-carboxamide
326 N-((1r,4r)-4-(3- 370.3 28
aminopropanamido)cyclohexyl)-6-methoxy- 2-naphthamide 327
N-((1r,4r)-4-(3- 358.2 >100
aminopropanamido)cyclohexyl)-4-oxo-4H- chromene-2-carboxamide 328
N-((1r,4r)-4-aminocyclohexyl)-4- 286.2 >100
hydroxyquinoline-2-carboxamide 329 N-((1r,4r)-4-(3- 357.3 >100
aminopropanamido)cyclohexyl)-4-(4H-1,2,4- triazol-4-yl)benzamide
330 N-((1r,4r)-4-(3- 370.2 7.49 aminopropanamido)cyclohexyl)-2,2-
difluorobenzo[d][1,3]dioxole-5-carboxamide 331 5-(((1r,4r)-4-(3-
348.2 85.12 aminopropanamido)cyclohexyl)car-
bamoyl)benzo[c][1,2,5]oxadiazole 1-oxide 332 N-((1r,4r)-4-(3- 332.2
>100 aminopropanamido)cyclohexyl)benzo[c][1,2,5]oxa-
diazole-5-carboxamide 333 N-((1r,4r)-4-aminocyclohexyl)-4-(1H-
251.1 >100 imidazol-1-yl)butanamide 334
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(6- 412.3 34.86
methoxynaphthalen-2-yl)propanamide 335 N-((1r,4r)-4-(3- 347.2
>100 aminopropanamido)cyclohexyl)-5-fluoro-1H-
indole-2-carboxamide 336 N-((1r,4r)-4-aminocyclohexyl)-1H- 259.1
>100 benzo[d]imidazole-2-carboxamide
337 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 223.1 >100
imidazole-2-carboxamide 338 (1r,4r)-N-(1-(1-(L-alanyl)piperidin-4-
320.3 >100 yl)ethyl)bicyclo[2.2.1]hept-5-ene-2- carboxamide 339
N-((1r,4r)-4-aminocyclohexyl)-4- 234.1 >100 methylnicotinamide
340 N-((1r,4r)-4-(3- 440.3 >100
aminopropanamido)cyclohexyl)-3-(tert-
butyl)-1-(3-methylbenzyl)-1H-pyrazole-5- carboxamide 341
N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)- 369.1 >100
1-(3-methylbenzyl)-1H-pyrazole-5- carboxamide 342 N-((1r,4r)-4-(3-
343.2 37.68 aminopropanamido)cyclohexyl)-7-methyl-
1H-indole-2-carboxamide 343
N-((1r,4r)-4-aminocyclohexyl)-7-methyl-1H- 272.2 68.49
indole-2-carboxamide 344 N-((1r,4r)-4-(3- 305.1 36.4
aminopropanamido)cyclohexyl)-5- methylnicotinamide 345
N-((1r,4r)-4-aminocyclohexyl)-5- 234.2 50.67 methylnicotinamide 346
N-((1r,4r)-4-aminocyclohexyl)-6- 234.1 >100 methylnicotinamide
347 N-((1r,4r)-4-(3- 311.2 >100 aminopropanamido)cyclohexyl)-3-
methylisothiazole-4-carboxamide 348
N-((1r,4r)-4-aminocyclohexyl)-3- 240.2 >100
methylisothiazole-4-carboxamide 349 N-((1r,4r)-4-(3- 294.2 >100
aminopropanamido)cyclohexyl)-1-methyl- 1H-pyrazole-3-carboxamide
350 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 223.2 >100
pyrazole-3-carboxamide 351 N-((1r,4r)-4-(3- 350.3 >100
aminopropanamido)cyclohexyl)-3-(tert-
butyl)-1-methyl-1H-pyrazole-5-carboxamide 352
N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)- 279.3 >100
1-methyl-1H-pyrazole-5-carboxamide 353 N-((1r,4r)-4-(3- 321.2
>100 aminopropanamido)cyclohexyl)-6- methoxypicolinamide 354
N-((1r,4r)-4-aminocyclohexyl)-6- 250.2 >100 methoxypicolinamide
355 N-((1r,4r)-4-(3- 322 >100 aminopropanamido)cyclohexyl)-6-
methoxypyrazine-2-carboxamide 356 N-((1r,4r)-4-aminocyclohexyl)-6-
251.2 >100 methoxypyrazine-2-carboxamide 357
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 320.2 >100
aminopicolinamide 358 N-((1r,4r)-4-aminocyclohexyl)-4-chloro-2-
320.9 >100 (trifluoromethyl)benzamide 359
N-((1r,4r)-4-aminocyclohexyl)thiazole-5- 226.1 >100 carboxamide
360 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-3- 258.1 >100
carboxamide 361 N-((1r,4r)-4-(3- 307.1 >100
aminopropanamido)cyclohexyl)-5- hydroxypicolinamide 362
N-((1r,4r)-4-aminocyclohexyl)-2-(3,5- 269.2 >100
difluorophenyl)acetamide 363 3-amino-N-((1r,4r)-4-(2-(pyridin-3-
305.1 >100 yl)acetamido)cyclohexyl)propanamide 364
3-amino-N-((1r,4r)-4-(2-(pyrimidin-5- 306.2 >100
yl)acetamido)cyclohexyl)propanamide 365
N-((1r,4r)-4-aminocyclohexyl)-2-(pyrimidin- 235.2 >100
5-yl)acetamide 366 N-((1r,4r)-4-(2-(1H-imidazol-1- 294.1 >100
yl)acetamido)cyclohexyl)-3- aminopropanamide 367 N-((1r,4r)-4-
276.1 >100 aminocyclohexyl)benzo[d]thiazole-2- carboxamide 368
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 12.33
indole-6-carboxamide 369 N-((1r,4r)-4-(3- 330.1 65.22
aminopropanamido)cyclohexyl)-1H- benzo[d]imidazole-5-carboxamide
370 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 373.2 >100
methoxy-1H-indole-3-carboxamide 371 N-((1r,4r)-4-(3- 359.2 >100
aminopropanamido)cyclohexyl)-4-methoxy- 1H-indole-3-carboxamide 372
N-((1r,4r)-4-aminocyclohexyl)-4-methoxy- 288.1 >100
1H-indole-3-carboxamide 373 N-((1r,4r)-4-(3- 342.1 >100
aminopropanamido)cyclohexyl)quinoxaline- 2-carboxamide 374
N-((1r,4r)-4-(3- 330.3 86.56 aminopropanamido)cyclohexyl)-1H-
benzo[d]imidazole-2-carboxamide 375 N-((1r,4r)-4-(3- 322.2 >100
aminopropanamido)cyclohexyl)-4-(1H- imidazol-1-yl)butanamide 376
N-((1r,4r)-4-(3- 307.2 >100 aminopropanamido)cyclohexyl)-2-
hydroxyisonicotinamide 378
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 321.1 >100
hydroxynicotinamide 379 N-((1r,4r)-4-(3- 305.1 >100
aminopropanamido)cyclohexyl)-3- methylisonicotinamide 380
N-((1r,4r)-4-aminocyclohexyl)-3- 234.1 >100
methylisonicotinamide 381 N-((1r,4r)-4-(3- 305.1 >100
aminopropanamido)cyclohexyl)-4- methylnicotinamide 382
N-((1r,4r)-4-(3- 305.2 >100 aminopropanamido)cyclohexyl)-6-
methylnicotinamide 383 N-((1r,4r)-4-(3- 322.1 >100
aminopropanamido)cyclohexyl)-5- methoxypyrazine-2-carboxamide 384
N-((1r,4r)-4-aminocyclohexyl)-5- 251 >100
methoxypyrazine-2-carboxamide 385 6-amino-N-((1r,4r)-4-(3- 306.2
>100 aminopropanamido)cyclohexyl)picolinamide 386
6-amino-N-((1r,4r)-4- 235.1 >100 aminocyclohexyl)picolinamide
387 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 320.2 >100
aminonicotinamide 388 6-amino-N-((1r,4r)-4-(3- 306.2 >100
aminopropanamido)cyclohexyl)nicotinamide 389
N-((1r,4r)-4-aminocyclohexyl)-6- 238.2 >100 fluoropicolinamide
390 N-((1r,4r)-4-(3- 309.2 >100 aminopropanamido)cyclohexyl)-3-
fluoroisonicotinamide 391 N-((1r,4r)-4-(3- 329.1 >100
aminopropanamido)cyclohexyl)-1H-indole- 3-carboxamide 392
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 319.2 >100
methylisonicotinamide 393 N-((1r,4r)-4-(3- 305.2 >100
aminopropanamido)cyclohexyl)-2- methylisonicotinamide 394
N-((1r,4r)-4-aminocyclohexyl)-2- 234.1 >100
methylisonicotinamide 395 N-(1-(1-(L-alanyl)piperidin-4- 361.2
>100 yl)ethyl)benzo[d]thiazole-2-carboxamide 396
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 325 10.61
methylthiazole-2-carboxamide 397 N-((1r,4r)-4-(3- 311 27.42
aminopropanamido)cyclohexyl)-5- methylthiazole-2-carboxamide 398
N-((1r,4r)-4-aminocyclohexyl)-5- 240.1 >100
methylthiazole-2-carboxamide 399
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 359.2 >100
oxoindoline-4-carboxamide 400 N-((1r,4r)-4-aminocyclohexyl)-2-
274.2 >100 oxoindoline-4-carboxamide 401 N-((1r,4r)-4-(3- 371.1
>100 aminopropanamido)cyclohexyl)-5-methyl-1-
phenyl-1H-1,2,3-triazole-4-carboxamide 402 N-((1r,4r)-4-(3- 335.2
>100 aminopropanamido)cyclohexyl)-4,6-
dimethyl-2-oxo-1,2-dihydropyridine-3- carboxamide 403
N-((1r,4r)-4-aminocyclohexyl)-4-(3-methyl- 315.1 >100
5-oxo-4,5-dihydro-1H-pyrazol-1- yl)benzamide 404 N-((1r,4r)-4-(3-
357.2 >100 aminopropanamido)cyclohexyl)-4-
hydroxyquinoline-2-carboxamide 405
N-((1r,4r)-4-aminocyclohexyl)quinoxaline-2- 271.2 >100
carboxamide 406 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 358.2
>100 (1H-pyrrolo[3,2-b]pyridin-3-yl)acetamide 407
N-((1r,4r)-4-(2-(1H-pyrrolo[3,2-b]pyridin-3- 344.2 >100
yl)acetamido)cyclohexyl)-3- aminopropanamide 408
N-((1r,4r)-4-aminocyclohexyl)-2-(1H- 273.2 >100
pyrrolo[3,2-b]pyridin-3-yl)acetamide 409
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 321.2 70.41
hydroxynicotinamide 410 N-((1r,4r)-4-(3- 307.3 44.48
aminopropanamido)cyclohexyl)-2- hydroxynicotinamide 411
N-((1r,4r)-4-aminocyclohexyl)-2- 236.2 >100 hydroxynicotinamide
412 N-((1r,4r)-4-(3- 294.1 >100
aminopropanamido)cyclohexyl)-1-methyl- 1H-imidazole-2-carboxamide
413 N-(l-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 308.1 >100
methyl-1H-pyrazole-5-carboxamide 414 N-((1r,4r)-4-(3- 294.1 >100
aminopropanamido)cyclohexyl)-1-methyl- 1H-pyrazole-5-carboxamide
415 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 223.1 >100
pyrazole-5-carboxamide 416 (1R,4R)-N-((1r,4R)-4-(3- 306.1 >100
aminopropanamido)cyclohexyl)bicyclo[2.2.1]hept- 5-ene-2-carboxamide
417 (1r,4r)-N-((1r,4R)-4- 235.1 >100
aminocyclohexyl)bicyclo[2.2.1]hept-5-ene-2- carboxamide 418
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 320.3 >100
aminopicolinamide 419 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-
321.2 >100 aminopyrimidine-5-carboxamide 420
4-amino-N-((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)pyrimidine- 5-carboxamide 421
4-amino-N-((1r,4r)-4- 236.1 >100
aminocyclohexyl)pyrimidine-5-carboxamide 422 N-((1r,4r)-4-(3- 309.2
>100 aminopropanamido)cyclohexyl)-6- fluoropicolinamide 423
N-((1r,4r)-4-aminocyclohexyl)-5- 236.2 >100 hydroxypicolinamide
424 N-((1r,4r)-4-aminocyclohexyl)-6-oxo- 239.1 >100
1,4,5,6-tetrahydropyridazine-3-carboxamide 425 N-((1r,4r)-4-(3-
330.1 37.49 aminopropanamido)cyclohexyl)-1H- indazole-3-carboxamide
426 N-((1r,4r)-4-aminocyclohexyl)-2-(1H- 223.1 >100
imidazol-1-yl)acetamide 427 N-((1r,4r)-4-(3- 347.2 >100
aminopropanamido)cyclohexyl)benzo[d]thiazole- 2-carboxamide 428
(1r,4r)-4-amino-N-(2-oxoindolin-5- 274.1 30.6
yl)cyclohexane-1-carboxamide 429 N-((1r,4r)-4-aminocyclohexyl)-2-
310 14.5 oxoindoline-5-sulfonamide 430 N-((1r,4r)-4-(3- 345.2
>100 aminopropanamido)cyclohexyl)-2- oxoindoline-4-carboxamide
431 3-amino-N-((1r,4r)-4-(2-(4-bromo-3,5- >100
dimethyl-1H-pyrazol-1- yl)propanamido)cyclohexyl)propanamide 432
N-((1r,4r)-4-(3- 386.3 36.97
aminopropanamido)cyclohexyl)-4-(3-methyl-
5-oxo-4,5-dihydro-1H-pyrazol-1- yl)benzamide 433
(2R,4S)-N-(1-(1-(L-alanyl)piperidin-4- 313.2 45.65
yl)ethyl)-4-hydroxypyrrolidine-2- carboxamide 434
(2R,4S)-N-((1r,4r)-4-(3- 299.2 >100
aminopropanamido)cyclohexyl)-4- hydroxypyrrolidine-2-carboxamide
435 (2R,4S)-N-((1r,4r)-4-aminocyclohexyl)-4- 228.1 >100
hydroxypyrrolidine-2-carboxamide 436
(R)-N-((1r,4r)-4-aminocyclohexyl)-1,2,3,4- 274.1 12.51
tetrahydroquinoline-2-carboxamide 437 5-amino-N-((1r,4r)-4-(3-
306.2 >100 aminopropanamido)cyclohexyl)picolinamide 438
5-amino-N-((1r,4r)-4- 235.2 >100
aminocyclohexyl)picolinamide
439 N-((1r,4r)-4-(3- 392.2 >100
aminopropanamido)cyclohexyl)-4-chloro-2- (trifluoromethyl)benzamide
440 N-((1r,4r)-4-(3- 370.2 >100
aminopropanamido)cyclohexyl)-2,2-
difluorobenzo[d][1,3]dioxole-4-carboxamide 441
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5- 386.1 37.45
dihydroxy-2-naphthamide 442 N-((1r,4r)-4-(3- 297.2 >100
aminopropanamido)cyclohexyl)thiazole-5- carboxamide 443
3-amino-N-((1r,4r)-4-(2-(3,5- 340.2 >100
difluorophenyl)acetamido)cyclo- hexyl)propanamide 444
5-acetamido-N-((1r,4r)-4- 277 >100 aminocyclohexyl)picolinamide
445 N-(1-(1-(L-alanyl)piperidin-4- 345 >100
yl)ethyl)imidazo[1,2-b]pyridazine-2- carboxamide 446
N-((1r,4r)-4-(3- 331.1 >100
aminopropanamido)cyclohexyl)imidazo[1,2- b]pyridazine-2-carboxamide
447 N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2- 260 >100
b]pyridazine-2-carboxamide 448 N-((1r,4r)-4-aminocyclohexyl)-2-(2-
288.2 >100 oxoindolin-5-yl)acetamide 449
3-amino-N-((1r,4r)-4-((2-oxoindoline)-5- 381.1 >100
sulfonamido)cyclohexyl)propanamide 450
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 389.2 25.37
methyl-3-oxo-3,4-dihydro-2H- benzo[b][1,4]oxazine-6-carboxamide 451
N-((1r,4r)-4-(3- 375.2 9.9 aminopropanamido)cyclohexyl)-2-methyl-3-
oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6- carboxamide 452
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-3- 304.2 39.15
oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6- carboxamide 453
N-((1r,4r)-4-((R)-3- 359.2 0.26 >40
aminobutanamido)cyclohexyl)-2- oxoindoline-5-carboxamide 454
N-((1r,4r)-4-aminocyclohexyl)-2-(4-bromo- 342.9 >100
3,5-dimethyl-1H-pyrazol-1-yl)propanamide 455
N-((1r,4r)-4-aminocyclohexyl)-4-(1H-1,2,4- 286.2 >100
triazol-1-yl)benzamide 456 N-((1r,4r)-4-(3- 357.2 21.97
aminopropanamido)cyclohexyl)-2- hydroxyquinoline-3-carboxamide 457
N-((1r,4r)-4-aminocyclohexyl)-2-(3- 301 >100
(trifluoromethyl)phenyl)acetamide 458
3-amino-N-((1r,4r)-4-aminocyclohexyl)-2- 299.1 >100
methylquinoline-4-carboxamide 459
(3R)-N-(4-aminocyclohexyl)-1,2,3,4- 274.1 >100
tetrahydroisoquinoline-3-carboxamide 460
N-((1r,4r)-4-aminocyclohexyl)-3,5- 301 20.71
dihydroxy-2-naphthamide 461
5-(2-(piperidin-4-yl)acetyl)octahydro-2H- 266.1 >100
pyrrolo[3,2-c]pyridin-2-one 462
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 362.1 >100
acetamidopicolinamide 463 5-acetamido-N-((1r,4r)-4-(3- 348 >100
aminopropanamido)cyclohexyl)picolinamide 464
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 336.2 32.68
cyclopropyl-1,2,4-oxadiazole-3-carboxamide 465
3-amino-N-((1r,4r)-4-(2-(2-oxoindolin-5- 359.2 38.81
yl)acetamido)cyclohexyl)propanamide 466
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(2- 373.2 60
oxoindolin-5-yl)acetamide 467 (1r,4r)-4-(3-aminopropanamido)-N-(2-
345 4.46 oxoindolin-5-yl)cyclohexane-1-carboxamide 468
3-amino-N-(2,2-dimethyl-3-((2-oxoindoline)- 369.2 18.32
5-sulfonamido)propyl)propanamide 469
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 359.2 >100
oxoisoindoline-5-carboxamide 470 N-((1r,4r)-4-aminocyclohexyl)-2,3-
288 7.46 dioxoindoline-5-carboxamide 471 N-((1r,4r)-4-(3- 345.2
0.61 aminopropanamido)cyclohexyl)-2- oxoindoline-5-carboxamide 472
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 371.3 >100
(1H-1,2,4-triazol-1-yl)benzamide 473 N-((1r,4r)-4-(3- 357.2 53.11
aminopropanamido)cyclohexyl)-4-(1H-1,2,4- triazol-1-yl)benzamide
474 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 371.2 22.09
hydroxyquinoline-3-carboxamide 475 N-((1r,4r)-4-aminocyclohexyl)-2-
286.2 22.16 hydroxyquinoline-3-carboxamide 476
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(3- 386.1 51.13
(trifluoromethyl)phenyl)acetamide 477 3-amino-N-((1r,4r)-4-(2-(3-
372 22.78 (trifluoromethyl)phenyl)acetamido)cyclo-
hexyl)propanamide 478 3-amino-N-((1r,4r)-4-(3- 370.2 31.62
aminopropanamido)cyclohexyl)-2- methylquinoline-4-carboxamide 479
N-((1r,4r)-4-(3- 372 5.02 aminopropanamido)cyclohexyl)-3,5-
dihydroxy-2-naphthamide 480 N-((1r,4r)-4-aminocyclohexyl)-3- 236.2
>100 hydroxypicolinamide 481 N-((1r,4r)-4-(3- 310.2 15.1
aminopropanamido)cyclohexyl)-6-oxo-
1,4,5,6-tetrahydropyridazine-3-carboxamide 482 (E)-N-((1r,4r)-4-(3-
306.1 71.06 aminopropanamido)cyclohexyl)-3-(1H-
imidazol-4-yl)acrylamide 483 5-(2-(1-(3-aminopropanoyl)piperidin-4-
337.2 10.25 yl)acetyl)octahydro-2H-pyrrolo[3,2- c]pyridin-2-one 484
N-((1r,4r)-4-aminocyclohexyl)-5- 251.1 85.66
cyclopropyl-1,2,4-oxadiazole-3-carboxamide 485 N-((1r,4r)-4-(3-
322.1 12.92 aminopropanamido)cyclohexyl)-5-
cyclopropyl-1,2,4-oxadiazole-3-carboxamide 486
2-amino-N-(2,2-dimethyl-3-((2-oxoindoline)- 355 18.82
5-sulfonamido)propyl)acetamide 487 N-((1r,4r)-4-aminocyclohexyl)-1-
274.1 37.89 oxoisoindoline-5-carboxamide 488
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,3- 373.1 14.08
dioxoindoline-5-carboxamide 489
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 384.3 31.62
amino-2-methylquinoline-4-carboxamide 490
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 393.2 0.43 >40
chloro-2-oxoindoline-5-carboxamide 491 N-((1r,4r)-4-(3- 379.2 0.15
>40 aminopropanamido)cyclohexyl)-6-chloro-2-
oxoindoline-5-carboxamide 492
N-((1r,4r)-4-aminocyclohexyl)-6-chloro-2- 308.1 1.59
oxoindoline-5-carboxamide 493 N-((1r,4r)-4-aminocyclohexyl)-4-
237.1 >50 hydroxypyrimidine-5-carboxamide 494
(E)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 320.2 >100
3-(1H-imidazol-4-yl)acrylamide 495
(E)-N-((1r,4r)-4-aminocyclohexyl)-3-(1H- 235.1 >100
imidazol-4-yl)acrylamide 496
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 345.2 6.57
pyrazolo[3,4-c]pyridine-5-carboxamide 497
N-((1r,4r)-4-aminocyclohexyl)-1H- 260 35.73
pyrazolo[3,4-c]pyridine-5-carboxamide 498
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 379 51
fluorobenzo[d]thiazole-2-carboxamide 499 N-((1r,4r)-4-(3- 365.2
86.27 aminopropanamido)cyclohexyl)-6-
fluorobenzo[d]thiazole-2-carboxamide 500
N-((1r,4r)-4-aminocyclohexyl)-6- 294.1 >100
fluorobenzo[d]thiazole-2-carboxamide 501
1-(2-amino-2-oxoethyl)-N-((1r,4r)-4- 267.2 50
aminocyclohexyl)-1H-1,2,3-triazole-4- carboxamide 502
N-((1r,4r)-4-aminocyclohexyl)-1H- 209.1 >100
imidazole-2-carboxamide 503 N-((1r,4r)-4-(3- 345.2 >100
aminopropanamido)cyclohexyl)-1- oxoisoindoline-5-carboxamide 504
N-((1r,4r)-4-(3- 359 5.38 aminopropanamido)cyclohexyl)-2,3-
dioxoindoline-5-carboxamide 505 N-((1r,4r)-4-(3- 345.2 16.1
aminopropanamido)cyclohexyl)-2- oxoindoline-7-carboxamide 506
N-(4-aminocyclohexyl)-2-oxoindoline-7- 274.2 42.25 carboxamide 507
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 224.2 >100
1,2,4-triazole-5-carboxamide 508
3-amino-N-((1r,4r)-4-aminocyclohexyl)-1H- 225 >50
1,2,4-triazole-5-carboxamide 509
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 322.1 >50
hydroxypyrimidine-5-carboxamide 510 N-((1r,4r)-4-(3- 308.1 >50
aminopropanamido)cyclohexyl)-4- hydroxypyrimidine-5-carboxamide 511
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 321.1 >50
hydroxypicolinamide 512 N-((1r,4r)-4-(3- 307 >50
aminopropanamido)cyclohexyl)-3- hydroxypicolinamide 513
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 321.2 >50
hydroxynicotinamide 514 N-((1r,4r)-4-(3- 307.1 >50
aminopropanamido)cyclohexyl)-5- hydroxynicotinamide 515
N-((1r,4r)-4-aminocyclohexyl)-5- 236.1 >50 hydroxynicotinamide
516 1-(2-amino-2-oxoethyl)-N-((1r,4r)-4-(3- 338.2 >50
aminopropanamido)cyclohexyl)-1H-1,2,3- triazole-4-carboxamide 517
N-(4-aminocyclohexyl)-1H-imidazole-4- 209.2 >50 carboxamide 518
N-(4-(3-aminopropanamido)cyclohexyl)-1H- 280.2 >50
imidazole-2-carboxamide 519 N-((1r,4r)-4-(3- 343.2 >50
aminopropanamido)cyclohexyl)-2-methyl- 1H-indole-5-carboxamide 520
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H- 272.2 >50
indole-5-carboxamide 521 N-((1r,4r)-4-aminocyclohexyl)-1H- 209.2
>50 imidazole-4-carboxamide 522
N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H- 223.2 >50
imidazole-5-carboxamide 523
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4H- 295.1 >50
1,2,4-triazole-3-carboxamide 525 N-((1r,4r)-4-(3- 281.1 >50
aminopropanamido)cyclohexyl)-4H-1,2,4- triazole-3-carboxamide 527
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 328 >50
chloro-1H-pyrazole-3-carboxamide 528 N-((1r,4r)-4-(3- 314 >50
aminopropanamido)cyclohexyl)-5-chloro- 1H-pyrazole-3-carboxamide
529 N-((1r,4r)-4-(3- 331.2 4.45 aminopropanamido)cyclohexyl)-1H-
pyrazolo[3, 4-c]pyridine-5-carboxamide 530 N-((1r,4r)-4-(3- 297.1
>50 aminopropanamido)cyclohexyl)-5-oxo-4,5-
dihydro-1H-1,2,4-triazole-3-carboxamide 531
N-((1r,4r)-4-aminocyclohexyl)-5-oxo-4,5- 226.1 >50
dihydro-1H-1,2,4-triazole-3-carboxamide 532 N-((1r,4r)-4-(3- 348.1
>50 aminopropanamido)cyclohexyl)thiazolo[5,4-
c]pyridine-2-carboxamide 533
N-((1r,4r)-4-aminocyclohexyl)thiazolo[5,4- 277.1 >50
c]pyridine-2-carboxamide 534
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-(2- 352.2 >50
amino-2-oxoethyl)-1H-1,2,3-triazole-4- carboxamide 535
N-((1r,4r)-4-aminocyclohexyl)-5-ethyl-1H- 238.1 >50
1,2,4-triazole-3-carboxamide 536 N-((1r,4r)-4-(3- 309.2 >50
aminopropanamido)cyclohexyl)-5-ethyl-4H-
1,2,4-triazole-3-carboxamide 537 N-((1r,4r)-4-(3- 280.2 >50
aminopropanamido)cyclohexyl)-1H- imidazole-4-carboxamide 538
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 357.2 >50
methyl-1H-indole-5-carboxamide 539
N-((1R,4r)-4-((1r,4R)-4-aminocyclohexane- 335.2 >50
1-carboxamido)cyclohexyl)-1H-1,2,4- triazole-5-carboxamide 540
N-((1r,4r)-4-(4- 295.1 >50 aminobutanamido)cyclohexyl)-4H-1,2,4-
triazole-3-carboxamide 541
N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H- 244.1 >50
1,2,4-triazole-3-carboxamide 542
N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H- 223.1 >50
imidazole-4-carboxamide 543 N-((1r,4r)-4-(3- 295.1 >50
aminopropanamido)cyclohexyl)-5-methyl-
4H-1,2,4-triazole-3-carboxamide 544
N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 224.2 >50
1,2,4-triazole-3-carboxamide
545 N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H- 243.1 >50
pyrazole-3-carboxamide 546
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 311.1 9.76
oxo-4,5-dihydro-1H-1,2,4-triazole-3- carboxamide 547
N-(1-(2-(piperidin-4-yl)acetyl)piperidin-4- 321.2 >50
yl)-4H-1,2,4-triazole-3-carboxamide 548
N-((1r,4r)-4-aminocyclohexyl)-3-iodo-1H- 335.9 >50
1,2,4-triazole-5-carboxamide 549
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 309.2 >50
methyl-1H-1,2,4-triazole-5-carboxamide 550
N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H- 224.1 14.71
1,2,4-triazole-3-carboxamide 551 N-(1-(1-(L-alanyl)piperidin-4-
362.2 >50 yl)ethyl)thiazolo[5,4-c]pyridine-2- carboxamide 552
N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 339.2 6.44
ethylthiazole-2-carboxamide 553 N-((1r,4r)-4-(3- 325.2 25.61
aminopropanamido)cyclohexyl)-5- ethylthiazole-2-carboxamide 554
N-((1r,4r)-4-aminocyclohexyl)-5- 254.1 >50
ethylthiazole-2-carboxamide 555 N-(1-((1r,4r)-4-aminocyclohexane-1-
321.1 >50 carbonyl)piperidin-4-yl)-4H-1,2,4-triazole-3-
carboxamide 556 N-(1-(3-aminopropanoyl)piperidin-4-yl)-4H- 267.2
>50 1,2,4-triazole-3-carboxamide 557
(.+-.)-trans-N-(1-(4-aminocyclohexane-1- 344.1 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide 558
(.+-.)-cis-N-(1-(4-aminocyclohexane-1- 358.1 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide (+Na) 559
N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 275.1 3.49
dihydro-1H-pyrrolo[2,3-c]pyridine-5- carboxamide 560
N-(1-(4-aminobutanoyl)piperidin-4-yl)-4H- 281.1 >10
1,2,4-triazole-3-carboxamide 561
N-((1r,4r)-4-aminocyclohexyl)-N-methyl- 224.1 >10
1H-1,2,4-triazole-5-carboxamide 562
N-((1r,4r)-4-aminocyclohexyl)-4-methyl-1H- 223.2 >10
imidazole-2-carboxamide 563
(.+-.)-trans-N-(1-((3-aminopropyl)sulfonyl)-2- 340.05 >10
methylpiperidin-4-yl)benzamide 564
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 340.05 >10
methylpiperidin-4-yl)benzamide 565
N-((1r,4r)-4-aminocyclohexyl)-6-bromo-2- 364 >10
hydroxyquinoline-3-carboxamide 566 N-((1r,4r)-4-(3- >10
aminopropanamido)cyclohexyl)-6-bromo-2-
hydroxyquinoline-3-carboxamide 567
(.+-.)-cis-N-(1-(4-aminocyclohexane-1- 366.3 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide (+Na) 568
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 438.15 >10
methylpiperidin-4-yl)-[1,1',-biphenyl]-4- (+Na) carboxamide 569
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 368.1 8.02
methylpiperidin-4-yl)-3-ethylbenzamide 570
(.+-.)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 340.1 >10
methylpiperidin-4-yl)benzamide 571
(.+-.)-trans-N-(1-(4-aminocyclohexane-1- 344.1 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide 572
2-amino-N-((1r,4r)-4-aminocyclohexyl)-1H- 224.1 >10
imidazole-4-carboxamide 573
(.+-.)-trans-N-(1-((3-aminopropyl)sulfonyl)-2- 368.2 >10
methylpiperidin-4-yl)-3-ethylbenzamide 574
N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2- 260.1 >10
a]pyrimidine-3-carboxamide *IC.sub.50 values are an average of n =
1 to n = 50
TABLE-US-00007 TABLE 3A LCMS M + H or SMYD3 (M + Na) Biochem SMYD3
or IC.sub.50 cell IC.sub.50 Cpd. No. Chemical Name ((M - NH.sub.2))
(.mu.M)* (.mu.M)* 575 N-((1R,3R,5S)-8-(((1r,4R)-4- 447 0.00044
2.17352 aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 576
N-((1R,3r,5S)-8-((4-aminopiperidin- 466 0.00049 0.52547
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-6-
fluoro-2-oxoindoline-5-carboxamide 577 N-((1R,3r,5S)-8-(((1- 461
0.00067 0.4806 methylpiperidin-4- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 578
N-((1R,3r,5S)-8-((4-aminopiperidin- 448 0.00068 0.85408
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide 579 N-((1R,3r,5S)-8-((4-aminopiperidin-
482 0.00081 1.12914 1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6- chloro-2-oxoindoline-5-carboxamide
580 N-((2S,4S)-1-((4-aminopiperidin-1- 436 0.0009 1.63568
yl)sulfonyl)-2-methylpiperidin-4-yl)- 2-oxoindoline-5-carboxamide
581 N-((1R,3r,5S)-8-(((1-(3- 505 0.00095 1.67455
hydroxypropyl)piperidin-4- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 582
N-((2S,4S)-1-((4-aminopiperidin-1- 470 0.00098 0.81381
yl)sulfonyl)-2-methylpiperidin-4-yl)- 6-chloro-2-oxoindoline-5-
carboxamide 583 N-((1R,3R,5S)-8-(((1r,4R)-4- 481 0.0011 1.50735
aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-6-
chloro-2-oxoindoline-5-carboxamide 584
N-((2S)-1-((4-(2-aminopropan-2- 471 0.00147 0.65295
yl)phenyl)sulfonyl)-2- methylpiperidin-4-yl)-2-oxoindoline-
5-carboxamide 585 6-chloro-N-((1R,3r,5S)-8-(((1-(3- 539 0.00173
0.76375 hydroxypropyl)piperidin-4- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 586
6-chloro-N-((1R,3r,5S)-8-((4- 496 0.00189 0.42454
(methylamino)piperidin-1- yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 587
N-((1R,3r,5S)-8-((4- 538 0.00198 0.07099 (benzylamino)piperidin-1-
yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide 588 N-((2S,4S)-1-((4-(2-aminopropan-2-
505 0.00198 0.35648 yl)phenyl)sulfonyl)-2-
methylpiperidin-4-yl)-6-chloro-2- oxoindoline-5-carboxamide 589
N-((1R,3r,5S)-8-((4- 462 0.00213 0.98725 (methylamino)piperidin-1-
yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide 590 2-oxo-N-((1R,3r,5S)-8-((piperidin-3-
447 0.00214 0.76757 ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 591
N-((1R,3R,5S)-8-(((1s,4S)-4- 447 0.00233 2.31394
aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide 592 N-((1R,3r,5S)-8-((4- 572 0.00258
0.05357 (benzylamino)piperidin-1- yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6- chloro-2-oxoindoline-5-carboxamide
593 N-((1R,3r,5S)-8-((4- 476 0.00289 0.50002
(dimethylamino)piperidin-1- yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 594
6-chloro-N-((1R,3r,5S)-8-((4- 510 0.00346 0.30139
(dimethylamino)piperidin-1- yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2- oxoindoline-5-carboxamide 595
6-chloro-2-oxo-N-((1R,3r,5S)-8-(((1- 591 0.00354 0.03609
(4,4,4-trifluorobutyl)piperidin-4- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 596
6-chloro-2-oxo-N-((1R,3r,5S)-8- 481 0.0036 2.66255
((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 597
2-oxo-N-((1R,3r,5S)-8-((piperidin-4- 447 0.00398 3.43731
ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide 598 6-chloro-2-oxo-N-((1R,3S,5S)-8- 481 0.00412
1.26702 ((((S)-piperidin-3- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 599
N-((2S,4S)-2-methyl-1-((piperidin-4- 435 0.00442 9.48804
ylmethyl)sulfonyl)piperidin-4-yl)-2- oxoindoline-5-carboxamide 600
6-chloro-2-oxo-N-((1R,3R,5S)-8- 481 0.00499 0.72841
((((R)-piperidin-3- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 601
2-oxo-N-((1R,3r,5S)-8-((piperidin-4- 449 0.00521 4.54161
ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2,3-
dihydrobenzo[d]oxazole-6- carboxamide 602
N-((1R,3r,5S)-8-((4-aminopiperidin- 528 0.00712 3.72505
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-6-
bromo-2-oxoindoline-5-carboxamide 603
N-((3S)-1-((4-aminopiperidin-1- 470 0.00853 2.67708
yl)sulfonyl)-3-methylpiperidin-4-yl)- 6-chloro-2-oxoindoline-5-
carboxamide 604 N-((1R,3r,5S)-8-((4-aminopiperidin- 496 0.01347
0.20704 1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-6-
chloro-1-methyl-2-oxoindoline-5- carboxamide 605
N-((2S,4S)-1-((4-aminopiperidin-1- 416 0.01544 0.20068
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-ethylisothiazole-3-carboxamide 606
N-((1R,3r,5S)-8-((4-aminopiperidin- 462 0.01561 1.79073
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-6-
methyl-2-oxoindoline-5-carboxamide 607
N-((2S,4S)-1-((4-aminopiperidin-1- (451) 0.01813 0.20535
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-cyclopropyl-1,3,4-thiadiazole-2- carboxamide 608
N-((3R,4R)-1-((4-aminopiperidin-1- 470 0.02137 6.23686
yl)sulfonyl)-3-methylpiperidin-4-yl)- 6-chloro-2-oxoindoline-5-
carboxamide 609 N-((1R,3r,5S)-8-((4-aminopiperidin- 464 0.02365
3.70034 1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-3-oxo-
3,4-dihydro-2H- benzo[b][1,4]oxazine-6-carboxamide 610
N-((1R,3r,5S)-8-((4-aminopiperidin- 428 0.02378 0.21618
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5-
ethylisothiazole-3-carboxamide 611 1-methyl-2-oxo-N-((1R,3r,5S)-8-
461 0.02593 3.91552 ((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 612
N-((1R,3r,5S)-8-((4-(2-aminopropan- 483 0.03068 2.53133
2-yl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide 613 N-((1R,3r,5S)-8-((4-(2-aminopropan-
517 0.03712 1.77071 2-yl)phenyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6- chloro-2-oxoindoline-5-carboxamide
614 6-chloro-2-oxo-N-((1R,3r,5S)-8-((2- 481 0.04599 0.37965
(pyrrolidin-1-yl)ethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 615
2-oxo-N-((1R,3r,5S)-8-((2- 447 0.04974 0.76121
(pyrrolidin-1-yl)ethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 616
N-((1R,3r,5S)-8-((4-aminopiperidin- 423 0.0499 0.53953
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5-
ethylpyridazine-3-carboxamide 617 6-chloro-1-methyl-2-oxo-N- 495
0.05233 2.95866 ((1R,3r,5S)-8-((piperidin-4- ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline- 5-carboxamide 618
N-((1R,3r,5S)-8-((4-aminopiperidin- 441 0.05583 0.3477
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5-
cyclopropyl-1,3,4-thiadiazole-2- carboxamide 619
N-((2S,4S)-1-((4-aminopiperidin-1- 411 0.05959 0.46793
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-ethylpyridazine-3-carboxamide 620 2-oxo-N-(1-((piperidin-4- 421
0.06816 10 ylmethyl)sulfonyl)piperidin-4- yl)indoline-5-carboxamide
621 N-(1-((3- 415 0.07749 6.83658 aminopropyl)sulfonyl)piperidin-4-
yl)-6-chloro-2-oxoindoline-5- carboxamide 622 N-((1R,3r,5S)-8-((4-
472 0.13055 1.07968 aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2,2- difluorobenzo[d][1,3]dioxole-5-
carboxamide 623 N-((1R,3R,5S)-8-(((1r,4R)-4- 472 0.1358 0.89555
aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2,2-
difluorobenzo[d][1,3]dioxole-5- carboxamide 624 N-(1-((3- 381
0.15882 10 aminopropyl)sulfonyl)piperidin-4-
yl)-2-oxoindoline-5-carboxamide 625
(R)-2-methyl-3-oxo-N-((1R,3r,5S)-8- 477 0.18459 10
((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-3,4-
dihydro-2H-benzo[b][1,4]oxazine-6- carboxamide 626
N-((1R,3r,5S)-8-((4-aminopiperidin- 473 0.22228 2.96871
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2,2-
difluorobenzo[d][1,3]dioxole-5- carboxamide 627
N-((1R,3R,5S)-8-(((1r,4R)-4- 562 0.22495 1.54162
(benzylamino)cyclohexyl)sulfonyl)-
8-azabicyclo[3.2.1]octan-3-yl)-2,2- difluorobenzo[d][1,3]dioxole-5-
carboxamide 628 2,2-difluoro-N-((1R,3r,5S)-8- 472 0.23189 3.62035
((piperidin-4-ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-
yl)benzo[d][1,3]dioxole-5- carboxamide 629
N-((2S,4R)-1-((4-aminopiperidin-1- (438) 0.32589 2.08253
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-ethylisothiazole-3-carboxamide 630
2,2-difluoro-N-((1R,3r,5S)-8-(((1- 486 0.3614 6.55362
methylpiperidin-4- yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-
yl)benzo[d][1,3]dioxole-5- carboxamide 631
N-((2S,4R)-1-((4-aminopiperidin-1- (451) 0.4699 4.89772
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-cyclopropyl-1,3,4-thiadiazole-2- carboxamide 632
N-((2S,4S)-1-((4- 471 0.52572 10 acetamidophenyl)sulfonyl)-2-
methylpiperidin-4-yl)-2-oxoindoline- 5-carboxamide 633
N-((1R,3r,5S)-8-((4-aminopiperidin- 423 0.52917 10
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5-
cyclopropyl-1H-pyrazole-3- carboxamide 634
N-((3R,4S)-1-((4-aminopiperidin-1- 470 0.52937 0.97208
yl)sulfonyl)-3-methylpiperidin-4-yl)- 6-chloro-2-oxoindoline-5-
carboxamide 635 3-ethyl-N-((1R,3r,5S)-8-((piperidin- 420 0.62038 10
4-ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3- yl)benzamide 636
N-((1R,3r,5S)-8-((4-aminopiperidin- 464 0.81894 10
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-3-oxo-
3,4-dihydro-2H- benzo[b][1,4]oxazine-7-carboxamide 637
N-((1R,3r,5S)-8-((4-aminopiperidin- 423 0.8386 10 1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-1- cyclopropyl-1H-pyrazole-4-
carboxamide 638 N-((1R,3R,5S)-8-((1r,4R)-4- 411 0.96185 10
aminocyclohexane-1-carbonyl)-8- azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide 639 N-((2S,4S)-1-((4-aminopiperidin-1-
411 1.00072 10 yl)sulfonyl)-2-methylpiperidin-4-yl)-
1-cyclopropyl-1H-pyrazole-4- carboxamide 640 N-((2S)-1-((1r,4S)-4-
((416)) 2.04146 10 aminocyclohexane-1-carbonyl)-2-
methylpiperidin-4-yl)-6-chloro-2- oxoindoline-5-carboxamide 641
N-(1-((4- 491 5.93159 10 acetamidophenyl)sulfonyl)piperidin-
4-yl)-6-chloro-2-oxoindoline-5- carboxamide 642
N-((2S,4S)-1-((1r,4S)-4- ((382)) 6.81095 10
aminocyclohexane-1-carbonyl)-2-
methylpiperidin-4-yl)-2-oxoindoline- 5-carboxamide 643 N-(1-((4-
457 16.85335 10 acetamidophenyl)sulfonyl)piperidin-
4-yl)-2-oxoindoline-5-carboxamide 644
N-((1R,3r,5S)-8-((4-aminopiperidin- 424.00 0.0185 0.25715
1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-3-
cyclopropylisoxazole-5-carboxamide *IC.sub.50 values are an average
of n = 1 to n = 50
TABLE-US-00008 TABLE 4A SMYD2 Biochem Cpd. LCMS IC.sub.50 No.
Chemical Name M + H (.mu.M)* 645
5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3- 261.2 0.74472
yl]pyridazine-3-carboxamide 646
5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3- 323.2 0.51586
yl}pyridazine-3-carboxamide 647
5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3- 323.2 7.80106
yl}pyridazine-3-carboxamide 648
N-{1-[(5-chloro-1-methyl-1H-imidazol-4- 347.2 7.32825
yl)methyl]azetidin-3-yl}-5-cyclopropylpyridazine-3- carboxamide 649
5-cyclopropyl-N-{1-[1-(2,5- 391.1 0.14034
dichlorophenyl)ethyl]azetidin-3-yl}pyridazine-3- carboxamide 650
5-cyclopropyl-N-(1-{1-[3-(2-hydroxyethoxy)-2- 413.2 0.31235
methoxyphenyl]ethyl}azetidin-3-yl)pyridazine-3- carboxamide 651
N-(1-benzylazetidin-3-yl)-5-cyclopropylpyridazine- 309.2 0.54112
3-carboxamide 652 N-(1-{1-[2-chloro-3-(2- 417.2 0.04156
hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-5-
cyclopropylpyridazine-3-carboxamide 657
N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4- 208.1 10.38816
carboxamide 659 1-cyclopropyl-N-(1-methylazetidin-3-yl)-1H-1,2,3-
222.1 2.8375 triazole-4-carboxamide 660
1-cyclopropyl-N-(1-propylazetidin-3-yl)-1H-1,2,3- 250.1 1.16661
triazole-4-carboxamide 661
1-cyclopropyl-N-(1-ethylazetidin-3-yl)-1H-1,2,3- 236.2 1.57571
triazole-4-carboxamide 662
1-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H- 250.2 0.84606
1,2,3-triazole-4-carboxamide 663
1-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H- 250.2 0.58519
1,2,3-triazole-4-carboxamide 664
1-cyclopropyl-N-(1-cyclopropylazetidin-3-yl)-1H- 248.1 1.48071
1,2,3-triazole-4-carboxamide 665
1-cyclopropyl-N-[1-(cyclopropylmethyl)azetidin-3- 262.2 1.99933
yl]-1H-1,2,3-triazole-4-carboxamide 666
1-cyclopropyl-N-[1-(oxetan-3-ylmethyl)azetidin-3- 278.2 6.06091
yl]-1H-1,2,3-triazole-4-carboxamide 667
1-cyclopropyl-N-[1-(2-methoxyethyl)azetidin-3-yl]- 266.2 2.45794
1H-1,2,3-triazole-4-carboxamide 668
1-cyclopropyl-N-[1-(2-methylpropyl)azetidin-3-yl]- 264.2 2.74698
1H-1,2,3-triazole-4-carboxamide 669
N-[1-(cyclobutylmethyl)azetidin-3-yl]-1- 276.2 1.61707
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 670
1-cyclopropyl-N-[1-(2-hydroxyethyl)azetidin-3-yl]- 252.1 4.53271
1H-1,2,3-triazole-4-carboxamide 671
N-(1-benzylazetidin-3-yl)-1-cyclopropyl-1H-1,2,3- 298.1 4.20527
triazole-4-carboxamide 672
N-(1-benzylazetidin-3-yl)-1-cyclopropyl-1H-1,2,3- 298.2 1.55139
triazole-4-carboxamide 673
1-cyclopropyl-N-[1-(2-phenylethyl)azetidin-3-yl]- 312.2 1.55399
1H-1,2,3-triazole-4-carboxamide 674
1-cyclopropyl-N-[1-(2-hydroxy-1- 328.2 4.27205
phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4- carboxamide 675
1-cyclopropyl-N-[1-(1-phenylpropyl)azetidin-3-yl]- 326.2 0.49364
1H-1,2,3-triazole-4-carboxamide 676
N-{1-[1-(4-chlorophenyl)ethyl]azetidin-3-yl}-1- 346.2 2.18182
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 677
1-cyclopropyl-N-{1-[1-(2,4- 348.2 2.86259
difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 678 1-cyclopropyl-N-{1-[1-(2- 330.2 0.90683
fluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole- 4-carboxamide
679 1-cyclopropyl-N-{1-[1-(3- 342.2 1.45146
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
680 1-cyclopropyl-N-(1-{1-[4- 380.2 >50.0
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 681
N-{1-[1-(4-butoxyphenyl)ethyl]azetidin-3-yl}-1- 384.2 1.29111
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 682
1-cyclopropyl-N-{1-[1-(2- 342.3 0.66494
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
683 1-cyclopropyl-N-{1-[1-(2- 342.3 0.79678
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
684 1-cyclopropyl-N-(1-{1-[2- 396.2 2.13234
(trifluoromethoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 685
1-cyclopropyl-N-{1-[1-(pyridin-2-yl)ethyl]azetidin- 313.1 3.56033
3-yl}-1H-1,2,3-triazole-4-carboxamide 686
1-cyclopropyl-N-[1-(3-methoxypropyl)azetidin-3- 280.1 3.76161
yl]-1H-1,2,3-triazole-4-carboxamide 687 1-cyclopropyl-N-{1-[1-(3,4-
348.2 2.89677 difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 688 1-cyclopropyl-N-{1-[1-(3,4- 386.2
5.09675 dimethoxyphenyl)propan-2-yl]azetidin-3-yl}-1H-
1,2,3-triazole-4-carboxamide 689 1-cyclopropyl-N-{1-[1-(4-fluoro-2-
360.2 1.88646 methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 690 1-cyclopropyl-N-(1-{1-[2-methoxy-5-
410.2 7.98548 (trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 691
N-{1-[1-(2H-1,3-benzodioxol-5-yl)ethyl]azetidin-3- 356.2 0.80698
yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 692
N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.2 0.17228
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 693
N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.3 0.17574
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 694
1-cyclopropyl-N-{1-[1-(4- 344.2 0.78735
fluorophenyl)propyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
695 N-{1-[1-(3-chlorophenyl)ethyl]azetidin-3-yl}-1- 346.1 1.00761
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 696
1-cyclopropyl-N-{1-[1-(2,5- 380.1 0.18717
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 697 1-cyclopropyl-N-{1-[1-(2,5- 380.1
0.18937 dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 698 1-cyclopropyl-N-{1-[1-(3,4- 372.2
3.69446 dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 699 1-cyclopropyl-N-{1-[1-(pyrimidin-5-
314.2 9.54128 yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide 700 1-cyclopropyl-N-(1-{1-[4- 394.2 2.66609
(trifluoromethyl)phenyl]propyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 701 1-cyclopropyl-N-(1-{[3-(2- 372.2
8.02678 methoxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 702 1-cyclopropyl-N-(1-{1-[3-(2- 386.1
3.57947 methoxyethoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 703
1-(2-hydroxyethyl)-N-[1-(propan-2-yl)azetidin-3- 254.2 >50.0
yl]-1H-1,2,3-triazole-4-carboxamide 704
1-cyclopropyl-N-(1-{1-[3-(2- 372.2 0.64045
hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 705 1-cyclopropyl-N-[1-(1-{3-[2- 385.2
2.04485 (methylamino)ethoxy]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide 706 1-cyclopropyl-N-[1-(1-{3-[2-
399.2 2.1244 (dimethylamino)ethoxy]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide 707
1-cyclopropyl-N-[1-(3-hydroxypropyl)azetidin-3- 266.1 1.91172
yl]-1H-1,2,3-triazole-4-carboxamide 708 1-cyclopropyl-N-{1-[3-
293.2 >50.0 (dimethylamino)propyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 709
1-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3- 312.2 0.37665
yl}-1H-1,2,3-triazole-4-carboxamide 710
N-{1-[1-(2-chloro-4-fluorophenyl)ethyl]azetidin-3- 364.1 0.34116
yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 711
1-cyclopropyl-N-{1-[1-(3- 344.2 1.00729
fluorophenyl)propyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
712 N-(1-{1-[4-chloro-3- 414.2 7.35557
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 713
N-[1-(4-chloro-5-methoxy-2,3-dihydro-1H-inden-1- 388.1 2.88746
yl)azetidin-3-yl]-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide
714 N-{1-[1-(3-chloro-5-fluorophenyl)ethyl]azetidin-3- 364.1
2.12503 yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 715
1-cyclopropyl-N-{1-[1-(pyrimidin-2- 314.2 1.9389
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 716
1-cyclopropyl-N-{1-[1-(1,3-thiazol-2- 319.1 30.73955
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 717
1-cyclopropyl-N-(1-{[1-(2-methoxyethyl)-1H- 346.3 3.05744
pyrazol-4-yl]methyl}azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
718 1-cyclopropyl-N-{1-[1-(dimethyl-1,3-thiazol-5- 347.2 2.95156
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 719
N-[1-(5-chloro-2,3-dihydro-1H-inden-1-yl)azetidin- 358.2 4.40844
3-yl]-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide 720
1-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3- 312.2 23.25339
yl}-1H-1,2,3-triazole-4-carboxamide 721
1-cyclopropyl-N-{1-[(1R)-1-phenylpropyl]azetidin- 326.2 4.80835
3-yl}-1H-1,2,3-triazole-4-carboxamide 722
1-cyclopropyl-N-{1-[(1S)-1-phenylpropyl]azetidin- 326.3 0.19827
3-yl}-1H-1,2,3-triazole-4-carboxamide 723
1-(2-aminoethyl)-N-[1-(propan-2-yl)azetidin-3-yl]- 253.2 >50.0
1H-1,2,3-triazole-4-carboxamide 724
1-cyclopropyl-N-{1-[1-(4-methoxypyridin-2- 343.2 1.27222
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 725
1-cyclopropyl-N-{1-[1-(3-methoxypyridin-2- 343.2 1.02479
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 726
1-cyclopropyl-N-(1-{[3- 355.2 10.70724
(methylcarbamoyl)phenyl]methyl}azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 727
N-{1-[(3-carbamoylphenyl)methyl]azetidin-3-yl}-1- 341.1 7.29596
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 728
1-cyclopropyl-N-(1-{1-[4-(morpholin-4- 397.2 0.75494
yl)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 729
1-cyclopropyl-N-{1-[2,2,2-trifluoro-1-(3- 396.2 >50.0
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
730 1-cyclopropyl-N-{1-[1-(3- 404.2 3.04417
phenoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
731 N-{1-[cyclobutyl(phenyl)methyl]azetidin-3-yl}-1- 352.2 1.51599
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 732
1-cyclopropyl-N-{1-[1-(4-fluoro-3- 360.2 2.58965
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
733 1-cyclopropyl-N-{1-[(1-methyl-1H-imidazol-4- 302.2 6.80081
yl)methyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 734
1-cyclopropyl-N-(1-{[3-(2- 358.2 2.30886
hydroxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 735 1-cyclopropyl-N-[1-({3-[2- 371.2
2.33404 (methylamino)ethoxy]phenyl}methyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide 736 1-cyclopropyl-N-[1-({3-[2-
385.2 2.80792 (dimethylamino)ethoxy]phenyl}methyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide 737
N-(1-{1-[3-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.3 0.71843
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 738
1-cyclopropyl-N-[1-(5-methoxy-1,2,3,4- 368.3 5.82879
tetrahydronaphthalen-1-yl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide 739 1-cyclopropyl-N-{1-[1-(4- 404.2 1.07309
phenoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
740 1-cyclopropyl-N-[1-(5-fluoro-2,3-dihydro-1H-inden- 342.2
6.96336 1-yl)azetidin-3-yl]-1H-1,2,3-triazole-4-carboxamide 741
1-cyclopropyl-N-(1-{1-[2- 380.2 1.00727
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 742 1-cyclopropyl-N-{1-[1-(2,6- 348.2
2.84963 difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 743 1-cyclopropyl-N-{1-[1-(2,3- 380.2
0.48846 dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 744
1-cyclopropyl-N-[1-(4,5-dimethoxy-2,3-dihydro- 384.2 23.71632
1H-inden-1-yl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide 745 1-cyclopropyl-N-{1-[1-(pyrazin-2-yl)ethyl]azetidin-
314.1 7.44095 3-yl}-1H-1,2,3-triazole-4-carboxamide 746
1-cyclopropyl-N-{1-[1-(2,5- 348.2 7.77636
difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 747 1-cyclopropyl-N-{1-[1-(4- 330.2 1.92161
fluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole- 4-carboxamide
748 1-cyclopropyl-N-(1-{1-[3- 380.2 2.80977
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 749
1-cyclopropyl-N-{1-[2,2,2-trifluoro-1-(4- 396.1 0.56478
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
750 1-cyclopropyl-N-{1-[1-(2-hydroxy-6- 358.2 1.27817
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
751 1-cyclopropyl-N-{1-[1-(1,3-thiazol-2- 333.2 20.98439
yl)propyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 752
1-cyclopropyl-N-[1-(2-methoxy-1- 342.2 6.09419
phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4- carboxamide 753
1-cyclopropyl-N-[1-({3- 341.3 15.98565
[(methylamino)methyl]phenyl}methyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide 754
N-(1-{[3-(aminomethyl)phenyl]methyl}azetidin-3- 327.2 7.33653
yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 755
1-cyclopropyl-N-[1-(1-phenylcyclopropyl)azetidin- 324.2 30.45617
3-yl]-1H-1,2,3-triazole-4-carboxamide 756
1-cyclopropyl-N-[1-({1-[2-(methylamino)ethyl]-2- 362.3 17.04064
oxopyrrolidin-3-yl}methyl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide 757
1-cyclopropyl-N-[1-(2-phenylpropan-2-yl)azetidin- 326.2 3.8847
3-yl]-1H-1,2,3-triazole-4-carboxamide 758
1-cyclopropyl-N-(1-{[4-(methylamino)oxan-2- 335.3 >50.0
yl]methyl}azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 759
1-cyclopropyl-N-[1-(1-phenylpropan-2-yl)azetidin- 326.2 1.39034
3-yl]-1H-1,2,3-triazole-4-carboxamide 760
1-cyclopropyl-N-{1-[1-(4-fluorophenyl)-2- 358.2 3.27451
methylpropyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 761
1-cyclopropyl-N-{1-[1-(1H-indazol-3- 352.2 3.21089
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 762
1-cyclopropyl-N-[1-(7-methoxy-2,3-dihydro-1H- 354.3 7.97221
inden-1-yl)azetidin-3-yl]-1H-1,2,3-triazole-4- carboxamide 763
1-cyclopropyl-N-{1-[1-(2,3- 372.2 0.08855
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 764 1-cyclopropyl-N-{1-[1-(2,3- 372.2
0.09346 dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 765
1-cyclopropyl-N-{1-[(3-oxo-2,3-dihydro-1H- 353.1 10.21303
isoindol-5-yl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 766 1-cyclopropyl-N-[1-(2,2,2-trifluoro-1-
366.2 >50.0 phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide 767 1-cyclopropyl-N-{1-[1-(2,3-dihydro-1,4- 370.1
0.57587 benzodioxin-6-yl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 768 1-cyclopropyl-N-{1-[1-(2,6- 372.3
1.68248 dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 769 1-cyclopropyl-N-{1-[1-(2,6- 380.1
1.19872 dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 770
1-(2,2-difluorocyclopropyl)-N-[1-(propan-2- 286.2 4.19117
yl)azetidin-3-yl]-1H-1,2,3-triazole-4-carboxamide 771
1-cyclopropyl-N-[1-(1-{3- 355.2 4.98252
[(methylamino)methyl]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide 772
1-cyclopropyl-N-(1-{[3-(hydroxymethyl)-2- 358.2 10.81324
methoxyphenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 773 1-cyclopropyl-N-[1-(2-methanesulfonyl-1-
390.1 >50.0 phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide 774 1-cyclopropyl-N-{1-[1-(3-oxo-3,4-dihydro-2H-1,4-
383.2 1.61549 benzoxazin-6-yl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 775 N-(1-{1-[2-chloro-3-(2- 406.2 0.04944
hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 776
1-cyclopropyl-N-(1-{1-[3-(2-hydroxyethoxy)-2- 402.2 0.34533
methoxyphenyl]ethyl}azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
777 1-cyclopropyl-N-{1-[(3-methoxy-1-methyl-1H- 332.2 5.61969
pyrazol-4-yl)methyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
778 rel-N-{1-[(1R)-1-[4- 418.2 0.08453
(benzyloxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 779
rel-1-cyclopropyl-N-{1-[(1R)-1-(2,5- 380.1 0.10953
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 780 rel-1-cyclopropyl-N-{1-[(1R)-1-(2- 342.3
0.3468 methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 781
1-cyclopropyl-N-[1-(3-phenyloxetan-3-yl)azetidin- 340.2 >50.0
3-yl]-1H-1,2,3-triazole-4-carboxamide 782
1-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H- 392.4 2.61584
imidazol-4-yl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 783 1-cyclopropyl-N-{1-[1-(3- 369.1 3.13518
acetamidophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 784 N-{1-[(5-chloro-1-methyl-1H-imidazol-4-
336.2 21.02524 yl)methyl]azetidin-3-yl}-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 785 1-cyclopropyl-N-{1-[1-(1H-imidazol-4-
302.2 2.594 yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide 786 1-cyclopropyl-N-{1-[cyclopropyl(4- 356.1 1.70115
fluorophenyl)methyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
787 1-cyclopropyl-N-[1-(2-methyl-1- 340.3 1.42952
phenylpropyl)azetidin-3-yl]-1H-1,2,3-triazole-4- carboxamide 788
rel-N-{1-[(1R)-1-[4- 0.4137
(benzyloxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 789
rel-1-cyclopropyl-N-{1-[(1R)-1-(2,5- 31.57011
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 790 rel-1-cyclopropyl-N-{1-[(1R)-1-(2-
28.78884 methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 791 1-cyclopropyl-N-{1-[1-(pyridin-2- 327.1
2.47462 yl)propyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide
792 N-{1-[(1-benzyl-1H-pyrazol-4-yl)methyl]azetidin-3- 378.2
0.01635 yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 793
1-cyclopropyl-N-[1-(6-methoxy-1,2,3,4- 368.2 9.91987
tetrahydronaphthalen-1-yl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide 794 N-(1-{[3-(aminomethyl)-2- 357.3 32.30456
methoxyphenyl]methyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 795
N-{1-[(1-benzyl-1H-imidazol-4-yl)methyl]azetidin- 378.3 7.14819
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide 796
N-(1-{1-[2-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.2 0.4215
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 797
1-cyclopropyl-N-(1-{1-[4-(1H-imidazol-1- 378.1 1.56764
yl)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 798
1-cyclopropyl-N-{1-[1-(2- 344.2 0.42506
fluorophenyl)propyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
799 1-cyclopropyl-N-[2,2-dimethyl-1-(propan-2- 278.2 9.59545
yl)azetidin-3-yl]-1H-1,2,3-triazole-4-carboxamide 800
N-(1-{1-[4-(benzyloxy)-2- 448.3 0.96532
methoxyphenyl]ethyl}azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide 801 1-cyclopropyl-N-{1-[1-(2,4-
372.3 1.05608 dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 802
N-(1-{[4-(benzyloxy)phenyl]methyl}azetidin-3-yl)- 404.2 0.08341
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 803
N-{1-[1-(2-chloro-3-methoxyphenyl)ethyl]azetidin- 376.2 0.06945
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide 804
rel-1-cyclopropyl-N-{1-[(1R)-1-(2,3- 372.2 0.04426
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 805 rel-1-cyclopropyl-N-{1-[(1S)-1-(2,3-
42.35178 dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 806
1-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H-pyrazol- 392.2 0.97043
4-yl]methyl}azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 807
5-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H-pyrazol- 403.2 0.52752
4-yl]methyl}azetidin-3-yl)pyridazine-3-carboxamide 808
1-cyclopropyl-N-[1-(propan-2-yl)piperidin-3-yl]- 278.2 19.78446
1H-1,2,3-triazole-4-carboxamide 809
N-{1-[(1-benzyl-1H-imidazol-5-yl)methyl]azetidin- 378.3 >50.0
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide 810
1-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H- 392.3 9.28801
imidazol-5-yl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 811 N-{1-[(3-chloro-1-methyl-1H-pyrazol-4-
336.1 1.2247 yl)methyl]azetidin-3-yl}-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 812 1-cyclopropyl-N-[1-({2-methoxy-3- 371.2
41.20464 [(methylamino)methyl]phenyl}methyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide 813
1-cyclopropyl-N-{1-[1-(4-fluorophenyl)-2- 346.2 15.19205
hydroxyethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 814
5-cyclopropyl-N-(1-ethylazetidin-3-yl)pyridazine-3- 247.2 0.59765
carboxamide 815 5-cyclopropyl-N-[1-(propan-2-yl)piperidin-3- 289.2
18.67277 yl]pyridazine-3-carboxamide 816
N-(1-{1-[4-(benzyloxy)phenyl]-2,2,2- 472.3 >50.0
trifluoroethyl}azetidin-3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide 817 N-(1-{1-[4-(benzyloxy)-2- 452.2
0.10155 chlorophenyl]ethyl}azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide 818 1-cyclopropyl-N-(1-{[4-(3-
386.3 3.00034 methoxypropoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 819 1-cyclopropyl-N-(1-{[4-(2,3- 388.2
1.99348 dihydroxypropoxy)phenyl]methyl}azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 820
N-(5-hydroxy-3-oxo-3,4-dihydro-2H-1,4- 320 >50.0
benzoxazin-7-yl)-3-(methylamino)cyclohexane-1- carboxamide 821
1-cyclopropyl-N-{1-[1-(4- 342.3 0.78452
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3- triazole-4-carboxamide
822 1-cyclopropyl-N-(1-{[4-(2- 372.3 1.96551
hydroxypropoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 823 1-cyclopropyl-N-(1-{[4-(3- 372.2
3.21621 hydroxypropoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 824 1-cyclopropyl-N-{1-[(4- 314.1
0.88212 hydroxyphenyl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 825
5-cyclopropyl-N-(1-methylazetidin-3-yl)pyridazine- 233.2 0.39067
3-carboxamide 826 1-cyclopropyl-N-{1-[(4- 328.2 1.83875
methoxyphenyl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide 827 1-cyclopropyl-N-(1-{[4-(2- 358.3 1.37605
hydroxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 828 1-cyclopropyl-N-(1-{[4-(pyridin-4-
405.2 1.03298 ylmethoxy)phenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 829
1-cyclopropyl-N-[1-(1-{4-[2-(morpholin-4-yl)-2- 455.3 0.71252
oxoethoxy]phenyl}ethyl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide 830 1-cyclopropyl-N-(1-{[4-(2- 372.3 2.06713
methoxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 831 rel-N-{1-[(1S)-1-[2-chloro-3-(2-
406.2 0.05775 hydroxyethoxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 832
rel-N-{1-[(1R)-1-[2-chloro-3-(2- 406.2 14.28102
hydroxyethoxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 833
N-{1-[(3-chloro-1-methyl-1H-pyrazol-4- 347.1 0.94017
yl)methyl]azetidin-3-yl}-5-cyclopropylpyridazine-3-
carboxamide 834 1-cyclopropyl-N-[2-(dimethylamino)ethyl]-1H- 224.3
>50.0 1,2,3-triazole-4-carboxamide 835
1-cyclopropyl-N-[1-(1-{2-methoxy-3- 385.3 0.77956
[(methylamino)methyl]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide 836
N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 429.3 0.02651
5-cyclopropylpyridazine-3-carboxamide 837
N-{1-[(1S)-1-(3-chlorophenyl)propyl]azetidin-3-yl}- 360.3 0.33977
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 838
5-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H- 403.3 0.49607
imidazol-4-yl]methyl}azetidin-3-yl)pyridazine-3- carboxamide 839
N-[1-(azetidin-3-yl)ethyl]-5-cyclopropylpyridazine- 247.2 18.24266
3-carboxamide 840 5-cyclopropyl-N-{1-[1-(propan-2-yl)azetidin-3-
289.2 36.83929 yl]ethyl}pyridazine-3-carboxamide 841
5-cyclopropyl-N-{1-[(1S)-1-(2- 353.3 5.00737
methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3- carboxamide 842
5-cyclopropyl-N-{1-[(1R)-1-(2- 353.3 0.18913
methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3- carboxamide 843
(.+-.)-cis-N-(1-{[3- 382.2 1.15555
(benzyloxy)cyclobutyl]methyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 844
1-cyclopropyl-N-[1-(1-{4-[2-oxo-2-(piperidin-1- 453.3 1.54771
yl)ethoxy]phenyl}ethyl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide 845
N-{1-[1-(2-chloro-4-methoxyphenyl)ethyl]azetidin- 376.2 0.08798
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide 846
1-cyclopropyl-N-(1-{[4-(1,3-thiazol-4- 411.2 1.08508
ylmethoxy)phenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 847 N-[1-(1-{4-[(3- 452.2 0.27389
chlorophenyl)methoxy]phenyl}ethyl)azetidin-3-yl]-
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 848 N-[1-(1-{4-[(4-
452.2 0.06933 chlorophenyl)methoxy]phenyl}ethyl)azetidin-3-yl]-
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 849
1-cyclopropyl-N-(1-{[4-(pyridin-2- 405.1 2.66119
ylmethoxy)phenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 850 1-cyclopropyl-N-(1-{1-[4-(piperidin-3-
425.2 3.32842 ylmethoxy)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 851
N-{1-[1-(2-chloro-3-methoxyphenyl)ethyl]azetidin- 387.2 0.07206
3-yl}-5-cyclopropylpyridazine-3-carboxamide 852
(.+-.)-trans-N-(1-{[3- 382.3 0.98162
(benzyloxy)cyclobutyl]methyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 853
1-cyclopropyl-N-(1-{1-[4-(2- 432.3 0.77613
phenylethoxy)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 854 1-cyclopropyl-N-{1-[1-(4-{[4- 475.3
0.96536 (methylcarbamoyl)phenyl]methoxy}phenyl)ethyl]azetidin-
3-yl}-1H-1,2,3-triazole-4-carboxamide 855
1-cyclopropyl-N-[1-(1-{4-[(4- 448.3 0.15904
methoxyphenyl)methoxy]phenyl}ethyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide 856 5-cyclopropyl-N-{1-[1-(4-
353.2 0.60267 methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-
carboxamide 857 1-cyclopropyl-N-[1-(1-{4-[2- 399.2 1.97865
(dimethylamino)ethoxy]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide 858 1-cyclopropyl-N-[1-(1-{4-[3-
413.2 4.79409 (dimethylamino)propoxy]phenyl}ethyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide 859
N-{1-[1-(2-chlorophenyl)ethyl]azetidin-3-yl}-1- 346.2 0.16007
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 860
N-{1-[1-(5-chloro-2-methoxyphenyl)ethyl]azetidin- 376.2 2.79163
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4- carboxamide 861
5-cyclopropyl-N-{1-[1-(2,3- 383.2 0.12148
dimethoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3- carboxamide 862
N-(1-{1-[4-(benzylamino)phenyl]ethyl}azetidin-3- 417.3 0.334
yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 863
N-{1-[1-(4-benzamidophenyl)ethyl]azetidin-3-yl}-1- 431.3 1.73815
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 864
1-cyclopropyl-N-(1-{1-[4-(2,2- 398.3 3.14078
dimethylpropoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 865
1-cyclopropyl-N-{1-[1-(5-methoxypyrimidin-2- 344.2 1.6379
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4- carboxamide 866
N-{1-[(1S)-1-(3-chlorophenyl)propyl]azetidin-3-yl}- 371.2 0.35518
5-cyclopropylpyridazine-3-carboxamide 867 5-cyclopropyl-N-[3- 249.2
>50.0 (dimethylamino)propyl]pyridazine-3-carboxamide 868
N-(1-{1-[4-(benzyloxy)-3- 452.2 0.92507
chlorophenyl]ethyl}azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide 869 5-cyclopropyl-N-[2- 235.2
21.10972 (dimethylamino)ethyl]pyridazine-3-carboxamide 913
5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H- 249.2 1.69797
imidazole-2-carboxamide 914
5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3- 311.2 0.72872
yl}-1H-imidazole-2-carboxamide 915
5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3- 311.2 >50.0
yl}-1H-imidazole-2-carboxamide 916
5-cyclopropyl-N-[1-(propan-2-yl)piperidin-4- 289.3 29.10492
yl]pyridazine-3-carboxamide 917
5-cyclopropyl-N-(1-methylpiperidin-4- 261.2 >50.0
yl)pyridazine-3-carboxamide 918
5-cyclopropyl-N-(1-methylpiperidin-3- 261.3 >50.0
yl)pyridazine-3-carboxamide *IC.sub.50 values are an average of n =
1 to n = 50
TABLE-US-00009 TABLE 6A SMYD2 Biochem LCMS IC.sub.50 Cpd. No.
Chemical Name M + H (.mu.M)* 919
1-cyclopropyl-N-(1-isopropylazetidin-3-yl)-1H- 249.2 4.6
imidazole-4-carboxamide 920
N-(1-(1-(3-(2-chlorophenyl)-1H-indazol-5- 462.2 >50
yl)ethyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 921
1-cyclopropyl-N-(3-(dimethylamino)propyl)-1H- 238.3 5.4
1,2,3-triazole-4-carboxamide 922 1-cyclopropyl-N-(1-(1-(4- 417.2
0.65 ((phenylamino)methyl)phenyl)ethyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 923
1-cyclopropyl-N-(1-(1-(5-methoxypyridin-2- 343.3 2.7
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 924
1-cyclopropyl-N-(1-((6-(phenylamino)pyridin-3- 390.2
yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 925
1-cyclopropyl-N-(1-(1-(4-(piperidin-4- 425.3 4.3
ylmethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 926
N-(1-((6-(benzylamino)pyridin-3-yl)methyl)azetidin- 404.2
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 927
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 411.2 0.011
yl)methyl)azetidin-3-yl)-4-cyclopropyl-1H- imidazole-2-carboxamide
928 5-cyclopropyl-N-(1-(4-((1-methyl-1H-pyrazol-4- 419.3 0.61
yl)methoxy)benzyl)azetidin-3-yl)pyridazine-3- carboxamide 929
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 423.2 0.0012
yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3- carboxamide 930
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 422.7 0.0033
yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide 931
N-(1-((1-benzyl-1H-1,2,3-triazol-4- 379.3 11.1
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 932
1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H- 408.2 0.028
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
933 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 389.2 0.0078
yl)-5-cyclopropylpyridazine-3-carboxamide 934
5-cyclopropyl-N-(1-(1-(3- 353.2 0.69
methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3- carboxamide 935
1-cyclopropyl-N-(1-(1-(2-methyl-2H-indazol-5- 366.2 1.6
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 936
N-(1-((1-(benzo[d]thiazol-5-ylmethyl)-1H-pyrazol-4- 435.2 0.080
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 937
1-cyclopropyl-N-(1-((1-((4-methyloxazol-2- 383.2 0.12
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 938
N-(1-(1-(2-chloro-5-methoxyphenyl)ethyl)azetidin- 376.2 0.13
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 939
N-(1-(1-(4-(benzyloxy)-3- 448.3 3.6
methoxyphenyl)ethyl)azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide 940
N-(1-((1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1- 288.2 7.7
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 941
1-cyclopropyl-N-(1-((1-(4-(methylthio)benzyl)-1H- 424.2 0.028
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
942 N-(1-((1-(2-chlorobenzyl)-1H-pyrazol-4- 412.1 0.11
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 943
1-cyclopropyl-N-(1-((1-(4-(trifluoromethyl)benzyl)- 446.2 0.014
1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 944
1-cyclopropyl-N-(1-((1-(oxazol-2-ylmethyl)-1H- 369.2 0.92
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
945 1-cyclopropyl-N-(1-((1-(thiazol-4-ylmethyl)-1H- 385.2 1.2
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
946 1-cyclopropyl-N-(1-((1-ethyl-1H-pyrazol-4- 316.2 2.0
yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 947
N-(1-((1-(4-(tert-butyl)benzyl)-1H-pyrazol-4- 434.3 0.056
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 948
N-(1-((1-(cyclohexylmethyl)-1H-pyrazol-4- 384.3 0.36
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 949
1-cyclopropyl-N-(1-((1-((tetrahydro-2H-pyran-4- 386.2 2.4
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 950
1-cyclopropyl-N-(1-((1-((tetrahydrofuran-3- 372.3 2.0
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 951
1-cyclopropyl-N-(1-((1-(4-fluorobenzyl)-1H-pyrazol- 396.2 0.022
4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 952
1-cyclopropyl-N-(1-(1-(1-methyl-1H-indazol-5- 366.2 1.63
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 953
N-(1-(4-((1H-pyrazol-1-yl)methyl)benzyl)azetidin-3- 378.3 5.6
yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 954
N-(1-(4-((1H-pyrazol-1-yl)methyl)benzyl)azetidin-3- 389.3 2.4
yl)-5-cyclopropylpyridazine-3-carboxamide 955
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 378.2 0.073
yl)-5-cyclopropylisoxazole-3-carboxamide 956
N-(1-(1-(2-chloro-3-(2-hydroxy-2- 434.2 2.6
methylpropoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 957
1-cyclopropyl-N-(1-(1-(4-((4- 448.3 0.16
methoxybenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 958 5-cyclopropyl-N-(1-(1-(4- 353.2
0.60 methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3- carboxamide
959 1-cyclopropyl-N-(1-(1-(4-(2- 399.2 2.0
(dimethylamino)ethoxy)phenyl)ethyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 960 1-cyclopropyl-N-(1-(1-(4- 432.3
0.78 phenethoxyphenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 961 4-cyclopropyl-N-(1-isopropylazetidin-3-
260.2 1.3 yl)picolinamide 962 4-cyclopropyl-N-(1-(1-(2,5- 390.1
0.48 dichlorophenyl)ethyl)azetidin-3-yl)picolinamide 963
1-cyclopropyl-N-(1-(1-(4-((4- 475.3 0.97
(methylcarbamoyl)benzyl)oxy)phenyl)ethyl)azetidin-
3-yl)-1H-1,2,3-triazole-4-carboxamide 964 N-(1-(1-(2-chloro-3-(2-
416.2 10.5 hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-4-
cyclopropylpicolinamide 965
N-(1-(1-(2-chloro-3-methoxyphenyl)ethyl)azetidin- 387.2 0.072\
3-yl)-5-cyclopropylpyridazine-3-carboxamide 966
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 388.3 0.013
yl)-4-cyclopropylpicolinamide 967
N-(1-(4-(benzyloxy)benzyl)azetidin-3-yl)-4- 414.2 0.15
cyclopropylpicolinamide 968 1-cyclopropyl-N-(1-(1-(4-(2,2,2- 410.2
1.7 trifluoroethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 969 rac-N-(1-(((1r,3r)-3- 382.3 0.98
(benzyloxy)cyclobutyl)methyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 970
N-(1-(1-(5-chloro-2- 412.2 5.1
(difluoromethoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 971
1-cyclopropyl-N-(1-(1-(4-((4- 432.3 0.088
methylbenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 972 1-cyclopropyl-N-(1-(4-(pyridin-3-
405.3 1.3 ylmethoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide 973 N-(1-(1-(2-chloro-3-(2,3- 436.2 >50
dihydroxypropoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 974
1-cyclopropyl-N-(1-(1-(4- 418.3 0.87
(phenoxymethyl)phenyl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide 975 N-(1-(1-(2-chloro-3-(2- 419.3 5.4
(methylamino)ethoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 976
N-(1-(1-(5-chloro-2- 414.2 1.8
(trifluoromethyl)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 977
N-(1-(1-(2-chloro-3-(2- 433.2 7.5
(dimethylamino)ethoxy)phenyl)ethyl)azetidin-3-yl)-
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 978
N-(1-(1-(2-chloro-3-(2- 420.2 1.1
hydroxypropoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 979
1-cyclopropyl-N-(1-(1-methylpiperidin-2-yl)ethyl)- 278.2 >50
1H-1,2,3-triazole-4-carboxamide 980
N-(1-(2-(4-(benzyloxy)phenyl)propan-2-yl)azetidin- 432.3 0.99
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 981
5-cyclopropyl-N-(1-(1-methylpiperidin-2- 289.2 >50
yl)ethyl)pyridazine-3-carboxamide 982
1-cyclopropyl-N-(1-((1-(3-methoxybenzyl)-1H- 408.3 0.169
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
983 1-cyclopropyl-N-(1-(4-(1-hydroxy-2- 418.2 1.39
phenylethyl)benzyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
984 rac-1-cyclopropyl-N-((R)-2,2-dimethyl-1-((R)-1- 340.2 18.9
phenylethyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 985
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 412.2 0.0039
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 986
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 377.3 >50
yl)-5-cyclopropyl-1H-imidazole-2-carboxamide 987
N-(1-((1-(3-chlorobenzyl)-1H-pyrazol-4- 412.2 0.024
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 988 N-(1-(4-((1,3,4-thiadiazol-2- 412.2 1.9
yl)methoxy)benzyl)azetidin-3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide 989 N-(1-(1-(5-chloro-2-(4- 456.2
>50.0 fluorophenoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 990
1-cyclopropyl-N-(1-(1-(4-(piperidin-3- 425.2 3.3
ylmethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 991
1-cyclopropyl-N-(1-((1-(thiazol-2-ylmethyl)-1H- 385.2 0.76
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
992 1-cyclopropyl-N-(1-(4-(pyridin-2- 405.1 2.7
ylmethoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide
993 1-cyclopropyl-N-(1-((1-(4-methylbenzyl)-1H- 392.3 0.016
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
994 1-cyclopropyl-N-(1-(1-(6-oxo-1,6-dihydropyridin-3- 329.2 5.4
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 995
1-cyclopropyl-N-(1-((1-(2-methoxybenzyl)-1H- 408.2 1.3
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
996 N-(1-(1-(4-((4- 452.2 0.069
chlorobenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 997 N-(1-(1-(4-((3-
452.2 0.27 chlorobenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 998
1-cyclopropyl-N-(1-((1-isobutyl-1H-pyrazol-4- 343.4 2.4
yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 999
1-cyclopropyl-N-(1-(4-(thiazol-4- 411.2 1.1
ylmethoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide
1000 1-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)-1H-1,2,3- 264.1
>50 triazole-4-carboxamide 1001
N-(1-((1-(cyclobutylmethyl)-1H-pyrazol-4- 356.2 1.4
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide 1002
N-(1-(1-(2-chloro-4-methoxyphenyl)ethyl)azetidin- 376.2 0.088
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide 1003
5-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)pyridazine- 275.2 19.0
3-carboxamide 1004 1-cyclopropyl-N-(1-(1-(4-(2-oxo-2-(piperidin-1-
453.3 1.5 yl)ethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide 1005 4-cyclopropyl-N-(1-(1-(2,3- 381.9 0.13
dimethoxyphenyl)ethyl)azetidin-3-yl)picolinamide 1006
1-cyclopropyl-N-(1-((1-(cyclopropylmethyl)-1H- 342.2 1.7
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
1007 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 395.1
0.072
yl)-5-cyclopropyl-1,3,4-thiadiazole-2-carboxamide 1008
rac-N-(1-(((1s,3s)-3- 382.2 1.2
(benzyloxy)cyclobutyl)methyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 1009
N-(1-(1-(3-(2-aminoethoxy)-2- 405.3 5.7
chlorophenyl)ethyl)azetidin-3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide 1012
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 411.1
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H- imidazole-4-carboxamide
1017 1-cyclopropyl-N-(1-((1-((1-methyl-1H-pyrazol-4- 382.2
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide 1020 N-(1-(1-(4-((4- 475.3 0.95
acetamidobenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide 1021
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 379.2 0.065
yl)-5-cyclopropyl-1,3,4-oxadiazole-2-carboxamide 1022
N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 377.2 0.073
yl)-1-cyclopropyl-1H-imidazole-4-carboxamide 1023
5-cyclopropyl-N-((1R,3s,5S)-8-methyl-8- 287.2 6.3
azabicyclo[3.2.1]octan-3-yl)pyridazine-3- carboxamide 1024
5-cyclopropyl-N-((1R,3r,5S)-8-methyl-8- 287.2 >50
azabicyclo[3.2.1]octan-3-yl)pyridazine-3- carboxamide 1025
1-cyclopropyl-N-(1-(4-((1-methyl-1H-pyrazol-4- 408.3 1.2
yl)methoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole- 4-carboxamide
1026 rac-1-cyclopropyl-N-((R)-2,2-dimethyl-1-((S)-1- 340.3 0.91
phenylethyl)azetidin-3-yl)-1H-1,2,3-triazole-4- carboxamide 1028
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 413.2
yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3,4-
oxadiazole-2-carboxamide *IC.sub.50 values are an average of n = 1
to n = 50
[0111] In another embodiment, a Compound of the Disclosure is a
compound having Formulae I-XVII, provided that the compound is not
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)benzamide:
##STR01035##
[0112] In some embodiments, the disclosure relates to
pharmaceutical compositions comprising
N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)benzamide and a
pharmaceutically acceptable carrier.
[0113] In some embodiments, the disclosure relates to a method of
inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a
subject, comprising administering to a subject in need thereof an
effective amount of N-(1-((4-acetamidophenyl)
sulfonyl)piperidin-4-yl)benzamide.
Definitions
[0114] For the purpose of the present disclosure, the terms used in
connection with A or A.sup.1 have the chemical structures set forth
in Table 2, each of which may be optionally substituted with one or
more substituents, e.g., 1, 2, 3, 4, or 5 substituents, depending
on the nature of the group and the number of available positions.
For example, when A or A.sup.1 is 2-furanyl there are three carbon
atoms for available for substitution. When A or A.sup.1 is
2-naphthalenyl there are seven carbon atoms available for
substitution. Substitution may occur at any available carbon or
nitrogen atom. Optional substituents include, but are not limited
to, halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C.sub.1-6
alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl,
(cycloalkyl)alkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 5-
to 14-membered heteroaryl, optionally substituted 4- to 14-membered
heterocyclo, or aralkyl.
TABLE-US-00010 TABLE 2 A or A.sup.1 Chemical structure
1,2,3-triazolyl ##STR01036## 1,2,4-triazolyl ##STR01037##
1-imidazolyl ##STR01038## 1-isoquinolinyl ##STR01039## 1-pyrazolyl
##STR01040## 2-(1,2,3,4- tetrahydroquinolinyl) ##STR01041##
2-benzo[d]imidazolyl ##STR01042## 2-benzo[d]thiazolyl ##STR01043##
2-chromenyl-4-one ##STR01044## 2-furanyl ##STR01045##
2-imidazo[1,2-b]pyridazinyl ##STR01046## 2-imidazolyl ##STR01047##
2-indolyl ##STR01048## 2-naphthalenyl ##STR01049## 2-pyrazinyl
##STR01050## 2-pyridyl ##STR01051## 2-pyrimidinyl ##STR01052##
2-pyrrolidinyl ##STR01053## 2-pyrrolyl ##STR01054## 2-quinolinyl
##STR01055## 2-quinoxalinyl ##STR01056## 2-thiazolo[5,4-c]pyridinyl
##STR01057## 2-thiazolyl ##STR01058## 2-thiophenyl ##STR01059##
3-(1,2,3,4- tetrahydroisoquinoline) ##STR01060##
3-(1,2,4-oxadiazolyl) ##STR01061## 3-imidazo[1,2-a]pyrimidinyl
##STR01062## 3-indazolyl ##STR01063## 3-indolyl ##STR01064##
3-isothiazolyl ##STR01065## 3-pyrazolyl ##STR01066## 3-pyridazinyl
##STR01067## 3-pyridinyl-2-one ##STR01068## 3-pyridyl ##STR01069##
3-pyrrolo[3,2-b]pyridinyl ##STR01070## 3-quinolinyl ##STR01071##
4-(2,2- difluorobenzo[d][1,3]dioxolyl) ##STR01072##
4-cyclohexanyl-1-amine ##STR01073## 4-imidazolyl ##STR01074##
4-indolinyl-2-one ##STR01075## 4-indolyl ##STR01076##
4-isothiazolyl ##STR01077## 4-oxazolyl ##STR01078## 4-piperidinyl
##STR01079## 4-pyrazolyl ##STR01080## 4-pyridyl ##STR01081##
4-quinolinyl ##STR01082## 5-(1,3-dihydro-2H-
benzo[d]imidazolyl-2-one) ##STR01083##
5-(1,3-dihydro-2H-pyrrolo[2,3- b]pyridinyl-2-one) ##STR01084##
5-(1,3-dihydro-2H-pyrrolo[2,3- c]pyridinyl-2-one) ##STR01085##
5-(2,2- difluorobenzo[d][1,3]dioxolyl) ##STR01086##
5-(2,4-dihydro-3H-1,2,4- triazolyl-3-one) ##STR01087##
5-4H-furo[3,2-b]pyrrolyl ##STR01088## 5-benzo[c][1,2,5]oxadiazolyl
##STR01089## 5-benzo[d][1,3]dioxolyl ##STR01090##
5-benzo[d]oxazolyl-2(3H)-one ##STR01091##
5-bicyclo[2.2.1]heptyl-2-ene ##STR01092## 5-indolinyl-2,3-dione
##STR01093## 5-indolinyl-2-one ##STR01094## 5-indolyl ##STR01095##
5-isoindolinyl-1-one ##STR01096## 5-isoxazolyl ##STR01097##
5-pyrazolo[3,4-c]pyridinyl ##STR01098## 5-pyrazolyl ##STR01099##
5-pyrimidinyl ##STR01100## 5-thiazolyl ##STR01101## 6-(1,2,3,4-
tetrahydronaphthalenyl) ##STR01102## 6-(3,4-dihydroquinolinyl-
2(1H)-one) ##STR01103## 6-(3,4-dihydroquinoxalinyl- 2(1H)-one)
##STR01104## 6-(4,5-dihydropyridazinyl- 3(2H)-one) ##STR01105##
6-benzo[b][1,4]oxazinyl-3-one ##STR01106## 6-benzo[d]imidazolyl
##STR01107## 6-benzo[d]oxazolyl-2(3H)-one ##STR01108##
6-benzo[d]thiazolyl ##STR01109## 6-chromenyl-2-one ##STR01110##
6-imidazo[2,1-b]thiazole ##STR01111## 6-indazolyl ##STR01112##
6-indolinyl-2-one ##STR01113## 6-indolyl ##STR01114##
6-isoquinolinyl ##STR01115## 6-quinolinyl ##STR01116##
6-quinoxalinyl ##STR01117## 6-quinoxalinyl-2(1H)-one ##STR01118##
7-(3,4-dihydroquinolinyl- 2(1H)-one) ##STR01119##
7-(3,4-dihydroquinoxalin- 2(1H)-one) ##STR01120##
7-benzo[b][1,4]oxazinyl- 3-one ##STR01121## 7-indolinyl-2-one
##STR01122## 7-quinolinyl ##STR01123##
8-benzo[b][1,4]oxazinyl-3-one ##STR01124## cyclopropanyl
##STR01125## phenyl ##STR01126## 4-(prop-1-en-1-yl)-imidazole
##STR01127## 1-butanyl-imidazole ##STR01128## sec-butylcyclopropane
##STR01129## 2-(ethylsulfonyl)propanyl ##STR01130##
1-isobutylpyrrolidine ##STR01131## 4-pyridyl 1-oxide ##STR01132##
5-benzo[c][1,2,5]oxadiazolyl 1-oxide ##STR01133##
[0115] For the purpose of the present disclosure, the term "alkyl"
as used by itself or as part of another group refers to a straight-
or branched-chain aliphatic hydrocarbon containing one to twelve
carbon atoms (i.e., C.sub.3-12 alkyl) or the number of carbon atoms
designated (i.e., a C.sub.1 alkyl such as methyl, a C.sub.2 alkyl
such as ethyl, a C.sub.3 alkyl such as propyl or isopropyl, etc.).
In one embodiment, the alkyl group is chosen from a straight chain
C.sub.1-10 alkyl group. In another embodiment, the alkyl group is
chosen from a branched chain C.sub.3-10 alkyl group. In another
embodiment, the alkyl group is chosen from a straight chain
C.sub.1-6 alkyl group. In another embodiment, the alkyl group is
chosen from a branched chain C.sub.3-6 alkyl group. In another
embodiment, the alkyl group is chosen from a straight chain
C.sub.1-4 alkyl group. In another embodiment, the alkyl group is
chosen from a branched chain C.sub.3-4 alkyl group. In another
embodiment, the alkyl group is chosen from a straight or branched
chain C.sub.3-4 alkyl group. In another embodiment, the alkyl group
is partially or completely deuterated, i.e., one or more hydrogen
atoms of the alkyl group are replaced with deuterium atoms.
Non-limiting exemplary C.sub.1-10 alkyl groups include methyl
(including -CD.sub.3), ethyl, propyl, isopropyl, butyl, sec-butyl,
ten-butyl, iso-butyl, 3-pentyl, hexyl, heptyl, octyl, nonyl, and
decyl. Non-limiting exemplary C.sub.1-4 alkyl groups include
methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, and
iso-butyl.
[0116] For the purpose of the present disclosure, the term
"optionally substituted alkyl" as used by itself or as part of
another group means that the alkyl as defined above is either
unsubstituted or substituted with one, two, or three substituents
independently chosen from nitro, haloalkoxy, aryloxy, aralkyloxy,
alkylthio, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, alkoxycarbonyl, and
carboxyalkyl. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In
another embodiment, the alkyl is a C.sub.1-4 alkyl. In one
embodiment, the optionally substituted alkyl is substituted with
two substituents. In another embodiment, the optionally substituted
alkyl is substituted with one substituent. Non-limiting exemplary
optionally substituted alkyl groups include
--CH.sub.2CH.sub.2NO.sub.2, --CH.sub.2CH.sub.2CO.sub.2H,
--CH.sub.2CH.sub.2SO.sub.2CH.sub.3, --CH.sub.2CH.sub.2COPh, and
--CH.sub.2CH.sub.11.
[0117] For the purpose of the present disclosure, the term
"alkylenyl" as used herein by itself or part of another group
refers to a divalent form of an alkyl group as defined above. In
one embodiment, the alkylenyl is a divalent form of a C.sub.1-6
alkyl. In one embodiment, the alkylenyl is a divalent form of a
C.sub.1-4 alkyl. Non-limiting exemplary alkylenyl groups include
--CH.sub.2CH.sub.2--, --CH.sub.2CH.sub.2CH.sub.2--,
--CH.sub.2CH(CH.sub.3)CH.sub.2--, and
--CH.sub.2C(CH.sub.3).sub.2CH.sub.2--.
[0118] For the purpose of the present disclosure, the term
"cycloalkyl" as used by itself or as part of another group refers
to saturated and partially unsaturated (containing one or two
double bonds) cyclic aliphatic hydrocarbons containing one to three
rings having from three to twelve carbon atoms (i.e., C.sub.3-12
cycloalkyl) or the number of carbons designated. In one embodiment,
the cycloalkyl group has two rings. In one embodiment, the
cycloalkyl group has one ring. In another embodiment, the
cycloalkyl group is chosen from a C.sub.3-8 cycloalkyl group. In
another embodiment, the cycloalkyl group is chosen from a C.sub.3-6
cycloalkyl group. Non-limiting exemplary cycloalkyl groups include
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl,
cyclooctyl, norbornyl, decalin, adamantyl, cyclohexenyl,
spiro[3.3]heptane, and bicyclo[3.3.1]nonane.
[0119] For the purpose of the present disclosure, the term
"optionally substituted cycloalkyl" as used by itself or as part of
another group means that the cycloalkyl as defined above is either
unsubstituted or substituted with one, two, or three substituents
independently chosen from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, cycloalkylamino, haloalkyl, hydroxyalkyl,
alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, or (heteroaryl)alkyl. In one
embodiment, the optionally substituted cycloalkyl is substituted
with two substituents. In another embodiment, the optionally
substituted cycloalkyl is substituted with one substituent. In one
embodiment, the optionally substituted cycloalkyl is an
(amino)cycloalkyl. For the purpose of the present disclosure, the
term "(amino)cycloalkyl" as used by itself or as part of another
group means that the optionally substituted cycloalkyl as defined
above is substituted with one amino or alkylamino group, and
optionally one or two additional substituents. In one embodiment,
the optionally substituted cycloalkyl is an (amino)cyclohexyl. For
the purpose of the present disclosure, the term "(amino)cyclohexyl"
as used by itself or as part of another group means that the
optionally substituted cycloalkyl as defined above is a cyclohexyl
group substituted with one amino or alkylamino group, and
optionally one or two additional substituents. Non-limiting
exemplary optionally substituted cycloalkyl groups include:
##STR01134## ##STR01135##
[0120] Non-limiting exemplary (amino)cycloalkyl groups include:
##STR01136##
[0121] Non-limiting exemplary (amino)cyclohexyl groups include:
##STR01137##
[0122] For the purpose of the present disclosure, the term
"optionally substituted cyclohexyl" as used by itself or as part of
another group means that the optionally substituted cycloalkyl as
defined above is an optionally substituted cyclohexyl group.
[0123] For the purpose of the present disclosure, the term
"cycloalkylenyl" as used herein by itself or part of another group
refers to a divalent form of an optionally substituted cycloalkyl
group as defined above. In one embodiment, the cycloalkylenyl is a
"cyclohexylenyl." The term "cyclohexylenyl" as used herein by
itself or part of another group refers to a divalent form of an
optionally substituted cyclohexyl group. Non-limiting exemplary
cycloalkylenyl groups include:
##STR01138##
[0124] For the purpose of the present disclosure, the term
"1,4-cyclohexylenyl" as used herein by itself or part of another
group refers to a cyclohexylenyl as defined above wherein the 1-
and 4-positions of the cyclohexyl ring are substituted.
Non-limiting exemplary 1,4-cyclohexylenyl groups include:
##STR01139##
[0125] For the purpose of the present disclosure, the term
"(cycloalkylenyl)alkyl" as used herein by itself or part of another
group refers to an alkyl group substituted with a divalent form of
an optionally substituted cycloalkyl group. In one embodiment, the
cycloalkylenyl is a divalent for of optionally substituted
cyclohexyl. In one embodiment, the alkyl is C.sub.1-4 alkyl.
Non-limiting exemplary (cycloalkylenyl)alkyl groups include:
##STR01140##
[0126] For the purpose of the present disclosure, the term
"cycloalkenyl" as used by itself or part of another group refers to
a partially unsaturated cycloalkyl group as defined above. In one
embodiment, the cycloalkenyl has one carbon-to-carbon double bond.
In another embodiment, the cycloalkenyl group is chosen from a
C.sub.4-8 cycloalkenyl group. Exemplary cycloalkenyl groups include
cyclopentenyl and cyclohexenyl.
[0127] For the purpose of the present disclosure, the term
"optionally substituted cycloalkenyl" as used by itself or as part
of another group means that the cycloalkenyl as defined above is
either unsubstituted or substituted with one, two, or three
substituents independently chosen from halo, nitro, cyano, hydroxy,
amino, alkylamino, dialkylamino, haloalkyl, monohydroxyalkyl,
dihydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one
embodiment, the optionally substituted cycloalkenyl is substituted
with two substituents. In another embodiment, the optionally
substituted cycloalkenyl is substituted with one substituent. In
another embodiment, the cycloalkenyl is unsubstituted.
[0128] For the purpose of the present disclosure, the term
"alkenyl" as used by itself or as part of another group refers to
an alkyl group as defined above containing one, two or three
carbon-to-carbon double bonds. In one embodiment, the alkenyl group
is chosen from a C.sub.2-6 alkenyl group. In another embodiment,
the alkenyl group is chosen from a C.sub.2-4 alkenyl group.
Non-limiting exemplary alkenyl groups include ethenyl, propenyl,
isopropenyl, butenyl, sec-butenyl, pentenyl, and hexenyl.
[0129] For the purpose of the present disclosure, the term
"optionally substituted alkenyl" as used herein by itself or as
part of another group means the alkenyl as defined above is either
unsubstituted or substituted with one, two or three substituents
independently chosen from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy,
haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido,
sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl,
optionally substituted cycloalkyl, alkenyl, alkynyl, optionally
substituted aryl, optionally substituted heteroaryl, or optionally
substituted heterocyclo.
[0130] For the purpose of the present disclosure, the term
"alkynyl" as used by itself or as part of another group refers to
an alkyl group as defined above containing one to three
carbon-to-carbon triple bonds. In one embodiment, the alkynyl has
one carbon-to-carbon triple bond. In one embodiment, the alkynyl
group is chosen from a C.sub.2-6 alkynyl group. In another
embodiment, the alkynyl group is chosen from a C.sub.2-4 alkynyl
group. Non-limiting exemplary alkynyl groups include ethynyl,
propynyl, butynyl, 2-butynyl, pentynyl, and hexynyl groups.
[0131] For the purpose of the present disclosure, the term
"optionally substituted alkynyl" as used herein by itself or as
part of another group means the alkynyl as defined above is either
unsubstituted or substituted with one, two or three substituents
independently chosen from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy,
haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido,
sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl,
cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclo.
[0132] For the purpose of the present disclosure, the term
"haloalkyl" as used by itself or as part of another group refers to
an alkyl group substituted by one or more fluorine, chlorine,
bromine and/or iodine atoms. In one embodiment, the alkyl group is
substituted by one, two, or three fluorine and/or chlorine atoms.
In another embodiment, the haloalkyl group is chosen from a
C.sub.1-4 haloalkyl group. Non-limiting exemplary haloalkyl groups
include fluoromethyl, difluoromethyl, trifluoromethyl,
pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl,
2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, 4,4,4-trifluorobutyl,
and trichloromethyl groups.
[0133] For the purpose of the present disclosure, the term
"fluoroalkyl" as used by itself or as part of another group refers
to an alkyl group substituted by one or more fluorine atoms. In one
embodiment, the alkyl group is substituted by one, two, or three
fluorine atoms. In another embodiment, the fluoroalkyl group is
chosen from a C.sub.1-4 fluoroalkyl group. Non-limiting exemplary
fluoroalkyl groups include fluoromethyl, difluoromethyl,
trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl,
2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, and
4,4,4-trifluorobutyl.
[0134] For the purpose of the present disclosure, the term
"hydroxyalkyl" as used by itself or as part of another group refers
to an alkyl group substituted with one or more, e.g., one, two, or
three, hydroxy groups. In one embodiment, the hydroxyalkyl group is
a monohydroxyalkyl group, i.e., substituted with one hydroxy group.
In another embodiment, the hydroxyalkyl group is a dihydroxyalkyl
group, i.e., substituted with two hydroxy groups. In another
embodiment, the hydroxyalkyl group is chosen from a C.sub.1-4
hydroxyalkyl group. Non-limiting exemplary hydroxyalkyl groups
include hydroxymethyl, hydroxyethyl, hydroxypropyl and hydroxybutyl
groups, such as 1-hydroxyethyl, 2-hydroxyethyl, 1,2-dihydroxyethyl,
2-hydroxypropyl, 3-hydroxypropyl, 3-hydroxybutyl, 4-hydroxybutyl,
2-hydroxy-1-methylpropyl, and 1,3-dihydroxyprop-2-yl.
[0135] For the purpose of the present disclosure, the term "alkoxy"
as used by itself or as part of another group refers to an
optionally substituted alkyl, optionally substituted cycloalkyl,
optionally substituted alkenyl or optionally substituted alkynyl
attached to a terminal oxygen atom. In one embodiment, the alkoxy
group is chosen from a C.sub.1-4 alkoxy group. In another
embodiment, the alkoxy group is chosen from a C.sub.1-4 alkyl
attached to a terminal oxygen atom, e.g., methoxy, ethoxy,
tert-butoxy, --OCH.sub.2C.ident.CH, --OCH.sub.2C.ident.CCH.sub.3,
and --OCH.sub.2CH.sub.2CH.sub.2C.ident.CH.
[0136] For the purpose of the present disclosure, the term
"alkylthio" as used by itself or as part of another group refers to
a sulfur atom substituted by an optionally substituted alkyl group.
In one embodiment, the alkylthio group is chosen from a C.sub.1-4
alkylthio group. Non-limiting exemplary alkylthio groups include
--SCH.sub.3, and --SCH.sub.2CH.sub.3.
[0137] For the purpose of the present disclosure, the term
"alkoxyalkyl" as used by itself or as part of another group refers
to an alkyl group substituted with an alkoxy group. Non-limiting
exemplary alkoxyalkyl groups include methoxymethyl, methoxyethyl,
methoxypropyl, methoxybutyl, ethoxymethyl, ethoxyethyl,
ethoxypropyl, ethoxybutyl, propoxymethyl, iso-propoxymethyl,
propoxyethyl, propoxypropyl, butoxymethyl, tert-butoxymethyl,
isobutoxymethyl, sec-butoxymethyl, pentyloxymethyl,
--CH.sub.2OCH.sub.2C.ident.CH and
--CH.sub.2OCH.sub.2CH.sub.2CH.sub.2C.ident.CH.
[0138] For the purpose of the present disclosure, the term
"haloalkoxy" as used by itself or as part of another group refers
to a haloalkyl attached to a terminal oxygen atom. Non-limiting
exemplary haloalkoxy groups include fluoromethoxy, difluoromethoxy,
trifluoromethoxy, and 2,2,2-trifluoroethoxy.
[0139] For the purpose of the present disclosure, the term
"heteroalkyl" as used by itself or part of another group refers to
a stable straight or branched chain hydrocarbon radical containing
1 to 10 carbon atoms and at least two heteroatoms, which can be the
same or different, selected from O, N, or S, wherein: 1) the
nitrogen atom(s) and sulfur atom(s) can optionally be oxidized;
and/or 2) the nitrogen atom(s) can optionally be quaternized. The
heteroatoms can be placed at any interior position of the
heteroalkyl group or at a position at which the heteroalkyl group
is attached to the remainder of the molecule. In one embodiment,
the heteroalkyl group contains two oxygen atoms. In one embodiment,
the heteroalkyl contains one oxygen and one nitrogen atom, e.g., a
(hydroxyalkylamino)alkyl group, e.g.,
--CH.sub.2N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OH. In one embodiment,
the heteroalkyl contains two nitrogen atoms. Non-limiting exemplary
heteroalkyl groups include --CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3,
--OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3,
--CH.sub.2NHCH.sub.2CH.sub.2OCH.sub.2, --OCH.sub.2CH.sub.2NH.sub.2,
--NHCH.sub.2CH.sub.2N(H)CH.sub.3, --NHCH.sub.2CH.sub.2OCH.sub.3,
--CH.sub.2OCH.sub.2CH.sub.2NH.sub.2,
--CH.sub.2OCH.sub.2CH.sub.2N(H)CH.sub.2CH.sub.3, and
--OCH.sub.2CH.sub.2OCH.sub.3.
[0140] For the purpose of the present disclosure, the term "aryl"
as used by itself or as part of another group refers to a
monocyclic or bicyclic aromatic ring system having from six to
fourteen carbon atoms (i.e., C.sub.6-14 aryl). Non-limiting
exemplary aryl groups include phenyl (abbreviated as "Ph"),
naphthyl, phenanthryl, anthracyl, indenyl, azulenyl, biphenyl,
biphenylenyl, and fluorenyl groups. In one embodiment, the aryl
group is chosen from phenyl or naphthyl. In one embodiment, the
aryl group is phenyl.
[0141] For the purpose of the present disclosure, the term
"optionally substituted aryl" as used herein by itself or as part
of another group means that the aryl as defined above is either
unsubstituted or substituted with one to five substituents
independently selected from the group consisting of halo, nitro,
cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino,
haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy,
heteroaryloxy, aralkyl, aralkyloxy, (aralkyloxy)alkyl, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, heteroalkyl, optionally substituted alkyl, optionally
substituted cycloalkyl, alkenyl, alkynyl, optionally substituted
aryl, optionally substituted heteroaryl, optionally substituted
heterocyclo, (C.sub.1-4 haloalkoxy)alkyl, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
(carboxamido)alkyl-O--, mercaptoalkyl, (heterocyclo)alkyl,
(heterocyclo)alkyl-O--, (cycloalkylamino)alkyl,
(hydroxyalkylamino)alkyl, (amino)(heteroaryl)alkyl,
(heterocycloamino)alkyl (amino)(hydroxy)alkyl, (heteroaryl)alkyl,
(heteroaryl)alkyl-O--, --N(R.sup.43)(R.sup.44),
--CH.sub.2N(R.sup.43)(R.sup.44), --CH.sub.2N(H)C(.dbd.O)--R.sup.45,
and --N(H)C(.dbd.O)--R.sup.45, wherein R.sup.43 is hydrogen,
C.sub.1-4 alkyl, optionally substituted aryl, or optionally
substituted heteroaryl; R.sup.44 is alkoxyalkyl,
(heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, aralkyl, or
(dialkylamino)alkyl; and R.sup.45 is alkyl, alkoxyalkyl,
(heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, optionally substituted aryl, optionally
substituted heteroaryl, aralkyl, or (heteroaryl)alkyl. In another
embodiment, the optionally substituted aryl is substituted with one
to five substituents independently selected from the group
consisting of halo, nitro, cyano, hydroxy, amino, alkylamino,
dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy,
heteroaryloxy, aralkyl, aralkyloxy, (aralkyloxy)alkyl, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, heteroalkyl, optionally substituted alkyl, optionally
substituted cycloalkyl, alkenyl, alkynyl, optionally substituted
aryl, optionally substituted heteroaryl, optionally substituted
heterocyclo, (C.sub.1-4 haloalkoxy)alkyl, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl,
(hydroxyalkylamino)alkyl, (amino)(heteroaryl)alkyl,
(heterocycloamino)alkyl (amino)(hydroxy)alkyl, (heteroaryl)alkyl,
--N(R.sup.43)(R.sup.44), --CH.sub.2N(H)C(.dbd.O)--R.sup.4, and
--N(H)C(.dbd.O)--R.sup.45.
[0142] In one embodiment, the optionally substituted aryl is an
optionally substituted phenyl. In one embodiment, the optionally
substituted phenyl has four substituents. In another embodiment,
the optionally substituted phenyl has three substituents. In
another embodiment, the optionally substituted phenyl has two
substituents. In another embodiment, the optionally substituted
phenyl has one substituent. In another embodiment, the optionally
substituted phenyl has at least one amino, alkylamino,
dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(amino)(heteroaryl)alkyl, or (amino)(hydroxy)alkyl substituent.
Non-limiting exemplary substituted aryl groups include
2-methylphenyl, 2-methoxyphenyl, 2-fluorophenyl, 2-chlorophenyl,
2-bromophenyl, 3-methylphenyl, 3-methoxyphenyl, 3-fluorophenyl,
3-chlorophenyl, 4-methylphenyl, 4-ethylphenyl, 4-methoxyphenyl,
4-fluorophenyl, 4-chlorophenyl, 2,6-di-fluorophenyl,
2,6-di-chlorophenyl, 2-methyl, 3-methoxyphenyl, 2-ethyl,
3-methoxyphenyl, 3,4-di-methoxyphenyl, 3,5-di-fluorophenyl
3,5-di-methylphenyl, 3,5-dimethoxy, 4-methylphenyl,
2-fluoro-3-chlorophenyl, 3-chloro-4-fluorophenyl, and
2-phenylpropan-2-amine. The term optionally substituted aryl is
meant to include aryl groups having fused optionally substituted
cycloalkyl and fused optionally substituted heterocyclo rings.
Examples include:
##STR01141##
[0143] For the purpose of the present disclosure, the term
"arylenyl" as used herein by itself or part of another group refers
to a divalent form of an optionally substituted aryl group as
defined above. In one embodiment, the arylenyl is a divalent form
of an optionally substituted phenyl. In one embodiment, the
arylenyl is a divalent form of phenyl. Non-limiting exemplary
alkylenyl groups include:
##STR01142##
[0144] For the purpose of the present disclosure, the term
"aryloxy" as used by itself or as part of another group refers to
an optionally substituted aryl attached to a terminal oxygen atom.
A non-limiting exemplary aryloxy group is PhO--.
[0145] For the purpose of the present disclosure, the term
"heteroaryloxy" as used by itself or as part of another group
refers to an optionally substituted heteroaryl attached to a
terminal oxygen atom.
[0146] For the purpose of the present disclosure, the term
"aralkyloxy" or "arylalkyloxy" as used by itself or as part of
another group refers to an aralkyl group attached to a terminal
oxygen atom. A non-limiting exemplary aralkyloxy group is
PhCH.sub.2O--.
[0147] For the purpose of the present disclosure, the term
"(aralkyloxy)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with an aralkyloxy group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting
exemplary "(aralkyloxy)alkyl" groups include
--CH.sub.2OCH.sub.2(3-F-Ph) and
--CH.sub.2OCH.sub.2CH.sub.2CH.sub.2(2-OMe-Ph).
[0148] For the purpose of the present disclosure, the term
"heteroaryl" or "heteroaromatic" refers to monocyclic and bicyclic
aromatic ring systems having 5 to 14 ring atoms (i.e., a 5- to
14-membered heteroaryl) and 1, 2, 3, or 4 heteroatoms independently
chosen from oxygen, nitrogen, or sulfur. In one embodiment, the
heteroaryl has three heteroatoms. In another embodiment, the
heteroaryl has two heteroatoms. In another embodiment, the
heteroaryl has one heteroatom. In one embodiment, the heteroaryl
has 5 ring atoms, e.g., thienyl, a 5-membered heteroaryl having
four carbon atoms and one sulfur atom. In another embodiment, the
heteroaryl has 6 ring atoms, e.g., pyridyl, a 6-membered heteroaryl
having five carbon atoms and one nitrogen atom. Non-limiting
exemplary heteroaryl groups include thienyl, benzo[b]thienyl,
naphtho[2,3-b]thienyl, thianthrenyl, furyl, benzofuryl, pyranyl,
isobenzofuranyl, benzooxazonyl, chromenyl, xanthenyl, 2H-pyrrolyl,
pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrazinyl, pyrimidinyl,
pyridazinyl, isoindolyl, 3H-indolyl, indolyl, indazolyl, purinyl,
isoquinolyl, quinolyl, phthalazinyl, naphthyridinyl, cinnolinyl,
quinazolinyl, pteridinyl, 4aH-carbazolyl, carbazolyl, f-carbolinyl,
phenanthridinyl, acridinyl, pyrimidinyl, phenanthrolinyl,
phenazinyl, thiazolyl, isothiazolyl, phenothiazolyl, isoxazolyl,
furazanyl, and phenoxazinyl. In one embodiment, the heteroaryl is
chosen from thienyl (e.g., thien-2-yl and thien-3-yl), furyl (e.g.,
2-furyl and 3-furyl), pyrrolyl (e.g., 1H-pyrrol-2-yl and
1H-pyrrol-3-yl), imidazolyl (e.g., 2H-imidazol-2-yl and
2H-imidazol-4-yl), pyrazolyl (e.g., 1H-pyrazol-3-yl,
1H-pyrazol-4-yl, and 1H-pyrazol-5-yl), pyridyl (e.g., pyridin-2-yl,
pyridin-3-yl, and pyridin-4-yl), pyrimidinyl (e.g., pyrimidin-2-yl,
pyrimidin-4-yl, and pyrimidin-5-yl), thiazolyl (e.g., thiazol-2-yl,
thiazol-4-yl, and thiazol-5-yl), isothiazolyl (e.g.,
isothiazol-3-yl, isothiazol-4-yl, and isothiazol-5-yl), oxazolyl
(e.g., oxazol-2-yl, oxazol-4-yl, and oxazol-5-yl) and isoxazolyl
(e.g., isoxazol-3-yl, isoxazol-4-yl, and isoxazol-5-yl). The term
"heteroaryl" is also meant to include possible N-oxides. Exemplary
N-oxides include pyridyl N-oxide.
[0149] For the purpose of the present disclosure, the term
"optionally substituted heteroaryl" as used by itself or as part of
another group means that the heteroaryl as defined above is either
unsubstituted or substituted with one to four substituents, e.g.,
one or two substituents, independently chosen from halo, nitro,
cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl,
hydroxyalkyl, alkoxy, haloalkoxy, aralkyl, aryloxy, aralkyloxy,
alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, (heteroaryl)alkyl,
--N(R.sup.43)(R.sup.44), or --N(H)C(.dbd.O)--R.sup.45, wherein
R.sup.43 is hydrogen or Ca alkyl; R.sup.44 is alkoxyalkyl,
(heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, or
(dialkylamino)alkyl; and R.sup.45 is alkyl, optionally substituted
aryl, or optionally substituted heteroaryl. In one embodiment, the
optionally substituted heteroaryl has one substituent. In one
embodiment, the substituent is amino, alkylamino, dialkylamino,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (heterocyclo)alkyl, --N(R.sup.43)(R.sup.44),
or --N(H)C(.dbd.O)--R.sup.45. In another embodiment, the
substituent is aralkyl or (heteroaryl)alkyl. Examples include:
##STR01143##
In one embodiment, the optionally substituted is an optionally
substituted pyridyl, i.e., 2-, 3-, or 4-pyridyl. Any available
carbon or nitrogen atom can be substituted. The term optionally
substituted heteroaryl is meant to include heteroaryl groups having
fused optionally substituted cycloalkyl and fused optionally
substituted heterocyclo rings. Examples include:
##STR01144##
[0150] For the purpose of the present disclosure, the term
"heteroarylenyl" as used herein by itself or part of another group
refers to a divalent form of an optionally substituted heteroaryl
group as defined above. In one embodiment, the heteroarylenyl is a
divalent form of an optionally substituted pyridyl. Non-limiting
exemplary heteroarylenyl groups include:
##STR01145##
[0151] For the purpose of the present disclosure, the term
"heterocycle" or "heterocyclo" as used by itself or as part of
another group refers to saturated and partially unsaturated (e.g.,
containing one or two double bonds) cyclic groups containing one,
two, or three rings having from three to fourteen ring members
(i.e., a 3- to 14-membered heterocyclo) and at least one
heteroatom. Each heteroatom is independently selected from the
group consisting of oxygen, sulfur, including sulfoxide and
sulfone, and/or nitrogen atoms, which can be quaternized. The term
"heterocyclo" is meant to include cyclic ureido groups such as
imidazolidinyl-2-one, cyclic amide groups such as .beta.-lactam,
.gamma.-lactam, .delta.-lactam and .epsilon.-lactam, and cyclic
carbamate groups such as oxazolidinyl-2-one. The term "heterocyclo"
is also meant to include groups having fused optionally substituted
aryl groups, e.g., indolinyl, indolinyl-2-one,
benzo[d]oxazolyl-2(3H)-one. In one embodiment, the heterocyclo
group is chosen from a 4-, 5-, 6-, 7- or 8-membered cyclic group
containing one ring and one or two oxygen and/or nitrogen atoms. In
one embodiment, the heterocyclo group is chosen from a 5- or
6-membered cyclic group containing one ring and one or two nitrogen
atoms. In one embodiment, the heterocyclo group is chosen from a
8-, 9-, 10-, 11-, or 12-membered cyclic group containing two rings
and one or two nitrogen atoms. The heterocyclo can be optionally
linked to the rest of the molecule through a carbon or nitrogen
atom. Non-limiting exemplary heterocyclo groups include
2-oxopyrrolidin-3-yl, 2-imidazolidinone, piperidinyl, morpholinyl,
piperazinyl, pyrrolidinyl, 8-azabicyclo[3.2.1]octane (nortropane),
6-azaspiro[2.5]octane, 6-azaspiro[3.4]octane, indolinyl,
indolinyl-2-one, 1,3-dihydro-2H-benzo[d]imidazol-2-one
[0152] For the purpose of the present disclosure, the term
"optionally substituted heterocyclo" as used herein by itself or
part of another group means the heterocyclo as defined above is
either unsubstituted or substituted with one to four substituents
independently selected from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, aralkylamino, haloalkyl, hydroxyalkyl,
alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl,
heteroaryl, heterocyclo, alkoxyalkyl, (amino)alkyl,
hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl,
(cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl,
(heterocyclo)alkyl, and (heteroaryl)alkyl. Substitution may occur
on any available carbon or nitrogen atom, and may form a
spirocycle. In another embodiment, the optionally substituted
heterocyclo is substituted with one to four substituents
independently selected from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy,
haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido,
sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl,
cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo,
alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one
embodiment, the optionally substituted heterocyclo is substituted
with at least one amino, alkylamino, or dialkylamino group.
Non-limiting exemplary optionally substituted heterocyclo groups
include:
##STR01146## ##STR01147##
[0153] For the purpose of the present disclosure, the term
"heterocyclenyl" as used herein by itself or part of another group
refers to a divalent form of an optionally substituted heterocyclo
group as defined above. In one embodiment, the heterocyclenyl is a
divalent form of an optionally substituted azetidine. In one
embodiment, the heterocyclenyl is a divalent form of an optionally
substituted piperidinyl. Non-limiting exemplary heterocyclenyl
groups include:
##STR01148##
[0154] For the purpose of the present disclosure, the term
"optionally substituted pyrrolidinyl" as used by itself or as part
of another group means that the optionally substituted heterocyclo
as defined above is an optionally substituted pyrolidinyl
group.
[0155] For the purpose of the present disclosure, the term
"optionally substituted pyrrolidinenyl" as used herein by itself or
part of another group refers to a divalent form of an optionally
substituted pyrrolidinyl group as defined above. Non-limiting
exemplary optionally substituted pyrrolidinenyl groups include:
##STR01149##
[0156] For the purpose of the present disclosure, the term "amino"
as used by itself or as part of another group refers to
--NH.sub.2.
[0157] For the purpose of the present disclosure, the term
"alkylamino" as used by itself or as part of another group refers
to --NHR.sup.22, wherein R.sup.22 is C.sub.1-6 alkyl. In one
embodiment, R.sup.22 is C.sub.1-4 alkyl. Non-limiting exemplary
alkylamino groups include --N(H)CH.sub.3 and
--N(H)CH.sub.2CH.sub.3.
[0158] For the purpose of the present disclosure, the term
"dialkylamino" as used by itself or as part of another group refers
to --NR.sup.23aR.sup.23b, wherein R.sup.23a and R.sup.23b are each
independently C.sub.1-6 alkyl. In one embodiment, R.sup.23a and
R.sup.23b are each independently C.sub.1-4 alkyl. Non-limiting
exemplary dialkylamino groups include --N(CH.sub.3).sub.2 and
--N(CH.sub.3)CH.sub.2CH(CH.sub.3).sub.2.
[0159] For the purpose of the present disclosure, the term
"hydroxyalkylamino" as used by itself or as part of another group
refers to --NR.sup.24aR.sup.24b, wherein R.sup.24a is hydrogen or
C.sub.1-4 alkyl, and R.sup.24b is hydroxyalkyl. Non-limiting
exemplary hydroxyalkylamino groups include
--N(H)CH.sub.2CH.sub.2OH, --N(H)CH.sub.2CH.sub.2CH.sub.2OH,
--N(CH.sub.3)CH.sub.2CH.sub.2OH, and
--N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OH.
[0160] For the purpose of the present disclosure, the term
"(hydroxyalkylamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with an
hydroxyalkylamino group. In one embodiment, the alkyl is a
C.sub.1-4 alkyl. A non-limiting exemplary (hydroxyalkylamino)alkyl
group is --CH.sub.2N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OH.
[0161] For the purpose of the present disclosure, the term
"cycloalkylamino" as used by itself or as part of another group
refers to --NR.sup.25aR.sup.25b, wherein R.sup.25a is optionally
substituted cycloalkyl and R.sup.25b is hydrogen or C.sub.1-4
alkyl.
[0162] For the purpose of the present disclosure, the term
"heterocycloamino" as used by itself or as part of another group
refers to --NR.sup.25cR.sup.25d, wherein R.sup.25c is optionally
substituted heterocyclo and R.sup.25d is hydrogen or C.sub.1-4
alkyl. Non-limiting exemplary heterocycloamino groups include:
##STR01150##
[0163] For the purpose of the present disclosure, the term
"(heterocycloamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with an heterocycloamino
group. In one embodiment, the alkyl is a C.sub.1-4 alkyl.
[0164] For the purpose of the present disclosure, the term
"aralkylamino" as used by itself or as part of another group refers
to --NR.sup.26aR.sup.26b, wherein R.sup.26a is aralkyl and
R.sup.26b is hydrogen or C.sub.1-4 alkyl. Non-limiting exemplary
aralkylamino groups include --N(H)CH.sub.2Ph and
--N(CH.sub.3)CH.sub.2Ph.
[0165] For the purpose of the present disclosure, the term
"(amino)alkyl" as used by itself or as part of another group refers
to an alkyl group substituted with an amino group. In one
embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary
(amino)alkyl groups include --CH.sub.2NH.sub.2,
--C(NH.sub.2)(H)CH.sub.3, --CH.sub.2CH.sub.2NH.sub.2,
--CH.sub.2C(NH.sub.2)(H)CH.sub.3,
--CH.sub.2CH.sub.2CH.sub.2NH.sub.2,
--CH.sub.2CH.sub.2CH.sub.2CH.sub.2NH.sub.2, and
--CH.sub.2C(CH.sub.3).sub.2CH.sub.2NH.sub.2
[0166] For the purpose of the present disclosure, the term
"(alkylamino)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with an alkylamino group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. A non-limiting
exemplary (alkylamino)alkyl group is
--CH.sub.2CH.sub.2N(H)CH.sub.3.
[0167] For the purpose of the present disclosure, the term
"(dialkylamino)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted by a dialkylamino group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting
exemplary (dialkylamino)alkyl groups are
--CH.sub.2CH.sub.2N(CH.sub.3).sub.2.
[0168] For the purpose of the present disclosure, the term
"(cycloalkylamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted by a cycloalkylamino
group. In one embodiment, the alkyl is a C.sub.1-4 alkyl.
Non-limiting exemplary (cycloalkylamino)alkyl groups include
--CH.sub.2N(H)cyclopropyl, --CH.sub.2N(H)cyclobutyl, and
--CH.sub.2N(H)cyclohexyl.
[0169] For the purpose of the present disclosure, the term
"(aralkylamino)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with an aralkylamino group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. A non-limiting
exemplary (aralkylamino)alkyl group is
--CH.sub.2CH.sub.2CH.sub.2N(H)CH.sub.2Ph.
[0170] For the purpose of the present disclosure, the term
"(hydroxyalkylamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with an
hydroxyalkylamino group. A non-limiting exemplary
(hydroxyalkylamino)alkyl group is
--CH.sub.2CH.sub.2NHCH.sub.2CH.sub.2OH
[0171] For the purpose of the present disclosure, the term
"(cyano)alkyl" as used by itself or as part of another group refers
to an alkyl group substituted with one or more cyano, e.g., --CN,
groups. In one embodiment, the alkyl is a C.sub.1-4 alkyl.
Non-limiting exemplary (cyano)alkyl groups include
--CH.sub.2CH.sub.2CN, --CH.sub.2CH.sub.2CH.sub.2CN, and
--CH.sub.2CH.sub.2CH.sub.2CH.sub.2CN.
[0172] For the purpose of the present disclosure, the term
"(amino)(hydroxy)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one amino,
alkylamino, dialkylamino, or heterocyclo group and one hydroxy
group. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In
another embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting
exemplary (amino)(hydroxy)alkyl groups include:
##STR01151##
[0173] For the purpose of the present disclosure, the term
"(amino)(carboxamido)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one amino,
alkylamino, or dialkylamino, and one carboxamido group. In one
embodiment, the alkyl is a C.sub.1-6 alkyl. Non-limiting exemplary
(amino)(carboxamido)alkyl groups include:
##STR01152##
[0174] For the purpose of the present disclosure, the term
"(amino)(aryl)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one amino, alkylamino, or
dialkylamino group and one optionally substituted aryl group. In
one embodiment, the alkyl is a C.sub.1-6 alkyl. In one embodiment,
the optionally substituted aryl group is an optionally substituted
phenyl. Non-limiting exemplary (amino)(aryl)alkyl groups
include:
##STR01153##
[0175] For the purpose of the present disclosure, the term
"(aminoheteroaryl)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one amino,
alkylamino, or dialkylamino group and one optionally substituted
heteroaryl group. In one embodiment, the alkyl is a C.sub.1-6
alkyl. In one embodiment, the alkyl is a C.sub.1-4 alkyl. In one
embodiment, the optionally substituted heteroaryl group is an
optionally substituted pyridyl. Non-limiting exemplary
(amino)(heteroaryl)alkyl groups include:
##STR01154##
[0176] For the purpose of the present disclosure, the term
"(cycloalkyl)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one optionally
substituted cycloalkyl group. In one embodiment, the alkyl is a
C.sub.1-4 alkyl. In one embodiment, the cycloalkyl is a C.sub.3-6
cycloalkyl. In one embodiment, the optionally substituted
cycloalkyl group is substituted with an amino or (amino)alkyl
group. Non-limiting exemplary (cycloalkyl)alkyl groups include:
##STR01155##
[0177] For the purpose of the present disclosure, the term
"(hydroxy)(aryl)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one hydroxy group
and one optionally substituted aryl group. In one embodiment, the
alkyl is a C.sub.1-6 alkyl. In one embodiment, the optionally
substituted aryl group is an optionally substituted phenyl.
Non-limiting exemplary (hydroxy)(aryl)alkyl groups include:
##STR01156##
[0178] For the purpose of the present disclosure, the term
"carboxamido" as used by itself or as part of another group refers
to a radical of formula --C(.dbd.O)NR.sup.26aR.sup.26b, wherein
R.sup.26a and R.sup.26b are each independently hydrogen, optionally
substituted alkyl, optionally substituted aryl, aralkyl,
(heteroaryl)alkyl, or optionally substituted heteroaryl, or
R.sup.26a and R.sup.26b taken together with the nitrogen to which
they are attached from a 3- to 8-membered heterocyclo group. In one
embodiment, R.sup.26a and R.sup.26b are each independently hydrogen
or optionally substituted alkyl. Non-limiting exemplary carboxamido
groups include --CONH.sub.2, --CON(H)CH.sub.3,
--CON(CH.sub.3).sub.2, and --CON(H)Ph.
[0179] For the purpose of the present disclosure, the term
"(carboxamido)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with a carboxamido group.
Non-limiting exemplary (carboxamido)alkyl groups include
--CH.sub.2CONH.sub.2, --C(H)CH.sub.3--CONH.sub.2, and
--CH.sub.2CON(H)CH.sub.3.
[0180] For the purpose of the present disclosure, the term
"sulfonamido" as used by itself or as part of another group refers
to a radical of the formula --SO.sub.2NR.sup.27aR.sup.27b, wherein
R.sup.27a and R.sup.27b are each independently hydrogen, optionally
substituted alkyl, or optionally substituted aryl, or R.sup.27a and
R.sup.27b taken together with the nitrogen to which they are
attached from a 3- to 8-membered heterocyclo group. Non-limiting
exemplary sulfonamido groups include --SO.sub.2NH.sub.2,
--SO.sub.2N(H)CH.sub.3, and --SO.sub.2N(H)Ph.
[0181] For the purpose of the present disclosure, the term
"alkylcarbonyl" as used by itself or as part of another group
refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an
alkyl group. A non-limiting exemplary alkylcarbonyl group is
--COCH.sub.3.
[0182] For the purpose of the present disclosure, the term
"arylcarbonyl" as used by itself or as part of another group refers
to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an
optionally substituted aryl group. A non-limiting exemplary
arylcarbonyl group is --COPh.
[0183] For the purpose of the present disclosure, the term
"alkylsulfonyl" as used by itself or as part of another group
refers to a sulfonyl group, i.e., --SO.sub.2--, substituted by any
of the above-mentioned optionally substituted alkyl groups. A
non-limiting exemplary alkylsulfonyl group is
--SO.sub.2CH.sub.3.
[0184] For the purpose of the present disclosure, the term
"arylsulfonyl" as used by itself or as part of another group refers
to a sulfonyl group, i.e., --SO.sub.2--, substituted by any of the
above-mentioned optionally substituted aryl groups. A non-limiting
exemplary arylsulfonyl group is --SO.sub.2Ph.
[0185] For the purpose of the present disclosure, the term
"mercaptoalkyl" as used by itself or as part of another group
refers to any of the above-mentioned alkyl groups substituted by a
--SH group.
[0186] For the purpose of the present disclosure, the term
"carboxy" as used by itself or as part of another group refers to a
radical of the formula --COOH.
[0187] For the purpose of the present disclosure, the term
"carboxyalkyl" as used by itself or as part of another group refers
to any of the above-mentioned alkyl groups substituted with a
--COOH. A non-limiting exemplary carboxyalkyl group is
--CH.sub.2CO.sub.2H.
[0188] For the purpose of the present disclosure, the term
"alkoxycarbonyl" as used by itself or as part of another group
refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an
alkoxy group. Non-limiting exemplary alkoxycarbonyl groups are
--CO.sub.2Me and --CO.sub.2Et.
[0189] For the purpose of the present disclosure, the term
"aralkyl" or "arylalkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one, two, or three
optionally substituted aryl groups. In one embodiment, the aralkyl
group is a C.sub.1-4 alkyl substituted with one optionally
substituted aryl group. In another embodiment, the aralkyl group is
a C.sub.1 or C.sub.2 alkyl substituted with one optionally
substituted phenyl group. In another embodiment, the aralkyl group
is a C alkyl substituted with one optionally substituted phenyl
group, i.e., a benzyl group wherein the phenyl is optionally
substituted. Non-limiting exemplary aralkyl groups include benzyl,
phenethyl, --CHPh.sub.2, --CH.sub.2(4-OH-Ph), and
--CH(4-F-Ph).sub.2.
[0190] For the purpose of the present disclosure, the term "ureido"
as used by itself or as part of another group refers to a radical
of the formula --NR.sup.30a--C(.dbd.O)--NR.sup.30bR.sup.30c,
wherein R.sup.22a is hydrogen, alkyl, or optionally substituted
aryl, and R.sup.30b and R.sup.30c are each independently hydrogen,
alkyl, or optionally substituted aryl, or R.sup.30b and R.sup.30c
taken together with the nitrogen to which they are attached form a
4- to 8-membered heterocyclo group. Non-limiting exemplary ureido
groups include --NH--C(C.dbd.O)--NH.sub.2 and
--NH--C(C.dbd.O)--NHCH.sub.3.
[0191] For the purpose of the present disclosure, the term
"guanidino" as used by itself or as part of another group refers to
a radical of the formula
--NR.sup.28a--C(.dbd.NR.sup.29)--NR.sup.28bR.sup.28c, wherein
R.sup.28a, R.sup.28b, and R.sup.28c are each independently
hydrogen, alkyl, or optionally substituted aryl, and R.sup.2 is
hydrogen, alkyl, cyano, alkylsulfonyl, alkylcarbonyl, carboxamido,
or sulfonamido. Non-limiting exemplary guanidino groups include
--NH--C(C.dbd.NH)--NH.sub.2, --NH--C(C.dbd.NCN)--NH.sub.2, and
--NH--C(C.dbd.NH)--NHCH.sub.3.
[0192] For the purpose of the present disclosure, the term
"(heterocyclo)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one, two, or three
optionally substituted heterocyclo groups. In one embodiment, the
(heterocyclo)alkyl is a C.sub.1-4 alkyl substituted with one
optionally substituted heterocyclo group. The heterocyclo can be
linked to the alkyl group through a carbon or nitrogen atom.
Non-limiting exemplary (heterocyclo)alkyl groups include:
##STR01157##
[0193] For the purpose of the present disclosure, the term
"(heteroaryl)alkyl" or "heteroaralkyl" as used by itself or as part
of another group refers to an alkyl group substituted with one,
two, or three optionally substituted heteroaryl groups. In one
embodiment, the (heteroaryl)alkyl group is a C.sub.1-4 alkyl
substituted with one optionally substituted heteroaryl group.
Non-limiting exemplary (heteroaryl)alkyl groups include:
##STR01158##
[0194] For the purpose of the present disclosure, the term
"alkylcarbonylamino" as used by itself or as part of another group
refers to an alkylcarbonyl group attached to an amino. A
non-limiting exemplary alkylcarbonylamino group is
--NHCOCH.sub.3.
[0195] The present disclosure encompasses any of the Compounds of
the Disclosure being isotopically-labelled (i.e., radiolabeled) by
having one or more atoms replaced by an atom having a different
atomic mass or mass number. Examples of isotopes that can be
incorporated into the disclosed compounds include isotopes of
hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and
chlorine, such as .sup.2H (or deuterium (D)), .sup.3H, .sup.11C,
.sup.13C, .sup.14C, .sup.15N, .sup.18O, .sup.17O, .sup.31P,
.sup.32P, .sup.35S, .sup.18F, and .sup.36Cl, respectively, e.g.,
.sup.3H, .sup.11C, and .sup.14C. In one embodiment, provided is a
composition wherein substantially all of the atoms at a position
within the Compound of the Disclosure are replaced by an atom
having a different atomic mass or mass number. In another
embodiment, provided is a composition wherein a portion of the
atoms at a position within the Compound of the disclosure are
replaced, i.e., the Compound of the Disclosure is enriched at a
position with an atom having a different atomic mass or mass
number." Isotopically-labelled Compounds of the Disclosure can be
prepared by methods known in the art.
[0196] Compounds of the Disclosure may contain one or more
asymmetric centers and may thus give rise to enantiomers,
diastereomers, and other stereoisomeric forms. The present
disclosure is meant to encompass the use of all such possible
forms, as well as their racemic and resolved forms and mixtures
thereof. The individual enantiomers can be separated according to
methods known in the art in view of the present disclosure. When
the compounds described herein contain olefinic double bonds or
other centers of geometric asymmetry, and unless specified
otherwise, it is intended that they include both E and Z geometric
isomers. All tautomers are intended to be encompassed by the
present disclosure as well.
[0197] As used herein, the term "stereoisomers" is a general term
for all isomers of individual molecules that differ only in the
orientation of their atoms in space. It includes enantiomers and
isomers of compounds with more than one chiral center that are not
mirror images of one another (diastereomers).
[0198] The term "chiral center" or "asymmetric carbon atom" refers
to a carbon atom to which four different groups are attached.
[0199] The terms "enantiomer" and "enantiomeric" refer to a
molecule that cannot be superimposed on its mirror image and hence
is optically active wherein the enantiomer rotates the plane of
polarized light in one direction and its mirror image compound
rotates the plane of polarized light in the opposite direction.
[0200] The term "racemic" refers to a mixture of equal parts of
enantiomers and which mixture is optically inactive.
[0201] The term "absolute configuration" refers to the spatial
arrangement of the atoms of a chiral molecular entity (or group)
and its stereochemical description, e.g., R or S.
[0202] The stereochemical terms and conventions used in the
specification are meant to be consistent with those described in
Pure & Appl. Chem 68:2193 (1996), unless otherwise
indicated.
[0203] The term "enantiomeric excess" or "ee" refers to a measure
for how much of one enantiomer is present compared to the other.
For a mixture of R and S enantiomers, the percent enantiomeric
excess is defined as |R-S|*100, where R and S are the respective
mole or weight fractions of enantiomers in a mixture such that
R+S=1. With knowledge of the optical rotation of a chiral
substance, the percent enantiomeric excess is defined as
([.alpha.].sub.abs/[.alpha.].sub.max)*100, where [.alpha.].sub.abs
is the optical rotation of the mixture of enantiomers and
[.alpha.].sub.max is the optical rotation of the pure enantiomer.
Determination of enantiomeric excess is possible using a variety of
analytical techniques, including NMR spectroscopy, chiral column
chromatography or optical polarimetry.
[0204] The terms "enantiomerically pure" or "enantiopure" refer to
a sample of a chiral substance all of whose molecules (within the
limits of detection) have the same chirality sense.
[0205] The terms "enantiomerically enriched" or "enantioenriched"
refer to a sample of a chiral substance whose enantiomeric ratio is
greater than 50:50. Enantiomerically enriched compounds may be
enantiomerically pure.
[0206] The terms "a" and "an" refer to one or more.
[0207] The term "about," as used herein, includes the recited
number 10%. Thus, "about 10" means 9 to 11.
[0208] The present disclosure encompasses the preparation and use
of salts of the Compounds of the Disclosure, including non-toxic
pharmaceutically acceptable salts. Examples of pharmaceutically
acceptable addition salts include inorganic and organic acid
addition salts and basic salts. The pharmaceutically acceptable
salts include, but are not limited to, metal salts such as sodium
salt, potassium salt, cesium salt and the like; alkaline earth
metals such as calcium salt, magnesium salt and the like; organic
amine salts such as triethylamine salt, pyridine salt, picoline
salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine
salt, N,N'-dibenzylethylenediamine salt and the like; inorganic
acid salts such as hydrochloride, hydrobromide, phosphate, sulphate
and the like; organic acid salts such as citrate, lactate,
tartrate, maleate, fumarate, mandelate, acetate, dichloroacetate,
trifluoroacetate, oxalate, formate and the like; sulfonates such as
methanesulfonate, benzenesulfonate, p-toluenesulfonate and the
like; and amino acid salts such as arginate, asparaginate,
glutamate and the like. The term "pharmaceutically acceptable salt"
as used herein, refers to any salt, e.g., obtained by reaction with
an acid or a base, of a Compound of the Disclosure that is
physiologically tolerated in the target patient (e.g., a mammal,
e.g., a human).
[0209] Acid addition salts can be formed by mixing a solution of
the particular Compound of the Disclosure with a solution of a
pharmaceutically acceptable non-toxic acid such as hydrochloric
acid, fumaric acid, maleic acid, succinic acid, acetic acid, citric
acid, tartaric acid, carbonic acid, phosphoric acid, oxalic acid,
dichloroacetic acid, or the like. Basic salts can be formed by
mixing a solution of the compound of the present disclosure with a
solution of a pharmaceutically acceptable non-toxic base such as
sodium hydroxide, potassium hydroxide, choline hydroxide, sodium
carbonate and the like.
[0210] The present disclosure encompasses the preparation and use
of solvates of Compounds of the Disclosure. Solvates typically do
not significantly alter the physiological activity or toxicity of
the compounds, and as such may function as pharmacological
equivalents. The term "solvate" as used herein is a combination,
physical association and/or solvation of a compound of the present
disclosure with a solvent molecule such as, e.g. a disolvate,
monosolvate or hemisolvate, where the ratio of solvent molecule to
compound of the present disclosure is about 2:1, about 1:1 or about
1:2, respectively. This physical association involves varying
degrees of ionic and covalent bonding, including hydrogen bonding.
In certain instances, the solvate can be isolated, such as when one
or more solvent molecules are incorporated into the crystal lattice
of a crystalline solid. Thus, "solvate" encompasses both
solution-phase and isolatable solvates. Compounds of the Disclosure
can be present as solvated forms with a pharmaceutically acceptable
solvent, such as water, methanol, ethanol, and the like, and it is
intended that the disclosure includes both solvated and unsolvated
forms of Compounds of the Disclosure. One type of solvate is a
hydrate. A "hydrate" relates to a particular subgroup of solvates
where the solvent molecule is water. Solvates typically can
function as pharmacological equivalents. Preparation of solvates is
known in the art. See, for example, M. Caira et al, J. Pharmaceut.
Sci., 93(3):601-611 (2004), which describes the preparation of
solvates of fluconazole with ethyl acetate and with water. Similar
preparation of solvates, hemisolvates, hydrates, and the like are
described by E. C. van Tonder et al., AAPS Pharm. Sci. Tech.,
5(1):Article 12 (2004), and A. L. Bingham et al., Chem. Commun.
603-604 (2001). A typical, non-limiting, process of preparing a
solvate would involve dissolving a Compound of the Disclosure in a
desired solvent (organic, water, or a mixture thereof) at
temperatures above 20.degree. C. to about 25.degree. C., then
cooling the solution at a rate sufficient to form crystals, and
isolating the crystals by known methods, e.g., filtration.
Analytical techniques such as infrared spectroscopy can be used to
confirm the presence of the solvent in a crystal of the
solvate.
[0211] Since Compounds of the Disclosure are inhibitors of SMYD
proteins, such as SMYD3 and SMYD2, a number of diseases,
conditions, or disorders mediated by SMYD proteins, such as SMYD3
and SMYD2, can be treated by employing these compounds. The present
disclosure is thus directed generally to a method for treating a
disease, condition, or disorder responsive to the inhibition of
SMYD proteins, such as SMYD3 and SMYD2, in an animal suffering
from, or at risk of suffering from, the disorder, the method
comprising administering to the animal an effective amount of one
or more Compounds of the Disclosure.
[0212] The present disclosure is further directed to a method of
inhibiting SMYD proteins in an animal in need thereof, the method
comprising administering to the animal a therapeutically effective
amount of at least one Compound of the Disclosure.
[0213] The present disclosure is further directed to a method of
inhibiting SMYD3 in an animal in need thereof, the method
comprising administering to the animal a therapeutically effective
amount of at least one Compound of the Disclosure.
[0214] The present disclosure is further directed to a method of
inhibiting SMYD2 in an animal in need thereof, the method
comprising administering to the animal a therapeutically effective
amount of at least one Compound of the Disclosure.
[0215] As used herein, the terms "treat," "treating," "treatment,"
and the like refer to eliminating, reducing, or ameliorating a
disease or condition, and/or symptoms associated therewith.
Although not precluded, treating a disease or condition does not
require that the disease, condition, or symptoms associated
therewith be completely eliminated. As used herein, the terms
"treat," "treating," "treatment," and the like may include
"prophylactic treatment," which refers to reducing the probability
of redeveloping a disease or condition, or of a recurrence of a
previously-controlled disease or condition, in a subject who does
not have, but is at risk of or is susceptible to, redeveloping a
disease or condition or a recurrence of the disease or condition.
The term "treat" and synonyms contemplate administering a
therapeutically effective amount of a Compound of the Disclosure to
an individual in need of such treatment.
[0216] Within the meaning of the disclosure, "treatment" also
includes relapse prophylaxis or phase prophylaxis, as well as the
treatment of acute or chronic signs, symptoms and/or malfunctions.
The treatment can be orientated symptomatically, for example, to
suppress symptoms. It can be effected over a short period, be
oriented over a medium term, or can be a long-term treatment, for
example within the context of a maintenance therapy.
[0217] The term "therapeutically effective amount" or "effective
dose" as used herein refers to an amount of the active
ingredient(s) that is(are) sufficient, when administered by a
method of the disclosure, to efficaciously deliver the active
ingredient(s) for the treatment of condition or disease of interest
to an individual in need thereof. In the case of a cancer or other
proliferation disorder, the therapeutically effective amount of the
agent may reduce (i.e., retard to some extent and preferably stop)
unwanted cellular proliferation; reduce the number of cancer cells;
reduce the tumor size; inhibit (i.e., retard to some extent and
preferably stop) cancer cell infiltration into peripheral organs;
inhibit (i.e., retard to some extent and preferably stop) tumor
metastasis; inhibit, to some extent, tumor growth; modulate protein
methylation in the target cells; and/or relieve, to some extent,
one or more of the symptoms associated with the cancer. To the
extent the administered compound or composition prevents growth
and/or kills existing cancer cells, it may be cytostatic and/or
cytotoxic.
[0218] The term "container" means any receptacle and closure
therefore suitable for storing, shipping, dispensing, and/or
handling a pharmaceutical product.
[0219] The term "insert" means information accompanying a
pharmaceutical product that provides a description of how to
administer the product, along with the safety and efficacy data
required to allow the physician, pharmacist, and patient to make an
informed decision regarding use of the product. The package insert
generally is regarded as the "label" for a pharmaceutical
product.
[0220] The term "disease" or "condition" or "disorder" denotes
disturbances and/or anomalies that as a rule are regarded as being
pathological conditions or functions, and that can manifest
themselves in the form of particular signs, symptoms, and/or
malfunctions. As demonstrated below, Compounds of the Disclosure
inhibit SMYD proteins, such as SMYD3 and SMYD2 and can be used in
treating diseases and conditions such as proliferative diseases,
wherein inhibition of SMYD proteins, such as SMYD3 and SMYD2
provides a benefit.
[0221] In some embodiments, the Compounds of the Disclosure can be
used to treat a "SMYD protein mediated disorder" (e.g., a
SMYD3-mediated disorder or a SMYD2-mediated disorder). A SMYD
protein mediated disorder is any pathological condition in which a
SMYD protein is know to play a role. In some embodiments, a
SMYD-mediated disorder is a proliferative disease.
[0222] In some embodiments inhibiting SMYD proteins, such as SMYD3
and SMYD2, is the inhibition of the activity of one or more
activities of SMYD proteins such as SMYD3 and SMYD2. In some
embodiments, the activity of the SMYD proteins such as SMYD3 and
SMYD2 is the ability of the SMYD protein such as SMYD3 or SMYD2 to
transfer a methyl group to a target protein (e.g., histone). It
should be appreciated that the activity of the one or more SMYD
proteins such as SMYD3 and SMYD2 may be inhibited in vitro or in
vivo. Exemplary levels of inhibition of the activity one or more
SMYD proteins such as SMYD3 and SMYD2 include at least 10%
inhibition, at least 20% inhibition, at least 30% inhibition, at
least 40% inhibition, at least 50% inhibition, at least 60%
inhibition, at least 70% inhibition, at least 80% inhibition, at
least 90% inhibition, and up to 100% inhibition.
[0223] The SMYD (SET and MYND domain) family of lysine
methyltransferases (KMTs) plays pivotal roles in various cellular
processes, including gene expression regulation and DNA damage
response. The family of human SMYD proteins consists of SMYD,
SMYD2, SMYD3, SMYD4 and SMYD5. SMYD, SMYD2, and SMYD3 share a high
degree of sequence homology and, with the exception of SMYD5, human
SMYD proteins harbor at least one C-terminal tetratrico peptide
repeat (TPR) domain. (See e.g., Abu-Farha et al. J Mol Cell Biol
(2011) 3 (5) 301-308). The SMYD proteins have been found to be
linked to various cancers (See e.g., Hamamoto et al. Nat Cell.
Biol. 2004, 6: 731-740), Hu et al. Cancer Research 2009, 4067-4072,
and Komatsu et al. Carcinogenesis 2009, 301139-1146.)
[0224] SMYD3 is a protein methyltransferase found to be expressed
at high levels in a number of different cancers (Hamamoto, R., et
al., Nat. Cell Biol., 6(8):731-40 (2004)). SMYD3 likely plays a
role in the regulation of gene transcription and signal
transduction pathways critical for survival of breast, liver,
prostate and lung cancer cell lines (Hamamoto, R., et al., Nat.
Cell Biol., 6(8):731-40 (2004); Hamamoto, R., et al., Cancer Sci.,
97(2):113-8 (2006); Van Aller, G. S., et al., Epigenetics,
7(4):340-3 (2012); Liu, C., et al., J. Natl. Cancer Inst.,
105(22):1719-28 (2013); Mazur, P. K., et al., Nature,
510(7504):283-7 (2014)).
[0225] Genetic knockdown of SMYD3 leads to a decrease in
proliferation of a variety of cancer cell lines (Hamamoto, R., et
al., Nat. Cell Biol., 6(8):731-40 (2004); Hamamoto, L., et al.,
Cancer Sci., 97(2):113-8 (2006); Van Aller, G. S., et al.,
Epigenetics, 7(4):340-3 (2012); Liu, C., et al., J. Natl. Cancer
Inst., 105(22):1719-28 (2013); Mazur, P. K, et al., Nature,
510(7504):283-7 (2014)). Several studies employing RNAi-based
technologies have shown that ablation of SMYD3 in hepatocellular
carcinoma cell lines greatly reduces cell viability and that its
pro-survival role is dependent on its catalytic activity (Hamamoto,
R., et al., Nat. Cell Biol., 6(8):731-40 (2004); Van Aller, G. S.,
et al., Epigenetics, 7(4):340-3 (2012)). Moreover, SMYD3 has also
been shown to be a critical mediator of transformation resulting
from gain of function mutations in the oncogene, KRAS for both
pancreatic and lung adenocarcinoma in mouse models. The dependence
of KRAS on SMYD3 was also shown to be dependent on its catalytic
activity (Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)).
SMYD3 function has also been implicated in colerectal cancers and
RNAi mediated knockdown of SMYD3 has been shown to impair
colerectal cell proliferation. (Peserico et al., Cell Physiol. 2015
Feb. 28. doi: 10.1002/jcp.24975. [Epub ahead of print]).
[0226] Furthermore, SMYD3 function has also been shown to play a
role in immunology and development. For instance, de Almeida
reported that SMYD3 plays a role in generation of inducible
regulatory T cells (iTreg) cells. In a mouse model of respiratory
syncytial virus (RSV) infection, a model in which iTreg cells have
a critical role in regulating lung pathogenesis, SMYD3-/- mice
demonstrated exacerbation of RSV-induced disease related to
enhanced proinflammatory responses and worsened pathogenesis within
the lung (de Almeida et al. Mucosal Immunol. 2015 Feb. 11. doi:
10.1038/mi.2015.4. [Epub ahead of print]). In addition, as to
development, Proserpio et al. have shown the importance of SMYD3 in
the regulation of skeletal muscle atrophy (Proserpio et al. Genes
Dev. 2013 Jun. 1; 27(11):1299-312), while Fujii et al. have
elucidated the role of SMYD3 in cardiac and skeletal muscle
development (Fujii et al. PLoS One. 2011; 6(8):e23491).
[0227] SMYD2 (SET and MYND domain-containing protein 2) was first
characterized as protein that is a member of a sub-family of SET
domain containing proteins which catalyze the site-specific
transfer of methyl groups onto substrate proteins. SMYD2 was
initially shown to have methyltransferase activity towards lysine
36 on histone H3 (H3K36) but has subsequently been shown to have
both histone and non-histone methyltrasferase activity.
[0228] SMYD2 has been implicated in the pathogenesis of multiple
cancers. It has been shown to be over-expressed, compared to
matched normal samples, in tumors of the breast, cervix, colon,
kidney, liver, head and neck, skin, pancreas, ovary, esophagus and
prostate, as well as hematologic malignancies such as AML, B- and
T-ALL, CLL and MCL, suggesting a role for SMYD2 in the biology of
these cancers. More specifically, studies using genetic knock-down
of SMYD2 have demonstrated anti-proliferative effects in esophageal
squamous cell carcinoma (ESCC), bladder carcinoma and cervical
carcinoma cell lines. (See e.g., Komatsu et al., Carcinogenesis
2009, 30, 1139, and Cho et al., Neoplasia. 2012 June;
14(6):476-86). Moreover, high expression of SMYD2 has been shown to
be a poor prognostic factor in both ESCC and pediatric ALL. (See
e.g., Komatsu et al. Br J Cancer. 2015 Jan. 20; 112(2):357-64, and
Sakamoto et al., Leuk Res. 2014 April; 38(4):496-502). Recently,
Nguyen et al., have shown that a small molecule inhibitor of SMYD2
(LLY-507) inhibited the proliferation of several esophageal, liver
and breast cancer cell lines in a dose-dependent manner. (Nguyen et
al. J Biol Chem. 2015 Mar. 30. pii: jbc.M114.626861. [Epub ahead of
print]).
[0229] SMYD2 has also been implicated in immunology. For instance,
Xu et al. have shown that SMYD2 is a negative regulator of
macrophage activation by suppressing Interleukin-6 and TNF-alpha
production. (Xu et al., J Biol Chem. 2015 Feb. 27;
290(9):5414-23).
[0230] In one aspect, the present disclosure provides a method of
treating cancer in a patient comprising administering a
therapeutically effective amount of a Compound of the Disclosure.
While not being limited to a specific mechanism, in some
embodiments, Compounds of the Disclosure can treat cancer by
inhibiting SMYD proteins, such as SMYD3 and SMYD2. Examples of
treatable cancers include, but are not limited to, adrenal cancer,
acinic cell carcinoma, acoustic neuroma, acral lentigious melanoma,
acrospiroma, acute eosinophilic leukemia, acute erythroid leukemia,
acute lymphoblastic leukemia, acute megakaryoblastic leukemia,
acute monocytic leukemia, acute promyelocytic leukemia,
adenocarcinoma, adenoid cystic carcinoma, adenoma, adenomatoid
odontogenic tumor, adenosquamous carcinoma, adipose tissue
neoplasm, adrenocortical carcinoma, adult T-cell leukemia/lymphoma,
aggressive NK-cell leukemia, AIDS-related lymphoma, alveolar
rhabdomyosarcoma, alveolar soft part sarcoma, ameloblastic fibroma,
anaplastic large cell lymphoma, anaplastic thyroid cancer,
angioimmunoblastic T-cell lymphoma, angiomyolipoma, angiosarcoma,
astrocytoma, atypical teratoid rhabdoid tumor, B-cell chronic
lymphocytic leukemia, B-cell prolymphocytic leukemia, B-cell
lymphoma, basal cell carcinoma, biliary tract cancer, bladder
cancer, blastoma, bone cancer, Brenner tumor, Brown tumor,
Burkitt's lymphoma, breast cancer, brain cancer, carcinoma,
carcinoma in situ, carcinosarcoma, cartilage tumor, cementoma,
myeloid sarcoma, chondroma, chordoma, choriocarcinoma, choroid
plexus papilloma, clear-cell sarcoma of the kidney,
craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer,
colorectal cancer, Degos disease, desmoplastic small round cell
tumor, diffuse large B-cell lymphoma, dysembryoplastic
neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine
gland neoplasm, endodermal sinus tumor, enteropathy-associated
T-cell lymphoma, esophageal cancer, fetus in fetu, fibroma,
fibrosarcoma, follicular lymphoma, follicular thyroid cancer,
ganglioneuroma, gastrointestinal cancer, germ cell tumor,
gestational choriocarcinoma, giant cell fibroblastoma, giant cell
tumor of the bone, glial tumor, glioblastoma multiforme, glioma,
gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell
tumor, gynandroblastoa, gallbladder cancer, gastric cancer, hairy
cell leukemia, hemangioblastoma, head and neck cancer,
hemangiopericytoma, hematological malignancy, hepatoblastoma,
hepatosplenic T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's
lymphoma, invasive lobular carcinoma, intestinal cancer, kidney
cancer, laryngeal cancer, lentigo maligna, lethal midline
carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer,
lymphangioma, lymphangiosarcoma, lymphoepithelioma, lymphoma, acute
lymphocytic leukemia, acute myelogeous leukemia, chronic
lymphocytic leukemia, liver cancer, small cell lung cancer,
non-small cell lung cancer, MALT lymphoma, malignant fibrous
histiocytoma, malignant peripheral nerve sheath tumor, malignant
triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma,
mast cell leukemia, mediastinal germ cell tumor, medullary
carcinoma of the breast, medullary thyroid cancer, medulloblastoma,
melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic
urothelial carcinoma, mixed Mullerian tumor, mucinous tumor,
multiple myeloma, muscle tissue neoplasm, mycosis fungoides, myxoid
liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma,
neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma,
ocular cancer, oligoastrocytoma, oligodendroglioma, oncocytoma,
optic nerve sheath meningioma, optic nerve tumor, oral cancer,
osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid
cancer, paraganglioma, pinealoblastoma, pineocytoma, pituicytoma,
pituitary adenoma, pituitary tumor, plasmacytoma, polyembryoma,
precursor T-lymphoblastic lymphoma, primary central nervous system
lymphoma, primary effusion lymphoma, preimary peritoneal cancer,
prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma
periotonei, renal cell carcinoma, renal medullary carcinoma,
retinoblastoma, rhabdomyoma, rhabdomyosarcoma, Richter's
transformation, rectal cancer, sarcoma, Schwannomatosis, seminoma,
Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring
cell carcinoma, skin cancer, small blue round cell tumors, small
cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart,
spinal tumor, splenic marginal zone lymphoma, squamous cell
carcinoma, synovial sarcoma, Sezary's disease, small intestine
cancer, squamous carcinoma, stomach cancer, T-cell lymphoma,
testicular cancer, thecoma, thyroid cancer, transitional cell
carcinoma, throat cancer, urachal cancer, urogenital cancer,
urothelial carcinoma, uveal melanoma, uterine cancer, verrucous
carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer,
Waldenstrom's macroglobulinemia, Warthin's tumor, and Wilms'
tumor.
[0231] In another embodiment, the cancer is breast, cervix, colon,
kidney, liver, head and neck, skin, pancreas, ovary, esophagus, or
prostate cancer.
[0232] In another embodiment, the cancer is a hematologic
malignancy such as acute myeloid leukemia (AML), B- and T-acute
lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL),
or mantle cell lymphoma (MCL).
[0233] In another embodiment, the cancer is esophageal squamous
cell carcinoma (ESCC), bladder carcinoma, or cervical
carcinoma.
[0234] In another embodiment, the cancer is a leukemia, for example
a leukemia selected from acute monocytic leukemia, acute
myelogenous leukemia, chronic myelogenous leukemia, chronic
lymphocytic leukemia and mixed lineage leukemia (MLL). In another
embodiment the cancer is NUT-midline carcinoma. In another
embodiment the cancer is multiple myeloma. In another embodiment
the cancer is a lung cancer such as small cell lung cancer (SCLC).
In another embodiment the cancer is a neuroblastoma. In another
embodiment the cancer is Burkitt's lymphoma. In another embodiment
the cancer is cervical cancer. In another embodiment the cancer is
esophageal cancer. In another embodiment the cancer is ovarian
cancer. In another embodiment the cancer is colorectal cancer. In
another embodiment, the cancer is prostate cancer. In another
embodiment, the cancer is breast cancer.
[0235] In another embodiment, the present disclosure provides a
therapeutic method of modulating protein methylation, gene
expression, cell proliferation, cell differentiation and/or
apoptosis in vivo in the cancers mentioned above by administering a
therapeutically effective amount of a Compound of the Disclosure to
a subject in need of such therapy.
[0236] Compounds of the Disclosure can be administered to a mammal
in the form of a raw chemical without any other components present.
Compounds of the Disclosure can also be administered to a mammal as
part of a pharmaceutical composition containing the compound
combined with a suitable pharmaceutically acceptable carrier. Such
a carrier can be selected from pharmaceutically acceptable
excipients and auxiliaries. The term "pharmaceutically acceptable
carrier" or "pharmaceutically acceptable vehicle" encompasses any
of the standard pharmaceutical carriers, solvents, surfactants, or
vehicles. Suitable pharmaceutically acceptable vehicles include
aqueous vehicles and nonaqueous vehicles. Standard pharmaceutical
carriers and their formulations are described in Remington's
Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 19th ed.
1995.
[0237] Pharmaceutical compositions within the scope of the present
disclosure include all compositions where a Compound of the
Disclosure is combined with one or more pharmaceutically acceptable
carriers. In one embodiment, the Compound of the Disclosure is
present in the composition in an amount that is effective to
achieve its intended therapeutic purpose. While individual needs
may vary, a determination of optimal ranges of effective amounts of
each compound is within the skill of the art. Typically, a Compound
of the Disclosure can be administered to a mammal, e.g., a human,
orally at a dose of from about 0.0025 to about 1500 mg per kg body
weight of the mammal, or an equivalent amount of a pharmaceutically
acceptable salt or solvate thereof, per day to treat the particular
disorder. A useful oral dose of a Compound of the Disclosure
administered to a mammal is from about 0.0025 to about 50 mg per kg
body weight of the mammal, or an equivalent amount of the
pharmaceutically acceptable salt or solvate thereof. For
intramuscular injection, the dose is typically about one-half of
the oral dose.
[0238] A unit oral dose may comprise from about 0.01 mg to about 1
g of the Compound of the Disclosure, e.g., about 0.01 mg to about
500 mg, about 0.01 mg to about 250 mg, about 0.01 mg to about 100
mg, 0.01 mg to about 50 mg, e.g., about 0.1 mg to about 10 mg, of
the compound. The unit dose can be administered one or more times
daily, e.g., as one or more tablets or capsules, each containing
from about 0.01 mg to about 1 g of the compound, or an equivalent
amount of a pharmaceutically acceptable salt or solvate
thereof.
[0239] A pharmaceutical composition of the present disclosure can
be administered to any patient that may experience the beneficial
effects of a Compound of the Disclosure. Foremost among such
patients are mammals, e.g., humans and companion animals, although
the disclosure is not intended to be so limited. In one embodiment,
the patient is a human.
[0240] A pharmaceutical composition of the present disclosure can
be administered by any means that achieves its intended purpose.
For example, administration can be by the oral, parenteral,
subcutaneous, intravenous, intramuscular, intraperitoneal,
transdermal, intranasal, transmucosal, rectal, intravaginal or
buccal route, or by inhalation. The dosage administered and route
of administration will vary, depending upon the circumstances of
the particular subject, and taking into account such factors as
age, gender, health, and weight of the recipient, condition or
disorder to be treated, kind of concurrent treatment, if any,
frequency of treatment, and the nature of the effect desired.
[0241] In one embodiment, a pharmaceutical composition of the
present disclosure can be administered orally. In another
embodiment, a pharmaceutical composition of the present disclosure
can be administered orally and is formulated into tablets, dragees,
capsules, or an oral liquid preparation. In one embodiment, the
oral formulation comprises extruded multiparticulates comprising
the Compound of the Disclosure.
[0242] Alternatively, a pharmaceutical composition of the present
disclosure can be administered rectally, and is formulated in
suppositories.
[0243] Alternatively, a pharmaceutical composition of the present
disclosure can be administered by injection.
[0244] Alternatively, a pharmaceutical composition of the present
disclosure can be administered transdermally.
[0245] Alternatively, a pharmaceutical composition of the present
disclosure can be administered by inhalation or by intranasal or
transmucosal administration.
[0246] Alternatively, a pharmaceutical composition of the present
disclosure can be administered by the intravaginal route.
[0247] A pharmaceutical composition of the present disclosure can
contain from about 0.01 to 99 percent by weight, e.g., from about
0.25 to 75 percent by weight, of a Compound of the Disclosure,
e.g., about 1%, about 5%, about 10%, about 15%, about 20%, about
25%, about 30%, about 35%, about 40%, about 45%, about 50%, about
55%, about 60%, about 65%, about 70%, or about 75% by weight of a
Compound of the Disclosure.
[0248] A pharmaceutical composition of the present disclosure is
manufactured in a manner which itself will be known in view of the
instant disclosure, for example, by means of conventional mixing,
granulating, dragee-making, dissolving, extrusion, or lyophilizing
processes. Thus, pharmaceutical compositions for oral use can be
obtained by combining the active compound with solid excipients,
optionally grinding the resulting mixture and processing the
mixture of granules, after adding suitable auxiliaries, if desired
or necessary, to obtain tablets or dragee cores.
[0249] Suitable excipients include fillers such as saccharides (for
example, lactose, sucrose, mannitol or sorbitol), cellulose
preparations, calcium phosphates (for example, tricalcium phosphate
or calcium hydrogen phosphate), as well as binders such as starch
paste (using, for example, maize starch, wheat starch, rice starch,
or potato starch), gelatin, tragacanth, methyl cellulose,
hydroxypropylmethylcellulose, sodium carboxymethylcellulose, and/or
polyvinyl pyrrolidone. If desired, one or more disintegrating
agents can be added, such as the above-mentioned starches and also
carboxymethyl-starch, cross-linked polyvinyl pyrrolidone, agar, or
alginic acid or a salt thereof, such as sodium alginate.
[0250] Auxiliaries are typically flow-regulating agents and
lubricants such as, for example, silica, talc, stearic acid or
salts thereof (e.g., magnesium stearate or calcium stearate), and
polyethylene glycol. Dragee cores are provided with suitable
coatings that are resistant to gastric juices. For this purpose,
concentrated saccharide solutions can be used, which may optionally
contain gum arabic, talc, polyvinyl pyrrolidone, polyethylene
glycol and/or titanium dioxide, lacquer solutions and suitable
organic solvents or solvent mixtures. In order to produce coatings
resistant to gastric juices, solutions of suitable cellulose
preparations such as acetylcellulose phthalate or
hydroxypropylmethyl-cellulose phthalate can be used. Dye stuffs or
pigments can be added to the tablets or dragee coatings, for
example, for identification or in order to characterize
combinations of active compound doses.
[0251] Examples of other pharmaceutical preparations that can be
used orally include push-fit capsules made of gelatin, or soft,
sealed capsules made of gelatin and a plasticizer such as glycerol
or sorbitol. The push-fit capsules can contain a compound in the
form of granules, which can be mixed with fillers such as lactose,
binders such as starches, and/or lubricants such as talc or
magnesium stearate and, optionally, stabilizers, or in the form of
extruded multiparticulates. In soft capsules, the active compounds
are preferably dissolved or suspended in suitable liquids, such as
fatty oils or liquid paraffin. In addition, stabilizers can be
added.
[0252] Possible pharmaceutical preparations for rectal
administration include, for example, suppositories, which consist
of a combination of one or more active compounds with a suppository
base. Suitable suppository bases include natural and synthetic
triglycerides, and paraffin hydrocarbons, among others. It is also
possible to use gelatin rectal capsules consisting of a combination
of active compound with a base material such as, for example, a
liquid triglyceride, polyethylene glycol, or paraffin
hydrocarbon.
[0253] Suitable formulations for parenteral administration include
aqueous solutions of the active compound in a water-soluble form
such as, for example, a water-soluble salt, alkaline solution, or
acidic solution. Alternatively, a suspension of the active compound
can be prepared as an oily suspension. Suitable lipophilic solvents
or vehicles for such as suspension may include fatty oils (for
example, sesame oil), synthetic fatty acid esters (for example,
ethyl oleate), triglycerides, or a polyethylene glycol such as
polyethylene glycol-400 (PEG-400). An aqueous suspension may
contain one or more substances to increase the viscosity of the
suspension, including, for example, sodium carboxymethyl cellulose,
sorbitol, and/or dextran. The suspension may optionally contain
stabilizers.
[0254] In another embodiment, the present disclosure provides kits
which comprise a Compound of the Disclosure (or a composition
comprising a Compound of the Disclosure) packaged in a manner that
facilitates their use to practice methods of the present
disclosure. In one embodiment, the kit includes a Compound of the
Disclosure (or a composition comprising a Compound of the
Disclosure) packaged in a container, such as a sealed bottle or
vessel, with a label affixed to the container or included in the
kit that describes use of the compound or composition to practice
the method of the disclosure. In one embodiment, the compound or
composition is packaged in a unit dosage form. The kit further can
include a device suitable for administering the composition
according to the intended route of administration.
General Synthesis of Compounds
[0255] Compounds of the Disclosure are prepared using methods known
to those skilled in the art in view of this disclosure, or by the
illustrative methods shown in the General Schemes below. In the
General Schemes, A, Y, R.sup.12a, R.sup.12b, R.sup.13a, R.sup.13b,
and Z of Formulae A-D are as defined in connection with Formula VI,
unless otherwise indicated. In any of the General Schemes, suitable
protecting can be employed in the synthesis, for example, when Z is
(amino)alkyl or any other group that may group that may require
protection. (See, Wuts, P. G. M.; Greene, T. W., "Greene's
Protective Groups in Organic Synthesis", 4th Ed., J. Wiley &
Sons, N Y, 2007).
##STR01159##
[0256] Compound A is converted to compound B (i.e, a compound
having Formula VI, wherein X is --S(.dbd.O).sub.2--) by coupling
with a suitable sulfonyl chloride (Z--SO.sub.2Cl) in the presence
of a suitable base such as TEA or DIPEA in a suitable solvent such
as dichloromethane, acetonitrile, or DMF.
##STR01160##
[0257] Compound A is converted to compound C (i.e, a compound
having Formula VI, wherein X is --C(.dbd.O)--) by coupling with a
suitable acid chloride (Z--COCl) in the presence of a suitable base
such as TEA or DIPEA in a suitable solvent such as dichloromethane,
acetonitrile, or DMF, or by coupling with a suitable carboxylic
acid (Z--CO.sub.2H) in the presence of a suitable coupling reagent
such as HATU and a suitable base such as TEA or DIPEA in a suitable
solvent such as dichloromethane, acetonitrile, or DMF.
##STR01161##
[0258] Compound A is converted to compound D (i.e, a compound
having Formula VI, wherein X is --C(.dbd.O)C(R.sup.4)(H)--) by
coupling with a suitable carboxylic acid (Z--C(H)R.sup.4CO.sub.2H)
in the presence of a suitable coupling reagent such as HATU and a
suitable base such as TEA or DIPEA in a suitable solvent such as
dichloromethane, acetonitrile, or DMF.
EXAMPLES
General Synthetic Methods
[0259] General methods and experimental procedures for preparing
and characterizing Compounds of the Disclosure are set forth in the
general schemes above and the examples below. Wherever needed,
reactions were heated using conventional hotplate apparatus or
heating mantle or microwave irradiation equipment. Reactions were
conducted with or without stirring, under atmospheric or elevated
pressure in either open or closed vessels. Reaction progress was
monitored using conventional techniques such as TLC, HPLC, UPLC, or
LCMS using instrumentation and methods described below. Reactions
were quenched and crude compounds isolated using conventional
methods as described in the specific examples provided. Solvent
removal was carried out with or without heating, under atmospheric
or reduced pressure, using either a rotary or centrifugal
evaporator.
[0260] Compound purification was carried out as needed using a
variety of traditional methods including, but not limited to,
preparative chromatography under acidic, neutral, or basic
conditions using either normal phase or reverse phase HPLC or flash
columns or Prep-TLC plates. Compound purity and mass confirmations
were conducted using standard HPLC and/or UPLC and/or MS
spectrometers and/or LCMS and/or GC equipment (i.e., including, but
not limited to the following instrumentation: Waters Alliance 2695
with 2996 PDA detector connected with ZQ detector and ESI source;
Shimadzu LDMS-2020; Waters Acquity H Class with PDA detector
connected with SQ detector and ESI source; Agilent 1100 Series with
PDA detector; Waters Alliance 2695 with 2998 PDA detector, AB SCIEX
API 2000 with ESI source; Agilent 7890 GC). Exemplified compounds
were dissolved in either MeOH or MeCN to a concentration of
approximately 1 mg/mL and analyzed by injection of 0.5-10 .mu.L
into an appropriate LCMS system using the methods provided in the
following table. In each case the flow rate is 1 ml/min.
TABLE-US-00011 MS Heat MS Detector Mobile Mobile Block Temp Voltage
Method Column Phase A Phase B Gradient Profile (.degree. C.) (kV) A
Shim-pack Water/0.05% ACN/0.05% 5% to 100% B in 250 1.5 XR-ODS TFA
TFA 2.0 minutes, 100% 2.2 .mu.m B for 1.1 minutes, 3.0 .times. 50
mm 100% to 5% B in 0.2 minutes, then stop B Gemini- Water/0.04% ACN
5% to 100% B in 200 0.75 NX 3 .mu.m Ammonia 2.0 minutes, 100% C18 B
for 1.1 minutes, 110A 100% to 5% B in 0.1 minutes, then stop C
Shim-pack Water/0.05% ACN/0.05% 5% to 100% B in 250 0.85 XR-ODS TFA
TFA 2.0 minutes, 100% 1.6 .mu.m B for 1.1 minutes, 2.0 .times. 50
mm 100% to 5% B in 0.1 minutes, then stop D Shim-pack Water/0.05%
ACN/0.05% 5% to 100% B in 250 0.95 XR-ODS TFA TFA 2.0 minutes, 100%
2.2 .mu.m B for 1.1 minutes, 3.0 .times. 50 mm 100% to 5% B in 0.1
minutes, then stop
[0261] Compound structure confirmations were carried out using
standard 300 or 400 MHz NMR spectrometers with nOe's conducted
whenever necessary.
[0262] The following abbreviations are used herein:
TABLE-US-00012 Abbreviation Meaning ACN acetonitrile atm.
atmosphere DCM dichloromethane DHP dihydropyran DIBAL diisobutyl
aluminum hydride DIEA diisopropyl ethylamine DMF dimethyl formamide
DMF-DMA dimethyl formamide dimethyl acetal DMSO dimethyl sulfoxide
Dppf 1,1'- bis(diphenylphosphino)ferrocene EA ethyl acetate ESI
electrospray ionization EtOH Ethanol FA formic acid GC gas
chromatography H hour Hex hexanes HMDS hexamethyl disilazide HPLC
high performance liquid chromatography IPA Isopropanol LCMS liquid
chromatography/mass spectrometry MeOH Methanol Min Minutes NBS
N-bromo succinimide NCS N-chloro succinimide NIS N-iodo succinimide
NMR nuclear magnetic resonance nOe nuclear Overhauser effect Prep.
Preparative PTSA para-toluene sulfonic acid Rf retardation factor
rt room temperature RT retention time sat. Saturated SGC silica gel
chromatography TBAF tetrabutyl ammonium fluoride TEA Triethylamine
TFA trifluoroacetic acid THF Tetrahydrofuran TLC thin layer
chromatography UPLC ultra performance liquid chromatography
Example 1
Synthesis of tert-butyl
((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
##STR01162##
[0263] Step 1: Synthesis of tert-butyl
4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate
##STR01163##
[0265] To a solution of
1-(tert-butoxycarbonyl)piperidine-4-carboxylic acid (20.0 g, 87.23
mmol) in DCM (200 mL) was added HATU (36.46 g, 95.95 mmol), TEA
(17.62 g, 174.46 mmol) and N,O-dimethylhydroxylamine (8.93 g, 91.59
mmol). The mixture was stirred at 25.degree. C. for 16 h. The
mixture was washed with H.sub.2O and the DCM layer was evaporated
and the residue purified by silica column (PE/EA=1:1) to give the
tert-butyl 4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate
(21.0 g, yield: 88.5%). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta.=4.27-4.01 (m, 2H), 3.71 (s, 3H), 3.19 (s, 3H), 2.85-2.70
(m, 3H), 1.75-1.62 (m, 4H), 1.46 (s, 9H).
Step 2: Synthesis of tert-butyl
4-acetylpiperidine-1-carboxylate
##STR01164##
[0267] To a solution of tert-butyl
4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate (10.0 g, 36.76
mmol) in THF (150 mL) was added MeMgBr (24.5 mL, 73.52 mmol) at
-78.degree. C. The mixture was stirred at 25.degree. C. for 16 h.
TLC showed the reaction worked well. The mixture was quenched with
aq. NH.sub.4Cl and H.sub.2O (100 mL) was added. The mixture was
extracted with DCM (100 mL.times.3). The DCM layer was dried and
evaporated to give the tert-butyl 4-acetylpiperidine-1-carboxylate
(7.9 g, yield: 94.7%). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta.=4.10 (br. s., 2H), 2.88-2.70 (m, 2H), 2.46 (tt, J=3.6, 11.5
Hz, 1H), 2.17 (s, 3H), 1.84 (d, J=11.5 Hz, 2H), 1.58-1.48 (m, 2H),
1.48-1.41 (m, 9H).
Step 3: Synthesis of tert-butyl
4-(1-aminoethyl)piperidine-1-carboxylate
##STR01165##
[0269] To a solution of tert-butyl 4-acetylpiperidine-1-carboxylate
(7.9 g, 34.8 mmol) in MeOH (100 mL) was added NH.sub.4OAc (10.72 g,
139.2 mmol) and AcOH (1 mL). The mixture was stirred at 25.degree.
C. for 2 h, then was added NaBH.sub.3CN (2.63 g, 41.76 mmol). The
mixture was stirred at 25.degree. C. for 16 h. The mixture was
evaporated and 2N NaOH (50 mL) was added to the residue. The
solution was extracted with DCM (100 ml.times.3). The DCM layer was
washed with H.sub.2O and brine dried and evaporated to give the
tert-butyl 4-(1-aminoethyl)piperidine-1-carboxylate (7.93 g, yield:
100%). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta.=4.15 (br. s.,
2H), 2.77-2.57 (m, 3H), 1.76-1.59 (m, 2H) 1.46 (s, 9H), 1.33-10 (m,
5H), 1.06 (d, J=6.5 Hz, 3H).
Step 4: Synthesis of tert-butyl 4-(1-(((benzyloxy)carbonyl)amino)
ethyl)piperidine-1-carboxylate
##STR01166##
[0271] To a solution of tert-butyl
4-(1-aminoethyl)piperidine-1-carboxylate (7.93 g, 34.8 mmol) in THF
(80 mL) was added K.sub.2CO.sub.3 (9.6 g, 69.6 mmol) and Cbz-Cl
(7.1 g, 41.76 mmol). The mixture was stirred at 25.degree. C. for
16 h. The mixture diluted with H.sub.2O and extracted with EA (50
mL.times.3) and the EA layer evaporated to give tert-butyl
4-(1-(((benzyloxy)carbonyl)amino)ethyl)piperidine-1-carboxylate
(10.1 g. yield: 80.2%). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta.=7.42-7.23 (m, 5H), 7.16 (d, J=8.8 Hz, 1H), 5.00 (s, 2H),
3.94 (d, J=11.8 Hz, 2H), 3.45-3.34 (m, 1H), 2.71-2.55 (m, 2H),
1.67-1.42 (m, 3H), 1.38 (s, 9H), 1.13-0.89 (m, 5H).
Step 5: Synthesis of benzyl (1-(piperidin-4-yl)ethyl)carbamate
##STR01167##
[0273] To a solution of tert-butyl
4-(1-(((benzyloxy)carbonyl)amino)ethyl)piperidine-1-carboxylate
(10.1 g, 27.87 mmol) in EA (50 mL) was added HCl/EA (50 mL). The
mixture was stirred at 25.degree. C. for 16 h. Solvents were then
evaporated to give the benzyl (1-piperidin-4-yl)ethyl)carbamate as
a white solid. (8.3 g, yield: 100%). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta.=8.88 (br. s., 1H), 8.50 (d, J=9.5 Hz, 1H),
7.42-7.30 (m, 5H), 7.26 (d, J=8.8 Hz, 1H), 5.04-4.98 (m, 2H),
3.46-3.41 (m, 1H), 3.24 (d, J=11.8 Hz, 2H), 2.84-2.71 (m, 2H), 1.74
(d, J=13.6 Hz, 2H), 1.53 (d, J=3.8 Hz, 1H), 1.40-1.28 (m, 2H),
1.05-0.99 (m, 3H).
Step 6: Synthesis of tert-butyl
N-[(1S)-2-[4-[1-(benzyloxycarbonylamino)ethyl]-1-piperidyl]-1-methyl-2-ox-
o-ethyl]carbamate
##STR01168##
[0275] To a solution of benzyl (1-(piperidin-4-yl)ethyl)carbamate
(7.0 g, 23.43 mmol) in DCM (100 mL) was added HATU (8.9 g, 23.43
mmol), TEA (4.73 g, 46.86 mmol) and
(S)-2-((tert-butoxycarbonyl)amino)propanoic acid (4.43 g, 23.43
mmol). The mixture was stirred at 25.degree. C. for 5 h. The
mixture was washed with H.sub.2O and the DCM layer evaporated. The
residue was purified by silica column (PE/EA-1:1) to give the
tert-butyl
N-[(1S)-2-[4-[1-(benzyloxycarbonylamino)ethyl]-1-piperidyl]-1-methyl-2-ox-
o-ethyl]carbamate (8.9 g, yield: 87.7%). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta.=7 37 (s, 5H), 5.58 (br. s., 1H), 5.15-5.03 (m,
2H), 4.60 (dd, J=7.4, 14.7 Hz, 3H), 3.96-3.86 (m, 1H), 3.68 (br.
s., 1H), 2.99 (br. s., 1H), 2.54 (d, J=11.0 Hz, 1H), 1.91-1.63 (m,
3H), 1.44 (br. s., 9H), 1.28 (d, J=6.8 Hz, 4H), 1.21-1.07 (m,
4H).
Step 7: Synthesis of tert-butyl
((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
##STR01169##
[0277] To a solution of tert-butyl
N--[(S)-2-[4-[1-(benzyloxycarbonylamino)ethyl]-1-piperidyl]-1-methyl-2-ox-
o-ethyl]carbamate (8.9 g, 20.55 mmol) in MeOH (100 mL) was added
Pd/C (900 mg). The mixture was stirred at 25.degree. C. for 16
hours under H.sub.2 (50 psi). The reaction mixture was filtered and
the filtrate was evaporated to give the tert-butyl
((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate.
(5.6 g, yield: 91.2%). .sup.1H NMR (400 MHz, MeOD-d.sub.4):
.delta.=5.61 (t, J=7.2 Hz, 1H), 4.71-4.56 (m, 2H), 3.91 (br. s.,
1H), 3.06-2.96 (m, 1H), 2.77-2.71 (m, 1H), 2.59-2.50 (m, 1H),
1.85-1.68 (m, 2H), 1.44 (d, J=3.0 Hz, 9H), 1.35-1.22 (m, 4H),
1.19-1.04 (m, 4H); LCMS (m/z): 300.2 [M+H].sup.+.
Example 2
Synthesis of tert-butyl
(3-(((1r,4r)-4-aminocyclohexyl)amino)-3-oxopropyl)carbamate
##STR01170##
[0278] Step 1: Synthesis of tert-butyl
N-[3-[[4-(benzyloxycarbonylamino)cyclohexyl]amino]-3-oxo-propyl]carbamate
##STR01171##
[0280] To a solution of 3-((tert-butoxycarbonyl)amino)propanoic
acid (8.38 g, 44.30 mmol, 1.10 Eq) and TEA (8.2 g, 80 mmol, 2.0 Eq)
in DCM (500 mL) was added HATU (15.31 g, 40.27 mmol, 1.00 Eq) in
one portion at 20.degree. C. The mixture was stirred at 20.degree.
C. for 30 minutes. Then benzyl N-(4-aminocyclohexyl)carbamate
(10.00 g, 40.27 mmol, 1.00 Eq) was added in one portion at
20.degree. C. The mixture was stirred at 20.degree. C. for 12 hr at
which point LCMS analysis showed the reaction was complete. The
mixture was washed with water (400 mL.times.3) and extracted with
DCM (600 mL.times.3). The combined organic layer was concentrated
in vacuum. The residue was purified by recrystallization (from
minimum MeOH) to afford tert-butyl
N-[3-[[4-(benzyloxycarbonylamino) cyclohexyl]amino]-3-oxo-propyl]
carbamate (14.60 g, 34.80 mmol, 86.42% yield) as white solid. 1H
NMR (400 MHz, DMSO-d.sub.6) .delta. 7.74 (d, J=7.78 Hz, 1H),
7.31-7.40 (m, 5H), 7.20 (d, J=7.78 Hz, 1H), 6.73 (t, J=5.40 Hz,
1H), 5.00 (s, 2H), 3.44 (d, J=6.78 Hz, 1H), 3.23 (dd, J=7.40, 3.14
Hz, 1H), 3.10 (q, J=6.61 Hz, 2H), 2.18 (t, J=7.40 Hz, 2H), 1.78
(br. s., 4H), 1.37 (s, 9H), 1.16-1.27 (m, 4H); LCMS (m/z): 320.2
[M+H-100].sup.+.
Step 2: Synthesis of tert-butyl
(3-(((1r,4r)-4-aminocyclohexyl)amino)-3-oxopropyl) carbamate
[0281] To a solution of tert-butyl
N-[3-[[4-(benzyloxycarbonylamino)
cyclohexyl]amino]-3-oxo-propyl]carbamate (14.60 g, 34.80 mmol, 1.00
Eq) in MeOH (500 mL) was added Pd/C (5 g) under N.sub.2. The
suspension was degassed under vacuum and purged with H.sub.2
several times. The mixture was stirred under H.sub.2 (50 psi) at
50.degree. C. for 12 hours. LCMS showed the starting material was
consumed completely. The reaction mixture was filtered and
concentrated to give tert-butyl N-[3-[(4-aminocyclohexyl)
amino]-3-oxo-propyl]carbamate (9.80 g, 34.34 mmol, 98.67% yield) as
yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) 7.74 (d, J=7.53
Hz, 1H), 6.63-6.84 (m, 1H), 3.43 (br. s., 1H), 3.09 (q, J=6.78 Hz,
2H), 2.60 (br. s., 1H), 2.18 (t, J=7.28 Hz, 2H), 1.70-1.82 (m, 4H),
1.37 (s, 9H), 1.08-1.20 (m, 4H); LCMS (m/z): 230.2
[M+H-56].sup.+.
Example 3
Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindolin-
e-5-carboxamide (Cpd. No. 490)
##STR01172##
[0282] Step 1: Synthesis of
((2S)-1-(4-(1-(6-chloro-2-oxoindoline-5-carboxamido)
ethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
##STR01173##
[0284] To a mixture of 6-chloro-2-oxoindoline-5-carboxylic acid
(100.00 mg, 472.59 umol, 1.00 Eq), HATU (179.69 mg, 472.59 umol,
1.00 Eq) and TEA (47.82 mg, 472.59 umol, 1.00 Eq) in DCM (10 mL)
was added tert-butyl
((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
(141.50 mg, 472.59 umol, 1.00 Eq).The mixture was stirred at
20.degree. C. for 3 hours. LCMS showed the reaction was complete.
Water (5 mL) was added to the reaction and the aqueous phase was
extracted with DCM (10 mL.times.3). The combined organic phase was
dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated in
vacuum to afford tert-butyl
((2S)-1-(4-(1-(6-chloro-2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)-
-1-oxopropan-2-yl)carbamate (100.00 mg, crude). LCMS (m/z): 493.2
[M+H].sup.+.
Step 2: Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindolin-
e-5-carboxamide
##STR01174##
[0286] To a solution of tert-butyl
((2S)-1-(4-(1-(6-chloro-2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)-
-1-oxopropan-2-yl)carbamate (100.00 mg, 202.84 umol, 1.00 Eq) in
DCM (10 mL) was added dropwise TFA (3 mL) at 0.degree. C. The
resulting solution was then stirred for 3 hours at 25.degree. C.
TLC showed the reaction was complete. The mixture was evaporated
and purified by prep-HPLC to afford
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindolin-
e-5-carboxamide (38.50 mg, yield: 48.31%). .sup.1H NMR (400 MHz,
MeOD-d.sub.4): .delta.=7.29 (s, 1H), 6.95 (s, 1H), 4.56 (d, J=12.5
Hz, 1H), 4.45-4.38 (m, 1H), 3.91 (d, J=12.3 Hz, 2H), 3.54 (s, 2H),
3.15 (br. s., 2H), 2.72-2.63 (m, 1H), 2.01-1.85 (m, 2H), 1.75 (br.
s., 1H), 1.46 (dd, J=6.9, 11.7 Hz, 3H), 1.29-1.18 (m, 4H). LCMS
(m/z): 393.2 [M+H].sup.+.
Example 4
Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carbo-
xamide hydrochloride (Cpd. No. 86)
##STR01175##
[0287] Step 1: Synthesis of tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido) ethyl)
piperidin-1-yl) propan-2-yl) carbamate
##STR01176##
[0289] To a stirred solution of 2-oxoindoline-5-carboxylic acid
(0.177 g, 1.00 mmol) in DMF (2 mL), were added EDCI.HCl (0.24 g,
1.25 mmol), HOBt (0.168 g, 1.25 mmol) and triethylamine (0.35 mL,
2.5 mmol). The solution was stirred for 10 min at 0.degree. C.
tert-Butyl
((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
(0.25 g, 0.83 mmol) was added and the reaction stirred at rt for 6
h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was separated, washed with brine, dried over anhydrous
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a crude residue which was purified by column chromatography to
afford tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)pro-
pan-2-yl)carbamate (0.11 g, 28%). LCMS: 359.25 (M-Boc).
Step 2: Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carbo-
xamide hydrochloride
##STR01177##
[0291] To a stirred solution of tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)pro-
pan-2-yl)carbamate (0.1 g, 0.47 mmol) in dioxane (2 mL) was added 4
M dioxane:HCl solution (4 mL) at 0.degree. C. and the reaction
mixture stirred at rt for 5 h. The progress of the reaction was
monitored by TLC. After complete consumption of tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl)
piperidin-1-yl)propan-2-yl)carbamate, the solvent was removed under
reduced pressure to obtain a crude residue which was purified by
repeated washing with ether and pentane to obtain
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carbo-
xamide hydrochloride (0.08 g, 93%). .sup.1H NMR (400 MHz, DMSO-d6):
.delta. 10.63 (s, 1H), 8.06 (q, J=11.0, 8.4 Hz, 41), 7.77-7.70 (m,
2H), 6.85 (d, J=8.5 Hz, 1H), 4.38-4.35 (m, 2H), 3.85 (d, J=13.9 Hz,
2H), 3.53 (s, 2H), 3.09-2.90 (m, 1H), 2.57 (dd, J=25.3, 12.8 Hz,
1H), 1.75 (dd, J=26.2, 12.6 Hz, 3H), 1.3-1.28 (m, 3H), 1.12 (d,
J=6.8 Hz, 4H), 1.02 (d, J=12.5 Hz, 1H); LCMS: 359.25
(M+1).sup.+.
Example 5
Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenz-
o[d]oxazole-6-carboxamide hydrochloride (Cpd. No. 94)
##STR01178##
[0292] Step 1: Synthesis of tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)ethyl-
)piperidin-1-yl)propan-2-yl)carbamate
##STR01179##
[0294] To a stirred solution of
2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxylic acid (0.2 g, 0.66
mmol) in DMF (1.5 mL) was added EDCI.HCl (0.191 g, 1.00 mmol), HOBt
(0.091 g, 0.66 mmol) and diisopropylethylamine (0.34 mL, 2.00
mmol). The solution was stirred for 10 min at 0.degree. C. After
that, tert-butyl
((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
(0.142 g, 0.80 mmol) was added and the reaction stirred at rt for
12 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was separated, washed with brine, dried over anhydrous
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a crude residue which was purified by column chromatography to
afford tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)ethyl-
)piperidin-1-yl)propan-2-yl)carbamate (0.104 g, 33%). LCMS: 361.05
(M-Boc).sup.+.
Step 2: Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenz-
o[d]oxazole-6-carboxamide hydrochloride
##STR01180##
[0296] To a stirred solution of
((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)ethyl-
)piperidin-1-yl)propan-2-yl)carbamate (0.03 g, 0.08 mmol) in
dioxane (1 mL) at 0.degree. C. was added 4M dioxane:HCl solution (1
mL). The reaction mixture was stirred at rt for 3 h. The progress
of the reaction was monitored by TLC. After complete consumption of
starting material, the solvent was removed under reduced pressure
to obtain a crude residue which was purified by repeated washing
with ether and hexane to obtain
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenz-
o[d]oxazole-6-carboxamide hydrochloride (0.008 g, 36%). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 10.66 (s, 1H), 8.72 (d, J=12.3 Hz,
1H), 8.42 (q, J=8.1, 7.1 Hz, 2H), 7.74 (d, J=8.0 Hz, 2H), 6.86 (d,
J=8.1 Hz, 1H), 3.54 (s, 2H), 3.25 (d, J=12.4 Hz, 2H), 3.16 (t,
J=6.1 Hz, 2H), 2.82 (q, J=11.8 Hz, 2H), 2.62 (s, 1H), 1.79 (d,
J=13.4 Hz, 2H), 1.35-1.32 (m, 2H); LCMS: 274.15 (M+H).sup.+
Example 6
Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H--
benzo[d]imidazole-5-carboxamide (Cpd. No. 93)
##STR01181##
[0297] Step 1: Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H--
benzo[d]imidazole-5-carboxamide hydrochloride
##STR01182##
[0299] To a stirred solution of
2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylic acid (0.2 g,
0.66 mmol) in DMF (1.5 mL) was added EDCI.HCl (0.191 g, 1.00 mmol),
HOBt (0.091 g, 0.66 mmol) and diisopropylethylamine (0.34 mL, 2.00
mmol). The solution was stirred for 10 min at 0.degree. C. After
that tert-butyl
((2S)-1-(4-(I-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
(0.142 g, 0.80 mmol) was added and the reaction stirred at rt for
12 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was washed with brine, dried over anhydrous Na.sub.2SO.sub.4
and concentrated under reduced pressure to obtain a crude residue
which was purified by column chromatography to afford tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamido-
)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.140 g, 45%). LCMS:
360.2 (M-Boc).
Step 2: Synthesis of
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H--
benzo[d]imidazole-5-carboxamide hydrochloride
##STR01183##
[0301] To a stirred solution of tert-butyl
((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamido-
)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.1 g, 0.21 mmol) in
dioxane (2 mL) at 0.degree. C. was added 4M dioxane:HCl solution (1
mL). The reaction mixture was stirred at rt for 3 h. The progress
of the reaction was monitored by TLC. After complete consumption of
the starting material, the solvent was removed under reduced
pressure to obtain a crude residue which was purified by repeated
washing with ether and hexane to obtain
N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H--
benzo[d]imidazole-5-carboxamide hydrochloride (0.060 g, 69%).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.85 (d, J=16.4 Hz,
2H), 8.10 (p, J=8.9, 7.6 Hz, 4H), 7.55-7.52 (m, 1H), 7.44 (q, J=2.0
Hz, 1H), 6.95 (d, J=8.1 Hz, 1H), 4.44-4.24 (m, 2H), 3.88-3.86 (m,
2H), 3.09-2.91 (m, 1H), 2.6-2.57 (m, 1H), 1.83-1.64 (m, 3H),
1.33-0.99 (m, 8H); LCMS: 360.25 (M+1).sup.+.
Example 7
N-(1-(4-aminobutanoyl)piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide
(Cpd. No. 560)
##STR01184##
[0302] Step 1: Synthesis of tert-butyl
4-(1H-1,2,4-triazole-5-carbonylamino)piperidine-1-carboxylate
##STR01185##
[0304] To a solution of 1H-1,2,4-triazole-5-carboxylic acid (2.00
g, 17.69 mmol, 1.00 Eq) in DMF (100 mL) was added TEA (2.68 g,
26.53 mmol, 1.50 Eq), BOP-Cl (4.95 g, 19.46 mmol, 1.10 Eq), and
tert-butyl 4-aminopiperidine-1-carboxylate (3.90 g, 19.46 mmol,
1.10 Eq). The reaction mixture was stirred at 20.degree. C. for 12
hr. The reaction mixture was concentrated and dissolved in MeOH,
filtered, the organic layer was concentrated and purified by silica
gel column chromatography to give tert-butyl
4-(1H-1,2,4-triazole-5-carbonylamino)piperidine-1-carboxylate (3.13
g, 10.60 mmol, 59.9% yield) as a yellow solid. LCMS (m/z): 240.1
[M+H-56].sup.+.
Step 2: Synthesis of
N-(4-piperidyl)-1H-1,2,4-triazole-5-carboxamide
##STR01186##
[0306] To a solution of tert-butyl
4-(H-1,2,4-triazole-5-carbonylamino)piperidine-1-carboxylate (3.13
g, 10.60 mmol, 1.00 Eq) in DCM (50 mL) was added TFA (10 mL). The
reaction mixture was stirred at 20.degree. C. for 5 hr. The
reaction mixture was concentrated and lyophilized to afford
N-(4-piperidyl)-1H-1,2,4-triazole-5-carboxamide (6.00 g, 19.40
mmol, 91.51% yield) as a light yellow solid. LCMS (m/z): 196.2
[M+H].sup.+.
Step 3: Synthesis of tert-butyl
(4-(4-(H-1,2,4-triazole-5-carboxamido)piperidin-1-yl)-4-oxobutyl)carbamat-
e
##STR01187##
[0308] To a mixture of 4-((tert-butoxycarbonyl)amino)butanoic acid
(203.00 mg, 998.87 umol, 1.00 q) and HATU (379.80 mg, 998.87 umol,
1.00 Eq) in DCM (10 mL) was added Et.sub.3N (202.15 mg, 2.00 mmol,
2.00 Eq) in one portion at 20.degree. C. The mixture was stirred at
20.degree. C. for 30 min. Then
N-(piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide (195.00 mg,
998.87 umol, 1.00 Eq) was added in one portion at 20.degree. C. The
mixture was stirred at 20.degree. C. for 12 h. LCMS showed the
reaction was complete. The reaction mixture was washed with water
(40 mL.times.3) and extracted with DCM (50 mL.times.3). The
combined organic layer was concentrated under vacuum. The residue
was purified by prep-HPLC to afford tert-butyl
(4-(4-(1H-1,2,4-triazole-5-carboxamido)piperidin-1-yl)-4-oxobutyl)carbama-
te (200.00 mg, 525.71 umol, 52.63% yield) as white solid. .sup.1H
NMR (400 MHz, MeOD-d.sub.4) .delta. 8.45 (s, 1H) 4.54 (d, J=13.30
Hz, 1H) 4.13-4.21 (m, 1H) 4.01 (d, J=13.80 Hz, 1H) 3.23-3.30 (m,
1H) 3.11 (t, J=6.78 Hz, 2H) 2.85 (t, J=11.67 Hz, 1H) 2.46 (t,
J=7.53 Hz, 2H) 1.97-2.07 (m, 2H) 1.78 (quin, J=7.15 Hz, 2H)
1.53-1.65 (m, 2H) 1.38-1.53 (m, 9H); LCMS (m/z): 381.2
[M+H].sup.+.
Step 4: Synthesis of
N-(1-(4-aminobutanoyl)piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide
##STR01188##
[0310] To a mixture of tert-butyl
(4-(4-(1H-1,2,4-triazole-5-carboxamido)piperidin-1-yl)-4-oxobutyl)carbama-
te (200.00 mg, 525.71 umol, 1.00 Eq) in DCM (20 mL) was added TFA
(5 mL) dropwise at 0.degree. C. The mixture was stirred at
0.degree. C. for 30 min. The reaction then warmed slowly to
20.degree. C. and stirred at this temperature for another 12 h.
LCMS showed the reaction complete. The mixture was concentrated
under reduced pressure at 60.degree. C. The residue was purified by
prep-HPLC to afford
N-(1-(4-aminobutanoyl)piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide
(104.20 mg, 50.26% yield) as colorless oil (TFA salt). .sup.1H NMR
(400 MHz, MeOD-d.sub.4) .delta. 8.49 (s, 1H) 4.54 (d, J=13.55 Hz,
1H) 4.12-4.21 (m, 1H) 4.00 (d, J=13.80 Hz, 1H) 3.25 (t, J=11.80 Hz,
1H) 3.02 (t, J=7.28 Hz, 2H) 2.86 (t, J=11.67 Hz, 1H) 2.60 (t,
J=6.90 Hz, 2H) 1.92-2.08 (m, 4H) 1.46-1.73 (m, 2H); LCMS (m/z):
281.1 [M+H].sup.+
Example 8
Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide
hydrochloride (Cpd. No. 29
##STR01189##
[0311] Step 1: Synthesis of tert-butyl
((1r,4r)-4-(1-benzyl-3-methyl-1H-pyrazole-5-carboxamido)cyclohexyl)carbam-
ate
##STR01190##
[0313] To a stirred solution of
1-benzyl-3-methyl-1H-pyrazole-5-carboxylic acid (0.150 g, 0.69
mmol) in DMF (5 mL) was added HATU (0.393 g, 1.0 mmol) and
diisopropylethylamine (0.24 mL, 1.4 mmol). The solution was stirred
for 10 min at 0.degree. C. tert-Butyl
((1r,4r)-4-aminocyclohexyl)carbamate (0.147 g, 0.69 mmol) was added
and the reaction stirred at rt for 2 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with water and
extracted with ethyl acetate. The organic layer was separated,
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford tert-butyl
((1r,4r)-4-(1-benzyl-3-methyl-1H-pyrazole-5-carboxamido)cyclohexyl)carbam-
ate (0.08 g, 25%). LCMS: 313.1 (M-100).sup.+.
Step 2: Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide
hydrochloride
##STR01191##
[0315] To a stirred solution of tert-butyl
((1r,4r)-4-(1-benzyl-3-methyl-1H-pyrazole-5-carboxamido)cyclohexyl)carbam-
ate (0.05 g, 0.121 mmol) in dioxane (1 mL) at 0.degree. C. was
added 4 M dioxane:HCl (1.5 mL). The reaction mixture was stirred at
rt for 1 h. The progress of the reaction was monitored by TLC.
After complete consumption of the starting material, the solvent
was removed under reduced pressure to obtain a crude residue. The
material was purified by repeated washing with ether and pentane to
obtain
N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide
hydrochloride (0.03 g, 51%). .sup.1H NMR (400 MHz, DMSO-d6):
.delta. 8.26 (d, J=7.8 Hz, 1H), 7.94 (d, J=5.3 Hz, 3H), 7.33-7.10
(m, 5H), 6.66 (s, 1H), 5.60 (s, 2H), 2.96 (d, J=10.9 Hz, 1H), 2.16
(s, 3H), 1.96 (d, J=10.4 Hz, 2H), 1.83 (d, J=11.1 Hz, 2H),
1.47-1.26 (m, 4H); LCMS: 313.2 (M+H).sup.+.
Example 9
Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxami-
de hydrochloride
##STR01192##
[0316] Step 1: Synthesis of tert-butyl
((1r,4r)-4-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)cyclohexyl)carb-
amate
##STR01193##
[0318] To a stirred solution of tert-butyl
((1r,4r)-4-aminocyclohexyl)carbamate (0.090 g, 0.420 mmol) in DMF
(2 mL) was added EDCI (0.096 g, 0.504 mmol), HOBT (0.068 g, 0.504
mmol) and DIPEA (0.3 mL) and the solution stirred for 10 min at
0.degree. C. 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic acid
(0.064 g, 0.420 mmol) was then added and the reaction mixture
stirred at rt for 2 hr. The progress of the reaction was monitored
by TLC. After complete consumption of starting material, the
reaction was quenched with water and extracted with ethyl acetate.
The organic layer was separated, washed with brine, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue which was purified by column chromatography to afford
tert-butyl
((1r,4r)-4-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)cyclohexyl)carb-
amate (0.035 g, 24%). LCMS: 250.1 (M-100).sup.+ observed.
Step 2: Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxami-
de hydrochloride
##STR01194##
[0320] To a stirred solution of tert-butyl
((1r,4r)-4-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)cyclohexyl)carb-
amate (0.035 g, 0.10 mmol) in methanol (3 mL) was added 4M
methanol:HCl (3 mL) at 0.degree. C. and the reaction stirred at rt
for 16 hr. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the solvent was removed
under reduced pressure and the residue was purified by washings
with diethyl ether and DCM to obtain
N-((1r,4r)-4-aminocyclohexyl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxami-
de hydrochloride (0.013 g, 49%). .sup.1H NMR (400 MHz,
DMSO-d.sub.6) .delta. 8.58 (s, 1H), 8.31 (d, J=8.3 Hz, 1H), 7.97
(s, 2H), 4.1-4.05 (m, J=7.5, 3.9 Hz, 1H), 3.75-3.66 (m, 1H),
3.01-2.88 (m, 1H), 1.97 (d, J=10.5 Hz, 2H), 1.83 (d, J=9.5 Hz, 2H),
1.55-1.34 (m, 4H), 1.25-1.07 (m, 4H); LCMS: 250.05 (M+H).sup.+.
Example 10
Synthesis of 2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide
hydrochloride (Cpd. No. 100)
##STR01195##
[0321] Step 1: Synthesis of tert-butyl
4-((2-oxoindoline-5-carboxamido)methyl)
piperidine-1-carboxylate
##STR01196##
[0323] To a stirred solution of 2-oxoindoline-5-carboxylic acid
(0.7 g, 3.95 mmol) in DMF (5 mL) was added EDCI.HCl (1.13 g, 5.92
mmol), HOBt (0.8 g, 5.92 mmol) and triethylamine (1.7 mL, 11.8
mmol). The solution was stirred for 10 min at 0.degree. C. After
that tert-butyl 4-(aminomethyl)piperidine-1-carboxylate (0.93 g,
4.34 mmol) was added and the reaction stirred at rt for 16 h. The
progress of the reaction was monitored by TLC. After complete
consumption of starting material, the reaction was quenched with
water and extracted with ethyl acetate. The organic layer was
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by preparative HPLC to afford tert-butyl
4-((2-oxoindoline-5-carboxamido)methyl)piperidine-1-carboxylate
(0.130 g, 8%) LCMS: 274.1 (M-Boc).sup.+.
Step 2: Synthesis of
2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide
hydrochloride
##STR01197##
[0325] To a stirred solution of tert-butyl
4-((2-oxoindoline-5-carboxamido)methyl)piperidine-1-carboxylate
(0.03 g, 0.08 mmol) in dioxane (1 mL) at 0.degree. C. was added 4M
dioxane:HCl solution (mL). The reaction mixture was stirred at rt
for 3 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the solvent was removed
under reduced pressure to obtain a crude residue which was purified
by repeated washing with ether and hexane to obtain
2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide hydrochloride
(0.008 g, 36%). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.66
(s, 1H), 8.72 (d, J=12.3 Hz, 1H), 8.42 (q, J=8.1, 7.1 Hz, 2H), 7.74
(d, J=8.0 Hz, 2H), 6.86 (d, J 8.1 Hz, 1H), 3.54 (s, 2H), 3.25 (d,
J=12.4 Hz, 2H), 3.16 (t, J=6.1 Hz, 2H), 2.82 (q, J=11.8 Hz, 2H),
2.62 (s, 1H), 1.79 (d, J=13.4 Hz, 2H), 1.35-1.32 (m, 2H); LCMS:
274.15 (M+H).
Example 11
Synthesis of
2-oxo-N-((1R,3r,5SR)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.1-
]octan-3-yl)-2,3-dihydrobenzo[d]oxazole-6-carboxamide hydrochloride
(Cpd. No. 601)
##STR01198##
[0326] Step 1: Synthesis of benzyl
4-(((1R,3r,5S)-3-((2,2,2-trichloroethoxy)
carbonylamino)-8-aza-bicyclo[3.2.1]octan-8-ylsulfonyl)methyl)piperidine-1-
-carboxylate
##STR01199##
[0328] Into a 100-mL round-bottom flask was placed
2,2,2-trichloroethyl
N-[(1R,3S,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate (780 mg, 2.59
mmol, 1.00 equiv), dichloromethane (10 mL), TEA (0.93 g) added
dropwise at 0.degree. C. Then benzyl
4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (1 g, 3.01 mmol,
1.17 equiv) was added in several portions. The resulting solution
was stirred overnight at room temperature. The resulting mixture
was concentrated under vacuum. The residue was chromatographed on a
silica gel column with dichloromethane/methanol (20:1-10:1). This
resulted in 1.3 g (84%) of benzyl
4-[[(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabic-
yclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a
white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 7.41-7.32
(m, 5H), 5.32-5.10 (m, 2H), 4.48 (s, 2H), 4.27-4.12 (m, 4H),
4.00-3.96 (m, 1H), 2.93-2.80 (m, 4H), 230-2.07 (m, 5H), 1.98-1.91
(m, 6H), 1.30-1.26 (m, 3H) ppm. LCMS (method A, EST): RT=1.32 min,
m/z=620.2 [M+Na].sup.+.
Step 2: Synthesis of benzyl
4-(((1R,3r,5S)-3-amino-8-aza-bicyclo[3.2.1]octan-8-ylsulfonyl)methyl)pipe-
ridine-1-carboxylate
##STR01200##
[0330] Into a 100-mL round-bottom flask was placed benzyl
4-[[(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.-
2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (1 g, 1.68
mmol, 1.00 equiv), acetic acid (15 mL), water (1 mL), and zinc
(1.63 g, 24.92 mmol, 14.88 equiv). The resulting mixture was
stirred for 2 h at room temperature and then diluted with 30 mL of
H.sub.2O. The solids were filtered out. The pH value of the
filtrate was adjusted to 9 with NaOH (40%, aq.). The resulting
solution was extracted with 3.times.30 mL of dichloromethane and
the organic layers combined, dried over anhydrous sodium sulfate
and concentrated under vacuum. This resulted in 0.7 g (99%) of
benzyl
4-[[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperi-
dine-1-carboxylate as a white solid. LCMS (method D, ESI): RT=0.85
min, m/z=422.3 [M+H].sup.+.
Step 3: Synthesis of benzyl
4-(((1R,3r,5S)-3-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)-8-aza-b-
icyclo[3.2.1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate
##STR01201##
[0332] Into a 25-mL round-bottom flask was placed
2-oxo-2,3-dihydro-1,3-benzoxazole-6-carboxylic acid (100 mg, 0.56
mmol, 2.35 equiv), N,N-dimethylformamide (10 mL), HOBT (135 mg,
2.00 equiv) and EDCI (191 mg, 2.00 equiv). Then benzyl
4-[[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperi-
dine-1-carboxylate (100 mg, 0.24 mmol, 1.00 equiv) was added in
several portions. After complete addition, TEA (250 mg, 5.00 equiv)
was added dropwise. The resulting solution was stirred for 1 h at
room temperature. The mixture was concentrated under vacuum and the
residue diluted with 10 mL of H.sub.2O. This mixture was extracted
with 3.times.10 mL of ethyl acetate and the organic layers
combined. The combined extracts were washed with 2.times.30 mL of
brine, dried, and concentrated. The residue was chromatographed on
a silica gel column with dichloromethane/methanol (10/1). This
resulted in 100 mg (72%) of benzyl
4-[[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1,3-benzoxazole-6-amido)-8-azabicyclo-
[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as yellow
oil. LCMS (method D, ESI): RT=1.38 min, m/z=583.0 [M+H].sup.+.
Step 4: Synthesis of
2-oxo-N-((1R,3r,5S)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.1]-
octan-3-yl)-2,3-dihydrobenzo[d]oxazole-6-carboxamide
##STR01202##
[0334] Into a 25-mL round-bottom flask was placed benzyl
4-[[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1,3-benzoxazole-6-amido)-8-azabicyclo-
[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (100 mg,
0.17 mmol, 1.00 equiv) and hydrochloric acid (12N, 10 mL). The
resulting solution was stirred for 4 h at room temperature and then
concentrated under vacuum. The residue was applied onto Pre-HPLC
with the following conditions: Column: X Bridge C18, 19*150 mm, 5
um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow
rate: 20 mL/min; Gradient: 30% B to 70% B in 10 min; 254 nm. The
product was dissolved again into hydrochloric acid (5 mL, 12 N) and
concentrated under vacuum. This resulted in 7.3 mg (9%) of
2-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.-
1]octan-3-yl]-2,3-dihydro-1,3-benzoxazole-6-carboxamide as a white
solid. .sup.1H NMR (300 MHz, D.sub.2O) .delta.: 7.52-7.49 (m, 2H),
7.18-7.16 (m, 1H), 4.21 (s 2H), 4.08-4.03 (m, 1H), 3.38-3.34 (m,
2H), 3.20-3.18 (m, 2H), 3.02-2.93 (m, 2H), 2.24-1.94 (m, 11H),
1.54-1.51 (m, 2H) ppm. LCMS (method D, ESI): RT=1.65 min, m/z=449.2
[M-HCl+H].sup.+.
Example 12
Synthesis of
(2R)-2-methyl-3-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-a-
zabicyclo[3.2.1]octan-3-yl]-3,4-dihydro-2H-1,4-benzoxazine-6-carboxamide
hydrochloride (Cpd. No. 625)
##STR01203##
[0335] Step 1: Synthesis of methyl
3-(2-bromopropanamido)-4-hydroxybenzoate
##STR01204##
[0337] Into a 100-mL round-bottom flask was placed ethyl acetate
(10 mL), water (10 mL), methyl 3-amino-4-hydroxybenzoate (1 g, 5.98
mmol, 1.00 equiv), and sodium bicarbonate (553 mg, 1.10 equiv).
This was followed by the addition 2-bromopropanoyl bromide (1.3 g,
6.02 mmol, 1.00 equiv) which was added dropwise with stirring at
0.degree. C. The resulting solution was stirred for 30 min at room
temperature. The mixture was then washed with 2.times.30 mL of
H.sub.2O and 1.times.30 mL of brine. The mixture was dried over
anhydrous sodium sulfate, filtered and concentrated under vacuum.
This resulted in 1.5 g (83%) of methyl
3-(2-bromopropanamido)-4-hydroxybenzoate as a brown solid. .sup.1H
NMR (300 MHz, CDCl.sub.3) .delta.: 8.89 (s, 1H), 8.43 (s, 1H),
7.89-7.82 (m, 2H), 7.04 (d, J=8.4 Hz, 1H), 4.65 (q, J=14.1 Hz, 1H),
3.07 (s, 3H), 2.01 (d, J=7.2 Hz, 3H) ppm. LCMS (method D, ESI):
RT=1.30 min, m/z=302.0 [M+H].sup.+.
Step 2: Synthesis of methyl
2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylate
##STR01205##
[0339] Into a 100-mL round-bottom flask was placed
N,N-dimethylformamide (10 mL), methyl
3-(2-bromopropanamido)-4-hydroxybenzoate (1.5 g, 4.96 mmol, 1.00
equiv), and potassium carbonate (880 mg, 1.30 equiv). The resulting
mixture was stirred for 15 h at room temperature. The mixture was
then diluted with 30 mL of H.sub.2O. The solids were collected by
filtration. This resulted in 1 g (91%) of methyl
2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylate as
a brown solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 8.29 (s,
1H), 7.72 (q, J=8.4 Hz, 1H), 7.56 (d, J=2 Hz, 1H), 7.03 (d, J=8.4
Hz, 1H), 4.77 (q, J=14 Hz, 1H), 3.93 (s, 3H), 1.64 (d, J=7.2 Hz,
3H) ppm. LCMS (method C, ESI): RT=0.96 min, m/=222.0
[M+H].sup.+.
Step 3: Synthesis of
2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylic
Acid
##STR01206##
[0341] Into a 100-mL round-bottom flask was placed tetrahydrofuran
(15 mL), methanol (15 mL), water (10 ml), and methyl
2-methyl-3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylate
(1 g, 4.52 mmol, 1.00 equiv). This was followed by the addition of
a solution of sodium hydroxide (362 mg, 2.00 equiv) in 5 ml
H.sub.2O which was added dropwise with stirring at 0.degree. C. The
resulting solution was stirred for 10 min at 0.degree. C. in an
ice/salt bath. The resulting solution was allowed to react, with
stirring, for an additional 15 h at room temperature. The reaction
mixture was concentrated under vacuum. The residue was diluted with
30 mL of H.sub.2O and the pH adjusted to 3-4 with hydrochloric acid
(1 N). The solids were collected by filtration. This resulted in
900 mg (96%) of
2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylic
acid as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD) .delta.:
7.68 (q, J=8.4 Hz, 1H), 7.59 (d, J=2 Hz, 1H), 4.47 (s, 1H), 7.03
(d, J=8.4 Hz, 1H), 4.75 (q, J=13.6 Hz, 1H), 1.55 (d, J=6.8 Hz, 3H)
ppm. LCMS (method A, ESI): RT=1.08 min, m/z=208.0 [M+H].sup.+.
Step 4: Synthesis of tert-butyl
(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carbox-
amido)-8-azabicyclo[3.2.1]octane-8-carboxylate
##STR01207##
[0343] Into a 100-mL round-bottom flask was placed
N,N-dimethylformamide (50 mL),
2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylic
acid (500 mg, 2.41 mmol, 1.00 equiv), EDCI (923 mg, 2.00 equiv),
HOBT (652 mg, 2.00 equiv), and tert-butyl
(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1l]octane-8-carboxylate (710
mg, 3.14 mmol, 1.30 equiv). This was followed by the addition of
TEA (1232 mg, 5.0 equiv) which was added dropwise with stirring at
0.degree. C. The resulting solution was stirred for 14 h at room
temperature. The reaction mixture was then diluted with 50 mL of
EA. The resulting mixture was washed with 3.times.30 mL of H.sub.2O
and 1.times.30 mL of brine. The mixture was dried over anhydrous
sodium sulfate, filtered and concentrated. The residue was
chromatographed on a silica gel column with ethyl acetate/petroleum
ether (4:1). This resulted in 800 mg (80%) of tert-butyl
(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carbox-
amido)-8-azabicyclo[3.2.1]octane-8-carboxylate as a white solid.
.sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 8.66 (s, 1H), 7.52 (d,
J=1.6 Hz, 1H), 7.22 (q, J=8.4 Hz, 1H), 7.02 (d, J=8.4 Hz, 1H), 6.51
(d, J=6.8 Hz, 1H), 4.72 (q, J=13.6 Hz, 1H), 4.39-420 (m, 3H),
2.45-2.25 (m, 2H), 2.20-2.10 (m, 2H), 1.95-1.75 (m, 4H), 1.60 (d,
J=7.2 Hz, 3H),1.50 (s, 9H) ppm. LCMS (method C, EST): RT=1.08 min,
m/z=416.0 [M+H].sup.+.
Step 5: Synthesis of
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2-methyl-3-oxo-3,4-dihydro-2-
H-benzo[b][1,4]oxazine-6-carboxamide
##STR01208##
[0345] Into a 100-mL round-bottom flask was placed dichloromethane
(20 mL) and tert-butyl
(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carbox-
amido)-8-azabicyclo[3.2.1]octane-8-carboxylate (800 mg, 1.93 mmol,
1.00 equiv). To the above, hydrogen chloride (gas) was introduced.
The resulting solution was stirred for 4 h at room temperature and
then was concentrated under vacuum. The residue was diluted with 40
mL of H.sub.2O. The pH was adjusted to 8 with saturated aqueous
sodium carbonate and the resulting mixture extracted with
3.times.40 mL of DCM. The organic layers were combined and washed
with 2.times.40 mL of brine. The extract was concentrated under
vacuum. This resulted in 500 mg (82%) of
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2-methyl-3-oxo-3,4-dihydr-
o-2H-benzo[b][1,4]oxazine-6-carboxamide as a light yellow solid.
.sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 7.42 (q, J=8.4 Hz, 1H),
7.37 (d, J=2 Hz, 1H), 7.04 (d, J=8.4 Hz, 1H), 4.72 (q, J=13.6 Hz,
1H), 4.12 (t, J=6.4 Hz, 1H), 3.69 (s, 2H), 2.22-2.15 (m, 4H),
2.10-1.95 (m, 4H), 1.54 (d, J=6.8 Hz, 3H) ppm. LCMS (method A,
ESI): RT=0.93 min, m/z=364.0 [M+H].sup.+.
Step 6: Synthesis of benzyl
4-[[(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-ca-
rboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carbox-
ylate
##STR01209##
[0347] Into a 100-mL 3-necked round-bottom flask was placed
N,N-dimethylformamide (10 mL),
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2-methyl-3-oxo-3,4-dihydro-2-
H-benzo[b][1,4]oxazine-6-carboxamide (250 mg, 0.79 mmol, 1.00
equiv), and TEA (231 mg, 3.00 equiv). This was followed by the
addition of a solution of benzyl
4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (657 mg, 1.98
mmol, 2.50 equiv) in 2 ml N,N-dimethylformamide which was added
dropwise with stirring at -20.degree. C. The resulting solution was
stirred for 30 min at -20.degree. C. The mixture was allowed to
react, with stirring, for an additional 15 h at room temperature.
The mixture was diluted with 50 mL of EA and washed with 2.times.20
mL of water and 2.times.20 mL of brine. The organic phase was dried
over anhydrous sodium sulfate and filtered. The residue was
chromatographed on a silica gel column with
dichloromethane/methanol (20:1). This resulted in 60 mg (12%) of
benzyl
4-[[(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]ox-
azine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidin-
e-1-carboxylate as a white solid. LCMS (method B, ESI): RT=1.43
min, m/z=611.0 [M+H].sup.+.
Step 7: Synthesis of benzyl
4-[[(1R,3r,5S)-3-[(2R)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-
-6-amido]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxy-
late
##STR01210##
[0349] Benzyl
4-[[(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-ca-
rboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carbox-
ylate (60 mg) was purified by Chiral-Prep-HPLC with the following
conditions (Chiral_HPLC): Column, CHIRALPAK IA; mobile phase,
MTBE:EtOH=50:50; Detector, 254 nm. This resulted in 28 mg (47%) of
benzyl
4-[[(1R,3r,5S)-3-[(2R)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-
-6-carboxamido]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-c-
arboxylate as a white solid. ee value: 100%
Step 8: Synthesis of
(2R)-2-methyl-3-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-a-
zabicyclo[3.2.1]octan-3-yl]-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxam-
ide hydrochloride
##STR01211##
[0351] Into a 50-mL round-bottom flask was placed benzyl
4-[[(1R,3r,5S)-3-[(2R)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-
-6-carboxamido]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-c-
arboxylate (28 mg, 0.05 mmol, 1.00 equiv) and hydrochloric acid
(12N, 10 mL). The resulting solution was stirred for 4 h at room
temperature. The resulting mixture was washed with 2.times.10 mL of
DCM and the aqueous layer concentrated under vacuum. The crude
product was purified by Prep-HPLC with the following conditions
(Prep_HPLC_MC5): Column, X Select C18, 19*250 mm, 5 um; mobile
phase, Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 30 mL/min;
Gradient: 23% B to 42% B in 11.5 min; Detector, 254 nm. The
resulting fractions were concentrated under vacuum. The solids were
dissolved in 2 ml hydrochloric acid (12 N) and again concentrated
under vacuum. This resulted in 4.9 mg (21%) of
(2R)-2-methyl-3-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-a-
zabicyclo[3.2.1]octan-3-yl]-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxam-
ide hydrochloride as a white solid. .sup.1HNMR (400 MHz, D.sub.2O)
.delta.: 7.32 (d, J=8 Hz, 1H), 7.21 (s, 1H), 7.01 (d, J=8.4 Hz,
1H), 4.79-4.72 (m, 1H), 4.21 (s, 2H), 4.04 (s, 1H), 3.37 (d, J=12.8
Hz, 2H), 3.20 (d, J=6.4 Hz, 2H), 2.95 (t, J=10.4 Hz, 2H), 2.25-2.15
(m, 3H), 2.14-2.00 (m, 6H), 1.95 (d, J=14.8 Hz, 2H), 1.65-1.40 (m,
5H) ppm. LCMS (method A, ESI): RT=1.49 min,
m/z=477.3[M-HCl+H].sup.+.
Example 13
Synthesis of
N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1-
]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide (Cpd. No.
587)
##STR01212##
[0352] Step 1: Synthesis of tert-butyl
(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]-
octane-8-carboxylate
##STR01213##
[0354] Into a 250-mL 3-necked round-bottom flask was placed
tert-butyl
(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate (5 g,
22.09 mmol, 1.00 equiv), water (100 mL), and NaHCO.sub.3 (4.83 g,
149.50 mmol, 2.60 equiv). The solution was cooled to 0.degree. C.
and 2,2,2-trichloroethyl chloroformate (5.63 g, 26.57 mmol, 1.20
equiv) added dropwise over 10 mins. The resulting solution was
stirred at room temperature overnight. The reaction mixture was
extracted with 3.times.100 mL of dichloromethane and the organic
layers combined. The combined extracts were washed with 3.times.100
mL of brine, dried over anhydrous sodium sulfate, filtered and
concentrated under vacuum. The resulting residue was washed with
3.times.100 mL of hexane. This resulted in 8.32 g (94%) of
tert-butyl
(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]-
octane-8-carboxylate as a white solid. .sup.1H NMR (300 MHz,
CDCl.sub.3) .delta.: 5.30 (brs, 1H), 4.73 (s, 2H), 4.23 (brs, 2H),
4.00-3.89 (m, 1H), 2.30-2.17 (m, 2H), 2.12-2.03 (m, 2H), 1.90-1.80
(m, 2H), 1.78-1.69 (m, 2H), 1.46 (s, 9H) ppm. LCMS (method C, ESI):
RT=1.27 min, m/z=386.0 [M+H-15].sup.+.
Step 2: Synthesis of 2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate
##STR01214##
[0356] Into a 250-mL round-bottom flask was placed tert-butyl
(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]-
octane-8-carboxylate (4 g, 9.96 mmol, 1.00 equiv) and
dichloromethane (40 mL). To this hydrogen chloride (gas) was
introduced. The resulting solution was stirred for 1 h at room
temperature. The mixture was then concentrated under vacuum. This
resulted in 3.3 g (98%) of 2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride
as a white solid. .sup.1H NMR (300 MHz, D.sub.2O) .delta.: 4.72 (s,
2H), 4.09 (brs, 2H), 3.83-3.75 (m, 1H), 2.28-1.95 (m, 8H) ppm.
Step 3: Synthesis of 2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl]carbamate
##STR01215##
[0358] Into a 25-mL round-bottom flask was placed
2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride
(1.0 g, 2.% mmol, 1.00 equiv) and dichloromethane (15 mL). This was
followed by the addition of TEA (1.5 g, 14.82 mmol, 5.01 equiv)
dropwise with stirring at 0.degree. C. To this was then added
tert-butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (1.8 g,
6.02 mmol, 2.04 equiv) in several batches at 0.degree. C. The
resulting solution was stirred for 14 h at 20.degree. C. The
reaction mixture was diluted with 35 mL of dichloromethane and
washed with 3.times.10 mL of brine. The organic layer was dried
over anhydrous sodium sulfate and concentrated under vacuum. The
residue was chromatographed on a silica gel column with ethyl
acetate/petroleum ether (1:2). This resulted in 1.5 g (90%) of
2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl]carbamate as a white solid. .sup.1H
NMR (400 MHz, CDCl.sub.3) .delta.: 5.22 (brs, 1H), 4.75 (s, 2H),
4.46 (brs, 1H), 4.13 (brs, 2H), 4.01-3.95 (m, 1H), 3.70 (d, J=12.0
Hz, 2H), 3.58 (brs, 1H), 2.84 (t, J=11.2 Hz, 2H), 2.33-2.14 (m,
4H), 2.10-1.98 (m, 2H), 1.96-1.84 (m, 3H), 1.65-1.50 (m, 3H), 1.47
(s, 9H) ppm. LCMS (method D, ESI): RT=1.58 min, m/z=507.0
[M+H-56].sup.+.
Step 4: Synthesis of tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate
##STR01216##
[0360] Into a 100-mL round-bottom flask was placed
2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl]carbamate (1.0 g, 1.77 mmol, 1.00
equiv), AcOH (15 mL), zinc (1.73 g, 26.45 mmol, 14.92 equiv) and
water (1 mL). The resulting mixture was stirred for 1 h at
25.degree. C. The mixture was then diluted with 30 mL of H.sub.2O
and the solids were filtered out. The pH was adjusted to 9 with
sodium carbonate (aq. sat.). The resulting solution was extracted
with 5.times.30 mL of dichloromethane and the organic layers
combined. After concentration this resulted in 500 mg (73%) of
tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate as a white solid. LCMS (method A, ESI): RT=1.08 min,
m/z=333.0 [M+H-56].sup.+.
Step 5: Synthesis of tert-butyl
N-[1-[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyc-
lo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate
##STR01217##
[0362] Into a 25-mL round-bottom flask was placed tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate (200 mg, 0.51 mmol, 1.00 equiv), dichloromethane (5
mL), 2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (109 mg, 0.62
mmol, 1.20 equiv), EDCI (118 mg, 0.62 mmol, 1.20 equiv), and HOBT
(104 mg, 0.77 mmol, 1.50 equiv). This was followed by the addition
of TEA (260 mg, 2.57 mmol, 4.99 equiv) dropwise with stirring at
0.degree. C. The resulting solution was stirred for 14 h at
20.degree. C. The reaction mixture was then diluted with 10 mL of
dichloromethane and was washed with 2.times.5 mL of brine. The
organic layer was dried over anhydrous sodium sulfate and
concentrated under vacuum. The residue was chromatographed on a
silica gel column with ethyl acetate/petroleum ether (1:1). This
resulted in 243 mg (86%) of tert-butyl
N-[1-[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyc-
lo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a off-white
solid. LCMS (method A, ESI): RT=1.27 min, m/z=448.0
[M+H-100].sup.+.
Step 6: Synthesis of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
##STR01218##
[0364] Into a 25-mL round-bottom flask was placed tert-butyl
N-[1-[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyc-
lo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (241 mg, 0.44
mmol, 1.00 equiv) and dichloromethane (5 mL). To this hydrogen
chloride (gas) was introduced. The resulting solution was stirred
for 2 h at 15.degree. C. The mixture was then concentrated under
vacuum. This resulted in 200 mg (94%) of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride as a
yellow solid. .sup.1H NMR (400 MHz, CD.sub.3OD): 7.70 (d, J=8.0 Hz,
2H), 6.97 (d, J=8.0 Hz, 1H), 4.14 (s, 3H), 3.86 (d, J=13.2 Hz, 2H),
3.61 (s, 2H), 3.31-3.25 (m, 1H), 2.91 (t, J=12.4 Hz, 2H), 2.37-2.25
(m, 2H), 2.21-1.98 (m, 8H), 1.76-1.63 (m, 2H) ppm. LCMS (method A,
ESI): RT=1.07 min, m/z=448.3 [M+H].sup.+.
Step 7: Synthesis of
N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1-
]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
##STR01219##
[0366] Into a 25-mL round-bottom flask was placed
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride (60
mg, 0.12 mmol, 1.00 equiv), methanol (5 mL), and benzaldehyde (13
mg, 0.12 mmol, 0.99 equiv). The mixture was stirred for 0.5 h at
20.degree. C. To this NaBH.sub.3CN (7.8 mg, 0.12 mmol, 1.00 equiv)
was added in batches. The resulting solution was stirred for 2 h at
70.degree. C. The reaction mixture was concentrated under vacuum.
The residue was diluted with 5 mL of H.sub.2O and extracted with
2.times.5 mL of dichloromethane. The organic layers combined and
concentrated. The crude product was purified by Prep-HPLC with the
following conditions: Column, X Bridge C18, 19*150 mm, 5 um; Mobile
Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20
mL/min; Gradient: 30% B to 70% B in 10 min; Detector, 254 nm. This
resulted in 14.8 mg (18%) of
N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1-
]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
trifluoroacetic acid as a white solid. .sup.1H NMR (300 MHz,
CD.sub.3OD): 7.70 (d, J=7.8 Hz, 2H), 7.69-7.48 (m, 5H), 6.97 (d,
J=8.4 Hz, 1H), 4.28 (s, 2H), 4.14 (s, 3H), 3.92 (d, J=12.6 Hz, 2H),
3.60 (s, 2H), 3.54-3.35 (m, 1H), 2.90 (t, J=13.2 Hz, 2H), 2.35-2.22
(m, 4H), 2.21-2.10 (m, 4H), 2.09-1.98 (m, 2H), 1.85-1.68 (m, 2H)
ppm. LCMS (method A, ESI): RT=2.26 min, m/z=538.4 [M+H].sup.+.
Example 14
Synthesis of
N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1-
]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
trifluoroacetate (Cpd. No. 592)
##STR01220##
[0367] Step 1: Synthesis of tert-butyl
N-[1-[(1R,3r,5S)-3-(6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-
-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate
##STR01221##
[0369] Into a 25-mL round-bottom flask was placed
6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (170 mg,
0.80 mmol, 1.00 equiv), dichloromethane (10 mL), HOBT (216 mg, 1.60
mmol, 2.00 equiv), EDCI (306 mg, 1.60 mmol, 2.00 equiv), and
tert-butyl
N-1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4--
ylcarbamate (375 mg, 0.97 mmol, 1.20 equiv). This was followed by
the addition of TEA (400 mg, 3.95 mmol, 5.00 equiv) dropwise with
stirring at 0.degree. C. The resulting solution was stirred for 2 h
at room temperature. The reaction mixture was diluted with 10 mL of
dichloromethane and washed with 2.times.5 mL of brine. The organic
layer was dried over anhydrous sodium sulfate and concentrated
under vacuum. The residue was chromatographed on a silica gel
column with ethyl acetate/petroleum ether (3:1). This resulted in
300 mg (64%) of tert-butyl
N-[1-[(1R,3r,5S)-3-(6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-
-azabicyclo[3.2.1]octane-8-sulfonyl] piperidin-4-yl]carbamate as a
red solid. LCMS (method C, EST): RT=0.88 min, m/z=582.0
[M+H].sup.+.
Step 2: Synthesis of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
hydrochloride
##STR01222##
[0371] Into a 25-mL round-bottom flask was placed tert-butyl
N-[1-[(1R,3r,5S)-3-(6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-
-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (300
mg, 0.52 mmol, 1.00 equiv) and hydrogen chloride/dioxane (10 mL,
saturated, this solution was made by introducing hydrogen chloride
gas into 1,4-dioxane under 0.degree. C. for 6 hours). The resulting
solution was stirred for 4 h at room temperature. The mixture was
then concentrated under vacuum. This resulted in 170 mg (64%) of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
hydrochloride as a red solid. LCMS (method A, ESI): RT=0.96 min,
m/z=482.0 [M+H].sup.+.
Step 3: Synthesis of
N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1-
]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide;
trifluoroacetic Acid
##STR01223##
[0373] Into a 25-mL round-bottom flask was placed
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
hydrochloride (50 mg, 0.10 mmol, 1.00 equiv), methanol (5 mL), and
benzaldehyde (12.3 mg, 0.12 mmol, 1.20 equiv). The mixture was
stirred for 0.5 h at 20.degree. C. To the above NaBH.sub.3CN (7.3
mg, 0.12 mmol, 1.20 equiv) was added in batches. The resulting
solution was stirred for 1 h at 70.degree. C. The reaction mixture
was then concentrated under vacuum and the crude product purified
by Prep-HPLC with the following conditions: Column: X Select C18,
19*250 mm, 5 um; Mobile Phase A: Water/0.05% TFA. Mobile Phase B:
ACN; Flow rate: 30 mL/min; Gradient: 5% B to 36% B in 12.5 min;
Detector: 254 nm. This resulted in 28 mg (42%) of
N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1-
]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide
trifluoroacetate as a white solid. .sup.1H NMR (400 MHz,
CD.sub.3OD): 7.53-7.49 (m, 5H), 7.33 (s, 1H), 6.97 (s, 1H), 4.29
(s, 2H), 4.16 (s, 3H), 3.91 (d, J=12.8 Hz, 2H), 3.57 (s, 2H),
3.41-3.37 (m, 1H), 2.89 (t, J=10.8 Hz, 2H), 2.37-2.21 (m, 4H),
2.20-2.08 (m, 4H), 2.05-1.96 (m, 2H), 1.80-1.70 (m, 2H) ppm. LCMS
(method A, ESI): RT=1.31 min, m/z=572.2 [M+H].sup.+.
Example 15
Synthesis of
6-chloro-2-oxo-N-((1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)m-
ethylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide
(Cpd. No. 595)
##STR01224##
[0374] Step 1: Synthesis of tert-butyl
(1R,3S,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]-
octane-8-carboxylate
##STR01225##
[0376] Into a 250-mL round-bottom flask, was placed water (120 mL).
This was followed by the addition of tert-butyl
(1R,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate (2 g, 8.84
mmol, 1.00 equiv), sodium bicarbonate (1.92 g, 22.85 mmol, 2.59
equiv). To the mixture was added 2,2,2-trichloroethyl chloroformate
(2.28 g, 10.76 mmol, 1.22 equiv) dropwise with stirring at
0.degree. C. The resulting solution was stirred for 18 h at
20.degree. C. The resulting solution was extracted with 3.times.150
mL of ethyl acetate and the organic layers combined and dried over
anhydrous sodium sulfate and concentrated under vacuum. This
resulted in 4.16 g (crude) of tert-butyl
(1R,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]oct-
ane-8-carboxylate as a white solid. .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 4.75 (s, 2H), 4.25 (s, 2H), 4.00-3.90 (m, 1H),
2.29-2.00 (m, 4H), 2.89-2.71 (m, 4H), 1.45 (s, 9H) ppm.
Step 2: Synthesis of 2,22-trichloroethyl
(1S,3r,5R)-8-aza-bicyclo[3.2.1]octan-3-ylcarbamate
##STR01226##
[0378] Into a 100-mL round-bottom flask, was placed dichloromethane
(20 mL), tert-butyl
(1R,3S,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]-
octane-8-carboxylate (2 g, 4.98 mmol, 1.00 equiv). Then hydrogen
chloride gas was introduced into mixture. The resulting solution
was stirred for 12 h at 80.degree. C. The resulting mixture was
concentrated under vacuum. This resulted in 1.7 g (crude) of
2,2,2-trichloroethyl
N-[(1R,3S,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate as a yellow
solid. LCMS (method D, ESI): RT=0.86 min, m/z=303.2
[M+H].sup.+.
Step 3: Synthesis of benzyl
4-(((1S,3r,5R)-3-((2,2,2-trichloroethoxy)carbonylamino)-8-aza-bicyclo[3.2-
.1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate
##STR01227##
[0380] Into a 100-mL round-bottom flask, was placed dichloromethane
(30 mL), 2,2,2-trichloroethyl
N-[(1R,3S,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate (2.4 g, 7.96
mmol, 1.00 equiv), TEA (3.2 g, 31.62 mmol, 3.97 equiv). Then benzyl
4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (4 g, 12.05
mmol, 1.51 equiv) was added by dropwise at 0.degree. C. The
resulting solution was stirred for 12 h at 10.degree. C. The
resulting mixture was washed with 3.times.30 mL of water and
1.times.30 mL of brine. The mixture was dried over anhydrous sodium
sulfate and concentrated under vacuum. The residue was applied onto
a silica gel column with dichloromethane/methanol (20:1). This
resulted in 2.8 g (59%) of benzyl
4-[[(1R,3S,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.-
2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a yellow
solid. .sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 7.41-7.30 (m,
5H), 5.15 (s, 2H), 4.75 (s, 2H), 4.30-4.15 (m, 4H), 4.05-3.90 (m,
1H), 2.95-2.76 (m, 4H), 2.35-2.10 (m, 4H), 2.10-1.90 (m, 5H), 1.57
(s, 1H), 1.40-1.20 (m, 3H) ppm. LCMS (method D, ESI): RT=1.15 min,
m/z=596.1 [M+H].sup.+.
Step 4 2,2,2-trichloroethyl
(1S,3r,5R)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-y-
lcarbamate hydrochloride Salts
##STR01228##
[0382] Into a 250-mL round-bottom flask, was placed benzyl
4-[[(1R,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1-
]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (1.5 g, 2.51
mmol, 1.00 equiv). This was followed by the addition of
hydrochloric acid (12 N, 140 mL) at 10.degree. C. The resulting
solution was stirred for 12 h at 50.degree. C. The resulting
mixture was concentrated under vacuum. This resulted in 1.1 g (88%)
of 2,2-trichloroethyl
N-[(1R,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-
-yl]carbamate hydrochloride as a yellow solid. LCMS (method D,
ESI): RT=0.67 min, m/z=464.0 [M+H].sup.+.
Step 5: Synthesis of 2,2,2-trichloroethyl
(1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methylsulfonyl)-8-a-
za-bicyclo[3.2.1]octan-3-ylcarbamate
##STR01229##
[0384] Into a 100-mL round-bottom flask, was placed dichloromethane
(40 mL). This was followed by the addition of methanol (20 mL),
2,2-trichloroethyl
N-[(1R,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-
-yl]carbamate hydrochloride (300 mg, 0.60 mmol, 1.00 equiv),
4,4,4-trifluorobutanal (227 mg, 1.80 mmol, 3.00 equiv). Then
NaBH.sub.3CN (303 mg, 4.81 mmol, 8.00 equiv) was added into by
batchwise. To the mixture was added acetic acid (1 mL). The
resulting solution was stirred for 6 h at 10.degree. C. The
resulting mixture was concentrated under vacuum. The resulting
solution was extracted with 3.times.100 mL of dichloromethane and
the organic layers combined. The resulting mixture was washed with
1.times.50 mL of brine. The mixture was dried over anhydrous sodium
sulfate and concentrated under vacuum. The residue was purified by
flash chromatography with eluent (PE/EtOAc=2/1 to 100% EtOAc). This
resulted in 295 mg (86%) of
2,2,2-trichloroethylN-[(1R,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-y-
l]methane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate as
yellow oil. .sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 4.75 (s,
2H), 4.30 (s, 2H), 4.02-3.95 (m, 1H), 3.10-3.02 (m, 2H), 3.00-2.95
(m, 2H), 2.58-2.50 (m, 2H), 2.32-1.78 (m, 17H), 1.60-1.48 (m, 2H)
ppm. LCMS (method D, ESI): RT=0.97 min, m/z=572.0 [M+H].sup.+.
Step 6: Synthesis of
(1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methylsulfonyl)-8-a-
za-bicyclo[3.2.1]octan-3-amine
##STR01230##
[0386] Into a 100-mL round-bottom flask, was placed
2,2,2-trichloroethyl
N-[(1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfony-
l)-8-azabicyclo[3.2.1]octan-3-yl]carbamate (50 mg, 0.09 mmol, 1.00
equiv). This was followed by the addition of acetic acid (15 mL),
water (1 ML) and Zn (90 mg). The resulting solution was stirred for
12 h at 10.degree. C. The solids were filtered out. The pH value of
the solution was adjusted to 8 with sodium carbonate (sat. aq.).
The resulting solution was extracted with 3.times.50 mL of ethyl
acetate and the organic layers combined and concentrated under
vacuum. This resulted in 25 mg (72%) of
(1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfonyl)--
8-azabicyclo[3.2.1]octan-3-amine as a yellow solid. LCMS (method B,
ESI): RT=1.24 min, m/z=398.0 [M+H].sup.+.
Step 7: Synthesis of
6-chloro-2-oxo-N-((1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)m-
ethylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide
##STR01231##
[0388] Into a 100-mL round-bottom flask, was placed
N,N-dimethylformamide (10 mL)
(1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]su-
lfonyl)-8-azabicyclo[3.2.1]octan-3-amine (50 mg, 0.13 mmol, 1.00
equiv), 6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (46
mg, 0.22 mmol, 1.73 equiv), 1H-1,2,3-benzotriazol-1-ol (35 mg, 0.26
mmol, 2.06 equiv), EDCI (50 mg, 0.26 mmol, 2.07 equiv), TEA (0.3
mL). The resulting solution was stirred for 12 h at 10.degree. C.
The solids were filtered out. The resulting mixture was diluted
with 10 mL of water. The resulting solution was extracted with of
2.times.10 mL dichloromethane and the organic layers combined. The
organic phase was dried over anhydrous sodium sulfate and
concentrated under vacuum. The crude reside was purified by
Prep-HPLC with the following conditions (2 #-Waters 2767-2
(HPLC-08)): Column, Xbridge Prep Phenyl, 5 um, 19.times.150 mm;
mobile phase, Water with 50 mmol ammonium bicarbonate and
acetonitrile (10.0% acetonitrile up to 33.0% in 2 min, up to 53.0%
in 8 min, up to 100.0% in 1 min, down to 10.0% in 1 min); Detector,
UV 254 nm. This resulted in 5.7 mg (8%) of
6-chloro-2-oxo-N-[(1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]-
methane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-2,3-dihydro-1H-indole-5-c-
arboxamide as a light pink solid. .sup.1HNMR (300 MHz, CD.sub.3OD):
.delta. 7.32 (s, 1H), 6.95 (s, 1H), 4.30-4.10 (m, 3H), 3.35 (s,
2H), 3.10-2.90 (m, 4H), 2.50-2.40 (m, 2H), 2.40-1.90 (m, 15H),
1.85-1.70 (m, 2H), 1.51-1.35 (m, 2H) ppm. LCMS (method B, ESI):
RT=1.67 min, m/z=591.1 [M+H].sup.+.
Example 16
Synthesis of
N-((1R,3r,5S)-8-(4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-y-
l)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide trifluoroacetate
(Cpd. No. 622)
##STR01232##
[0389] Step 1: Synthesis of tert-butyl
(1R,3r,5S)-3-(2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxamido)-8-a-
zabicyclo[3.2.1]octane-8-carboxylate
##STR01233##
[0391] Into a 100-mL round-bottom flask was placed dichloromethane
(50 mL), 2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxylic acid
(1.5 g, 7.42 mmol, 1.00 equiv), tert-butyl
(1R,5S,7S)-7-amino-3-azabicyclo[3.3.2]decane-3-carboxylate (2.0 g,
7.86 mmol, 1.06 equiv), HATU (5.65 g), and TEA (2.25 g, 22.24 mmol,
3.00 equiv). The resulting solution was stirred for 12 h at
25.degree. C. The resulting mixture was washed with 3.times.50 mL
of H.sub.2O. The organic layer was dried over anhydrous sodium
sulfate and concentrated. The residue was chromatographed on a
silica gel column with PE:EA (1:1). This resulted in 3.0 g (92%) of
tert-butyl(1R,5r,7S)-7-(2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carbox-
amido)-3-azabicyclo[3.3.2]decane-3-carboxylate as a white solid.
.sup.1HNMR (300 MHz, DMSO): .delta. 8.20-8.15 (m, 1H), 7.77 (s,
1H), 7.68 (d, J=8.7 Hz, 1H), 7.52 (d, J=8.4 Hz, 1H), 4.08-3.90 (m,
1H), 3.50-3.10 (m, 2H), 2.15-1.80 (m, 8H), 1.50-1.30 (m, 9H) ppm.
LCMS (method C, ESI): RT=1.25 min, m/z=411.2 [M+H].sup.+.
Step 2: Synthesis of
N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-2,2-difluorobenzo[d][1,3]di-
oxole-5-carboxamide
##STR01234##
[0393] Into a 100-mL round-bottom flask was placed a solution of
tert-butyl
(1R,3r,5S)-3-(2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxamido)-8-a-
zabicyclo[3.2.1]octane-8-carboxylate (1.5 g, 3.65 mmol, 1.00 equiv)
in methanol (30 mL). Hydrogen chloride gas was introduced into the
solution at 0.degree. C. for 1 h. The resulting solution was
stirred for another 1 h at 20.degree. C. The mixture was then
concentrated under vacuum. This resulted in 1.3 g (crude) of
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2,2-difluoro-2H-1,3-benzo[d]-
[1,3]dioxole-5-carboxamide as a white solid. LCMS (method A, ESI):
RT=0.80 min, m/z=311.2 [M+H].sup.+.
Step 3: Synthesis of
2,2-difluoro-N-((1R,3r,5S)-8-(4-oxocyclohexylsulfonyl)-8-aza-bicyclo[3.2.-
1]octan-3-yl)benzo[d][1,3]dioxole-5-carboxamide
##STR01235##
[0395] Into a 250-mL 3-necked round-bottom flask purged and
maintained with an inert atmosphere of nitrogen was placed a
solution of
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2,2-difluoro-2H-1,3-benzo[d]-
[1,3]dioxole-5-carboxamide (900 mg, 2.90 mmol, 1.00 equiv) in THF
(150 mL). This was followed by the addition of LiHMDS (IM in THF,
10 mL) dropwise with stirring at -60.degree. C. To this was added
4-oxocyclohexane-1-sulfonyl chloride (700 mg, 3.56 mmol, 1.23
equiv) in portions at -60.degree. C. The resulting solution was
allowed to warm to room temperature and stirred for another 12
hours at 25.degree. C. The resulting mixture was concentrated under
vacuum. The residue was extracted with 3.times.60 mL of
dichloromethane and the organic layers combined, dried over
anhydrous sodium sulfate and concentrated. The residue was
chromatographed on a C18 gel column with H.sub.2O/CH.sub.3CN=3:5.
This resulted in 260 mg (19%) of
2,2-difluoro-N-[(1R,3rS,5S)-8-[(4-oxocyclohexane)sulfonyl]-8-azabicyclo[3-
.2.1]octan-3-yl]-2H-1,3-benzo[d][1,3]dioxole-5-carboxamide as a
white solid. LCMS (method B, ESI): RT=1.08 min, m/z=471.0
[M+H].sup.+.
Step 4: Synthesis of
N-((1R,3r,5S)-8-(4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-y-
l)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide
trifluoroacetate
##STR01236##
[0397] Into a 250-mL round-bottom flask was placed methanol (130
mL),
2,2-difluoro-N-[(1R,3r,5S)-8-[(4-oxocyclohexane)sulfonyl]-8-azabicyclo[3.-
2.1]octan-3-yl]-2H-1,3-benzo[d][1,3]dioxole-5-carboxamide (200 mg,
0.43 mmol, 1.00 equiv), HCOONH.sub.4 (1080 mg, 17.13 mmol, 40.29
equiv), and acetic acid (24 mg, 0.40 mmol, 0.94 equiv). Then
NaBH.sub.3CN (50 mg, 0.79 mmol, 1.87 equiv) was added batchwise.
The resulting solution was stirred for 2 h at 20.degree. C. The
mixture was then concentrated under vacuum. The residue was
slurried with 150 mL of EtOAc and then filtrated. The filtrate was
concentrated under vacuum. The crude product was purified by
Prep-HPLC with the following conditions: Column, X Bridge C18,
19*150 mm, 5 um; mobile phase, Mobile Phase A: Water/0.05% TFA,
Mobile Phase B: ACN; Flow rate: 20 mL/min; Detector, 254 nm. This
resulted in 15.2 mg (6%) of
N-[(1R,3r,5S)-8-[(4-aminocyclohexane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-
-yl]-2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxamide
trifluoroacetic acid as a white solid. .sup.1H NMR (300 MHz,
D.sub.2O): .delta. 7.46-7.44 (m, 2H), 7.19 (d, J=6 Hz, 1H), 4.18
(s, 2H), 4.05 (t, J=6.0 Hz, 1H), 3.48-3.10 (m, 2H), 2.30-1.80 (m,
13H), 1.65-1.38 (m, 3H) ppm. LCMS (method D, ESI): RT=1.55 min,
m/z=472.0 [M+H].sup.+.
Example 17
Synthesis of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride (Cpd. No.
610)
##STR01237##
[0398] Step 1: Synthesis of tert-butyl
N-[1-[(1R,3r,5S)-3-(5-ethyl-1,2-thiazole-3-carboxamido)-8-azabicyclo[3.2.-
1]octane-8-sulfonyl]piperidin-4-yl]carbamate
##STR01238##
[0400] Into a 50-mL round-bottom flask purged and maintained with
an inert atmosphere of nitrogen was placed dichloromethane (10 mL),
5-ethyl-1,2-thiazole-3-carboxylic acid (44 mg, 0.28 mmol, 1.00
equiv), tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate (100 mg, 0.34 mmol, 1.21 equiv), HOBT (52 mg, 0.38
mmol, 1.36 equiv)), and EDCI (150 mg, 0.79 mmol, 2.80 equiv). This
was followed by the addition of a solution of triethylamine (80 mg,
0.79 mmol, 2.80 equiv) in dichloromethane (1 ml) which was added
dropwise with stirring at 0.degree. C. The resulting solution was
stirred for 15 hours at 20.degree. C. The reaction was quenched by
the addition of 50 mL of water and extracted with 2.times.100 mL of
dichloromethane. The organic layers were combined and washed with
1.times.50 mL of brine. The organic layer was dried over anhydrous
sodium sulfate and concentrated under vacuum. The residue was
chromatographed on a silica gel column with ethyl acetate/petroleum
ether (1:2). This resulted in 120 mg (81%) of tert-butyl
N-[1-[(1R,3r,5S)-3-(5-ethyl-1,2-thiazole-3-carboxamido)-8-azabicyclo[3.2.-
1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a solid. LCMS
(method A, ESI): RT=1.61 min, m/z=528.0[M+H].sup.+.
Step 2: Synthesis of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride
##STR01239##
[0402] Into a 50-mL round-bottom flask was placed tert-butyl
N-[1-[(1R,3r,5S)-3-(5-ethyl-1,2-thiazole-3-carboxamido)-8-azabicyclo[3.2.-
1]octane-8-sulfonyl]piperidin-4-yl]carbamate (120 mg, 0.23 mmol,
1.00 equiv) and hydrogen chloride/dioxane (10 mL, saturated, this
solution was made by introducing hydrogen chloride gas into
1,4-dioxane under 0.degree. C. for 6 hours). The resulting solution
was stirred for 3 hours at 20.degree. C. The mixture was then
concentrated under vacuum. This resulted in 57.8 mg (55%) of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride as a solid.
.sup.1H NMR (300 MHz, D.sub.2O) .delta.: 7.45 (s, 1H), 4.15-4.02
(m, 3H), 3.80-3.78 (m, 2H), 3.38-3.22 (m, 1H), 2.98-2.82 (m, 4H),
2.30-2.18 (m, 2H), 2.11-1.87 (m, 8H), 1.71-1.52 (m, 2H), 1.30-1.20
(m, 3H) ppm. LCMS (method A, ESI): RT=1.81 min, m/z=428.2
[M-HCl+H].sup.+.
Example 18
Synthesis of
N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan-
-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide
hydrochloride (Cpd. No. 609)
##STR01240##
[0403] Step 1: Synthesis of
3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylic Acid
##STR01241##
[0405] Into a 100-mL round-bottom flask was placed methyl
3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylate (1 g,
4.83 mmol, 1.00 equiv), methanol (15 mL), tetrahydrofuran (15 mL),
and water (15 mL). This was followed by the addition of a solution
of sodium hydroxide (386 mg, 9.65 mmol, 2.00 equiv) in 5 ml
H.sub.2O which was added dropwise with stirring at 0.degree. C. The
solution was stirred for 20 min at 0.degree. C. in an ice/salt
bath. The resulting solution was allowed to react, with stirring,
for an additional 18 h at room temperature. The reaction mixture
was then concentrated under vacuum. The residue was diluted with 50
mL of H.sub.2O and The pH adjusted to 3-4 with hydrochloric acid (1
N). The resulting mixture was extracted with 3.times.50 mL of ethyl
acetate. The organic layers were combined and washed with
2.times.30 mL of water and 1.times.30 mL of brine. The organic
layer was dried over anhydrous sodium sulfate, filtered, and the
filtrate concentrated under vacuum. This resulted in 850 mg (91%)
of 3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylic acid
as a brown solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.:7.68
(q, J=8, 4 Hz, 1H), 7.61 (d, J=1.8 Hz, 1H), 7.02 (d, J=8.4 Hz, 1H),
4.68 (s, 2H) ppm. LCMS (method A, ESI): RT=1.01 min, m/z=194.0
[M+H].sup.+.
Step 2: Synthesis of 2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl]carbamate
##STR01242##
[0407] Into a 100-mL round-bottom flask was placed dichloromethane
(30 mL), 2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride
(900 mg, 2.66 mmol, 1.00 equiv), and TEA (1.37 g, 13.54 mmol, 5.00
equiv). This was followed by the addition of a solution of
tert-butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (1.6 g,
5.35 mmol, 2.00 equiv) in 2 ml dichloromethane which was added
dropwise with stirring at 0.degree. C. The resulting solution was
stirred for 14 h at 10.degree. C. The mixture was then washed with
3.times.30 mL of brine. The organic layer was dried over anhydrous
sodium sulfate, filtered, and the filtrate concentrated under
vacuum. The residue was chromatographed on a silica gel column with
ethyl acetate/petroleum ether (1:1). This resulted in 1.1 g (73%)
of 2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl]carbamate as a white solid. .sup.1H
NMR (400 MHz, CDCl.sub.3) .delta.: 5.22 (s, 1H), 4.75 (s, 2H), 4.47
(s, 1H), 4.14 (s, 2H), 3.98 (d, J=6 Hz, 1H), 3.70 (d, J=12 Hz, 2H),
3.58 (s, 1H), 2.84 (t, J=1.2 Hz, 2H), 2.27-2.25 (m, 4H), 2.03 (d,
J=10.8 Hz, 2H), 1.95-1.87 (m, 4H), 1.58 (s, 2H), 1.55-1.40 (m, 9H)
ppm. LCMS (method C, ESI): RT=1.24 min, m/z=563.0 [M+H].sup.+.
Step 3: Synthesis of tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate
##STR01243##
[0409] Into a 100-mL round-bottom flask was placed
2,2,2-trichloroethyl
N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-
-azabicyclo[3.2.1]octan-3-yl]carbamate (1.1 g, 1.95 mmol, 1.00
equiv), Zn (1.9 g, 15.00 equiv), AcOH (15 mL), and water (1 mL).
The resulting mixture was stirred for 3 h at 10.degree. C. The
solids were filtered out. The pH was adjusted to 8 with sodium
carbonate (aq. sat.). The resulting solution was extracted with
4.times.50 mL of ethyl acetate. The organic layers were combined,
dried over anhydrous sodium sulfate, filtered, and concentrated
under vacuum. This resulted in 750 mg (crude) of tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate as a light yellow crude solid. LCMS (method C, ESI):
RT=0.61 min, m/z=389.0 [M+H].sup.+.
Step 4: Synthesis of tert-butyl
(1-(((1R,3r,5S)-3-(3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamid-
o)-8-azabicyclo[3.2.1]octan-8-yl)sulfonyl)piperidin-4-yl)carbamate
##STR01244##
[0411] Into a 100-mL round-bottom flask was placed
N,N-dimethylformamide (10 mL),
3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylic acid (55
mg, 0.28 mmol, 1.10 equiv), EDCI (98 mg, 0.51 mmol, 2.00 equiv),
HOBT (70 mg, 0.52 mmol, 2.00 equiv), and tert-butyl
N-1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4--
ylcarbamate (100 mg, 0.26 mmol, 1.00 equiv). This was followed by
the addition of TEA (131 mg, 1.29 mmol, 5.00 equiv) which was added
dropwise with stirring at 0.degree. C. The resulting solution was
stirred for 15 h at 10.degree. C. The reaction mixture was diluted
with 10 mL of H.sub.2O and extracted with 3.times.10 mL of ethyl
acetate. The organic layers were combined, dried over anhydrous
sodium sulfate, filtered, and concentrated under vacuum. The
residue was chromatographed on a silica gel column with
dichloromethane/methanol (10:1). This resulted in 100 mg (69%) of
tert-butyl
N-[1-[(1R,3r,5S)-3-(3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carbo-
xamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate
as a white solid. LCMS (method A, ESI): RT=1.32 min, m/z=586.0
[M+Na].sup.+.
Step 5: Synthesis of
N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan-
-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide
hydrochloride
##STR01245##
[0413] Into a 50-mL round-bottom flask was placed dichloromethane
(10 mL) and tert-butyl
N-[1-[(1R,3r,5S)-3-(3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carbo-
xamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate
(100 mg, 0.18 mmol, 1.00 equiv). To the above hydrogen chloride
(gas) was introduced. The resulting solution was stirred for 3 h at
10.degree. C. The reaction mixture was then concentrated under
vacuum. The crude product (80 mg) was purified by Prep-HPLC with
the following conditions (Prep_HPLC_MC5): Column, X Select C18,
19*250 mm, 5 um; mobile phase, A: Water/0.05% TFA, Mobile Phase B:
ACN; Flow rate: 30 mL/min; Gradient: 5% B to 36% B in 12.5 min;
Detector, 254 nm. The isolated purified product was dissolved in 2
ml concentrated hydrochloric acid and this solution concentrated
under vacuum. This resulted in 45.7 mg (52%) of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxamide
hydrochloride as a white solid. .sup.1H NMR (400 MHz, D.sub.2O)
.delta.: 7.28 (q, J=8.4 Hz, 1H), 7.18 (s, 1H), 6.98 (d, J=8.4 Hz,
1H), 4.60 (s, 2H), 4.10-3.95 (m, 3H), 3.74 (d, J=13.2 Hz, 2H),
3.35-3.25 (m, 1H), 2.88 (t, J=12 Hz, 2H), 2.25-2.18 (m, 2H),
2.10-1.98 (m, 6H), 1.91 (d, J=14.8 Hz, 2H), 1.67-1.52 (m, 2H) ppm.
LCMS (method A, ESi): RT=1.40 min, m/z=464.0 [M-HCl+H].sup.+.
Example 19
Synthesis of
N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-et-
hyl-1,2-thiazole-3-carboxamide hydrochloride (Cpd. No. 605)
##STR01246##
[0414] Step 1: Synthesis of ethyl 2-amino-4-oxohex-2-enoate
##STR01247##
[0416] Into a 250-mL round-bottom flask was placed ethyl
2,4-dioxohexanoate (10 g, 58.08 mmol, 1.00 equiv), benzene (100
mL), CH.sub.3COONH.sub.4 (13.4 g, 173.84 mmol, 2.99 equiv), and
acetic acid (10 mL). The resulting solution was stirred at
80.degree. C. overnight. The reaction mixture was cooled and
concentrated under vacuum. The residue was diluted with 200 mL of
ice-water and the pH adjusted to 8 with Na.sub.2CO.sub.3 (aq.
Sat.). The resulting mixture was extracted with 3.times.100 mL of
ethyl acetate and the organic layers combined, dried over anhydrous
sodium sulfate and concentrated under vacuum. The residue was
chromatographed on a silica gel column with ethyl acetate/petroleum
ether (1:10-1:5). This resulted in 7 g (70%) of ethyl
2-amino-4-oxohex-2-enoate as yellow oil. .sup.1H NMR (400 MHz,
CDCl.sub.3) .delta.: 5.92 (s, 1H), 4.36-4.30 (m, 2H), 2.49-2.44 (m,
2H), 1.28-1.24 (m, 3H), 1.14-1.11 (m, 3H) ppm.
Step 2: Synthesis of ethyl 5-ethyl-1,2-thiazole-3-carboxylate
##STR01248##
[0418] Into a 250-mL round-bottom flask was placed ethyl
2-amino-4-oxohex-2-enoate (4 g, 23.37 mmol, 1.00 equiv),
tetrahydrofuran (50 mL), and P.sub.2S.sub.5 (2.6 g, 11.70 mmol,
0.50 equiv). The mixture was stirred overnight at room temperature.
Ten the mixture was concentrated and the residue was dissolved in
ethyl acetate (20 mL). This solution was cooled to 0.degree. C. and
H.sub.2O.sub.2 (30%, 10 mL) was added dropwise. The resulting
mixture was stirred for 10 min at room temperature. To the mixture
was added activated charcoal. After filtration, the filtrate was
diluted with H.sub.2O (20 mL). This was extracted with EA (20
mL.times.3). The organic layers were combined, dried over anhydrous
sodium sulfate and concentrated under vacuum. This resulted in 2.44
g (56%) of ethyl 5-ethyl-1,2-thiazole-3-carboxylate as brown oil.
LCMS (method A, ESI): RT=1.36 min, m/z=186.1 [M+H].sup.+.
Step 3: Synthesis of 5-ethyl-1,2-thiazole-3-carboxylic Acid
##STR01249##
[0420] Into a 100-mL round-bottom flask was placed ethyl
5-ethyl-1,2-thiazole-3-carboxylate (2.44 g, 13.17 mmol, 1.00
equiv), methanol (10 mL), water (10 mL), tetrahydrofuran (10 mL)
and LiOH.H.sub.2O (1.66 g, 39.56 mmol, 3.00 equiv). The resulting
solution was stirred for 1 h at room temperature. The reaction
mixture was then concentrated under vacuum. The residue was diluted
with 30 mL of H.sub.2O and extracted with 5.times.30 mL of
dichloromethane. The organic layers were combined, dried over
anhydrous sodium sulfate and concentrated under vacuum. This
resulted in 1.44 g (70%) of 5-ethyl-1,2-thiazole-3-carboxylic acid
as a brown solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 7.63
(s, 1H), 3.04-2.96 (m, 2H), 1.42-1.19 (m, 3H) ppm. LCMS (method D,
ESI): RT=1.09 min, m/z=158.2 [M+H].sup.+.
Step 4: Synthesis of (2S)-tert-butyl
4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate
##STR01250##
[0422] Into a 250-mL round-bottom flask was placed
5-ethyl-1,2-thiazole-3-carboxylic acid (1.5 g, 9.54 mmol, 1.00
equiv), EDCI (2.92 g, 15.23 mmol, 1.60 equiv),
1H-1,2,3-benzotriazol-1-ol (2.1 g, 15.54 mmol, 1.63 equiv),
dichloromethane (20 mL), and (2S)-tert-butyl
4-amino-2-methylpiperidine-1-carboxylate (2.45 g, 11.43 mmol, 1.20
equiv). Then TEA (2.89 g, 28.56 mmol, 2.99 equiv) was added
dropwise. The resulting solution was stirred overnight at room
temperature. The reaction mixture was diluted with 30 mL of
H.sub.2O and extracted with 3.times.30 mL of dichloromethane. The
organic layers were combined, dried over anhydrous sodium sulfate
and concentrated under vacuum. The residue was chromatographed on a
combi-flash with eluent (EA:PE=1/1).This resulted in 1.5 g of
(2S)-tert-butyl
4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate
as a brown oil. LCMS (method D, ESI): RT=1.60 min, m/z=376.1
[M+Na].sup.+.
Step 5: Synthesis of (2S,4S)-tert-butyl
4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate
##STR01251##
[0424] tert-Butyl
(2S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxyl-
ate (470 mg, 1.33 mmol, 1.00 equiv was purified by Chiral-Prep-HPLC
with the following conditions: Column, CHIRALCEL OJ-3,mobile phase,
Hex (0.2% IPA):EtOH-70:30; Detector, 254 nm. This resulted in 200
mg (43%) of tert-butyl
(2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carbo-
xylate as a yellow solid. ee value: 100%
Step 6: Synthesis of
5-ethyl-N-((2S,4S)-2-methylpiperidin-4-yl)-1,2-thiazole-3-carboxamide
##STR01252##
[0426] Into a 25-mL round-bottom flask was placed tert-butyl
(2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carbo-
xylate (200 mg, 0.57 mmol, 1.00 equiv), dichloromethane (10 mL). To
the above hydrogen chloride (gas) was introduced. The resulting
solution was stirred for 1 h at room temperature. The resulting
mixture was then concentrated under vacuum. This resulted in 150 mg
(91%) of
5-ethyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide
hydrochloride as a white solid. LCMS (method C, ESI): RT=0.49 min,
m/z=254.4 [M-HCl+H].sup.+.
Step 7: Synthesis of tert-butyl
1-((2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidin-1-yls-
ulfonyl)piperidin-4-ylcarbamate
##STR01253##
[0428] Into a 25-mL round-bottom flask was placed
5-ethyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide
hydrochloride (150 mg, 0.52 mmol, 1.00 equiv) and dichloromethane
(10 mL). Then TEA (260 mg, 5.00 equiv) added dropwise followed by
tert-butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (750 mg,
2.51 mmol, 4.85 equiv) which was added in several portions. The
resulting mixture was stirred for 2 h at room temperature. The
mixture was concentrated under vacuum and the. residue was
chromatographed on a silica gel column with ethyl acetate/petroleum
ether (1/1). This resulted in 150 mg (56%) of tert-butyl
N-[1-[(2S,4S)-4-(5-ethyl-1,2-thiazole-3-amido)-2-methylpiperidine-1-sulfo-
nyl]piperidin-4-yl]carbamate as a yellow solid. LCMS (method C,
ESI): RT=1.57 min, m/z=516.2 [M+H].sup.+.
Step 8: Synthesis of
N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-et-
hyl-1,2-thiazole-3-carboxamide hydrochloride
##STR01254##
[0430] Into a 25-mL round-bottom flask was placed tert-butyl
N-[1-[(2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-
-sulfonyl]piperidin-4-yl]carbamate (150 mg, 0.29 mmol, 1.00 equiv)
and dichloromethane (10 mL). To the above hydrogen chloride (gas)
was introduced. The resulting solution was stirred for 1 h at room
temperature. The mixture was then concentrated under vacuum. This
resulted in 90 mg (68%) of
N-[(2S,4S)-1-(4-aminopiperidine-1-sulfonyl)-2-methylpiperidin-4-yl]-5-eth-
yl-1,2-thiazole-3-carboxamide hydrochloride as a white solid.
.sup.1H NMR (300 MHz, D.sub.2O) .delta.: 7.46 (s, 1H), 4.06-4.01
(m, 1H), 3.71-3.55 (m, 4H), 3.33-3.20 (m, 2H), 2.95-2.82 (m, 4H),
2.04-1.97 (m, 4H), 1.80-1.57 (m, 4H), 130-1.22 (m, 6H) ppm. LCMS
(method A, ESI): RT=1.74 min, m/z=416.2 [M-HCl+H].sup.+.
Example 20
Synthesis of
N-((2S,4R)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-et-
hyl-1,2-thiazole-3-carboxamide (Cpd. No. 629)
##STR01255##
[0431] Step 1: Synthesis of (2S,4R)-tert-butyl
4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate
##STR01256##
[0433] tert-Butyl
(2S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxyl-
ate (470 mg, 1.33 mmol, 1.00 equiv) was purified by
Chiral-Prep-HPLC with the following conditions: Column: CHIRALCEL
OJ-3-; mobile phase, Hex (0.2% IPA):EtOH=70:30; Detector, 254 nm.
This resulted in 100 mg (21%) of tert-butyl
(2S,4R)-4-(5-ethyl-1,2-thiazole-3-amido)-2-methylpiperidine-1-carboxylate
as a yellow solid. ee value: 100%.
Step 2: Synthesis of
5-ethyl-N-((2S,4R)-2-methylpiperidin-4-yl)-1,2-thiazole-3-carboxamide
##STR01257##
[0435] Into a 25-mL round-bottom flask was placed tert-butyl
(2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carbo-
xylate (100 mg, 0.28 mmol, 1.00 equiv) and dichloromethane (10 mL).
To the above hydrogen chloride (gas) was introduced. The resulting
solution was stirred for 1 h at room temperature. The mixture was
concentrated under vacuum. This resulted in 70 mg (85%) of
5-ethyl-N-[(2S,4R)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide
hydrochloride as a white solid. LCMS (method C, ESI): RT=0.49 min,
m/z=254.2 [M-HCl+H].sup.+.
Step 3: Synthesis of tert-butyl
1-((2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidin-1-yls-
ulfonyl)piperidin-4-ylcarbamate
##STR01258##
[0437] Into a 25-mL round-bottom flask was placed
5-ethyl-N-[(2S,4R)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide
hydrochloride (70 mg, 0.24 mmol, 1.00 equiv) and dichloromethane
(10 mL). TEA (120 mg) was added dropwise at 0.degree. C. tert-Butyl
N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (350 mg, 1.17 mmol,
4.85 equiv) was then added in several portions. The resulting
solution was stirred for 2 h at room temperature. The mixture was
then concentrated under vacuum. The residue was chromatographed on
a silica gel column with ethyl acetate/petroleum ether (1/1). This
resulted in 70 mg (56%) of tert-butyl
N-[1-[(2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-
-sulfonyl]piperidin-4-yl]carbamate as a yellow solid. LCMS (method
C, ESI): RT=1.54 min, m/z=538.2 [M+Na].sup.+.
Step 4: Synthesis of
N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-et-
hyl-1,2-thiazole-3-carboxamide
##STR01259##
[0439] Into a 25-mL round-bottom flask was placed tert-butyl
N-[1-[(2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-
-sulfonyl]piperidin-4-yl]carbamate (70 mg, 0.14 mmol, 1.00 equiv)
and dichloromethane (10 mL). To the above hydrogen chloride (gas)
was introduced. The resulting solution was stirred for 1 h at room
temperature. The mixture was then concentrated under vacuum. The
crude product was purified by Prep-HPLC with the following
conditions: Column: X Bridge RP, 19*150 mm, 5 um; Mobile Phase
A:Water/0.05% NH.sub.4HCO.sub.3, Mobile Phase B: ACN; Flow rate: 30
mL/min; Gradient: 25% B to 45% B in 8 min; 254 nm. This resulted in
13.8 mg (24%) of
N-[(2S,4R)-1-(4-aminopiperidine-1-sulfonyl)-2-methylpiperidin-4-yl]-5-eth-
yl-1,2-thiazole-3-carboxamide as a white solid. .sup.1H NMR (400
MHz, CD.sub.3OD) .delta.: 7.57 (s, 1H), 4.40-415 (m, 1H), 4.25-4.15
(m, 1H), 3.67-3.62 (m, 31), 3.30-3.15 (m, 1H), 3.06-3.00 (m, 2H),
2.89-2.79 (m, 3H), 1.98-1.85 (m, 5H), 1.80-1.58 (m, 2H), 1.51-1.40
(m, 1H), 1.40-1.36 (m, 6H) ppm. LCMS (method A, ESI): RT=1.68 min,
m/z=438.1 [M+Na].sup.+.
Example 21
Synthesis of
N-((2S,4S)-1-(4-acetamidophenylsulfonyl)-2-methylpiperidin-4-yl)-2-oxoind-
oline-5-carboxamide (Cpd. No. 632)
##STR01260##
[0440] Step 1: Synthesis of (2S)-tert-butyl
4-amino-2-methylpiperidine-1-carboxylate
##STR01261##
[0442] Into a 1-L round-bottom flask was placed methanol (600 mL),
HCOONH.sub.4 (32 g, 507.45 mmol, 36.08 equiv) and tert-butyl
(2S)-2-methyl-4-oxopiperidine-1-carboxylate (3 g, 14.07 mmol, 1.00
equiv). NaCNBH.sub.3 (1.7 g, 27.05 mmol, 1.92 equiv) was added
batchwise slowly at 0-5.degree. C. The resulting solution was
stirred for 16 hours at 25.degree. C. The reaction mixture was then
diluted with 250 mL of ethyl acetate and washed with 3.times.250 mL
of brine. The organic layer was dried over anhydrous sodium sulfate
and concentrated under vacuum. This resulted in 2.5 g (83%) of
tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate as
colorless oil. .sup.1H-NMR (400 MHz, CDCl.sub.3) .delta.: 4.13-4.11
(m, 1H), 3.98-3.97 (m, 1H), 3.49-3.28 (m, 2H), 2.24-2.10 (m, 2H),
1.76-1.75 (m, 21), 1.45 (s, 91), 1.27 (d, J=6.0 Hz, 311) ppm. LCMS
(method D, ESI): RT=1.04 min, n/z=215.0 [M+H].sup.+.
Step 2: Synthesis of (2S)-tert-butyl
4-(benzyloxycarbonylamino)-2-methylpiperidine-1-carboxylate
##STR01262##
[0444] Into a 250-mL round-bottom flask was placed water (50 mL),
tetrahydrofuran (50 mL), sodium carbonate (3.7 g, 34.91 mmol, 2.99
equiv), and tert-butyl
(2S)-4-amino-2-methylpiperidine-1-carboxylate (2.5 g, 11.67 mmol,
1.00 equiv). Then benzyl chloroformate (4 g, 23.45 mmol, 2.01
equiv) was added dropwise at 0-5.degree. C. The resulting solution
was stirred for 16 hours at 25.degree. C. The resulting mixture was
concentrated under vacuum. The residue was diluted with 100 mL of
ethyl acetate and washed with 3.times.100 mL of brine. The organic
layer was dried over anhydrous sodium sulfate and concentrated
under vacuum. The residue was chromatographed on a silica gel
column with ethyl acetate/petroleum ether (1/1). This resulted in 2
g (49%) of tert-butyl
(2S)-4-[[(benzyloxy)carbonyl]amino]-2-methylpiperidine-1-carboxylate
as colorless oil. .sup.1H-NMR (300 MHz, CD.sub.3OD) .delta.:
7.36-7.30 (m, 5H), 5.09 (s, 2H), 4.10-4.08 (m, 1H), 3.76-3.70 (m,
2H), 3.27-3.17 (m, 1H), 1.97-1.78 (m, 3H), 1.62-1.55 (m, 1H), 1.41
(s, 9H), 1.25 (d, J=8.0 Hz, 3H) ppm. LCMS (method D, ESI): RT=1.57
min, m/z=349.3 [M+H].sup.+.
Step 3: Synthesis of Benzyl
(2S)-2-methylpiperidin-4-ylcarbamate
##STR01263##
[0446] Into a 25-mL round-bottom flask was placed tert-butyl
(2S)-4-[[(benzyloxy)carbonyl]amino]-2-methylpiperidine-1-carboxylate
(400 mg, 1.15 mmol, 1.00 equiv) and dichloromethane (6 mL).
Trifluoroacetic acid (3 mL) was then added dropwise at 0-5.degree.
C. The resulting solution was stirred for 30 min at 25.degree. C.
The mixture was concentrated under vacuum which resulted in 300 mg
(crude) of benzyl N-[(2S)-2-methylpiperidin-4-yl]carbamate as a
yellow liquid. LCMS (method A, ESI): RT=1.07 min, m/z=249.1
[M+H].sup.+.
Step 4: Synthesis of benzyl
(2S)-1-(4-acetamidophenylsulfonyl)-2-methylpiperidin-4-ylcarbamate
##STR01264##
[0448] Into a 50-mL round-bottom flask was placed benzyl
N-[(2S)-2-methylpiperidin-4-yl]carbamate (300 mg, 121 mmol, 1.00
equiv) and triethylamine (600 mg, 5.93 mmol, 4.00 equiv) in
dichloromethane (30 mL). This was followed by the addition of
4-acetamidobenzene-1-sulfonyl chloride (720 mg, 3.08 mmol, 2.00
equiv) dropwise with stirring at 0.degree. C. The resulting
solution was stirred for 16 hours at 25.degree. C. The mixture was
then concentrated under vacuum. The residue was chromatographed on
a silica gel column with ethyl acetate/petroleum ether (2/1). This
resulted in 300 mg (56%) of benzyl
N-[(2S)-1-[(4-acetamidobenzene)sulfonyl]-2-methylpiperidin-4-yl]carbamate
as a yellow solid. LCMS (method D, ESI): RT=1.40 min, m/z=446.2
[M+H].sup.+.
Step 5: Synthesis of
N-(4-((2S)-4-amino-2-methylpiperidin-1-ylsulfonyl)
phenyl)acetamide
##STR01265##
[0450] Into a 50-mL round-bottom flask was placed benzyl
N-[(2S)-1-[(4-acetamidobenzene)sulfonyl]-2-methylpiperidin-4-yl]carbamate
(300 mg, 0.67 mmol, 1.00 equiv) and trifluoroacetic acid (10 mL).
The resulting solution was stirred for 1 hour at 60.degree. C. in
an oil bath. The mixture was then concentrated under vacuum. This
resulted in 280 mg (crude) of
N-[4-[(2S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide
as yellow oil. LCMS (method D, ESI): RT=0.96 min, m/z=312.2
[M+H].sup.+.
Step 6: Synthesis of
N-(4-((2S,4S)-4-amino-2-methylpiperidin-1-ylsulfonyl)phenyl)acetamide
and
N-(4-(((2S,4R)-4-amino-2-methylpiperidin-1-yl)sulfonyl)phenyl)acetamide
##STR01266##
[0452]
N-[4-[(2S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide
(200 mg, 0.64 mmol, 1.00 equiv) was separated by Prep-SFC with the
following conditions: Column, Lux Su Cellulose-44.6*150 mm, Sum
Chiral-A (LUX-4); mobile phase, 25% IPA with MeOH; Detector, UV
254/220 nm. This resulted in 100 mg (100%) of
N-[4-[(2S,4S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide
as a yellow solid and 40 mg (98%) of
N-[4-[(2S,4R)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide
as a yellow solid. ee value: 100%.
Step 7: Synthesis of
N-((2S,4S)-1-(4-acetamidophenylsulfonyl)-2-methylpiperidin-4-yl)-2-oxoind-
oline-5-carboxamide
##STR01267##
[0454] Into a 10-mL round-bottom flask was placed
2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (48 mg, 0.27 mmol,
2.00 equiv), 1-hydroxybenzotrizole (40 mg, 1.26 mmol, 2.00 equiv),
triethylamine (50 mg, 0.49 mmol, 4.00 equiv),
N-[4-[(2S,4S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide
(40 mg, 0.13 mmol, 1.00 equiv), and dichloromethane (4 mL).
N-(3-dimethylaminopropyl)-N'-ethylcarbodiimide hydrochloride (56
mg, 0.29 mmol, 2.00 equiv) was added batchwise at 0-5.degree. C.
The resulting solution was stirred for 16 hours at 25.degree. C.
The mixture was then washed with 3.times.5 mL of brine and the
organic layer concentrated under vacuum. The crude product was
purified by Prep-HPLC with the following conditions (2 #-Waters
2767-2 (HPLC-08)): Column, Xbridge Shield RP 18, Sum, 19150 mm;
mobile phase, water with 50 mmol NH.sub.4HCO.sub.3 and CH.sub.3CN
(10.0% CH.sub.3CN up to 28.0% in 2 min, up to 46.0% in 10 min, up
to 100.0% in 1 min, down to 10.0% in 1 min); Detector, UV 254 nm.
This resulted in 2.6 mg (4%) of
N-[(2S,4S)-1-[(4-acetamidobenzene)sulfonyl]-2-methylpiperidin-4-yl]-2-oxo-
-2,3-dihydro-1H-indole-5-carboxamide as a white solid. .sup.1H-NMR
(400 MHz, CD.sub.3OD) .delta.: 7.84-7.78 (m, 4H), 7.74-7.71 (m,
2H), 6.95 (d, J=8.0 Hz, 1H), 3.95-3.90 (m, 2H), 3.62-3.51 (m, 1H),
3.33-3.32 (m, 2H), 3.15-3.04 (m, 1H), 2.19 (s, 3H), 2.06-1.98 (m,
1H), 1.93-1.88 (m, 1H), 1.73-1.68 (m, 2H), 1.40 (d, J=8.0 Hz, 3H)
ppm. LCMS (method D, ESI): RT=2.62 min, m/z=471.2 [M+H].sup.+.
Example 22
Synthesis of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-5-ethylpyridazine-3-carboxamide trifluoroacetate (Cpd. No.
616)
##STR01268##
[0455] Step 1: Synthesis of 3-chloro-5-ethylpyridazine
##STR01269##
[0457] Into a 50-mL round-bottom flask was placed
5-ethyl-2,3-dihydropyridazin-3-one (100 mg, 0.81 mmol, 1.00 equiv)
and POCl.sub.3 (5 mL). The resulting solution was stirred for 2
hours at 80.degree. C. in an oil bath. The mixture was then
concentrated under vacuum. The residue was extracted with
1.times.100 mL of dichloromethane and the organic layer washed with
50 mL of sodium bicarbonate (aq. sat.) and brine. The organic layer
was dried over anhydrous sodium sulfate and concentrated under
vacuum. The residue was chromatographed on a silica gel column with
ethyl acetate/petroleum ether (30:100). This resulted in 80 mg
(69%) of 3-chloro-5-ethylpyridazine as yellow oil. TLC, Rf=0.2
(PE:EA=10:1).
Step 2: Synthesis of methyl 5-ethylpyridazine-3-carboxylate
##STR01270##
[0459] Into a 30-mL pressure tank reactor (100 mL) was placed
3-chloro-5-ethylpyridazine (80 mg, 0.55 mmol, 1.00 equiv), methanol
(10 mL), triethylamine (112 mg, 1.11 mmol, 2.02 equiv), and
Pd(dppf)Cl2 (148 mg). To the above CO (gas) was introduced and
maintained at 30 atm. The resulting solution was stirred for 15 h
at 80.degree. C. The solids were filtered out. The filtrate was
extracted with 2.times.100 mL of ethyl acetate and the organic
layers combined, washed with 50 mL of brine, dried over anhydrous
sodium sulfate and concentrated under vacuum. The residue was
chromatographed on a silica gel column with ethyl acetate/petroleum
ether (30:100). This resulted in 80 mg (86%) of methyl
5-ethylpyridazine-3-carboxylate as yellow oil. LCMS (method C,
ESI): RT=0.78 min, m/z=167.0 [M+H].sup.+.
Step 3: Synthesis of 5-ethylpyridazine-3-carboxylic Acid
##STR01271##
[0461] Into a 10-mL round-bottom flask was placed methyl
5-ethylpyridazine-3-carboxylate 80 mg, 0.48 mmol, 1.00 equiv) and
C.sub.2H.sub.5OH (5 mL). This was followed by the addition of a
solution of LiOH.H.sub.2O (100 mg, 2.4 mmol, 5.00 equiv) in water
(1 mL) which was added dropwise with stirring at 0.degree. C. The
resulting solution was stirred for 3 hour at 20.degree. C. The
reaction was then quenched by the addition of 50 mL of water. The
pH was adjusted to 5 with hydrochloric acid (6N). The mixture was
extracted with 2.times.100 mL of dichloromethane and the combined
organic layers dried over anhydrous sodium sulfate and concentrated
under vacuum. This resulted in 60 mg (34.7%) of
5-ethylpyridazine-3-carboxylic acid as black oil. LCMS (method D,
ESI): RT=0.90 min, m/z=153.0 [M+H].sup.+.
Step 4: Synthesis of tert-butyl
N-[1-[(1R,3r,5S)-3-(5-ethylpyridazine-3-carboxamido)-8-azabicyclo[3.2.1]o-
ctane-8-sulfonyl]piperidin-4-yl]carbamate
##STR01272##
[0463] Into a 50-mL round-bottom flask purged and maintained with
an inert atmosphere of nitrogen was placed dichloromethane 20 mL)
and 5-ethylpyridazine-3-carboxylic acid (60 mg, 0.39 mmol, 1.00
equiv). To the above was added tert-butyl
N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-
-yl]carbamate (150 mg, 0.39 mmol, 0.98 equiv), HOBT (79 mg, 0.58
mmol, 1.49 equiv)), and EDCI (223 mg, 1.17 mmol, 2.99 equiv). This
was followed by the addition of a solution of triethylamine (118
mg, 1.17 mmol, 2.99 equiv) in dichloromethane (2 ml) which was
added dropwise with stirring at 0.degree. C. over 3 min. The
resulting solution was stirred for 15 hours at 20.degree. C. The
mixture was extracted with 2.times.100 mL of dichloromethane and
the organic layers combined, washed with 50 mL of water and 50 mL
of brine, and concentrated under vacuum. The residue was
chromatographed on a silica gel column with ethyl acetate/petroleum
ether (50:100). This resulted in 50 mg (24%) of tert-butyl
N-[1-[(1R,3r,5S)-3-(5-ethylpyridazine-3-carboxamido)-8-azabicyclo[3.2.1]o-
ctane-8-sulfonyl]piperidin-4-yl]carbamate as yellow oil. LCMS
(method D, ESI): RT=1.46 min, m/z=523.0 [M+H].sup.+.
Step 5: Synthesis of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-5-ethylpyridazine-3-carboxamide trifluoroacetate
##STR01273##
[0465] Into a 25-mL round-bottom flask was placed tert-butyl
N-[1-[(1R,3r,5S)-3-(5-ethylpyridazine-3-carboxamido)-8-azabicyclo[3.2.1]o-
ctane-8-sulfonyl]piperidin-4-yl]carbamate (50 mg, 0.10 mmol, 1.00
equiv) and hydrogen chloride/dioxane (10 mL, saturated, this
solution was made by introducing hydrogen chloride gas into
1,4-dioxane under 0.degree. C. for 6 hours). The resulting solution
was stirred for 4 h at 20.degree. C. The mixture was then
concentrated under vacuum. The crude product was purified by
Prep-HPLC with the following conditions: Column: X Select C18,
19*250 mm, 5 um; Mobile Phase A: Water/0.05% TFA. Mobile Phase B:
ACN; Flow rate: 30 mL/min; Gradient: 12% B to 52% B in 11.5 min;
254 nm. This resulted in 17.9 mg (35%) of
N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-
-yl]-5-ethylpyridazine-3-carboxamide trifluoroacetate as a yellow
solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.: 9.29 (s, 1H),
8.19 (s, 1H), 4.37-4.28 (m, 1H), 4.21-4.11 (s, 2H), 3.86 (d, J=15.0
Hz, 2H), 3.30-3.20 (m, 1H), 2.99-2.80 (m, 4H), 2.45-2.30 (m, 2H),
2.18-2.00 (m, 8H), 1.79-1.61 (m, 2H), 1.40-1.29 (m, 3H) ppm. LCMS
(method D, ESI): RT=1.27 min, m/z=423.2 [M+H].sup.+.
Example 23
Synthesis of
2-oxo-N-[1-[(piperidin-4-ylmethane)sulfonyl]piperidin-4-yl]-2,3-dihydro-1-
H-indole-5-carboxamide trifluoroacetate (Cpd. No. 620)
##STR01274##
[0466] Step 1: Synthesis of
2-oxo-2,3-dihydro-1H-indole-5-carboxylic Acid
##STR01275##
[0468] Into a 50-mL round-bottom flask was placed methyl
2-oxo-2,3-dihydro-1H-indolo-5-carboxylate (800 mg, 4.18 mmol, 1.00
equiv) and methanol (10 mL). This was followed by the addition of a
solution of NaOH (670 mg, 16.75 mmol, 4.00 equiv) in water (10 mL)
dropwise with stirring at 0.degree. C. The resulting solution was
stirred for 14 h at 20.degree. C. The mixture was then concentrated
under vacuum and the residue taken up in 20 mL of H.sub.2O. This
was washed with 2.times.5 mL of dichloromethane. The pH was
adjusted to 4 with hydrochloric acid (1 N) and extracted with
5.times.50 mL of ethyl acetate and the organic layers combined.
Concentration resulted in 592 mg (80%) of
2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid as a yellow solid.
.sup.1H NMR (400 MHz, DMSO) .delta.: 12.5 (brs, 1H), 10.7 (s, 1H),
7.82 (d, J=8.4 Hz, 1H), 7.76 (s, 1H), 6.88 (d, J=8.0 Hz, 1H), 3.54
(s, 2H) ppm. LCMS (method A, ESI): RT=0.97 min, m/z=178.0
[M+H].sup.+.
Step 2: Synthesis of tert-butyl
4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-carboxylate
##STR01276##
[0470] Into a 25-mL round-bottom flask was placed tert-butyl
4-aminopiperidine-1-carboxylate (300 mg, 1.50 mmol, 1.00 equiv),
dichloromethane (10 m), 2-oxo-2,3-dihydro-1H-indole-5-carboxylic
acid (319 mg, 1.80 mmol, 1.20 equiv), EDCI (344 mg, 1.79 mmol, 1.20
equiv), and HOBT (304 mg, 2.25 mmol, 1.50 equiv). This was followed
by the addition of TEA (454 mg, 4.49 mmol, 3.00 equiv) dropwise
with stirring at 0.degree. C. The resulting solution was stirred
for 14 h at 20.degree. C. The solids were collected by filtration.
This resulted in 393 mg (73%) of tert-butyl
4-(2-oxo-2,3-dihydro-1H-indole-5-amido)piperidine-1-carboxylate as
a yellow solid. LCMS (method C, ESI): RT=0.78 min, m/z=304.0
[M+H-56].sup.+.
Step 3: Synthesis of
2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-indole-5-carboxamide
hydrochloride
##STR01277##
[0472] Into a 25-mL round-bottom flask was placed tert-butyl
4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-carboxylate
(250 mg, 0.70 mmol, 1.00 equiv) and hydrogen chloride/dioxane (3
mL, saturated, this solution was made by introducing hydrogen
chloride gas into 1,4-dioxane under 0.degree. C. for 6 hours). The
resulting solution was stirred for 2 h at 20.degree. C. The mixture
was then concentrated under vacuum. This resulted in 200 mg (97%)
of 2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-indole-5-carboxamide
hydrochloride as a light yellow solid. .sup.1H NMR (400 MHz,
D.sub.2O) .delta.: 7.65 (s, 2H), 6.95 (s, 1H), 4.04 (t, J=10.4 Hz,
1H), 3.54 (s, 2H), 3.42 (d, J=13.2 Hz, 2H), 3.12-3.01 (m, 2H), 2.13
(d, J=14.0 Hz, 2H), 1.81-1.65 (m, 2H) ppm. LCMS (method A. ESI):
RT=0.89 min, m/z=260.0 [M+H].sup.+.
Step 4: Synthesis of benzyl
4-[[4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-sulfonyl]me-
thyl]piperidine-1-carboxylate
##STR01278##
[0474] Into a 50-mL round-bottom flask was placed
2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-indole-5-carboxamide
hydrochloride (80 mg, 0.27 mmol, 1.00 equiv) and NMP (16 mL). This
was followed by the addition of TEA (82 mg, 0.81 mmol, 3.00 equiv)
dropwise with stirring at 0.degree. C. To this was then added
benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (135 mg,
0.41 mmol, 1.50 equiv) in several batches at 0.degree. C. The
resulting solution was stirred for 2 h at 20.degree. C. The mixture
was concentrated under vacuum. The residue was chromatographed on a
silica gel column with dichloromethane/methanol (50:1-20:1). The
collected fractions were combined and concentrated under vacuum.
This resulted in 100 mg (67%) of benzyl
4-[[4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-sulf-
onyl]methyl]piperidine-1-carboxylate as a yellow solid. LCMS
(method C, ESI): RT=1.04 min, m/z=555.0 [M+H].sup.+.
Step 5: Synthesis of
2-oxo-N-[1-[(piperidin-4-ylmethane)sulfonyl]piperidin-4-yl]-2,3-dihydro-1-
H-indole-5-carboxamide trifluoroacetate
##STR01279##
[0476] Into a 25-mL round-bottom flask was placed benzyl
4-[[4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-sulfonyl]me-
thyl]piperidine-1-carboxylate (80 mg, 0.14 mmol, 1.00 equiv) and
hydrochloric acid (12 N, 5 mL). The resulting solution was stirred
for 2 h at 20.degree. C. The mixture was then concentrated under
vacuum. The crude product was purified by Prep-HPLC with the
following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile
Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 30
mL/min; Gradient: 15% B to 43% B in 10 min; Detector: 254 nm. This
resulted in 13.2 mg (17%) of
2-oxo-N-[1-[(piperidin-4-ylmethane)sulfonyl]piperidin-4-yl]-2,3-dihydro-1-
H-indole-5-carboxamide trifluoroacetate as a white solid. .sup.1H
NMR (400 MHz, D.sub.2O) .delta.: 7.61 (s, 2H), 7.00 (d, J=4.4 Hz,
1H), 4.00-3.90 (m, 1H), 3.75-3.66 (m, 2H), 3.60 (s, 2H), 3.43-3.37
(m, 2H), 3.15 (d, J=6.4 Hz, 2H), 3.05-2.92 (m, 4H), 2.31-2.18 (m,
1H), 2.15-1.97 (m, 4H), 1.69-1.50 (m, 4H) ppm. LCMS (method A.
ESI): RT=1.03 min, m/z=421.1 [M+H].sup.+.
Example 24
Synthesis of
N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
##STR01280##
[0477] Step 1: Synthesis of Ethyl 2-diazo-3-oxopropanoate
##STR01281##
[0479] Oxalyl chloride (87.9 g, 693 mmol) was added to a cold
solution of N,N-dimethylformamide (42.3 g, 578 mmol) in CHCl.sub.3
(150 mL) and the reaction was stirred at room temperature for 30
min, followed by heating at 40.degree. C. for a further 1 h. After
chilling the reaction to -10.degree. C., ethyl 2-diazoacetate (63.0
g, 552 mmol) was added and the mixture was stirred at room
temperature for 2 h. The mixture was then concentrated and the
residue was diluted with ether (200 mL), the solid was collected by
filtration and dissolved in 10% aq. HOAc (200 mL), then stirred for
a further 1 h. The resulting mixture was extracted with ethyl
acetate (300 mL.times.3) and the organic was washed with saturated
Na.sub.2CO.sub.3 aq. (300 mL) and brine (300 mL), dried over
Na.sub.2SO.sub.4, filtered and concentrated to give crude ethyl
2-diazo-3-oxopropanoate (27 g, 32.8%) as red oil, which was used
for next step without further purification. .sup.1H-NMR (400 MHz,
CD.sub.3OD) .delta. ppm: 9.67 (s, 1H), 4.33 (q, J=7.2 Hz, 2H), 1.32
(t, J=7.2, 3H).
Step 2: Synthesis of ethyl
1-cyclopropyl-1H-1,2,3-triazole-4-carboxylate
##STR01282##
[0481] To a solution of ethyl 2-diazo-3-oxopropanoate (27 g, 189
mmol) in EtOH (100 mL) was added acetic acid (28.3 g, 472 mmol).
Cyclopropanamine (10.7 g, 189 mmol) was added slowly and the
mixture was stirred at room temperature overnight. The solvent was
removed and saturated Na.sub.2CO.sub.3 aq. was added to the residue
to bring the pH to 8. The mixture was extracted with ethyl acetate
(200 mL.times.3), washed with brine (100 mL), dried over
Na.sub.2SO.sub.4, filtered and concentrated. The resulting residue
was purified by flash chromatography (PE:EA-2:1) to give crude
ethyl 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylate (18.5 g, 54.0%)
as yellow oil. ESI-LCMS (m/z): 182.2 [M+H].sup.+.
Step 3: Synthesis of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic
Acid
##STR01283##
[0483] To a solution of ethyl
1-cyclopropyl-1H-1,2,3-triazole-4-carboxylate (18.5 g, 102 mmol) in
THF (80 mL)/H.sub.2O (40 mL) was added lithium hydroxide hydrate
(4.5 g, 107 mmol), the resulting mixture was stirred at room
temperature for 3 hr. The solvent was removed and the residue was
dissolved in H.sub.2O (50 mL), extracted with EA (100 mL). The
organic phase was discarded and the water phase was acidified with
2N HCl until the pH=5, The aqueous solution was extracted with
DCM:MeOH=10:1 (1.5 L). The organic layer was dried and concentrated
to afford 6.3 g of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic
acid as white solid. The aqueous layer was concentrated to afford
another 11.4 g crude product, which was used for next step without
further purification. ESI-LCMS (m/z): 154.1[M+H].sup.+.
Step 4: Synthesis of tert-butyl 3-(1-cyclopropyl-1H-1, 2,
3-triazole-4-carboxamido)azetidine-1-carboxylate
##STR01284##
[0485] A solution of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic
acid (2 g, 13.0 mmol) in thionyl chloride (10 mL) was stirred at
65.degree. C. for 2 h. The reaction mixture was concentrated under
reduced pressure. Then the reaction residue was diluted with DMF (5
mL) and added dropwise to the solution of tert-butyl
3-aminoazetidine-1-carboxylate (2.23 g, 13.0 mmol) and DIPEA (4.19
g, 32.5 mmol) in DCM (15 mL) under 0.degree. C. The resulting
mixture was stirred at room temperature overnight. The solvent was
removed and the residue was diluted with ethyl acetate (200 mL),
washed with water (10 mL.times.3) and brine (50 mL), dried over
Na.sub.2SO.sub.4, filtered and concentrated. The resulting residue
was purified by Flash chromatography (DCM:NH.sub.3 in MeOH
(7N)=100:0-50:1) to give tert-butyl
3-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)azetidine-1-carboxylate
(3 g, 75.1%) as a yellow solid. ES-LCMS (m/z): 252.2
[M-55].sup.+.
Step 5: Synthesis of
N-(Azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
##STR01285##
[0487] A solution of tert-butyl 3-(1-cyclopropyl-1H-1,
2,3-triazole-4-carboxamido)azetidine-1-carboxylate (3.0 g, 9.8
mmol) in HCl/MeOH (20 mL) was stirred at 50.degree. C. for 2 h.
After completion, the solvent was removed in vacuo. The residue was
dissolved in NH.sub.3/MeOH (7 mol/L, 20 mL) and stirred for 30 min.
The solvent was removed and the residue was purified by Flash
chromatography (DCM:NH.sub.3 in MeOH (7N)=100:0-30:1-15:1) to give
N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
(1.6 g, 80%) as a white solid. ESI-LCMS (m/z): 208.1 [M+H].sup.+.
.sup.1H-NMR (400 MHz, CD.sub.3OD) S ppm: 8.38 (s, 1H), 4.92-4.86
(m, 1H), 3.98-3.97 (m, 1H), 3.82-3.72 (m, 4H), 1.26-1.20 (m,
4H).
Example 25
Synthesis of 5-cyclopropylpyridazine-3-carboxylic Acid
##STR01286##
[0488] Step 1: Synthesis of 5-cyclopropylpyridazin-3-ol
##STR01287##
[0490] To a solution of 5-chloropyridazin-3-ol (1.0 g, 7.7 mmol) in
toluene/H.sub.2O (100: 5, 50 mL) was added sequentially
cyclopropylboronic acid (987 mg, 11.5 mmol), K.sub.3PO.sub.4 (4.51
g, 23.0 mmol), diacetoxypalladium (86.2 mg, 384 .mu.mol) and
tricyclohexylphosphine (107 mg, 384 .mu.mol).The reaction mixture
was stirred at 100.degree. C. under N.sub.2 atmosphere for 20 h.
then concentrated in vacuum to remove the solvent Water (20 mL) was
added and the solution was acidified with hydrochloric acid (4 M)
to pH=3. The solution was extracted with EtOAc (200 mL.times.3) and
the combined organic layer were washed with saturated NaCl
solution, dried over Na.sub.2SO.sub.4, concentrated to give a brown
residue then purified by silica-gel chromatography (PE:EA=1:1) to
afford the desired product (350 mg, 34% yield) as white solid.
ESI-LCMS (m/z): 137.1 [M+1].sup.+.
Step 2: Synthesis of 3-chloro-5-cyclopropylpyridazine
##STR01288##
[0492] A solution of 5-cyclopropylpyridazin-3-ol (350 mg, 2.6 mmol)
in phosphorous oxychloride (10 mL) was stirred at 80.degree. C. for
2 h. The remaining POCl.sub.3 was removed under vacuum then the
residue was cooled and added to 20 g of ice. The reaction mixture
was neutralized with saturated NaHCO.sub.3 solution and extracted
with EtOAc (40 mL.times.3), the combined organic extract is washed
with brine (100 mL.times.2), dried over Na.sub.2SO.sub.4 and the
solvent is removed under vacuum, the resulting residue was purified
by silica-gel chromatography (PE:EA=2:1) to afford the product
3-chloro-5-cyclopropylpyridazine as a colorless oil (200 mg, 50%
yield). ESI-LCMS (m/z): 155.2 [M+1].sup.+.
Step 3: Synthesis of ethyl
5-cyclopropylpyridazine-3-carboxylate
##STR01289##
[0494] Potassium acetate (284 mg, 2.9 mmol) was added to a solution
of 3-chloro-5-cyclopropylpyridazine (150 mg, 1.0 mmol) in ethanol
(10 mL). The mixture was degassed, then Pd(dppf)C12 (35.4 mg, 0.05
mmol) was added. The resulting mixture was heated under an
atmosphere of CO at 70.degree. C. for 20 hr. The reaction mixture
was filtrated and the filtrate was concentrated under reduced
pressure. The residue was purified by column chromatography
(PE:EA=1:1) to obtain the desired product ethyl
5-cyclopropylpyridazine-3-carboxylate (100 mg, 54% yield, colorless
oil). ESI-LCMS (m/z): 193.1 [M+H].sup.+; .sup.1HNMR (400 MHz,
CD.sub.3OD) ppm: 9.06 (d, J=2.4 Hz, 1H), 7.81 (d, J=2.4 Hz, 1H),
7.39 (q, J=6.8 Hz, 2H), 2.11-1.92 (m, 1H), 1.34 (t, J=6.8 Hz, 3H),
0.96-0.93 (m, 2H).
Step 4: Synthesis of 5-cyclopropylpyridazine-3-carboxylic Acid
##STR01290##
[0496] To a solution of methyl
5-cyclopropylpyridazine-3-carboxylate (185 mg, 1.03 mmol) in
THF/H.sub.2O (8 mL/2 mL) was added lithium hydroxide hydrate (64.6
mg, 1.54 mmol). The reaction mixture was stirred at room
temperature for 3 h. Progress of the reaction was monitored by TLC
and LCMS. After completion, the mixture was adjusted to pH=5 with
1N HCl, then concentrated directly to
5-cyclopropylpyridazine-3-carboxylic acid (170 mg, 94.6%) as yellow
solid and used in next step directly. ESI-LCMS (m/z): 165
[M+1].sup.+.
Example 26
Synthesis of
2-(3-(1-(3-Aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethan-1-ol
##STR01291##
[0497] Step 1: Synthesis of 1-(2-chloro-3-methoxyphenyl)ethano
##STR01292##
[0499] A mixture of 2-chloro-3-methoxybenzaldehyde (2.38 g, 14
mmol) in THE (50 mL) was stirred at 0.degree. C., and a solution of
methylmagnesium bromide (5.6 mL, 16.7 mmol, 3M) in ether was added.
The resulting mixture was stirred overnight. The reaction mixture
was diluted with 1 N HCl (50 mL) and extracted with ethyl acetate
(50 mL.times.3), the combined organic phase was washed with brine,
dried over sodium sulfate and concentrated to afford
1-(2-chloro-3-methoxyphenyl)ethanol (2.60 g, 99.6%) as a yellow
oil. .sup.1HNMR (400 MHz, CD.sub.3OD) .delta. ppm: 7.49 (d, J=8.4
Hz, 1H), 6.90-6.85 (m, 2H), 5.25 (q, J=6.4, 12.8 Hz, 1H), 3.81 (s,
3H), 1.48 (d, J=6.4 Hz, 3H).
Step 2: Synthesis of 1-(2-chloro-3-methoxyphenyl)ethanone
##STR01293##
[0501] A mixture of 1-(2-chloro-3-methoxyphenyl)ethanol (2.0 g,
10.7 mmol) and manganese(IV) oxide (4.65 g, 53.5 mmol) in DCM (50
mL) was heated to 40.degree. C. and stirred overnight. The reaction
mixture was filtered through Celite and the filtrate was
concentrated to afford 1-(2-chloro-3-methoxyphenyl)ethanone (1.83
g, 89.8%) as a yellow oil. ESI-LCMS (m/z): 185.0 [M+1].sup.+.
Step 3: Synthesis of 1-(2-chloro-3-hydroxyphenyl)ethanone
##STR01294##
[0503] A mixture of 1-(2-chloro-3-methoxyphenyl)ethanone (540 mmol,
2.92 mmol) and aluminum trichloride (972 mg, 7.29 mmol) in
monochlorobenzene (10 mL) was stirred at 120.degree. C. for 2 hrs.
After cooling to rt, the reaction mixture was added dropwise into
1N HCl in a water bath and the mixture was extracted with ethyl
acetate (20 mL.times.3). The combined organic phase was washed with
brine, dried over sodium sulfate and concentrated. The residue was
purified by chromatography (PE:EA=5:1) to afford
1-(2-chloro-3-hydroxyphenyl)ethanone (400 mg, 80.3%) as a yellow
solid ESI-LCMS (m/z): 171.0[M+H].sup.+.
Step 4: Synthesis of
1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethanone
##STR01295##
[0505] A mixture of 1-(2-chloro-3-hydroxyphenyl)ethanone (330 mg,
1.93 mmol), 2-bromoethanol (482 mg, 3.86 mmol) and K.sub.2CO.sub.3
(800 mg, 5.79 mmol) in DMF (10 mL) was heated to 80.degree. C.
overnight. Water was added and the mixture was extracted with ethyl
acetate (30 mL.times.3), the combined organic phase was washed with
brine, dried over sodium sulfate and concentrated. The residue was
purified by chromatography (DCM:MeOH=50:1) to afford
1-(2-chloro-3-(2-hydroxyethoxy) phenyl)ethanone (400 mg, 79.2%) as
a yellow oil. ESI-LCMS (m/z): 251.1 [M+H].sup.+.
Step 5: Synthesis of tert-butyl
1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-ylcarbamate
##STR01296##
[0507] A mixture of 1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethanone
(214 mg, 1 mmol), tert-butyl azetidin-3-ylcarbamate (206 mg, 1.20
mmol), acetic acid (120 mg, 2.00 mmol) and NaBH.sub.3CN (125 mg,
2.00 mmol) in MeOH (10 ml) was stirred at 70.degree. C. overnight.
The reaction mixture was concentrated and adjusted pH=8-9 with a
saturated solution of Na.sub.2CO.sub.3. The resulting mixture was
extracted with DCM (30 mL.times.3) and the combined organic phase
was washed with brine, dried over sodium sulfate and concentrated.
The residue was purified by prep-TLC (DCM:MeOH=20:1) to afford
tert-butyl
(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)
carbamate (220 mg, 52.7%) as a yellow oil. ESI-LCMS (m/z): 371.2
[M+1].sup.+.
Step 6: Synthesis of
2-(3-(1-(3-Aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethanol
##STR01297##
[0509] A mixture of tert-butyl
(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl and
azetidin-3-yl)carbamate (200 mg, 539 .mu.mol) in a solution of
HCl/MeOH (10 mL, 3N) was stirred at rt for 3 hrs. The reaction
mixture was concentrated under reduced pressure to afford
2-(3-(1-(3-aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethanol (120
mg, 68.9%) as a yellow oil. ESI-LCMS (m/z): 271.2 [M+1].sup.+.
Example 27
Synthesis of
(S)--N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1-c-
yclopropyl-1H-1,2,3-triazole-4-carboxamide (Cpd. No. 831)
##STR01298##
[0510] Step 1: Synthesis of
N-(1-(1-(2-Chloro-3-(2-hydroxyethoxy)phenyl)
ethyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
##STR01299##
[0512] A mixture of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic
acid (22.9 mg, 150 .mu.mol), 2
(3-(1-(3-aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethanol (40.6
mg, 0.15 mmol), HATU (85.4 mg, 225 .mu.mol) and DIPEA (38.6 mg, 300
.mu.mol) in DMF (2 mL) was stirred at rt for 2 h. water was added
and the mixture was extracted with ethyl acetate (10 mL.times.3),
the combined organic phase was washed with brine, dried over sodium
sulfate and concentrated. The residue was purified by Pre-TLC
(DCM:MEOH=20:1) to afford
N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1-cyclop-
ropyl-1H-1,2,3-triazole-4-carboxamide (15 mg, 24.6%) as a white
solid. ESI-LCMS (m/z): 406.1 [M+23].sup.+. .sup.1HNMR (400 MHz,
CD.sub.3OD) .delta. ppm: 8.38 (s, 1H), 7.43 (d, J=8.4 Hz, 1H),
7.00-6.93 (m, 2H), 4.66-4.59 (m, 1H), 4.06-3.95 (m, 4H), 3.89-3.86
(m, 2H), 3.83-3.79 (m, 1H), 3.53-3.50 (m, 1H), 3.22 (t, J=7.2 Hz,
1H), 3.04 (t, J=7.2 Hz, 1H), 1.30-1.19 (m, 7H).
Step 2: Synthesis of
(S)--N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)
azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
##STR01300##
[0514]
N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1--
cyclopropyl-1H-1,2,3-triazole-4-carboxamide (350 mg, 862 .mu.mol)
was separated by chiral HPLC to obtain two single enantiomers,
(isomer 1: 160 mg, white solid, Ret time 5.02 min; isomer 2: 170
mg, Ret time 6.51 min), absolute stereochemistry is undefined, the
isomer (Ret time: 5.02 min) was assumed to be S configuration,
(S)--N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1-c-
yclopropyl-1H-1,2,3-triazole-4-carboxamide (160 mg, 45.8%) as a
white solid. ESI-LCMS (m/z): 406.2 [M+1].sup.+. .sup.1HNMR (400
MHz, CD.sub.3OD) ppm: 8.38 (s, 1H), 7.44 (d, J=8.4 Hz, 1H),
6.99-6.94 (m, 2H), 4.63 (t, J=7.2 Hz, 1H), 4.06-3.98 (m, 41H),
3.89-3.86 (m, 2H), 3.82 (t. J=7.2 Hz, 1H), 3.52 (t, J=7.2 Hz, 1H),
3.22 (t, J=7.2 Hz, 1H), 3.05 (t, J=7.2 Hz, 1H), 1.27-1.21 (m, 7H).
SFC conditions: Instrument: SFC-80 (Thar, Waters) t; Column:
REGISCELL 20'250 mm, Sum (Dacel); Column temperature: 35.degree.
C.; Mobile phase: CO.sub.2/MEOH (0.2% methanol amina)=60/40: Flow
rate: 80 g/min: Back pressure: 100 bar; Detection wavelength: 214
nm; Cycle time: 8.8 min; Sample solution: 350 mg dissolved in 15 ml
Methanol; Injection volume: 3 mL.
Example 28
Synthesis of
N-(1-((1-(4-Chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopr-
opyl-1H-1,2,3-triazole-4-carboxamide (Cpd. No. 985)
##STR01301##
[0515] Step 1: Synthesis of
1-(4-Chlorobenzyl)-1H-azole-4-carbaldehyde
##STR01302##
[0517] To a solution of 1H-pyrazole-4-carbaldehyde (70 mg, 728
.mu.mol) in MeCN (5 mL) was added 1-(bromomethyl)-4-chlorobenzene
(149 mg, 728 .mu.mol) and cesium carbonate (472 mg, 1.45 mmol). The
mixture was stirred at r.t. for 2 h. The mixture was concentrated,
diluted with EA and water. The organic phase was washed with brine
(10 mL.times.2), dried over Na.sub.2SO.sub.4 and concentrated to
give 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (162 mg, 101%)
as a white solid, which was used in the next step without further
purification. ESI-LCMS (m/z): 221[M+H].sup.+.
Step 2: Synthesis of
N-(1-((1-(4-Chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopr-
opyl-1H-1,2,3-triazole-4-carboxamide
##STR01303##
[0519] A mixture of
N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (62
mg, 299 .mu.mol), 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde
(65.9 mg, 299 .mu.mol), and sodium cyanoborohydride (56.3 mg, 897
.mu.mol) in MeOH (10 mL) was stirred at 60.degree. C. for 16 h. The
mixture was cooled and concentrated. The residue was diluted with
EA, washed with water (10 mL) and brine (10 mL.times.2), dried over
Na.sub.2SO.sub.4 and concentrated. The residue was purified by
prep-HPLC to give
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopr-
opyl-1H-1,2,3-triazole-4-carboxamide (70 mg, 56.9%) as a white
solid. ESI-LCMS (m/z): 412[M+H].sup.+; .sup.1HNMR (400 MHz,
CD.sub.3OD) .delta. ppm: 8.38 (s, 1H), 7.67 (s, 1H), 7.50 (s, 1H),
7.35 (d, J=8.0 Hz, 2H), 7.21 (d, J=8.0 Hz, 2H), 5.31 (s, 2H),
4.65-4.61 (in, 1H), 4.00-3.96 (m, 1H), 3.71-3.67 (m, 2H), 3.61 (s,
2H), 3.22 (t, J=8.0 Hz, 2H), 1.30-1.24 (m, 2H), 1.21-1.19 (m,
2H).
Example 29
Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylpyridazine-3-carboxamide (Cpd No. 929)
##STR01304##
[0520] Step 1: Synthesis of tert-butyl
(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)carbamate
##STR01305##
[0522] A mixture of 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde
(200 mg, 0.9063 mmol), tert-Butyl (azetidin-3-yl)carbamate
hydrochloride (377 mg, 1.81 mmol) and acetic acid (54.4 mg, 0.9063
mmol) were dissolved in MeOH (40 ml). After stirred for 2 h at
r.t., sodium cyanoborohydride (142 mg, 2.26 mmol) was added to the
solution. The mixture was stirring over night at r.t. Then, the
solution was concentrated under reduced pressure and the residue
purified by flash column chromatography (eluant: DCM MeOH=10:1 (600
ml)). To furnish tert-butyl
(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)carbamate
(273 mg, 54.2%) as colorless oil. ESI-LCMS (m/z):
377[M+H].sup.+.
Step 2: Synthesis of
1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-amine
##STR01306##
[0524] tert-Butyl
(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)carbamate
(273 mg, 0.4908 mmol) was dissolved in HCl in MeOH (3M) (20 ml).
The solution was stirring over night at 50.degree. C. After cooled
to r.t., the solution was concentrated to afford
1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-amine (200
mg, 71.7%) as yellow solid, which was used for next step without
purification. ESI-LCMS (m/z): 277[M+H].sup.+.
Step 3: Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylpyridazine-3-carboxamide
##STR01307##
[0526] 5-cyclopropylpyridazine-3-carboxylic acid (60 mg, 0.3654
mmol) and HATU (250 mg, 0.6577 mmol) were dissolved in DMF (6 ml).
After stirred for 1 h at r.t.,
1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-amine (219
mg, 0.3836 mmol) and triethylamine (110 mg, 1.09 mmol) were added
to the solution. Then, the mixture was stirring for 4 h at r.t.
Then, ethyl acetate (100 ml) was added and the ethyl acetate layer
was washed by brine (50 mL.times.1), dried by Na.sub.2SO.sub.4, and
concentrated. The residue was purified by Prep-HPLC to afford
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylpyridazine-3-carboxamide (72 mg, 46.7%) as white solid.
ESI-LCMS (m/z): 423[M+H].sup.1HNMR (400 MHz, CD.sub.3OD) .delta.
ppm: 9.15 (s, 1H), 7.86 (s, 1H), 7.69 (s, 1H), 7.51 (s, 1H),
7.36-7.32 (m, 2H), 7.20 (d, J=8.4 Hz, 2H), 5.32 (s, 2H), 4.72-4.68
(m, 1H), 3.74-3.70 (m, 2H), 3.63 (s, 2H), 3.30-3.26 (m, 2H),
2.12-2.08 (m, 111), 1.33-1.28 (m, 2H), 1.04-1.00 (m, 211).
Example 30
Synthesis of
N-(1-((1-(4-chlorbenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopro-
pylpicolinamide (Cpd. No. 930)
##STR01308##
[0527] Step 1: Synthesis of tert-butyl
3-(4-bromopicolinamido)azetidine-1-carboxylate
##STR01309##
[0529] To a solution of 4-bromopicolinic acid (10.0 mmol, 2.02 g),
HATU (15.0 mmol, 5.7 g), HOAT (15.0 mmol, 2.04 g) and DIPEA (20.0
mmol, 2.58 g) in DMF (50 ml) was added tert-butyl
3-aminoazetidine-1-carboxylate (10.0 mmol, 1.72 g) and stirred at
r.t. overnight. Added ethyl acetate (300 ml), washed with water
(150 ml.times.6), dried over Na.sub.2SO.sub.4, concentrated and the
residue was crystallized with ethyl acetate petroleum ether=1:5 to
give pale yellow powder (2.63 g, 74%). ESI-LCMS (m/z): 356
[M+H].sup.+.
Step 2: Synthesis of tert-butyl
3-(4-cyclopropylpicolinamido)azetidine-1-carboxylate
##STR01310##
[0531] To a solution of tert-butyl
3-(4-bromopicolinamido)azetidine-1-carboxylate (16.2 mmol, 5.8 g),
cyclopropylboronic acid (32.4 mmol, 22.8 g), K.sub.3PO.sub.4 (48.5
mmol, 10.2 g) in dioxane (50 mL) was added Pd(dppf)Cl2 (1.61 mmol,
1.2 g). The mixture was degassed under reduced pressure while
stirring and recharged with argon gas, this procedure was repeated
for seven times and then heated to 100.degree. C. overnight. The
solvent was removed and the residue was purified by column
chromatography (eluant: ethyl acetate:petroleum ether=1:3) to give
tert-butyl 3-(4-cyclopropylpicolinamido)azetidine-1-carboxylate as
a white solid (2.6 g, 50.5%). ESI-LCMS (m/z): 318 [M+H].sup.+.
Step 3: Synthesis of
N-(azetidin-3-yl)-4-cyclopropylpicolinamide
##STR01311##
[0533] tert-Buty
3-(4-cyclopropylpicolinamido)azetidine-1-carboxylate (1.1 g, 3.46
mmol) in 3N HCl in MeOH (50 ml) was stirred at room temperature for
16 h. LCMS showed the reaction was completed, the solvent was
removed under reduced pressure, then NH.sub.3 in MeOH (7N, 10 ml)
was added and concentrated. The crude product was purified by flash
column chromatography (40 g silica gel column, eluted with DCM:NH;
in MeOH (7N)=10:1) to give the desired product
N-(azetidin-3-yl)-4-cyclopropylpicolinamide (537 mg, 71.5%) as a
white solid.
Step 4: Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opylpicolinamide
##STR01312##
[0535] A mixture of N-(azetidin-3-yl)-4-cyclopropylpicolinamide (50
mg, 0.2301 mmol), 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde
(50.7 mg, 0.2301 mmol) and HOAc (34.5 mg, 0.6903 mmol) in MeOH (10
ml) was stirred at r.t. for 16 h. LCMS showed the reaction was
completed, the solvent was removed under reduced pressure, NH.sub.3
in MeOH (7N, 10 ml) was added and concentrated, the crude product,
which was purified by Prep-TLC (eluant: DCM:NH.sub.3 in MeOH
(7N)=20:1) to give the desired product
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opylpicolinamide (30 mg, 30.9%) as a colorless oil. ESI-LCMS (m/z):
422[M+H].sup.+; .sup.1HNMR (400 MHz, CD.sub.3OD) .delta. ppm: 8.44
(d, J=5.2 Hz, 1H), 7.76 (s, 1H), 7.68 (s, 1H), 7.51 (s, 1H),
7.35-7.32 (m, 2H), 7.28-7.26 (m, 1H), 7.20 (d, J=8.4 Hz, 2H), 5.32
(s, 2H), 4.67-4.63 (m, 1H), 3.73-3.69 (m, 2H), 3.62 (s, 2H),
3.26-3.22 (m, 2H), 2.05-2.01 (m, 1H), 1.20-1.15 (m, 2H), 0.91-0.87
(m, 2H).
Example 31
Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opyl-1H-imidazole-2-carboxamide (Cpd. No. 927)
##STR01313##
[0536] Step 1: Synthesis of
4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole
##STR01314##
[0538] To a solution of 5-cyclopropyl-1H-imidazole (5.16 g, 47.7
mmol) in anhydrous THF (50 mL) was added NaH (2.85 g, 71.5 mmol)
portion-wise at 0.degree. C. under nitrogen atmosphere and the
mixture was stirred 0.degree. C. for 0.5 h. To the reaction mixture
was added SEM-Cl (11.9 g, 71.5 mmol) dropwise at 0.degree. C. under
nitrogen atmosphere and the mixture was stirred at 0.degree. C. for
2 h. The mixture was concentrated in vacuo and the residue was
purified with column chromatograph on silica gel (petroleum
ether:ethyl acetate=2:1) to afford
4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole
(2.10 g, 18.4%) as a yellow liquid. ESI-LCMS (m/z):
239[M+H].sup.+.
Step 2: Synthesis of
4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxy-
lic Acid
##STR01315##
[0540] Into the stirred solution of
4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole
(400 mg, 1.7 mmol) in THF (20 mL) was added BuLi (0.7 mL, 2.5 M) at
-70.degree. C., the mixture was stirred at -70.degree. C. for 1 h,
then solid CO.sub.2 was added at -70.degree. C., stirred for the
next 1 h, acidified with HC (1 M). Concentrated in vacuum to
obtained desired product (350 mg, yellow oil, Y: 74%). ESI-LCMS
(m/z): 283[M+H].sup.+.
Step 3: Synthesis of tert-butyl
3-(4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carb-
oxamido)azetidine-1-carboxylate
##STR01316##
[0542] Into the stirred solution of
4-cyclopropyl-1-(2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxyl-
ic acid (350 mg, 1.23 mmol), tert-butyl
3-aminoazetidine-1-carboxylate (316 mmol, 1.84 mmol) and HATU (700
mg, 1.84 mmol) in DMF (10 mL) was added DIPEA (478 mg, 3.7 mmol).
The mixture was stirred at r.t. for 2 h. Concentrated in vacuum to
remove the solvent, the residue was purified by Pre-TLC (petroleum
ether:ethyl acetate 1:1) to afford tert-butyl
3-(4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carb-
oxamido)azetidine-1-carboxylate as a colorless oil (200 mg, 37%).
ESI-LCMS (m/z): 437[M+H].sup.+.
Step 4: Synthesis of
N-(azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide
##STR01317##
[0544] Into the stirred solution of tert-butyl
3-(4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carb-
oxamido)azetidine-1-carboxylate (200 mg 0.5 mmol) in DCM (10 mL)
was added TFA (444 mg, 4.6 mmol). The mixture was stirred at r.t.
for 2 h. Concentrated in vacuum to remove the solvent to obtained
the residue, basified with saturated NaHCO.sub.3, extracted with
EtOAc (30 mL.times.3), combined the organic layer, dried over
Na.sub.2SO.sub.4, concentrated in vacuum to obtained the crude
N-(azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide, which
was used without further purification (80 mg, brown oil, Y: 84%).
ESI-LCMS (m/z): 207[M+H].sup.+.
Step 5: Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opyl-1H-imidazole-2-carboxamide
##STR01318##
[0546] Into the stirred solution of
N-(azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide (400 mg,
1.9 mmol) and 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (425
mg, 1.9 mmol) in MeOH (20 mL) was added NaBH.sub.3CN (600 mg, 9.6
mmol). The mixture was stirred at 60.degree. C. for 20 h. The
product was purified by reversed phase prep-HPLC (TFA,
CH.sub.3CN:H2O=5%-95%) to afford
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopr-
opyl-1H-imidazole-2-carboxamide (49 mg, 6%). ESI-LCMS (m/z):
411[M+H].sup.+; .sup.1HNMR (400 MHz, CD.sub.3OD) .delta. ppm: 7.92
(s, 1H), 7.67 (s, 1H), 7.36-7.34 (m, 2H), 7.24 (d, J=8.8 Hz, 2H),
6.91 (brs, 1H), 5.36 (s, 2H), 4.77-4.74 (m, 1H), 4.31-4.26 (m, 4H),
4.16-4.11 (m, 2H), 1.91-1.87 (m, 1H), 0.93-0.90 (m, 2H), 0.75-0.72
(m, 2H).
Example 32
Synthesis of
1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin--
3-yl)-1H-1,2,3-triazole-4-carboxamide (Cpd. No. 932)
##STR01319##
[0547] Step 1: Synthesis of
1-(4-methoxybenzyl)-1H-pyrazole-4-carbaldehyde
##STR01320##
[0549] To a mixture of 1H-pyrazole-4-carbaldehyde (100 mg, 1.04
mmol) and 1-(chloromethyl)-4-methoxybenzene (162 mg, 1.04 mmol) in
CH.sub.3CN (6 mL) was added potassium carbonate (287 mg, 2.08
mmol), the resulting mixture was stirred at reflux for 1 h. The
mixture was poured into water (20 mL) and extracted with EtOAc
(3.times.20 mL). The organic layer was dried over Na.sub.2SO.sub.4
and concentrated to give
1-(4-methoxybenzyl)-1H-pyrazole-4-carbaldehyde (220 mg, 93.3%) as a
colorless oil. ESI-LCMS (m/z): 217[M+H].sup.+.
Step 2: Synthesis of
1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin--
3-yl)-1H-1,2,3-triazole-4-carboxamide
##STR01321##
[0551] To a mixture of
N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (50
mg, 0.2412 mmol) and 1-(4-methoxybenzyl)-1H-pyrazole-4-carbaldehyde
(62.5 mg, 02894 mmol) in methanol (5 mL) was added acetic acid (724
.mu.g, 0.01206 mmol), the mixture was stirred at r.t. for 15 min,
then sodium cyanoborohydride (30.3 mg, 0.4824 mmol) was added, the
resulting mixture was stirred at 40.degree. C. overnight. The
mixture was concentrated under reduced pressure. The residue was
dissolved in aqueous solution of Na.sub.2CO.sub.3 and extracted
with EtOAc (3.times.20 mL). The organic layer was dried over
Na.sub.2SO.sub.4 and concentrated. The residue was purified by
prep-TLC (CH.sub.2Cl.sub.2/NH.sub.3.MeOH=20/1) to give
1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin--
3-yl)-1H-1,2,3-triazole-4-carboxamide (53 mg, 53.9%) as a white
solid. ESI-LCMS (m/z): 408[M+H].sup.+; .sup.1HNMR (400 MHz,
CD.sub.3OD) .delta. ppm: 8.39 (s, 1H), 7.62 (s, 1H), 7.48 (s, 1H),
7.19 (d, J=8.4 Hz, 2H), 6.90 d, J=8.4 Hz, 2H), 5.24 (s, 2H),
4.64-4.62 (m, 1H), 3.99-3.98 (m, 1H), 3.79 (s, 3H), 3.73-3.69 (m,
2H), 3.63 (s, 2H), 3.27-3.23 (m, 2H), 1.28-1.22 (m, 4H).
Example 33
SMYD3 Biochemical Assay
General Materials
[0552] S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH),
Tris, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin (BSG),
and Tris(2-carboxyethyl)phosphine hydrochloride solution (TCEP)
were purchased from Sigma-Aldrich at the highest level of purity
possible. .sup.3H-SAM was purchase from American Radiolabeled
Chemicals with a specific activity of 80 Ci/mmol. 384-well opaque
white OptiPlates and SPA beads (Perkin Elmer, catalog #RPNQ0013)
were purchased from PerkinElmer.
Substrates
[0553] N-terminally GST-taggcd MEKK2 (MAP3K2) protein corresponding
to reference sequence AAF63496.3 was purchased from Life
Technologies (catalog #PV4010). This protein was expressed in High
Five insect cells and purified to >85% purity. Protein identity
was confirmed by MS/MS analysis after proteolytic digestion. The
protein sequence used was:
TABLE-US-00013 (SEQ ID No. 1)
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGTMDDQQALNSIMQDL
AVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVK
LEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKALELLDRSIHMKS
LKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSS
PPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQMLDPLSLSSPENSGS
GSCPSLDSPLDGESYPKSRMPRAQSYPDNHQEFSDYDNPIFEKFGKGGTY
PRRYHVSYHHQEYNDGRKTFPRARRTQGNQLTSPVSFSPTDHSLSTSSGS
SIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGKLLGQ
GAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL
HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYT
RQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLS
GTGMKSVTGTPYWMSPEVISGQGYGRKADIWSVACTVVEMLTEKPPWAEF
EAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLRHM FVHYH.
Molecular Biology
[0554] Full-length human SMYD3 isoform 1 (BAB86333) was inserted
into a modified pET21b plasmid containing a His6 tag and TEV and
SUMO cleavage sites. Because two common variants of SMYD3 exist in
the population, site directed mutagenesis was subsequently
performed to change amino acid 13 from an asparagine to a lysine,
resulting in plasmid pEPZ533. A lysine at position 13 conforms to
the more commonly occurring sequence (NP_001161212).
Protein Expression
[0555] E. coli (BL21 codonplus RIL strain, Stratagene) were
transformed with plasmid pEPZ553 by mixing competent cells and
plasmid DNA and incubating on ice for 30 minutes followed by heat
shock at 42.degree. C. for 1 minute and cooling on ice for 2
minutes. Transformed cells were grown and selected on LB agar with
100 .mu.g/mL ampicillin and 17 .mu.g/mL chloramphenicol at
37.degree. C. overnight. A single clone was used to inoculate 200
mL of LB medium with 100 .mu.g/mL ampicillin and 17 .mu.g/mL
chloramphenicol and incubated at 37.degree. C. on an orbital shaker
at 180 rpm. Once in log growth, the culture was diluted 1:100 into
2 L of LB medium and grown until OD.sub.600 was about 0.3 after
which the culture was incubated at 15.degree. C. and 160 rpm. Once
OD reached about 0.4, IPTG was added to a final concentration of
0.1 mM and the cells were grown overnight at 15.degree. C. and 160
rpm. Cells were harvested by centrifugation at 8000 rpm, for 4
minutes at 4.degree. C. and stored at -80.degree. C. for
purification.
Protein Purification
[0556] Expressed full-length human His-tagged SMYD3 protein was
purified from cell paste by Nickel affinity chromatography after
equilibration of the resin with Buffer A (25 mM Tris, 200 mM NaCl,
5% glycerol, 5 mM .beta.-mercaptoethanol, pH7.8). The column was
washed with Buffer B (Buffer A plus 20 mM imidazole) and His-tagged
SMYD3 was eluted with Buffer C (Buffer A plus 300 mM imidazole).
The His tag, TEV and SUMO cleavage sites were removed generating
native SMYD3 by addition of ULP1 protein at a ratio of 1:200
(ULP:SMYD3). Imidazole was removed by dialysis overnight in Buffer
A. The dialyzed solution was applied to a second Nickel column and
the native SMYD3 protein was collected from the column
flow-through. The flow-through was dialyzed in Buffer D (25 mM
Tris, 5% glycerol, 5 mM .beta.-mercaptoethanol, 50 mM NaCl, pH7.8)
and ULP1 was removed using a Q sepharose fast flow column. SMYD3
was eluted in Buffer A and further purified using an S200
size-exclusion column equilibrated with Buffer A. SMYD3 was
concentrated to 2 mg/mL with a final purity of 89%.
Predicted Translation:
TABLE-US-00014 [0557] SMYD3(Q9H7B4) (SEQ ID No. 2)
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCD
RCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPD
SVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
FQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPS
ISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERR
KQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHW
KWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIM
RVTHGREHSLIEDLILLLEECDANIRAS.
General Procedure for SMYD3 Enzyme Assays on MEKK2 Protein
Substrate
[0558] The assays were all performed in a buffer consisting of 25
mM Tris-Cl pH 8.0, 1 mM TCEP, 0.005% BSG, and 0.005% Tween 20,
prepared on the day of use. Compounds in 100% DMSO (1 ul) were
spotted into a 384-well white opaque OptiPlate using a Bravo
automated liquid handling platform outfitted with a 384-channel
head (Agilent Technologies). DMSO (1 ul) was added to Columns 11,
12, 23, 24, rows A-H for the maximum signal control and 1 ul of
SAH, a known product and inhibitor of SMYD3, was added to columns
11, 12, 23, 24, rows I-P for the minimum signal control. A cocktail
(40 ul) containing the SMYD3 enzyme was added by Multidrop Combi
(Thermo-Fisher). The compounds were allowed to incubate with SMYD3
for 30 min at room temperature, then a cocktail (10 ul) containing
SAM and MEKK2 was added to initiate the reaction (final volume=51
ul). The final concentrations of the components were as follows:
SMYD3 was 0.4 nM, .sup.3H-SAM was 8 nM, MEKK2 was 12 nM, SAH in the
minimum signal control wells was 1 mM, and the DMSO concentration
was 2%. The assays were stopped by the addition of non-radiolabeled
SAM (10 ul) to a final concentration of 100 uM, which dilutes the
.sup.3H-SAM to a level where its incorporation into MEKK2 is no
longer detectable. Radiolabeled MEKK2 was detected using a
scintillation proximity assay (SPA). 10 uL of a 10 mg/mL solution
of SPA beads in 0.5 M citric acid was added and the plates
centrifuged at 600 rpm for 1 min to precipitate the radiolabeled
MEKK2 onto the SPA beads. The plates were then read in a
PerkinElmer TopCount plate reader to measure the quantity of
.sup.3H-labeled MEKK2 as disintegrations per minute (dpm) or
alternatively, referred to as counts per minute (cpm).
% Inhibition Calculation
[0559] % inh = 100 - ( dpm cmpd - dpm min dpm max - dpm min )
.times. 100 ##EQU00001##
[0560] Where dpm=disintegrations per minute, cmpd=signal in assay
well, and min and max are the respective minimum and maximum signal
controls.
Four-Parameter IC50 Fit
[0561] Y = Bottom + ( Top - Bottom ) ( 1 + ( X IC 50 ) Hill
Coefficient ##EQU00002##
[0562] Where top and bottom are the normally allowed to float, but
may be fixed at 100 or 0 respectively in a 3-parameter fit. The
Hill Coefficient normally allowed to float but may also be fixed at
1 in a 3-parameter fit. Y is the % inhibition and X is the compound
concentration.
[0563] SMYD3 biochemical assay data for representative Compounds of
the Disclosure are presented in Tables 1A and 3A in the column
titled "SMYD3 Biochem IC.sub.50 (.mu.M)."
Example 34
SMYD3 Cell Assay
Trimethyl-MEKK2-in-Cell Western Assay
[0564] 293T17 adherent cells were purchased from ATCC (American
Type Culture Collection). Manassas, Va. USA. MEM/Glutamax medium,
Optimem Reduced Serum medium, penicillin-streptomycin, 0.05%
trypsin and 1.times.D-PBS were purchased from Life Technologies,
Grand Island, N.Y., USA. PBS-10.times. was purchased from Ambion,
Life Technologies, Grand Island, N.Y., USA. PBS with Tween 20 (PBST
(10.times.)) was purchased from KPL, Gaithersburg, Md., USA. Tet
System FBS-approved FBS US Source was purchased from Clontech,
Mountain View, Calif., USA. Odyssey blocking buffer, 800CW goat
anti-rabbit IgG (H+L) antibody, 680CW Goat anti-mouse IgG (H+L) and
Licor Odyssey infrared scanner were purchased from Licor
Biosciences, Lincoln, Nebr., USA. Tri-methyl-Lysine [A260]-MEKK2
antibody, MEKK2 and SMYD3 plasmids were made at Epizyme. Anti-flag
monoclonal mouse antibody was purchased from Sigma, St. Louis, Mo.,
USA. Methanol was purchased from VWR, Franklin, Mass., USA. 10%
Tween 20 was purchased from KPL, Inc., Gaithersburg, Md., USA.
Fugene was purchased from Promega, Madison, Wis., USA. The Biotek
ELx405 was purchased from BioTek, Winooski, Vt., USA. The multidrop
combi was purchased from Thermo Scientific, Waltham, Mass.,
USA.
[0565] 293T/17 adherent cells were maintained in growth medium
(MEM/Glutamax medium supplemented with 10% v/v Tet System FBS and
cultured at 37.degree. C. under 5% CO.sub.2.
Cell Treatment, in Cell Western (ICW) for Detection of
Trimethyl-Lysine-MEKK2 and MEKK2.
[0566] 293T/17 cells were seeded in assay medium at a concentration
of 33,333 cells per cm.sup.2 in 30 mL medium per T150 flask and
incubated at 37.degree. C. under 5% CO.sub.2. Plasmids were
prepared for delivery to cells by first mixing 1350 .mu.L Opti-MEM
with Fugene (81 .mu.L) in a sterile Eppendorf and incubated for
five minutes at room temperature (RT). MEKK2-flag (13.6 ug/Ti150)
MEKK2 p3XFlag-CMV-14 with C-3XFlag and SMYD3 (0.151 ug150) SMYD3
p3XFlag-CMV-14 without C-3XFlag plasmids were aliquotted to a 1.7
mL sterile microfuge tube. The gene ID for MEKK2 and SMYD3 is
NM_006609.3 and Q9H7B4, respectively. Entire volume of
Opti-MEM/Fugene mixture was then added to a microfuge tube
containing DNA plasmid, mixed and then incubated .times.15 minutes
at RT. The medium on the 293T/17 cells was refreshed, and the
DNA/Fugene complex is added aseptically to each flask, rocked
gently, and incubated at 37 C for 5 hours. Medium was then removed,
and cells were washed once with PBS in the flask. Trypsin 0.05% (3
mL) was added and cells incubated for three minutes. Room
temperature MEM+10% Tet system FBS was added and cells were mixed
gently, and counted using the Vi-cell. Cells were seeded at 100,000
cells/mL in 50 .mu.L MEM/10% Tet FBS/Pen/Strep to a 384 well
black/clear poly-D-lysine coated plate containing test agent
diluted in DMSO. The final top concentration of test compound was
40 .mu.M. The total concentration of DMSO did not exceed 0.2%
(v/v). Plates were incubated .times.30 minutes at RT in low-airflow
area, followed by incubation at 37.degree. C. under 5% CO.sub.2 for
24 hours. Medium was aspirated from all wells of assay plates prior
to fixation and permeabilization with ice cold (-20.degree. C.)
methanol (90 .mu.L/well) for ten minutes. Plates were rinsed with
PBS three times on BioTek ELx405. PBS was removed with a final
aspiration, and Odyssey blocking buffer (50 .mu.L/well) was added
to each well and incubated for one hour at RT. Primary antibody
solution was prepared (anti-trimethyl-MEKK2 at 1:600 dilution plus
mouse anti-flag antibody at 1:10,000 dilution in diluent (Odyssey
Blocking buffer+0.1% Tween 20)) and 20 .mu.L per well was dispensed
using the Multidrop Combi. Assay plates were then sealed with foil,
and incubated overnight at 4.degree. C. Plates were washed five
times with PBS-Tween (1.times.) on Biotek ELx405 and blotted on
paper towel to remove excess reagent. Detection antibody solution
(IRDye 800 CW goat anti-rabbit IgG diluted 1:400 in diluent
(Odyssey Blocking buffer+0.1% Tween 20), plus IRDye 680CW goat
anti-mouse IgG at 1:500 in diluent (Odyssey Blocking buffer+0.1%
Tween 20) was added (20 .mu.L/well) and incubated in dark for one
hour at RT. Plates were then washed four times with PBS-T
(1.times.) on ELx405. A final rinse with water was performed (115
.mu.L/well.times.three washes on the ELx405). Plates were then
centrifuged upside down, on paper towel, at 200.times.g to remove
excess reagent. Plates were left to dry in dark for one hour. The
Odyssey Imager was used to measure the integrated intensity of 700
and 800 wavelengths at resolution of 84 .mu.m, medium quality,
focus offset 4.0, 700 channel intensity=3.5 to measure the
MEKK2-flag signal, 800 channel intensity=5 to measure the
Trimethyl-MEKK2 signal of each well.
Calculations:
[0567] First, the ratio for each well was determined b
( Trimethyl MEKK 2 800 nm value flag tagged MEKK 2 700 nm value )
##EQU00003##
[0568] Each plate included fourteen control wells of DMSO only
treatment (Minimum Inhibition) as well as fourteen control wells
for maximum inhibition (Background). The average of the ratio
values for each control type was calculated and used to determine
the percent inhibition for each test well in the plate. Reference
compound was serially diluted two-fold in DMSO for a total of nine
test concentrations, beginning at 40 .mu.M. Percent inhibition was
calculated (below).
Percent Inhibition = 100 - ( ( ( Individual Test Sample Ratio ) - (
Background Avg Ratio ) ( Minimum Inhibition Ratio ) - ( Background
Average Ratio ) ) * 100 ) ##EQU00004##
[0569] Non-linear regression curves were generated to calculate the
IC.sub.50 and dose-response relationship using triplicate wells per
concentration of compound.
[0570] SMYD3 cell assay data for representative Compounds of the
Disclosure are presented in Tables 1A and 3A in the column titled
"SMYD3 Cell IC.sub.50 (.mu.M)."
Example 35
SMYD2 Biochemical Assay
General Materials
[0571] S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH),
bicine, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin
(BSG), and Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) were
purchased from Sigma-Aldrich at the highest level of purity
possible. .sup.3H-SAM was purchase from American Radiolabeled
Chemicals with a specific activity of 80 Ci/mmol. 384-well
streptavidin Flashplates were purchased from PerkinElmer.
Substrates
[0572] Peptide was synthesized with a N-terminal linker-affinity
tag motif and a C-terminal amide cap by 21.sup.st Century
Biochemicals. The peptide was high high-performance liquid
chromatography (HPLC) purified to greater than 95% purity and
confirmed by liquid chromatography mass spectrometry (LC-MS). The
sequence was
TABLE-US-00015 (SEQ ID NO: 3)
ARTKQTARKSTGGKAPRKQLATKAARKSA(K-Biot)-amide.
Production of Recombinant SMYD2 Enzymes for Biochemical Enzyme
Activity Assays
[0573] Full length SMYD2 (NP_064582.2) was cloned into a
pFastbac-Htb-lic vector with an N-terminal His6 tag and FLAG tag,
preceded by a TEV protease cleavage site. The protein was expressed
in Sf9 insect cells. Cells were resuspended in lysis buffer (25 mM
HEPES-NaOH, pH 7.5, 200 mM NaCl, 5% glycerol, and 5 mM .beta.-ME)
and lysed by sonication. The protein was purified by Ni-NTA
(Qiagen), followed by TEV cleavage to remove the His6 tag,
subtractive Ni-NTA (Qiagen), and gel filtration chromatography
using an S200 column (GE Healthcare). Purified protein was stored
in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl, and 1 mM TCEP.
General Procedure for SMYD2 Enzyme Assays on Peptide Substrates
[0574] The assays were all performed in a buffer consisting of 20
mM Bicine (pH=7.6), 1 mM TCEP, 0.005% Bovine Skin Gelatin, and
0.002% Tween20, prepared on the day of use. Compounds in 100% DMSO
(1 ul) were spotted into a polypropylene 384-well V-bottom plates
(Greiner) using a Platemate Plus outfitted with a 384-channel head
(Thermo Scientific). DMSO (1 ul) was added to Columns 11, 12, 23,
24, rows A-H for the maximum signal control and 1 ul of SAH, a
known product and inhibitor of SMYD2, was added to columns 11, 12,
23, 24, rows I-P for the minimum signal control. A cocktail (40 ul)
containing the SMYD2 enzyme was added by Multidrop Combi
(Thermo-Fisher). The compounds were allowed to incubate with SMYD2
for 30 min at room temperature, then a cocktail (10 ul) containing
.sup.3H-SAM and peptide was added to initiate the reaction (final
volume=51 ul). The final concentrations of the components were as
follows: SMYD2 was 1.5 nM, .sup.3H-SAM was 10 nM, and peptide was
60 nM, SAH in the minimum signal control wells was 1000 uM, and the
DMSO concentration was 2%. The assays were stopped by the addition
of non-radioactive SAM (10 ul) to a final concentration of 600 uM,
which dilutes the .sup.3H-SAM to a level where its incorporation
into the peptide substrate is no longer detectable. 50 ul of the
reaction in the 384-well polypropylene plate was then transferred
to a 384-well Flashplate and the biotinylated peptides were allowed
to bind to the streptavidin surface for at least 1 hour before
being washed three times with 0.1% Tween20 in a Biotek ELx405 plate
washer. The plates were then read in a PerkinElmer TopCount plate
reader to measure the quantity of .sup.3H-labeled peptide bound to
the Flashplate surface, measured as disintegrations per minute
(dpm) or alternatively, referred to as counts per minute (cpm).
% Inhibition Calculation
[0575] % inh = 100 - ( dpm cmpd - dpm min dpm max - dpm min )
.times. 100 ##EQU00005##
[0576] Where dpm=disintegrations per minute, cmpd=signal in assay
well, and min and max are the respective minimum and maximum signal
controls.
Four-Parameter IC50 Fit
[0577] % inhibition = Bottom + ( Top - Bottom ) ( 1 + ( IC 50 / [ I
] ) Hill coefficient ) ##EQU00006##
[0578] Where top and bottom are the normally allowed to float, but
may be fixed at 100 or 0 respectively in a 3-parameter fit. The
Hill Coefficient normally allowed to float but may also be fixed at
1 in a 3-parameter fit. I is the compound concentration.
[0579] SMYD2 biochemical assay data for representative Compounds of
the Disclosure are presented in Tables 4A and 6A in the column
titled "SMYD2 Biochem IC.sub.50 (.mu.M)."
[0580] Having now fully described this invention, it will be
understood by those of ordinary skill in the art that the same can
be performed within a wide and equivalent range of conditions,
formulations, and other parameters without affecting the scope of
the invention or any embodiment thereof.
[0581] Other embodiments of the invention will be apparent to those
skilled in the art from consideration of the specification and
practice of the invention disclosed herein. It is intended that the
specification and examples be considered as exemplary only, with a
true scope and spirit of the invention being indicated by the
following claims.
[0582] All patents and publications cited herein are fully
incorporated by reference herein in their entirety.
Sequence CWU 1
1
31855PRTArtificial Sequencesynthesized protein 1Met Ala Pro Ile Leu
Gly Tyr Trp Lys Ile Lys Gly Leu Val Gln Pro1 5 10 15Thr Arg Leu Leu
Leu Glu Tyr Leu Glu Glu Lys Tyr Glu Glu His Leu 20 25 30Tyr Glu Arg
Asp Glu Gly Asp Lys Trp Arg Asn Lys Lys Phe Glu Leu 35 40 45Gly Leu
Glu Phe Pro Asn Leu Pro Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60Leu
Thr Gln Ser Met Ala Ile Ile Arg Tyr Ile Ala Asp Lys His Asn65 70 75
80Met Leu Gly Gly Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu Glu
85 90 95Gly Ala Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile Ala Tyr
Ser 100 105 110Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu Ser Lys
Leu Pro Glu 115 120 125Met Leu Lys Met Phe Glu Asp Arg Leu Cys His
Lys Thr Tyr Leu Asn 130 135 140Gly Asp His Val Thr His Pro Asp Phe
Met Leu Tyr Asp Ala Leu Asp145 150 155 160Val Val Leu Tyr Met Asp
Pro Met Cys Leu Asp Ala Phe Pro Lys Leu 165 170 175Val Cys Phe Lys
Lys Arg Ile Glu Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190Leu Lys
Ser Ser Lys Tyr Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195 200
205Thr Phe Gly Gly Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro Arg
210 215 220His Asn Gln Thr Ser Leu Tyr Lys Lys Ala Gly Thr Met Asp
Asp Gln225 230 235 240Gln Ala Leu Asn Ser Ile Met Gln Asp Leu Ala
Val Leu His Lys Ala 245 250 255Ser Arg Pro Ala Leu Ser Leu Gln Glu
Thr Arg Lys Ala Lys Ser Ser 260 265 270Ser Pro Lys Lys Gln Asn Asp
Val Arg Val Lys Phe Glu His Arg Gly 275 280 285Glu Lys Arg Ile Leu
Gln Phe Pro Arg Pro Val Lys Leu Glu Asp Leu 290 295 300Arg Ser Lys
Ala Lys Ile Ala Phe Gly Gln Ser Met Asp Leu His Tyr305 310 315
320Thr Asn Asn Glu Leu Val Ile Pro Leu Thr Thr Gln Asp Asp Leu Asp
325 330 335Lys Ala Leu Glu Leu Leu Asp Arg Ser Ile His Met Lys Ser
Leu Lys 340 345 350Ile Leu Leu Val Ile Asn Gly Ser Thr Gln Ala Thr
Asn Leu Glu Pro 355 360 365Leu Pro Ser Leu Glu Asp Leu Asp Asn Thr
Val Phe Gly Ala Glu Arg 370 375 380Lys Lys Arg Leu Ser Ile Ile Gly
Pro Thr Ser Arg Asp Arg Ser Ser385 390 395 400Pro Pro Pro Gly Tyr
Ile Pro Asp Glu Leu His Gln Val Ala Arg Asn 405 410 415Gly Ser Phe
Thr Ser Ile Asn Ser Glu Gly Glu Phe Ile Pro Glu Ser 420 425 430Met
Glu Gln Met Leu Asp Pro Leu Ser Leu Ser Ser Pro Glu Asn Ser 435 440
445Gly Ser Gly Ser Cys Pro Ser Leu Asp Ser Pro Leu Asp Gly Glu Ser
450 455 460Tyr Pro Lys Ser Arg Met Pro Arg Ala Gln Ser Tyr Pro Asp
Asn His465 470 475 480Gln Glu Phe Ser Asp Tyr Asp Asn Pro Ile Phe
Glu Lys Phe Gly Lys 485 490 495Gly Gly Thr Tyr Pro Arg Arg Tyr His
Val Ser Tyr His His Gln Glu 500 505 510Tyr Asn Asp Gly Arg Lys Thr
Phe Pro Arg Ala Arg Arg Thr Gln Gly 515 520 525Asn Gln Leu Thr Ser
Pro Val Ser Phe Ser Pro Thr Asp His Ser Leu 530 535 540Ser Thr Ser
Ser Gly Ser Ser Ile Phe Thr Pro Glu Tyr Asp Asp Ser545 550 555
560Arg Ile Arg Arg Arg Gly Ser Asp Ile Asp Asn Pro Thr Leu Thr Val
565 570 575Met Asp Ile Ser Pro Pro Ser Arg Ser Pro Arg Ala Pro Thr
Asn Trp 580 585 590Arg Leu Gly Lys Leu Leu Gly Gln Gly Ala Phe Gly
Arg Val Tyr Leu 595 600 605Cys Tyr Asp Val Asp Thr Gly Arg Glu Leu
Ala Val Lys Gln Val Gln 610 615 620Phe Asp Pro Asp Ser Pro Glu Thr
Ser Lys Glu Val Asn Ala Leu Glu625 630 635 640Cys Glu Ile Gln Leu
Leu Lys Asn Leu Leu His Glu Arg Ile Val Gln 645 650 655Tyr Tyr Gly
Cys Leu Arg Asp Pro Gln Glu Lys Thr Leu Ser Ile Phe 660 665 670Met
Glu Tyr Met Pro Gly Gly Ser Ile Lys Asp Gln Leu Lys Ala Tyr 675 680
685Gly Ala Leu Thr Glu Asn Val Thr Arg Lys Tyr Thr Arg Gln Ile Leu
690 695 700Glu Gly Val His Tyr Leu His Ser Asn Met Ile Val His Arg
Asp Ile705 710 715 720Lys Gly Ala Asn Ile Leu Arg Asp Ser Thr Gly
Asn Val Lys Leu Gly 725 730 735Asp Phe Gly Ala Ser Lys Arg Leu Gln
Thr Ile Cys Leu Ser Gly Thr 740 745 750Gly Met Lys Ser Val Thr Gly
Thr Pro Tyr Trp Met Ser Pro Glu Val 755 760 765Ile Ser Gly Gln Gly
Tyr Gly Arg Lys Ala Asp Ile Trp Ser Val Ala 770 775 780Cys Thr Val
Val Glu Met Leu Thr Glu Lys Pro Pro Trp Ala Glu Phe785 790 795
800Glu Ala Met Ala Ala Ile Phe Lys Ile Ala Thr Gln Pro Thr Asn Pro
805 810 815Lys Leu Pro Pro His Val Ser Asp Tyr Thr Arg Asp Phe Leu
Lys Arg 820 825 830Ile Phe Val Glu Ala Lys Leu Arg Pro Ser Ala Asp
Glu Leu Leu Arg 835 840 845His Met Phe Val His Tyr His 850
8552428PRTArtificial Sequencesynthesized protein 2Met Glu Pro Leu
Lys Val Glu Lys Phe Ala Thr Ala Lys Arg Gly Asn1 5 10 15Gly Leu Arg
Ala Val Thr Pro Leu Arg Pro Gly Glu Leu Leu Phe Arg 20 25 30Ser Asp
Pro Leu Ala Tyr Thr Val Cys Lys Gly Ser Arg Gly Val Val 35 40 45Cys
Asp Arg Cys Leu Leu Gly Lys Glu Lys Leu Met Arg Cys Ser Gln 50 55
60Cys Arg Val Ala Lys Tyr Cys Ser Ala Lys Cys Gln Lys Lys Ala Trp65
70 75 80Pro Asp His Lys Arg Glu Cys Lys Cys Leu Lys Ser Cys Lys Pro
Arg 85 90 95Tyr Pro Pro Asp Ser Val Arg Leu Leu Gly Arg Val Val Phe
Lys Leu 100 105 110Met Asp Gly Ala Pro Ser Glu Ser Glu Lys Leu Tyr
Ser Phe Tyr Asp 115 120 125Leu Glu Ser Asn Ile Asn Lys Leu Thr Glu
Asp Lys Lys Glu Gly Leu 130 135 140Arg Gln Leu Val Met Thr Phe Gln
His Phe Met Arg Glu Glu Ile Gln145 150 155 160Asp Ala Ser Gln Leu
Pro Pro Ala Phe Asp Leu Phe Glu Ala Phe Ala 165 170 175Lys Val Ile
Cys Asn Ser Phe Thr Ile Cys Asn Ala Glu Met Gln Glu 180 185 190Val
Gly Val Gly Leu Tyr Pro Ser Ile Ser Leu Leu Asn His Ser Cys 195 200
205Asp Pro Asn Cys Ser Ile Val Phe Asn Gly Pro His Leu Leu Leu Arg
210 215 220Ala Val Arg Asp Ile Glu Val Gly Glu Glu Leu Thr Ile Cys
Tyr Leu225 230 235 240Asp Met Leu Met Thr Ser Glu Glu Arg Arg Lys
Gln Leu Arg Asp Gln 245 250 255Tyr Cys Phe Glu Cys Asp Cys Phe Arg
Cys Gln Thr Gln Asp Lys Asp 260 265 270Ala Asp Met Leu Thr Gly Asp
Glu Gln Val Trp Lys Glu Val Gln Glu 275 280 285Ser Leu Lys Lys Ile
Glu Glu Leu Lys Ala His Trp Lys Trp Glu Gln 290 295 300Val Leu Ala
Met Cys Gln Ala Ile Ile Ser Ser Asn Ser Glu Arg Leu305 310 315
320Pro Asp Ile Asn Ile Tyr Gln Leu Lys Val Leu Asp Cys Ala Met Asp
325 330 335Ala Cys Ile Asn Leu Gly Leu Leu Glu Glu Ala Leu Phe Tyr
Gly Thr 340 345 350Arg Thr Met Glu Pro Tyr Arg Ile Phe Phe Pro Gly
Ser His Pro Val 355 360 365Arg Gly Val Gln Val Met Lys Val Gly Lys
Leu Gln Leu His Gln Gly 370 375 380Met Phe Pro Gln Ala Met Lys Asn
Leu Arg Leu Ala Phe Asp Ile Met385 390 395 400Arg Val Thr His Gly
Arg Glu His Ser Leu Ile Glu Asp Leu Ile Leu 405 410 415Leu Leu Glu
Glu Cys Asp Ala Asn Ile Arg Ala Ser 420 425329PRTArtificial
Sequencesynthesized proteinMISC_FEATUREC-terminal amide cap 3Ala
Arg Thr Lys Gln Thr Ala Arg Lys Ser Thr Gly Gly Lys Ala Pro1 5 10
15Arg Lys Gln Leu Ala Thr Lys Ala Ala Arg Lys Ser Ala 20 25
* * * * *