U.S. patent application number 16/776371 was filed with the patent office on 2021-06-17 for light inhibitors for asthma, lung and airway inflammation, respiratory, interstitial, pulmonary and fibrotic disease treatment.
The applicant listed for this patent is LA JOLLA INSTITUTE FOR ALLERGY AND IMMUNOLOGY. Invention is credited to Michael Croft, Taylor Doherty, Shahram Salek-Ardakani.
Application Number | 20210179725 16/776371 |
Document ID | / |
Family ID | 1000005107584 |
Filed Date | 2021-06-17 |
United States Patent
Application |
20210179725 |
Kind Code |
A1 |
Croft; Michael ; et
al. |
June 17, 2021 |
LIGHT INHIBITORS FOR ASTHMA, LUNG AND AIRWAY INFLAMMATION,
RESPIRATORY, INTERSTITIAL, PULMONARY AND FIBROTIC DISEASE
TREATMENT
Abstract
Methods of treating inflammatory conditions, disease and
disorders are provided. Method include, for example, contacting or
administering a sufficient amount of a LIGHT inhibitor to a subject
to treat the inflammatory condition, disease or disorder.
Inventors: |
Croft; Michael; (San Diego,
CA) ; Doherty; Taylor; (San Diego, CA) ;
Salek-Ardakani; Shahram; (San Diego, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
LA JOLLA INSTITUTE FOR ALLERGY AND IMMUNOLOGY |
La Jolla |
CA |
US |
|
|
Family ID: |
1000005107584 |
Appl. No.: |
16/776371 |
Filed: |
January 29, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15294577 |
Oct 14, 2016 |
|
|
|
16776371 |
|
|
|
|
15051252 |
Feb 23, 2016 |
|
|
|
15294577 |
|
|
|
|
13010670 |
Jan 20, 2011 |
9301994 |
|
|
15051252 |
|
|
|
|
12233428 |
Sep 18, 2008 |
|
|
|
13010670 |
|
|
|
|
60973383 |
Sep 18, 2007 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 45/06 20130101;
C07K 2317/24 20130101; A61K 38/191 20130101; A61K 39/3955 20130101;
C07K 2319/70 20130101; C07K 2317/76 20130101; C07K 2317/21
20130101; C07K 16/2875 20130101; A61K 9/007 20130101; A61K 31/00
20130101; A61K 2039/505 20130101; A61K 49/0004 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 31/00 20060101 A61K031/00; A61K 38/19 20060101
A61K038/19; A61K 9/00 20060101 A61K009/00; A61K 39/395 20060101
A61K039/395; A61K 45/06 20060101 A61K045/06; A61K 49/00 20060101
A61K049/00 |
Goverment Interests
GOVERNMENT SUPPORT
[0002] The work was supported in part by Grant A1070535 from the
National Institute of Health RO1. The government has certain rights
in the invention.
Claims
1.-5. (canceled)
6. A method for treating a fibrotic disease or disorder, comprising
administering a sufficient amount of an inhibitor of LIGHT (p30
polypeptide) to a subject to treat the fibrotic disease or
disorder, wherein the fibrotic disease or disorder is atopic
dermatitis and the inhibitor of LIGHT (p30 polypeptide) comprises
a) an LT.beta.R (lymphotoxin beta receptor) polypeptide
subsequence, b) a soluble LT.beta.R, c) a dominant-negative variant
of LT.beta.R, or d) a chimeric polypeptide comprising an LT.beta.R
polypeptide, an LT.beta.R polypeptide subsequence, a soluble
LT.beta.R or a dominant-negative variant.
7-12. (canceled)
13. The method of claim 6, wherein treatment reduces, decreases,
inhibits, delays, eliminates or prevents the probability, severity,
frequency, or duration of one or more symptoms associated with or
caused by the fibrotic disease or disorder.
14. The method of claim 6, wherein one or more symptoms of the
fibrotic disease or disorder, is reduced, inhibited, abrogated,
eliminated or reversed.
15-18. (canceled)
19. The method of claim 6, wherein the method reduces or inhibits
progression, severity, frequency, duration or probability of a
symptom of the fibrotic disease or disorder.
20. The method of claim 6, wherein the fibrotic disease or
disorder, is caused by an allergen or by exercise.
21. The method of claim 6, wherein the fibrotic disease or
disorder, is chronic or acute.
22-27. (canceled
28. The method of claim 6, wherein the inhibitor of LIGHT (p30
polypeptide) comprises an antibody or subsequence thereof that
binds to LIGHT (p30 polypeptide), an antibody or subsequence
thereof that binds to HVEM (herpesvirus entry mediator), or an
antibody or subsequence thereof that binds to LT.beta.R
(lymphotoxin beta receptor).
29. The method of claim 28, wherein the antibody is human or
humanized.
30-33. (canceled
34. The method of claim 6, wherein the method reduces or decreases
undesirable or abnormal eosinophil migration, chemotaxis or
generation.
35. The method of claim 6, further comprising contacting or
administering a second drug to the subject prior to, with or
following administering the inhibitor of LIGHT (p30
polypeptide).
36. The method of claim 35, wherein the second drug comprises a
hormone, steroid, anti-inflammatory or anti-allergy drug.
37. (canceled)
38. The method of claim 35, wherein the second drug comprises an
anti-histamine, anti-leukotriene, anti-IgE, anti-.alpha.4 integrin,
anti-.beta.2 integrin, anti-CCR3 antagonist, .beta.2 agonist or
anti-selectin.
39-40. (canceled)
41. The method of claim 6, wherein the subject is administered the
inhibitor of LIGHT (p30 polypeptide) one, two, three, four or more
times daily, weekly, monthly, bi-monthly, or annually.
42. The method of claim 6, wherein the amount of inhibitor of LIGHT
(p30 polypeptide) administered is about 0.00001 mg/kg, to about
10,000 mg/kg, about 0.0001 mg/kg, to about 1000 mg/kg, about 0.001
mg/kg, to about 100 mg/kg, about 0.01 mg/kg, to about 10 mg/kg,
about 0.1 mg/kg, to about 1 mg/kg body weight.
43. The method of claim 6, wherein the amount of the inhibitor of
LIGHT (p30 polypeptide) administered to the subject is less than
about 0.00001 mg/kg body weight.
44-48. (canceled)
Description
RELATED APPLICATIONS
[0001] This application is a continuation application of
application Ser. No. 15/051,252, filed Feb. 23, 2016, which is a
continuation of application Ser. No. 13/010,670, filed Jan. 20,
2011, now U.S. Pat. No. 9,301,994, which is a divisional of
application Ser. No. 12/233,428, filed Sep. 18, 2008, which claims
the benefit of priority to provisional application No. 60/973,383,
filed Sep. 18, 2007, all of which applications are expressly
incorporated herein by reference in their entirety
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Feb. 23, 2016, is named LIAI0445373.txt and is 8,931 bytes in
size.
INTRODUCTION
[0004] Allergic asthma afflicts 10 million people in the US and is
responsible for approximately five thousand deaths annually. The
prevalence of asthma has significantly increased over the past few
decades along with other allergic diseases, which are characterized
by helper T cell 2 (Th2) responses. Current therapy primarily
includes corticosteroids, bronchodilators, and leukotriene
antagonists. A subset of those with more severe disease have a
progressive decline in lung function attributed to airway
remodeling which includes bronchial epithelial mucus metaplasia,
airway smooth muscle hypertrophy/hyperplasia, subepithelial
fibrosis, and increased angiogenesis. Current asthma treatment has
little impact, if any, on airway remodeling.
[0005] Inflammatory cells including T cells, eosinophils,
macrophages, and mast cells, as well as structural cells including
epithelial, smooth muscle, and fibroblasts have roles in the
establishment and maintenance of remodeling. Growth factors and
cytokines that regulate remodeling include TGF-.beta., VEGF, IL-5,
IL-9, IL-13, and eotaxin. An understanding of novel mechanisms may
lead to much needed therapies that target airway remodeling and Th2
driven lung inflammation.
[0006] LIGHT (TNFSF14, p30 polypeptide) is a protein expressed on
activated CD4/CD8 T cells, dendritic cells (DCs), monocytes, and
natural killer cells (NK). The binding of LIGHT to herpes virus
entry mediator (HVEM), which is expressed on resting T cells, DCs,
and monocytes, or the lymphotoxin beta receptor (LT.beta.R), which
is expressed on DCs and stromal cells, promotes T cell activation,
proliferation, and cytokine production. Studies have determined
that LIGHT deficient animals have no significant abnormalities in
the development of lymphoid organs and lymphocytes.
SUMMARY
[0007] The invention is based at least in part on the finding that
LIGHT (P30 polypeptide), a TNF superfamily protein expressed on
activated T cells, and other immune cells such as dendritic cells,
controls the development of airway remodeling and TH2 driven lung
responses. Inhibiting or blocking LIGHT from interacting with its
receptors, HVEM or L.beta.R, can be used as an anti-inflammatory,
for example, to inhibit or suppress asthmatic inflammation, as well
as treat airway remodeling, among other inflammatory conditions,
diseases and disorders. In addition, inhibiting or blocking LIGHT
from interacting with its receptors, HVEM or LT.beta.R, is
applicable towards a wide range of chronic and acute
fibroproliferative diseases of the lung and airways, including
pulmonary fibrosis and COPD (chronic obstructive pulmonary
disease), and other tissue and organ systems.
[0008] In accordance with the invention, there are provided,
methods of reducing or inhibiting lung or airway inflammation
(chronic or acute). In one embodiment, a method includes contacting
or administering a sufficient amount of an inhibitor of LIGHT (p30
polypeptide) to a subject in need thereof to reduce or inhibit lung
or airway inflammation in the subject.
[0009] In accordance with the invention, there are also provided,
methods of treating asthma. In one embodiment, a method includes
contacting or administering a sufficient amount of an inhibitor of
LIGHT (p30 polypeptide) to a subject in need thereof to treat
asthma.
[0010] In accordance with the invention, there are further
provided, methods for treating a respiratory, interstitial,
pulmonary disease or disorder, and fibrotic diseases and disorders
(chronic or acute). In one embodiment, a method includes contacting
or administering a sufficient amount of an inhibitor of LIGHT (p30
polypeptide) to a subject to treat the respiratory, interstitial,
or pulmonary disease or disorder, or the fibrotic disease or
disorder.
[0011] LIGHT inhibitors include, for example, molecules that bind
to LIGHT and inhibit LIGHT binding or interaction with HVEM. LIGHT
inhibitors also include molecules that bind to LIGHT and inhibit
LIGHT binding or interaction with LT.beta.R. LIGHT inhibitors
further include molecules that bind to HVEM and inhibit LIGHT
binding or interaction with HVEM. LIGHT inhibitors additionally
include molecules that bind to LT.beta.R and inhibit LIGHT binding
or interaction with LT.beta.R. LIGHT inhibitors moreover include
prodrugs of the foregoing.
[0012] Invention methods include contact or administration, in
vitro, ex vivo or in vivo (e.g., to a subject in need of
treatment). In various embodiments, lung or airway inflammation,
asthma, or a symptom caused by or associated with respiratory,
interstitial, or pulmonary disease or disorder, or the fibrotic
disease or disorder is reduced, decreased, inhibited, delayed,
halted, or prevented in the subject, locally, or regionally in an
area (region), tissue or organ of the subject. In particular
aspects, a symptom is reduced, decreased, inhibited, delayed,
halted, or prevented in a respiratory, interstitial or pulmonary
tissue or organ. In another aspect, a method reduces, decreases,
inhibits, delays, halts, or prevents inflammation or constriction
of lung, airways or respiratory mucosum. In yet another embodiment,
contacting or administration in vivo is in a subject that has
previously experienced an asthmatic episode or airway- or
broncho-constriction or is in need of airway- or
broncho-dilation.
[0013] In accordance with the invention, there are also provided,
methods of inhibiting, reducing or decreasing progression,
severity, frequency, duration or probability of one or more
symptoms caused by or associated with lung or airway inflammation
or asthma. In one embodiment, a method includes administering to a
subject an amount of a LIGHT inhibitor sufficient to inhibit,
reduce or decrease progression, severity, frequency, duration or
probability of a symptom associated with lung or airway
inflammation or asthma. In various aspects, asthma is caused by an
allergen or by exercise.
[0014] Symptoms include, for example, lung, airway or respiratory
mucosum inflammation or tissue damage or remodeling, shortness of
breath (dyspnea), rapid breathing (tachypnea), wheezing, stridor,
coughing, decreased or reduced lung capacity, chest-tightness,
chest pain, prolonged expiration, increased heart rate
(tachycardia), runny nose, airway-constriction, decreased lung
capacity, or an acute asthmatic episode, or infiltration of a lung
or pulmonary or lymphatic tissue (draining lymph nodes), lymph
nodes or airway with immune cells, such as leukocytes and
eosinophils, hyperplasia of mucus secreting epithelium,
inflammatory lesion of lung, goblet cell hyperplasia, or increased
Th2 cytokine production (e.g., an interleukin such as IL-4, IL-5,
IL-9, IL-13, IL-16, IL-17 or IL-25).
[0015] Respiratory diseases can affect the upper or lower
respiratory tract. Non-limiting examples include asthma, allergic
asthma, bronchiolitis and pleuritis. Additional non-limiting
examples include allergic disorders, such as Extrinsic bronchial
asthma; Allergic rhinitis; Onchocercal dermatitis; Atopic
dermatitis, Drug reactions; Nodules, eosinophilia, rheumatism,
dermatitis, and swelling (NERDS); Eosophageal and gastrointestinal
allergies. Further non-limiting examples include Airway
Obstruction, Apnea, Asbestosis, Atelectasis, Berylliosis,
Bronchiectasis, Bronchiolitis, Bronchiolitis Obliterans, Organizing
Pneumonia, Bronchitis, Bronchopulmonary Dysplasia, Common Cold,
Cough, Empyema, Pleural Empyema, Pleural Epiglottitis, Hemoptysis,
Hypertension, Kartagener Syndrome, Meconium Aspiration, Pleural
Effusion, Pleurisy, Pneumonia, Pneumothorax, Respiratory Distress
Syndrome, Respiratory Hypersensitivity, Respiratory Tract
Infections, Rhinoscleroma, Scimitar Syndrome, Severe Acute
Respiratory Syndrome, Silicosis, Tracheal Stenosis and Whooping
Cough. Still further non-limiting examples of respiratory diseases
include influenza.
[0016] In another embodiment, a method includes administering an
amount sufficient to inhibit, reduce or decrease progression,
severity, frequency, probability, duration or prevent one or more
adverse physiological or psychological symptoms caused by or
associated with a chronic or acute condition, disorder or disease
caused by or associated with undesirable or abnormal lung or airway
inflammation, asthma, or a respiratory, interstitial, or pulmonary
disease or disorder. In particular aspects, a condition, disorder
or disease is allergic asthma, an acute asthmatic episode, airway
constriction, or lung or airway inflammation, or a respiratory,
interstitial, or pulmonary disease or disorder.
[0017] Invention treatment methods include providing a given
subject with an objective or subjective improvement of the
condition, disorder or disease, a symptom caused by or associated
with the condition, disorder or disease, or the probability or
susceptibility of a subject to the condition or a symptom caused by
or associated with the condition, disorder or disease. In various
embodiments, treatment reduces, decreases, inhibits, delays,
eliminates or prevents the probability, susceptibility, severity,
frequency, or duration of one or more symptoms caused by or
associated with the condition, disorder or disease. In a particular
aspect, a method inhibits, reduces or decreases the probability,
severity, frequency, duration or preventing a subject from having
an acute asthmatic episode (e.g., an acute asthmatic episode caused
by an allergen, allergic asthma or exercise). In another particular
aspect, a method reduces the probability, severity, frequency,
duration or delays, halts, or prevents airway-constriction. In
additional aspects, treatment improves or increases
airway-dilation. In further aspects, a treatment improves asthma,
reduces or inhibits lung or airway inflammation, or reduces or
inhibits a symptom caused by or associated with a respiratory,
interstitial, or pulmonary disease or disorder.
[0018] Candidate subjects for methods of the invention include
mammals, such as humans. Candidate subjects for methods of the
invention also include subjects that are in need of treatment,
e.g., any subject that may benefit from a treatment. Candidate
subjects for methods of the invention therefore include subjects
that have or are at risk of having a condition, disorder or disease
caused by or associated with asthma, lung or airway inflammation,
or a respiratory, interstitial, or pulmonary disease or disorder.
In particular aspects, a subject has been diagnosed as having
asthma, lung or airway inflammation, or a respiratory,
interstitial, or pulmonary disease or disorder, or is at risk of
having asthma, lung or airway inflammation, or a respiratory,
interstitial, or pulmonary disease or disorder.
[0019] Methods of the invention can be practiced by administration
or contact with any dose amount, frequency, delivery route or
timing of a LIGHT inhibitor. In particular embodiments, a subject
is administered or contacted a LIGHT inhibitor one, two, three,
four or more times hourly, daily, bi-weekly, weekly, monthly or
annually. In additional embodiments, an amount administered is
about 0.00001 mg/kg, to about 10,000 mg/kg, about 0.0001 mg/kg, to
about 1000 mg/kg, about 0.001 mg/kg, to about 100 mg/kg, about 0.01
mg/kg, to about 10 mg/kg, about 0.1 mg/kg, to about 1 mg/kg body
weight, one, two, three, four, or more times per hour, day,
bi-weekly, week, month or annually. In further embodiments, the
amount administered is less than about 0.00001 mg/kg, one, two,
three, four, or more times per hour, day, bi-weekly, week, month or
annually. In particular aspects, the amount is administered
substantially contemporaneously with, or within about 1-60 minutes,
hours, or days of the onset of a symptom caused by or associated
with asthma, lung or airway inflammation, or a respiratory,
interstitial, or pulmonary disease or disorder.
[0020] Methods of the invention include routes of contact or
administration of LIGHT inhibitor locally, regionally and
systemically. In a particular embodiment, a LIGHT inhibitor is
administered to achieve delivery to lungs, airways, or a lung,
airway, respiratory, interstitial, or pulmonary area (region),
tissue or organ.
[0021] Methods of the invention can be practiced in conjunction
with one or more other treatment protocols or therapeutic regimens.
In a particular embodiment, a method includes contacting or
administering a second agent or drug to the subject prior to, with
or following contacting or administering LIGHT inhibitor. In
particular aspects, a second agent or drug includes an
anti-inflammatory, anti-asthmatic or anti-allergy drug; a hormone
or a steroid; an anti-histamine, anti-leukotriene, anti-I.e.,
anti-.alpha.4 integrin, anti-.beta.2 integrin, anti-CCR3
antagonist, .beta.2 agonist or an anti-selectin.
[0022] Invention compositions can be formulated as appropriate for
practice of the methods. In one embodiment, a composition includes
a LIGHT inhibitor, and a pharmaceutically acceptable carrier. In a
particular aspect, the carrier is a physiologically acceptable gas,
liquid, dry powder or an aerosol. In an additional particular
aspect, the carrier is a capable of traversing into a lung or
airway area (region), tissue or organ, an interstitial, or
pulmonary area (region), tissue or organ, or a mucosal area
(region), tissue or organ, or epithelium thereof. In a further
particular aspect, the carrier is lipophilic or non-lipophilic.
[0023] Invention compositions can also be included in articles of
manufacture or kits appropriate for practice of the invention
methods. In one embodiment, a LIGHT inhibitor is included in an
article of manufacture. In one aspect, an article of manufacture is
a container having disposed therein a LIGHT inhibitor. In
particular aspects, a container comprises a canister having
disposed therein contents comprising a LIGHT inhibitor, said
contents under pressure. In another aspect, a container comprises
an aerosol generator or a spray generator (e.g., an inhaler, nasal
sprayer or nebulizer). Exemplary inhalers include metered dose and
dry powder inhalers. In a further aspect, an article of manufacture
is for delivery of LIGHT inhibitor to the lungs or airways, for
example, an intubation tube or face mask.
[0024] In accordance with the invention, further provided are kits.
In one embodiment, a kit includes a LIGHT inhibitor or prodrug
thereof. In a particular aspect, a kit includes a LIGHT inhibitor
or prodrug thereof disposed in an article of manufacture for
delivery of the LIGHT inhibitor or prodrug to lung, airways or a
respiratory, interstitial, or pulmonary area (region), tissue or
organ, optionally with instructions for administering said LIGHT
inhibitor to a subject. In a particular aspect, a kit includes a
second drug (e.g., an anti-inflammatory, anti-asthmatic or
anti-allergy drug; a hormone or a steroid; an anti-histamine,
anti-leukotriene, anti-IgE, anti-.alpha.4 integrin, anti-.beta.2
integrin, anti-CCR3 antagonist, .beta.2 agonist, anti-selectin or
glucocorticoid; H1-receptor antagonist; or a xanthine drug). In
more particular aspects, an anti-leukotriene is a
cysteinyl-leukotriene (Cys-LT); a .beta.2 agonist is a
.beta.2-adrenoceptor.
BRIEF DESCRIPTION OF DRAWINGS
[0025] FIG. 1 shows reduced eosinophilic lung inflammation in
LIGHT-deficient mice after chronic challenge with antigen via the
airways. Percent of bronchoalveolar lavagae eosinophils at 1 day
and 3 days after last airway challenge is shown in the graph. Data
are mean eosinophils from 4 mice per group for each time point.
[0026] FIGS. 2A-2B show reduced peribronchial fibrosis and smooth
muscle mass in lungs of LIGHT-deficient mice after chronic
challenge with antigen via the airways: A) lung sections stained
with trichrome to measure fibrosis and for alpha-smooth muscle
actin; and B) bar graphs representative of the area of fibrosis or
smooth muscle quantified using image analysis with normalization
for bronchial size.
[0027] FIGS. 3A-3D show that LIGHT-deficient CD4 cells undergo
extensive apoptosis after encountering antigen in vivo: Left (top
and bottom) shows antigen-specific CD4 T cells (OT-II) visualized
by staining for Thy1.2 and CD4; Right (top and bottom) shows the
degree of apoptosis occurring within these CD4 T cell populations
determined by co-staining for annexin V and 7-AAD after gating on
Thy1.2+ cells. The percentages of early and late apoptotic cells
are indicated.
[0028] FIGS. 4A-4B show LIGHT-deficient CD4 T cells are defective
in promoting asthmatic lung inflammation: A) lung histology, by
H&E; sections from two individual antigen-challenged mice
receiving wild-type or LIGHT-deficient Th2 (OT-II) cells; and B)
total leukocyte and eosinophil counts by differential cytospin
stain; and measurements of IL-5 and IL-13 expression by ELISA in
bronchoalveolar samples. First set of data in each case, animals
challenged with PBS. Second set, animals challenged with OVA.
[0029] FIGS. 5A-5B show LIGHT-deficient T cells are impaired in
accumulating in the lung and lung-draining lymph nodes (LN)
following acute exposure to inhaled antigen (OVA): A) a bar graph
representing the LN results; and B) a graph representing the lung
results.
[0030] FIGS. 6A-6C show LIGHT-deficient T cells do not survive in
vivo after chronic exposure to repetitive allergen (OVA) challenge
via the airways: A-C) percentages (left) and absolute numbers
(right) of wild-type or LIGHT-deficient CD4 T cells expressing
OVA-specific TCR V.alpha.2V.beta.5 found in A) Bronchoalveolar
lavagae; B) Lung; and C) lung-draining lymph nodes (LDLN).
[0031] FIGS. 7A-7B show Eosinophilic lung inflammation is reduced
after therapeutic treatment with a lymphotoxin beta receptor (LTBR)
fusion protein given during chronic allergen challenge: A) Total
infiltrating cells (left) and eosinophils (right) in
bronchoalveolar lavage; and B) total infiltrating cells (left) and
eosinophils (right) in lung tissue.
DETAILED DESCRIPTION
[0032] The invention provides methods of reducing or inhibiting
lung or airway inflammation (chronic or acute). The invention also
provides methods of treating asthma. The invention further provides
methods for treating a respiratory, interstitial, pulmonary disease
or disorder, and fibrotic diseases and disorders (chronic or
acute). In various embodiments, a method includes contacting or
administering a sufficient amount of an inhibitor of LIGHT (p30
polypeptide) to a subject to reduce or inhibit lung or airway
inflammation, to treat asthma or to treat the respiratory,
interstitial, or pulmonary disease or disorder, or the fibrotic
disease or disorder.
[0033] The term "an inhibitor of LIGHT," means a molecule that
directly or indirectly inhibits binding of LIGHT (p30 polypeptide)
to HVEM or to LT.beta.R. Inhibitors therefore include molecules
that bind to LIGHT as well as molecules that bind to a LIGHT
receptor or target. Since LIGHT (p30 polypeptide) can bind to a
variety of receptors and targets, such as HVEM and LT.beta.R, LIGHT
(p30 polypeptide) inhibitors therefore include molecules that bind
to LIGHT (p30 polypeptide), molecules that bind to HVEM, as well as
molecules that bind to LT.beta.R, which can thereby inhibit binding
of LIGHT to HVEM, binding of LIGHT to LT.beta.R, etc., either
directly or indirectly.
[0034] A non-limiting representative example of human LIGHT (p30
polypeptide) sequence (SEQ ID NO:1; the amino acid residues of the
transmembrane domain are shaded, and the amino acid residues of the
extracellular domain are underlined) target for an inhibitor is as
set forth below:
TABLE-US-00001 ##STR00001##
ANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLG
GVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDS
SFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
[0035] A non-limiting representative example of human HVEM
(herpesvirus entry mediator) sequence target for an inhibitor, also
referred to as tumor necrosis factor receptor superfamily, member
14 (TNFRSF14) is as set forth below (SEQ ID NO:2):
TABLE-US-00002 MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYP
VGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQC
QMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATS
SPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKA
GAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
[0036] A non-limiting representative example of human LT.beta.R
sequence target for an inhibitor, is as set forth below (SEQ ID
NO:3):
TABLE-US-00003 MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEK
EYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLT
ICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCEL
LSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCE
NQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL
ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFP
DLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPG
EQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEP
PYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFI THD
[0037] Exemplary LIGHT inhibitors include, for example, small
organic compounds (e.g., drugs), polypeptide sequences such as
antibodies and antibody subsequences that bind to LIGHT (p30
polypeptide), HVEM (herpesvirus entry mediator) or LT.beta.R
(lymphotoxin beta receptor). Additional exemplary LIGHT inhibitors
include, for example, a LIGHT, HVEM or LT.beta.R (lymphotoxin beta
receptor) polypeptide subsequence, variant sequence, chimeric
sequence or dominant negative sequence (e.g., soluble forms of
LIGHT, HVEM or LT.beta.R). Further exemplary LIGHT inhibitors
include, for example, chimeric sequences, such as a fusion of a
LIGHT, HVEM or LT.beta.R polypeptide sequence (e.g., soluble forms
of LIGHT, HVEM or LT.beta.R) and an immunoglobulin (Ig)
sequence.
[0038] Exemplary LIGHT antibodies include, for example, antibodies
that bind to human LIGHT. Non-limiting examples of commercially
available antibodies that bind to human LIGHT include clone T5-39
(BioLegend, San Diego, Calif.), clone 115520 (R&D Systems,
Minneapolis, Minn.), clones A-20 and C-20 (Santa Cruz Biotech,
Santa Cruz, Calif.), and clone 4E3 (Novus Biologicals, Inc.,
Littleton, Colo.).
[0039] Antibodies include mammalian, human, humanized, humaneered
or primatized forms of heavy or light chain, V.sub.H and V.sub.L,
respectively, immunoglobulin (Ig) molecules. An "antibody" means
any monoclonal or polyclonal immunoglobulin molecule, such as IgM,
IgG, IgA, IgE, IgD, and any subclass thereof, which includes intact
immunoglobulin molecules, two full length heavy chains linked by
disulfide bonds to two full length light variable domains, V.sub.H
and V.sub.L, individually or in any combination, as well as
subsequences, such as Fab, Fab', (Fab').sub.2, Fv, Fd, scFv and
sdFv, unless otherwise expressly stated.
[0040] An antibody that binds to LIGHT, HVEM or LT.beta.R antibody
means that the antibody has affinity for LIGHT, HVEM or LT.beta.R.
"Specific binding" is where the binding is selective between the
two referenced molecules. Thus, specific binding of an antibody for
LIGHT, HVEM or LT.beta.R is that which is selective for an epitope
present in LIGHT, HVEM or LT.beta.R. Typically, specific binding
can be distinguished from non-specific when the dissociation
constant (K.sub.D) is less than about 1.times.10.sup.-5 M or less
than about 1.times.10.sup.-6 M or 1.times.10.sup.-7 M. Selective
binding can be distinguished from non-selective binding using
assays known in the art (e.g., immunoprecipitation, ELISA, Western
blotting) with appropriate controls.
[0041] Monoclonal antibodies are made by methods known in the art
(Kohler et al., Nature, 256:495(1975); and Harlow and Lane, Using
Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory,
1999). Briefly, monoclonal antibodies can be obtained by injecting
mice with antigen. The polypeptide or peptide used to immunize an
animal may be derived from translated DNA or chemically synthesized
and conjugated to a carrier protein. Commonly used carriers which
are chemically coupled to the immunizing peptide include, for
example, keyhole limpet hemocyanin (KLH), thyroglobulin, bovine
serum albumin (BSA), and tetanus toxoid. Antibody production is
verified by analyzing a serum sample, removing the spleen to obtain
B lymphocytes, fusing the B lymphocytes with myeloma cells to
produce hybridomas, cloning the hybridomas, selecting positive
clones that produce antibodies to the antigen, and isolating the
antibodies from hybridoma cultures. Monoclonal antibodies can be
isolated and purified from hybridoma cultures by a variety of
established techniques which include, for example, affinity
chromatography with Protein-A Sepharose, size-exclusion
chromatography, and ion-exchange chromatography (see e.g., Coligan
et al., Current Protocols in Immunology sections 2.7.1-2.7.12 and
sections 2.9.1-2.9.3; and Barnes et al., "Methods in Molecular
Biology," 10:79-104, Humana Press (1992)).
[0042] A "human antibody" means that the amino acid sequence of the
antibody is fully human, i.e., human heavy and light chain variable
and constant regions. The antibody amino acids are coded for in the
human DNA antibody sequences or exist in a human antibody. Fully
human antibodies can be made by human antibody transgenic or
transchromosomic animals, such as mice, or by isolation from human
antibody producing cell lines (e.g., B cells) by recombinant DNA
methodology known to the skilled artisan, such as gene cloning by
reverse transcriptase polymerase chain reaction (RT-PCR). An
antibody that is non-human may be made fully human by substituting
non-human amino acid residues with amino acid residues that exist
in a human antibody. Amino acid residues present in human
antibodies, CDR region maps and human antibody consensus residues
are known in the art (see, e.g., Kabat, Sequences of Proteins of
Immunological Interest, 4.sup.th Ed. US Department of Health and
Human Services. Public Health Service (1987); Chothia and Lesk, J.
Mol. Biol. (1987) 186:651; Padlan Mol. Immunol. (1994) 31:169; and
Padlan Mol. Immunol. (1991) 28:489). Methods of producing human
antibodies are also described, for example, in WO 02/43478 and WO
02/092812.
[0043] The term "humanized," when used in reference to an antibody,
means that the antibody sequence has non-human amino acid residues
of one or more complementarity determining regions (CDRs) that
specifically bind to the antigen in an acceptor human
immunoglobulin molecule, and one or more human amino acid residues
in the framework region (FR) that flank the CDRs. Any mouse, rat,
guinea pig, goat, non-human primate (e.g., ape, chimpanzee,
macaque, orangutan, etc.) or other animal antibody may be used as a
CDR donor for producing humanized antibody. Human framework region
residues can be replaced with corresponding non-human residues
(e.g., from the donor variable region). Residues in the human
framework regions can therefore be substituted with a corresponding
residue from the non-human CDR donor antibody. A humanized antibody
may include residues, which are found neither in the human antibody
nor in the donor CDR or framework sequences. The use of antibody
components derived from humanized monoclonal antibodies reduces
problems associated with the immunogenicity of non-human regions.
Methods of producing humanized antibodies are known in the art
(see, for example, U.S. Pat. Nos. 5,225,539; 5,530,101, 5,565,332
and 5,585,089; Riechmann et al., (1988) Nature 332:323; EP 239,400;
WO91/09967; EP 592,106; EP 519,596; Padlan Molecular Immunol.
(1991) 28:489; Studnicka et al., Protein Engineering (1994) 7:805;
Singer et al., J. Immunol. (1993) 150:2844; and Roguska et al.,
Proc. Nat'l. Acad. Sci. USA (1994) 91:969).
[0044] The term "humaneered," when used in reference to an
antibody, means that the antibody sequence has high affinity for
antigen but has a greater number of human germline sequences than a
humanized antibody. Typically humaneered antibody has at least 90%
or more human germline sequences.
[0045] As used herein, the terms "peptide," "polypeptide" and
"protein" are used interchangeably and refer to two or more amino
acids covalently linked by an amide bond or non-amide equivalent.
Polypeptides include full length native polypeptide, and "modified"
forms such as subsequences, variant sequences, fusion/chimeric
sequences and dominant-negative sequences.
[0046] Peptides include L- and D-isomers, and combinations thereof.
Peptides can include modifications typically associated with
post-translational processing of proteins, for example, cyclization
(e.g., disulfide or amide bond), phosphorylation, glycosylation,
carboxylation, ubiquitination, myristylation, or lipidation.
Modified peptides can have one or more amino acid residues
substituted with another residue, added to the sequence or deleted
from the sequence. Specific examples include one or more amino acid
substitutions, additions or deletions (e.g., 1-3, 3-5, 5-10, 10-20,
or more).
[0047] Subsequences and fragments refer to polypeptides having one
or more fewer amino acids in comparison to a reference (e.g.,
native) polypeptide sequence. An antibody subsequence that
specifically binds to LIGHT, HVEM or LT.beta.R can retain at least
a part of its binding or LIGHT inhibitory or antagonist
activity.
[0048] A variant peptide can have a sequence with 50%, 60%, 70%,
75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or more identity to a
reference sequence. Variant sequences include naturally occurring
alterations of sequence, due to intra-species polymorphisms or
different species, as well as artificially produced alterations of
sequence. Sequence homology between species is in the range of
about 70-80%. An amino acid substitution is one example of a
variant.
[0049] A "conservative substitution" is the replacement of one
amino acid by a biologically, chemically or structurally similar
residue. Biologically similar means that the substitution is
compatible with an activity or function of the unsubstituted
sequence. Structurally similar means that the amino acids have side
chains with similar length, such as alanine, glycine and serine, or
having similar size. Chemical similarity means that the residues
have the same charge or are both hydrophilic or hydrophobic.
Particular examples include the substitution of one hydrophobic
residue, such as isoleucine, valine, leucine or methionine for
another, or the substitution of one polar residue for another, such
as the substitution of arginine for lysine, glutamic for aspartic
acids, or glutamine for asparagine, serine for threonine, and the
like.
[0050] Peptides synthesized and expressed as fusion proteins have
one or more additional domains linked thereto, and are also
referred to as chimeric polypeptides. The additional domain(s) may
confer an additional function upon the sequence. For example,
HVEM-IgG or LT.beta.R-IgG fusion proteins can have LIGHT inhibitory
activity.
[0051] The term "fusion," when used in reference to two or more
molecules (e.g., polypeptides) means that the molecules are
covalently attached. A particular example for attachment of two
protein sequences is an amide bond or equivalent. The term
"chimeric," and grammatical variations thereof, when used in
reference to a protein, means that the protein is comprised of one
or more heterologous amino acid residues from one or more different
proteins.
[0052] The term "heterologous," when used in reference to a
polypeptide, means that the polypeptide is not normally contiguous
with the other polypeptide in its natural environment. Thus, a
chimeric polypeptide means that a portion of the polypeptide does
not exist fused with the other polypeptide in normal cells. In
other words, a chimeric polypeptide is a molecule that does not
normally exist in nature, i.e., such a molecule is produced by the
hand of man, e.g., artificially produced through recombinant DNA
technology.
[0053] As used herein, the term "mimetic" refers to a synthetic
chemical compound which has substantially the same structural
and/or functional characteristics as the reference molecule. The
mimetic can be entirely composed of synthetic, non-natural amino
acid analogues, or can be a chimeric molecule including one or more
natural peptide amino acids and one or more non-natural amino acid
analogs. The mimetic can also incorporate any number of natural
amino acid conservative substitutions as long as such substitutions
do not destroy activity.
[0054] Peptide mimetics can contain any combination of non-natural
structural components, which are typically from three structural
groups: a) residue linkage groups other than the natural amide bond
("peptide bond") linkages; b) non-natural residues in place of
naturally occurring amino acid residues; or c) residues which
induce secondary structural mimicry, i.e., induce or stabilize a
secondary structure, e.g., a beta turn, gamma turn, beta sheet,
alpha helix conformation, and the like. For example, a polypeptide
can be characterized as a mimetic when one or more of the residues
are joined by chemical means other than an amide bond. Individual
peptidomimetic residues can be joined by amide bonds, non-natural
and non-amide chemical bonds other chemical bonds or coupling means
including, for example, glutaraldehyde, N-hydroxysuccinimide
esters, bifunctional maleimides, N,N'-dicyclohexylcarbodiimide
(DCC) or N,N'-diisopropylcarbodiimide (DIC). Linking groups
alternative to the amide bond include, for example, ketomethylene
(e.g., --C(.dbd.O)--CH.sub.2-- for --C(.dbd.O)--NH--),
aminomethylene (CH.sub.2--NH), ethylene, olefin (CH.dbd.CH), ether
(CH.sub.2--O), thioether (CH.sub.2--S), tetrazole (CN.sub.4--),
thiazole, retroamide, thioamide, or ester (see, e.g., Spatola
(1983) in Chemistry and Biochemistry of Amino Acids, Peptides and
Proteins, Vol. 7, pp 267-357, "Peptide and Backbone Modifications,"
Marcel Decker, NY).
[0055] Peptides and peptidomimetics can be produced and isolated
using a variety of methods known in the art. Full length peptides
and fragments (subsequences) can be synthesized using chemical
methods known in the art (see, e.g., Caruthers, Nucleic Acids Res.
Symp. Ser. (1980) 215; Horn, Nucleic Acids Res. Symp. Ser. (1980)
225; and Banga, A. K., Therapeutic Peptides and Proteins,
Formulation, Processing and Delivery Systems (1995) Technomic
Publishing Co., Lancaster, Pa.). Peptide synthesis can be performed
using various solid-phase techniques (see, e.g., Roberge, Science
(1995) 269:202; Merrifield, Methods Enzymol. (1997) 289:3).
Automated synthesis may be achieved, e.g., using a peptide
synthesizer.
[0056] Individual synthetic residues and polypeptides incorporating
mimetics can be synthesized using a variety of procedures and
methodologies known in the art (see, e.g., Organic Syntheses
Collective Volumes, Gilman, et al. (Eds) John Wiley & Sons,
Inc., NY). Peptides and peptide mimetics can also be synthesized
using combinatorial methodologies. Techniques for generating
peptide and peptidomimetic libraries are known, and include, for
example, multipin, tea bag, and split-couple-mix techniques (see,
for example, al-Obeidi, Mol. Biotechnol. (1998) 9:205; Hruby, Curr.
Opin. Chem. Biol. (1997) 1:114; Ostergaard, Mol. Divers. (1997)
3:17; and Ostresh, Methods Enzymol. (1996) 267:220). Modified
peptides can be further produced by chemical modification methods
(see, e.g., Belousov, Nucleic Acids Res. (1997) 25:3440; Frenkel,
Free Radic. Biol. Med. (1995) 19:373; and Blommers, Biochemistry
(1994) 33:7886).
[0057] Inhibitors of LIGHT therefore include those that can bind
selectively as well as those that bind non-selectively to a ligand
or target (e.g., LIGHT, HVEM, LT.beta.R, etc.) in solution, in
solid phase, in vitro, ex vivo or in vivo. As used herein, the term
"selective" when used in reference to a LIGHT inhibitor, means that
the inhibitor binds specifically to the target entity (e.g., LIGHT,
HVEM, LT.beta.R, etc.) and does not significantly bind to a
non-ligand or non-target entity. A non-selective inhibitor means
that the inhibitor is not selective for the entity to which it
binds, i.e., it cross-reacts with other entities.
[0058] LIGHT inhibitors include variants and derivatives that
retain at least a part or all of an activity of the non-variant or
non-derivatized inhibitor. A particular activity (e.g., antagonist
or inhibitory activity) of a LIGHT inhibitor may be less than or
greater than the activity of a corresponding non-variant or
non-derivatized LIGHT inhibitor. For example, a LIGHT inhibitor
variant or derivative may have less or greater activity than
non-variant or non-derivatized LIGHT inhibitor.
[0059] Non-limiting examples of activities that can be retained, at
least in part, include inhibitory or antagonist activity, binding
affinity (e.g., K.sub.d), avidity and binding selectivity
(specificity) or non-selectivity. The variant or derivatized
inhibitor can exhibit an activity (e.g., binding affinity) that is
greater or less than a corresponding non-variant or non-derivatized
inhibitor, e.g., greater or less inhibitory activity, binding
affinity (e.g., K.sub.d), avidity or binding selectivity
(specificity) or non-selectivity. For example, "at least a part" of
an activity of an inhibitor can be when the variant or derivatized
agent has less of an inhibitory activity, e.g., 10-25%, 25-50%,
50-60%, 60-70%, 70-75%, 75-80%, 80-85%, 85-90%, 90-95%, 95-99%,
100%, or any percent or numerical value or range or value within
such ranges. An activity of an inhibitor can be when the variant or
derivatized agent has more inhibitory activity, e.g., 110-125%,
125-150%, 150-175%, 175-200%, 200-250%, 250-300%, 300-400%,
400-500%, 500-1000%, 1000-2000%, 2000-5000%, or more, or any
percent or numerical value or range or value within such ranges. At
least a part of binding affinity of an inhibitor can be when the
variant or derivatized inhibitor has less affinity, e.g., 1-3-fold,
1-5-fold, 2-5 fold, 5-10-fold, 5-15-fold, 10-15-fold, 15-20-fold,
20-25-fold, 25-30-fold, 30-50-fold, 50-100 fold, 100-500-fold
500-1000-fold, 1000-5000-fold, or less (e.g., K.sub.d), or any
numerical value or range of values within such ranges. At least a
part of binding affinity of an inhibitor can be when the variant or
derivatized inhibitor has more affinity, e.g., 1-3-fold, 1-5-fold,
2-5 fold, 5-10-fold, 5-15-fold, 10-15-fold, 15-20-fold, 20-25-fold,
25-30-fold, 30-50-fold, 50-100 fold, 100-500-fold 500-1000-fold,
1000-5000-fold, or more (e.g., K.sub.d), or any numerical value or
range of values within such ranges.
[0060] LIGHT inhibitors can be identified by assays known in the
art. For example, the amount of activity can be assessed directly,
such as measuring the particular activity (e.g., inhibitor
activity, binding affinity, avidity, selectivity (specificity) or
non-selectivity). For example, a LIGHT inhibitor can be identified
by inhibition of HVEM or LT.beta.R mediated lymphocyte activation
or cell proliferation. A LIGHT inhibitor can also be identified by
change in cell expression of a marker, such as ICAM expression.
LIGHT inhibitors can further be identified by the ability to
inhibit binding of purified LIGHT to purified HVEM or LT.beta.R (or
HVEM-IgG or LT.beta.R-IgG fusion proteins), for example, when
immobilized on a substrate (e.g., plastic) by ELISA, or when any of
the molecules are transfected into cells that can be identified by
labeling with the corresponding binding partner by flow cytometry.
More particularly, for ELISA assays, plate bound LIGHT can be
pre-incubated with LIGHT specific inhibitory molecules and blockade
of receptor fusion protein binding measured by detection of the
binding of the Fc fusion protein or lack of binding. Blockade of
cell surface associated LIGHT binding to receptors is assessed by
pre-incubation of LIGHT inhibitory molecules with cell lines
expressing LIGHT on the surface followed by addition of receptor Fc
fusion proteins. Assessment of inhibition is measured by detection
of binding of the receptor fusion proteins or lack of binding by
flow cytometry. Inhibition of LIGHT signaling in vitro can be
determined by inhibiting LIGHT mediated chemokine secretion from
colonic epithelial cells (HT29).
[0061] As used herein, the term "the same," when used in reference
to a LIGHT inhibitor means that the activity is within about 50%
more than or less than the reference inhibitor. The term
"substantially the same" when used in reference to inhibitor
activity means that the activity is within about 100-500%
(2-5-fold) or any percent value or range of percent values within
such ranges, more than or less than the reference inhibitor. The
same, when used in reference to binding affinity, means that the
dissociation constant (K.sub.d) is within about 1-5-fold, or any
numerical value or range of values within such a range, of the
referenced agent (e.g., 1-5 fold greater affinity or 1-5 fold less
affinity than the reference agent).
[0062] The term "substantially the same" when used in reference to
binding affinity, means that the dissociation constant (K.sub.d) is
within about 5 to 100 fold, or any numerical value or range of
values within such a range, of the reference inhibitor (5-100 fold
greater affinity or 5-100 fold less affinity than the reference
inhibitor). The term "the same," when used in reference to
association constant (K.sub.a) is within about 1 to 5 fold, or any
numerical value or range of values within such a range, of the
reference inhibitor (within 1-5 fold greater or 1-5 fold less than
the association constant, K.sub.a). The term "substantially the
same" when used in reference to association constant (K.sub.a),
means that the association constant is within about 5 to 100 fold
greater or less, or any numerical value or range of values within
such a range, than the association constant, K.sub.a, of the
reference inhibitor (5-100 fold greater or 5-100 fold less than the
reference inhibitor).
[0063] Dissociation (K.sub.d) constants can be measured using
radiolabeled inhibitors in competitive binding assays with
increasing amounts of unlabelled inhibitor to generate saturation
curves. The target, ligand or receptor used in the binding assay
(e.g., LIGHT, HVEM, or LT.beta.R, etc.) can be expressed in vitro,
on cells or be present in extracts. Association (K.sub.a) and
dissociation (K.sub.d) constants can be measured using surface
plasmon resonance (SPR) (Rich and Myszka, Curr. Opin. Biotechnol.
11:54 (2000); Englebienne, Analyst. 123:1599 (1998)). SPR methods
for real time detection and monitoring of protein binding rates are
known and are commercially available and can be used to determine
dissociation (K.sub.d) constants (BiaCore 2000, Biacore AB, Upsala,
Sweden; and Malmqvist, Biochem. Soc. Trans. 27:335 (1999)).
[0064] As used herein, the term "contact" and grammatical
variations thereof means a physical or functional interaction
between one entity and one or more other entities. An example of
physical contact is a direct or indirect binding, such as between a
LIGHT inhibitor and a target or receptor. An example of a
functional interaction is where an intermediate facilitates or
mediates a change in activity of one entity by another entity, such
as a signaling pathway where molecules within the pathway
functionally interact but need not physically contact each other.
In the methods, contact can occur in solution, in solid phase, in
vitro, ex vivo or in vivo (i.e., in a subject).
[0065] In accordance with the invention, there are provided methods
in solution, in solid phase, in vitro, ex vivo or in vivo (i.e., in
a subject). In one embodiment, a method includes contacting or
administering to a subject, e.g. a subject in need thereof, an
amount of a LIGHT inhibitor to treat the subject. In one particular
aspect, an amount of LIGHT inhibitor contacted with or administered
to the subject is sufficient to reduce or inhibit lung or airway
inflammation. In another particular aspect, an amount of LIGHT
inhibitor contacted with or administered to the subject is
sufficient to treat asthma. In a further aspect, an amount of LIGHT
inhibitor is administered to a subject sufficient to treat a
respiratory, interstitial, or pulmonary disease or disorder, or
fibrotic disease or disorder. In a still further aspect, an amount
of LIGHT inhibitor is administered to a subject whom has previously
experienced an asthmatic episode or airway-constriction or
obstruction, or is in need of airway-dilation, sufficient to
inhibit or reduce airway-constriction or obstruction, or to
increase, stimulate or improve airway-dilation.
[0066] As used herein, the term "associated with," when used in
reference to the relationship between a symptom and a condition,
disorder or disease, means that the symptom is caused by the
referenced condition, disorder or disease, or is a secondary effect
of the referenced condition, disorder or disease. A symptom that is
present in a subject may therefore be the direct result of or
caused by the referenced condition, or may be due at least in part
to the subject reacting or responding to the referenced condition,
disorder or disease, e.g., a secondary effect. For example,
symptoms that occur during an asthmatic or allergic episode are due
in part to hypersensitivity or an aberrant response of the immune
system of the subject to the antigen/allergen.
[0067] As used herein, the term "subject" includes animals,
typically mammalian animals, such as but not limited to humans,
non-human primates (apes, gibbons, chimpanzees, orangutans,
macaques), domestic animals (dogs and cats), farm animals (horses,
cows, goats, sheep, pigs), and experimental animals (mouse, rat,
rabbit, guinea pig). Subjects include animal disease models (e.g.,
asthma, allergy). Subjects include naturally occurring or
non-naturally occurring mutated or non-human genetically engineered
(e.g., transgenic or knockout) animals. Subjects further include
animals having or at risk of having a chronic or acute condition,
disorder or disease.
[0068] Conditions, disorders and diseases treatable in accordance
with the invention include, for example, chronic or acute
inflammatory conditions, disorders and diseases, allergies,
allergic conditions, disorders and diseases. An "inflammatory"
condition, disorder or disease refers to one or more physiological
responses that characterize or constitute inflammation. An
"allergy" or "allergic condition," as used herein refers to a
hypersensitivity to a substance (e.g., an allergen). Allergic
conditions, disorders and diseases include but are not limited to
allergic asthma, hayfever (seasonal rhinitis), allergic rhinitis,
allergic conjunctivitis, eczema, urticaria, food allergies, and
other atopic conditions.
[0069] Inflammatory, allergic and non-allergic and conditions,
disorders and diseases of the respiratory system, including airways
and lung, include asthma, chronic obstructive pulmonary disease
("COPD"), granulomatus diseases of the lungs and lower airway
passages, non-malignant proliferative disease of the lungs e.g.,
idiopathic pulmonary fibrosis, hypersensitivity pneumonitis and
bronchopulmonary dysplasia. Non-limiting examples of allergic
conditions, disorders and diseases include, for example, extrinsic
bronchial asthma; allergic rhinitis (AR); Onchocercal dermatitis;
atopic dermatitis, drug reactions; nodules, eosinophilia,
rheumatism, dermatitis, and swelling (NERDS); esophageal and
gastro-intestinal (GI) allergies.
[0070] In accordance with the invention, there are provided methods
of reducing progression, severity, frequency, duration,
susceptibility or probability of inflammatory, allergic and
non-allergic conditions, disorders and diseases of the respiratory
system. In one embodiment, a method includes administering to a
subject an amount of LIGHT inhibitor sufficient to reduce or
decrease progression, severity, frequency, duration, susceptibility
or probability of one or more adverse symptoms associated with
inflammation in the respiratory tissue or organ.
[0071] In another embodiment, a method includes administering to a
subject an amount of LIGHT inhibitor sufficient to reduce or
decrease progression, severity, frequency, duration, susceptibility
or probability of one or more adverse symptoms caused by or
associated with asthma (allergic or non-allergic). In one aspect,
the adverse symptom is selected from lung, airway or respiratory
mucosum inflammation or tissue damage, shortness of breath,
wheezing, coughing, chest-tightness, chest pain, increased heart
rate, runny nose, airway-constriction, decreased lung capacity, and
an acute asthmatic episode. In another aspect, asthma is caused by
or associated with exposure to an allergen or associated with
exercise. In yet another aspect, the subject has been diagnosed as
having asthma.
[0072] "Asthma" refers to an allergic or non-allergic condition,
disorder or disease of the respiratory system that is episodic and
characterized by inflammation with constriction, narrowing or
obstruction of the airways. Allergic asthma is typically associated
with increased reactivity of respiratory system (airways, lung,
etc.) to an inhaled agent. Asthma is frequently, although not
exclusively associated with atopic or allergic symptoms. Typically,
a subject with asthma suffers from recurrent attacks of paroxysmal
dyspnea (i.e., "reversible obstructive airway passage disease"),
cough, shortness of breath with wheezing due to spasmodic
contraction of the bronchi, sometimes referred to as
"bronchospasm," chest pain, chest tightness, etc. While a plurality
of such adverse symptoms typically occur in asthma, the existence
of any one is usually adequate for diagnosis of asthma, and for
treatment in accordance with the invention.
[0073] Asthmatic conditions include allergic asthma as well as
bronchial allergy, which typically are provoked by a variety of
factors including exercise such as vigorous exercise
("exercise-induced bronchospasm"), and irritant particles
(allergens such as pollen, dust, venoms, cotton, dander, foods).
Asthmatic conditions can be acute, chronic, mild, moderate or
severe asthma (unstable asthma), nocturnal asthma or asthma
associated with psychologic stress.
[0074] "Allergic rhinitis" is an allergic reaction of the nasal
mucosa (upper airways), which includes hay fever (seasonal allergic
rhinitis) and perennial rhinitis (non-seasonal allergic rhinitis)
which are typically characterized by seasonal or perennial
sneezing, rhinorrhea, nasal congestion, pruritis and eye itching,
redness and tearing. "Non-allergic rhinitis" refers to eosinophilic
non-allergic rhinitis, in subjects with negative skin tests, and
subjects who have abnormal or undesirable numbers of eosinophils in
their nasal secretions.
[0075] An "allergen" is a substance that can promote, stimulate or
induce an allergic or asthmatic episode in a subject. Allergens
include plant/tree pollens, insect venoms, animal dander, house
dust mite, dust, fungal spores, latex, food and drugs (e.g.,
penicillin). Examples of particular allergens include proteins
specific to the following genera: Canis (Canis familiaris);
Dermatophagoides (e.g., Dermatophagoides farinae); Felis (Felis
domesticus); Ambrosia (Ambrosia artemiisfolia); Lolium (e.g.,
Lolium perenne or Lolium multiflorum); Cryptomeria (Cryptomeria
japonica); Alternaria (Alternaria alternata); Alder; Alnus (Alnus
gultinosa); Betula (Betula verrucosa); Quercus (Quercus alba); Olea
(Olea europa); Artemisia (Artemisia vulgaris); Plantago (e.g.,
Plantago lanceolata); Parietaria (e.g., Parietaria officinalisor
Parietaria judaica); Blattella (e.g., Blattella germanica); Apis
(e.g., Apis multiflorum); Cupressus (e.g., Cupressus sempervirens,
Cupressus arizonica and Cupressus macrocarpa); Juniperus (e.g.,
Juniperus sabinoides, Juniperus virginiana, Juniperus communis and
Juniperus ashei); Thuya (e.g., Thuya orientalis); Chamaecyparis
(e.g., Chamaecyparis obtusa); Periplaneta (e.g., Periplaneta
americana); Agropyron (e.g., Agropyron repens); Secale (e.g.,
Secale cereale); Triticum (e.g., Triticum aestivum); Dactylis
(e.g., Dactylis glomerata); Festuca (e.g., Festuca elatior); Poa
(e.g., Poa pratensisor Poa compressa); Avena (e.g., Avena sativa);
Holcus (e.g., Holcus lanatus); Anthoxanthum (e.g., Anthoxanthum
odoratum); Arrhenatherum (e.g., Arrhenatherum elatius); Agrostis
(e.g., Agrostis alba); Phleum (e.g., Phleum pratense); Phalaris
(e.g., Phalaris arundinacea); Paspalum (e.g., Paspalum notatum);
Sorghum (e.g., Sorghum halepensis); and Bromus (e.g., Bromus
inermis). Allergens also include peptides and polypeptides used in
experimental animal models of allergy and asthma, including
ovalbumin (OVA) and Schistosoma mansoni egg antigen.
[0076] A "respiratory disorder" or a "respiratory mucosum disorder"
means a condition, disorder or disease related to a tissue or organ
of the respiratory system. Examples include, but are not limited
to, upper or lower airway inflammation, allergy(ies), breathing
difficulty, cystic fibrosis (CF), allergic rhinitis (AR), Acute
Respiratory Distress Syndrome (ARDS), pulmonary hypertension, lung
inflammation, bronchitis, airway obstruction, airway constriction,
airway narrowing, broncho-constriction and inflammation associated
with microbial or viral infections, such as influenza,
picornaviridae (rhinoviruses such as human rhinovirus (HRV);
enteroviruses (EV) such as polioviruses, coxsackieviruses and
echoviruses) or severe acute respiratory syndrome (SARS).
Additional non-limiting examples of respiratory disorders and
respiratory mucosum disorders include apnea, asbestosis,
atelectasis, berylliosis, bronchiectasis, bronchiolitis,
bronchiolitis obliterans Organizing Pneumonia, Bronchitis,
Bronchopulmonary Dysplasia, Common Cold, Cough, Empyema, Pleural
Empyema, Pleural Epiglottitis, Hemoptysis, Hypertension, Kartagener
Syndrome, Meconium Aspiration, Pleural Effusion, Pleurisy,
Pneumonia, Pneumothorax, Respiratory Distress Syndrome, Respiratory
Hypersensitivity, Respiratory Tract Infections, Rhinoscleroma,
Scimitar Syndrome, Severe Acute Respiratory Syndrome (SARS),
Silicosis, Tracheal Stenosis, and Whooping Cough.
[0077] Further non-limiting examples of interstitial and pulmonary
disorders include Eosinophilic pleural effusions; Transient
pulmonary eosinophilic infiltrates (Loffler); Histiocytosis;
Chronic eosinophilic pneumonia; Hypersensitivity pneumonitis;
Allergic bronchopulmonary aspergillosis; Sarcoidosis; Idiopathic
pulmonary fibrosis; pulmonary edema; pulmonary embolism; pulmonary
emphysema; Pulmonary Hyperventilation; Pulmonary Alveolar
Proteinosis; Chronic Obstructive Pulmonary Disease; Interstitial
Lung Diseases; and Topical eosinophilia.
[0078] The term "airway," as used herein, means a part of or the
whole respiratory system of a subject that is exposed to air.
"Airways" therefore include the upper and lower airway passages,
within which are not limited to the trachea, bronchi, bronchioles,
terminal and respiratory bronchioles, alveolar ducts and alveolar
sacs. Airways include sinuses, nasal passages, nasal mucosum and
nasal epithelium. The airway also includes, but is not limited to
throat, larynx, tracheobronchial tree and tonsils.
[0079] Particular non-limiting examples of subjects include
subjects having or at risk of having inflammation or lung or
airways, an inflammatory or allergic condition, disorder or
disease. Non-limiting examples of subjects further include subjects
having or at risk of having an adverse or undesirable symptom
associated with an inflammatory or allergic condition, disorder or
disease, such as asthma. Such at risk subjects can be identified by
a personal or family history, through genetic screening, tests
appropriate for detection of increased risk, or exhibiting relevant
symptoms indicating predisposition or susceptibility.
[0080] Subjects having or at risk of having an allergic condition,
disorder or disease include subjects with an existing allergic
condition or a known or a suspected predisposition towards
developing a symptom associated with or caused by an allergic
condition. Thus, the subject can have an active chronic allergic
condition, disorder or disease, an acute allergic episode, or a
latent allergic condition, disorder or disease. Certain allergic
conditions, are associated with seasonal or geographical
environmental factors. Thus, at risk subjects include those at risk
from suffering from a condition based upon a prior personal or
family history, and the season or physical location, but which the
condition or a symptom associated with the condition may not
presently manifest itself in the subject.
[0081] A subject having or at risk of having asthma refers to a
subject suffering from an acute episode of asthma, either a
new-onset or a recurrent episode, a subject with a prior history of
one or more episodes of asthma, or a subject with a known or
suspected predisposition towards developing asthma. A subject
having asthma can have active asthma or can be asymptomatic and
between acute asthma episodes. A subject having asthma can be
suffering from recently acute asthmatic episode (e.g., within
minutes or hours of episode onset). A subject having asthma can
have a positive skin test, or exhibit one or more symptoms
typically associated with acute or chronic asthma, for example, a
symptom of allergic asthma. A subject having or at risk of having
asthma may be or has been exposed to an allergen, for example, and
is at increased risk of suffering from an asthmatic episode due to
a predisposition or susceptibility towards an asthmatic episode
upon re-exposure to the allergen. Subjects predisposed or
susceptible to, exposed to or allergic to these or other allergens
are at risk of having asthma and, therefore, are amenable to
treatment in accordance with the invention.
[0082] At risk subjects also appropriate for treatment in
accordance with the invention include subjects exposed to an
allergen or are susceptible to having an allergic reaction, or
infection or exposure by an agent that is associated with an
allergy or allergic reaction. At risk subjects appropriate for
treatment in accordance with the invention include subjects having
a predisposition towards an allergic reaction, or infection or
exposure to an agent that is associated with an allergy or allergic
reaction due to a genetic or environmental risk factor. Methods of
the invention include subjects contacted with or administered to a
binding agent prophylactically.
[0083] In the methods of the invention in which a detectable result
or beneficial effect is a desired outcome, such as a therapeutic
benefit in a subject treated in accordance with the invention,
compositions such as LIGHT inhibitors can be administered in
sufficient or effective amounts. An "amount sufficient" or "amount
effective" includes an amount that, in a given subject, can have a
desired outcome or effect. The "amount sufficient" or "amount
effective" can be an amount of a LIGHT inhibitor that provides, in
single or multiple doses, alone or in combination with one or more
other (second) compounds or agents (e.g., a drug), treatments or
therapeutic regimens, a long or short term detectable response, a
desired outcome or beneficial effect in a particular given subject
of any measurable or detectable degree or duration (e.g., for
minutes, hours, days, months, years, or cured).
[0084] An amount sufficient or an amount effective can but need not
be provided in a single administration and can but need not be
administered alone (i.e., without a second drug, agent, treatment
or therapeutic regimen), or in combination with another compound,
agent, treatment or therapeutic regimen. In addition, an amount
sufficient or an amount effective need not be sufficient or
effective if given in single or multiple doses without a second
compound, agent, treatment or therapeutic regimen, since additional
doses, amounts or duration above and beyond such doses, or
additional drugs, agents, treatment or therapeutic regimens may be
included in order to be effective or sufficient in a given subject.
Further, an amount sufficient or an amount effective need not be
effective in each and every subject, nor a majority of subjects in
a given group or population. Thus, as some subjects may not benefit
from such treatments an amount sufficient or an amount effective
means sufficiency or effectiveness in a particular subject, not a
group or the general population. As is typical for such methods,
some subjects will exhibit a greater or less response to a method
of the invention, including treatment/therapy.
[0085] Reducing, inhibiting decreasing, eliminating, delaying,
halting or preventing a progression or worsening or an adverse
symptom of the condition, disorder or disease is a satisfactory
outcome. The dose amount, frequency or duration may be
proportionally increased or reduced, as indicated by the status of
the condition, disorder or disease being treated, or any adverse
side effects of the treatment or therapy. Dose amounts, frequencies
or duration also considered sufficient and effective are those that
result in a reduction of the use of another drug, agent, treatment
or therapeutic regimen or protocol. For example, a LIGHT inhibitor
is considered as having a beneficial or therapeutic effect if
contact, administration or delivery in vivo results in the use of a
lesser amount, frequency or duration of another drug, agent,
treatment or therapeutic regimen or protocol to treat the
condition, disorder or disease, or an adverse symptom thereof.
[0086] An "amount sufficient" or "amount effective" includes
reducing, preventing, delaying or inhibiting onset, reducing,
inhibiting, delaying, preventing or halting the progression or
worsening of, reducing, relieving, alleviating the severity,
frequency, duration, susceptibility or probability of one or more
adverse or undesirable symptoms associated with the condition,
disorder or disease of the subject. In addition, hastening a
subject's recovery from one or more adverse or undesirable symptoms
associated with the condition, disorder or disease is considered to
be an amount sufficient or effective. Various beneficial effects
and indicia of therapeutic benefit are as set forth herein and are
known to the skilled artisan.
[0087] An "amount sufficient" or "amount effective," in the
appropriate context, can refer to therapeutic or prophylactic
amounts. Therapeutically or prophylactically sufficient or
effective amounts mean an amount that, in a given subject,
detectably improves the condition, disorder or disease, such as an
inflammatory condition, disorder or disease, as assessed by one or
more objective or subjective clinical endpoints appropriate for the
condition, disorder or disease.
[0088] In accordance with the invention, there are provided methods
which provide a beneficial effect, such as a therapeutic benefit,
to a subject. In one embodiment, a method includes administering an
amount of LIGHT inhibitor sufficient to provide a therapeutic
benefit or beneficial effect to a subject. In one aspect, a method
reduces or inhibits probability, susceptibility, severity,
frequency, duration or prevents lung or airway inflammation in the
subject. In another aspect, a method reduces the probability,
susceptibility, severity, frequency, duration or prevents an
asthmatic episode (e.g., associated with allergic or non-allergic
asthma) in the subject. In an additional aspect, a method reduces
or inhibits probability, susceptibility, severity, frequency,
duration or prevents a symptom caused by or associated with a
respiratory, interstitial or pulmonary disease or disorder. In a
further aspect, a method increases, stimulates, enhances, induces
or promotes airway-dilation in the subject. In still another
aspect, a method reduces the probability, susceptibility, severity,
frequency, duration or prevents or eliminates airway-constriction
the subject. In a yet further aspect, a method is sufficient to
reduce progression, severity, frequency, duration, susceptibility,
probability, halt, eliminate or prevent one or more adverse
physiological or psychological symptoms associated with asthma
(allergic or non-allergic).
[0089] Sufficiency or effectiveness of a particular treatment can
be ascertained by various clinical indicia and endpoints. For
example, in order to ascertain an improvement in asthma, an
increase in airway dilation, lung function or a reduction in airway
constriction, obstruction or narrowing, progression, severity,
duration, frequency, susceptibility or probability of one or more
symptoms of asthma. An "amount sufficient" or "amount effective" to
treat asthma is therefore an amount that provides an objective or
subjective reduction or improvement in progression, severity,
frequency, susceptibility or probability of lung or airway
inflammation, lung or airway tissue damage, shortness of breath,
wheezing, coughing, chest-tightness, chest pain, increased heart
rate, runny nose, airway or broncho-constriction, -obstruction or
narrowing, decreased lung capacity, acute asthmatic episodes,
nighttime awakenings, etc. Thus, a reduction, decrease, inhibition,
delay, halt, prevention or elimination of one or more adverse
symptoms (e.g., shortness of breath, wheezing, coughing,
chest-tightness, chest pain, increased heart rate, runny nose,
acute asthmatic episodes, nighttime awakenings, etc.) can be used
as a measure of sufficiency or effectiveness.
[0090] A method to determine an improvement in lung or pulmonary
function is to measure the forced expiratory volume in one second
(FEV.sub.1) an increase of which indicates an improvement.
Spirometry is a test which measures the amount and rate at which
air can pass through airways. Airway narrowing due to inflammation
restricts air flow through the airways, which is detected by
changed spirometry values. Exercise challenge and methacholine
inhalation tests are also used to evaluate airway narrowing or
constriction. Yet another method to determine an improvement is to
measure serum IgE in a subject. A reduction in serum or
bronchoalveolar lavage (BAL) fluid IgE is an objective measure of
treatment efficacy. Various additional methods are known to the
skilled artisan for detecting improvement in lung or pulmonary
function.
[0091] An "amount sufficient" or "amount effective" also includes
an amount that, when used in combination with another binding
agent, drug, or treatment or therapeutic regimen, reduces the
dosage frequency, dosage amount, or an adverse symptom or side
effect of the other binding agent, drug or treatment or therapeutic
regimen, or eliminates the need for the other binding agent, drug
or treatment or therapeutic regimen. For example, an "amount
sufficient" or "amount effective" of a LIGHT inhibitor could result
in a reduction in the dosage frequency or dosage amount of a
steroid, antihistamine, beta adrenergic agonist, anticholinergic,
methylxanthine, anti-IgE, anti-leukotriene, anti-beta2 integrin,
anti-CCR3 antagonist, or anti-selectin required to achieve the same
clinical endpoint.
[0092] The terms "treat," "therapy" and grammatical variations
thereof when used in reference to a method means the method
provides an objective or subjective (perceived) improvement in a
subjects' condition, disorder or disease, or an adverse symptom
associated with the condition, disorder or disease. Non-limiting
examples of an improvement can therefore reduce or decrease the
probability, susceptibility or likelihood that the subject so
treated will manifest one or more symptoms of the condition,
disorder or disease. Additional symptoms and physiological or
psychological responses caused by or associated with conditions,
disorders or diseases associated with, for example, lung and airway
inflammation, asthma and a respiratory, interstitial or pulmonary
disease or disorder are set forth herein and known in the art and,
therefore, improvements in these and other adverse symptoms or
physiological or psychological responses can also be included in
the methods of the invention.
[0093] Methods of the invention therefore include providing a
detectable or measurable beneficial effect or therapeutic benefit
to a subject, or any objective or subjective transient or
temporary, or longer-term improvement (e.g., cure) in the
condition. Thus, a satisfactory clinical endpoint is achieved when
there is an incremental improvement in the subjects condition or a
partial reduction in the severity, frequency, duration or
progression of one or more associated adverse symptoms or
complications or inhibition, reduction, elimination, prevention or
reversal of one or more of the physiological, biochemical or
cellular manifestations or characteristics of the condition,
disorder or disease. A therapeutic benefit or improvement
("ameliorate" is used synonymously) therefore need not be complete
ablation of any or all adverse symptoms or complications associated
with the condition, disorder or disease but is any measurable or
detectable objectively or subjectively meaningful improvement in
the condition, disorder or disease. For example, inhibiting a
worsening or progression of the condition, disorder or disease, or
an associated symptom (e.g., slowing or stabilizing one or more
symptoms, complications or physiological or psychological effects
or responses), even if only for a few days, weeks or months, even
if complete ablation of the condition, disorder or disease, or an
associated adverse symptom is not achieved is considered to be
beneficial effect.
[0094] Prophylactic methods are included. "Prophylaxis" and
grammatical variations thereof mean a method in accordance with the
invention in which contact, administration or in vivo delivery to a
subject is prior to manifestation or onset of a condition, disorder
or disease (or an associated symptom or physiological or
psychological response), such that it can eliminate, prevent,
inhibit, decrease or reduce the probability, susceptibility, onset
or frequency of having a condition, disorder or disease, or an
associated symptom. Target subject's for prophylaxis can be one of
increased risk (probability or susceptibility) of contracting the
condition, disorder or disease, or an associated symptom, or
recurrence of a previously diagnosed condition, disorder or
disease, or an associated symptom, as set forth herein.
[0095] Any compound or agent (e.g., drug), therapy or treatment
having a beneficial, additive, synergistic or complementary
activity or effect (beneficial or therapeutic) can be used in
combination with a binding agent in accordance with the invention.
A "second compound" or "second agent" refers to any compound or
agent (e.g., drug) that is not the first compound or agent of the
recited composition, e.g., if a first drug or agent is a particular
LIGHT inhibitor, then a second drug or agent is different from the
first LIGHT inhibitor. The second compound or agent can but need
not be selective, for example, for binding to LIGHT, HVEM or
LT.beta.R.
[0096] In accordance with the invention there are provided methods
in which a second compound or agent (e.g., drug) is administered to
the subject. In one embodiment, a second compound or agent (e.g.,
drug) is administered to the subject prior to, with or following
contacting or administering a LIGHT inhibitor.
[0097] Methods of the invention therefore include combination
therapies and treatments. Examples of such combination therapies
include separate or pooled compounds or LIGHT inhibitors (e.g.,
pooled antagonists, compounds or agents). Accordingly, combination
compositions, therapies and treatments are provided, as well as
methods of using such combinations, therapies and treatments in
conjunction with the methods of the invention. Contact,
administration or in vivo delivery of a compound or agent, such as
a binding agent, or practice of a therapy or treatment, can occur
prior to, in conjunction with or following a method or method step
of the invention, e.g., prior to, in conjunction or following
administering a LIGHT inhibitor.
[0098] Non-limiting examples of functional classes of compounds and
agents useful as a second compound or agent (e.g., drug) include
anti-inflammatory, anti-asthmatic, airway dilators (e.g., xanthine
drugs such as methylxanthines, which are broncho-dilators) and
anti-allergy drugs. Additional non-limiting examples of compounds
and agents useful for employing in the invention, for example to
treat an allergic condition, disorder or disease (e.g., asthma,
allergic rhinitis) include hormones, such as steroids (e.g.,
glucocorticoids); antihistamines; beta adrenergic agonists;
anticholinergics; methylxanthines; anti-IgE; anti-leukotrienes;
anti-beta2 integrins; anti-alpha-4 integrins; H1-receptor
antagonists; anti-CCR3 antagonists; and anti-selectins.
[0099] Specific non-limiting examples of glucocorticoids include
dexamethasone, triamcinolone acetonide (AZMACORT.RTM.),
beclomethasone, dipropionate (VANCERIL.RTM.), flunisolide
(AEROBID.RTM.), fluticasone propionate (FLOVENT.RTM.), prednisone,
methylprednisolone and mometasonefuroate (ASMANEX.RTM.,
TWISTHALER.RTM.). Specific non-limiting examples of antihistamines
include chlorcyclizine, chlorpheniramine, triprolidine
(ACTIFED.RTM.), diphenhydramine hydrochloride (BENADRYL.RTM.),
fexofenadine hydrochloride (ALLEGRA.RTM.), hydroxyzine
hydrochloride (ATARAX.RTM.), loratadine (CLARITIN.RTM.),
promethazine hydrochloride (PHENERGAN.RTM.), pyrilamine; and
anti-IgE omalizumab (XOLAIR.RTM.). Specific non-limiting example of
beta adrenergic agonists include albuterol (VENTOLIN.RTM.;
PROVENTIL.RTM.), Xopenex.RTM., (S)-isomer subtracted from racemic
albuterol (Sepracor Inc.), pirbuterol, epinephrine, racepinephrine,
adrenaline, isoproterenol, salmeterol (Serevent.RTM.),
metaproterenol (ALUPENT.RTM.), bitolterol (Tornalate.RTM.),
fenoterol (BEROTEC.RTM.), formoterol (Foradil.RTM.), isoetharine,
procaterol, .beta.2-adrenoceptor and terbutaline (BRETHINE.RTM.,
LAMISIL.RTM.). A specific non-limiting example of an
anticholinergic (cholinergic receptor antagonist) includes
ipratropium bromide (ATROVENT.RTM.) and tiotropium. Specific
non-limiting examples of methylxanthines include theophylline,
aminophylline, theobromine, cromolyn (Intal.RTM.) and nedocromil
(Fisons). A specific non-limiting example of an anti-IgE is
omalizumab (XOLAIR.RTM.). Specific non-limiting examples of
anti-leukotrienes (leukotriene inhibitors) include
cysteinyl-leukotriene (Cys-LT), Singulair.RTM. and
Accolate.RTM..
[0100] Anti-inflammatory agents useful for employing in the methods
include cytokines and chemokines. Particular non-limiting examples
of cytokines include anti-inflammatory cytokines such as IL-4 and
IL-10. Anti-cytokines and anti-chemokines, such as antibodies that
bind to pro-inflammatory cytokines, TNF.alpha., IFN.gamma., IL-1,
IL-2, IL-6, etc., as well as anti-Th2 cytokines such as IL-5,
IL-13, etc., can be employed in the methods.
[0101] Additional functional classes of compounds and agents useful
as a second compound or agent (e.g., drug) include selective or
non-selective potassium channel activators (bronchodilatators);
muscarinic M3 receptor antagonists; M2 receptor agonists; opioid
receptor agonists (inhibit release of sensory neuropeptides);
H3-receptor agonists (inhibit acetylcholine release); phospholipase
A2 inhibitors; 5-lipoxygenase inhibitors; 5-lipoxygenase activating
protein (FLAP) inhibitors; phosphodiesterase inhibitors;
immunomodulating agents (Ciclosporine); antibody against adhesion
molecules; and antagonists of tachykinins (e.g., Substance P or
neurokinin).
[0102] Compositions including LIGHT inhibitors can be included in a
pharmaceutically acceptable carrier (excipient, diluent, vehicle or
filling agent) for administration to a subject. The terms
"pharmaceutically acceptable" and "physiologically acceptable" mean
a biologically acceptable formulation, gaseous, liquid or solid, or
mixture thereof, which is suitable for one or more routes of
administration, in vivo delivery or contact. Such formulations
include solvents (aqueous or non-aqueous), solutions (aqueous or
non-aqueous), emulsions (e.g., oil-in-water or water-in-oil),
suspensions, syrups, elixirs, dispersion and suspension media,
coatings, isotonic and absorption promoting or delaying agents,
compatible with pharmaceutical administration or in vivo contact or
delivery. Aqueous and non-aqueous solvents, solutions and
suspensions may include suspending agents and thickening agents.
Such pharmaceutically acceptable carriers include tablets (coated
or uncoated), capsules (hard or soft), microbeads, powder, granules
and crystals.
[0103] Cosolvents and adjuvants may be added to the formulation.
Non-limiting examples of cosolvents contain hydroxyl groups or
other polar groups, for example, alcohols, such as isopropyl
alcohol; glycols, such as propylene glycol, polyethyleneglycol,
polypropylene glycol, glycol ether; glycerol; polyoxyethylene
alcohols and polyoxyethylene fatty acid esters. Adjuvants include,
for example, surfactants such as, soya lecithin and oleic acid;
sorbitan esters such as sorbitan trioleate; and
polyvinylpyrrolidone.
[0104] Supplementary active compounds (e.g., preservatives,
antioxidants, antimicrobial agents including biocides and biostats
such as antibacterial, antiviral and antifungal agents) can also be
incorporated into the compositions. Pharmaceutical compositions may
therefore include preservatives, anti-oxidants and antimicrobial
agents.
[0105] Preservatives can be used to inhibit microbial growth or
increase stability of the active ingredient thereby prolonging the
shelf life of the pharmaceutical formulation. Suitable
preservatives are known in the art and include, for example, EDTA,
EGTA, benzalkonium chloride or benzoic acid or benzoates, such as
sodium benzoate. Antioxidants include, for example, ascorbic acid,
vitamin A, vitamin E, tocopherols, and similar vitamins or
provitamins.
[0106] An antimicrobial agent or compound directly or indirectly
inhibits, reduces, delays, halts, eliminates, arrests, suppresses
or prevents contamination by or growth, infectivity, replication,
proliferation, reproduction, of a pathogenic or non-pathogenic
microbial organism. Classes of antimicrobials include,
antibacterial, antiviral, antifungal and antiparasitics.
Antimicrobials include agents and compounds that kill or destroy
(-cidal) or inhibit (-static) contamination by or growth,
infectivity, replication, proliferation, reproduction of the
microbial organism.
[0107] Exemplary antibacterials (antibiotics) include penicillins
(e.g., penicillin G, ampicillin, methicillin, oxacillin, and
amoxicillin), cephalosporins (e.g., cefadroxil, ceforanid,
cefotaxime, and ceftriaxone), tetracyclines (e.g., doxycycline,
chlortetracycline, minocycline, and tetracycline), aminoglycosides
(e.g., amikacin, gentamycin, kanamycin, neomycin, streptomycin,
netilmicin, paromomycin and tobramycin), macrolides (e.g.,
azithromycin, clarithromycin, and erythromycin), fluoroquinolones
(e.g., ciprofloxacin, lomefloxacin, and norfloxacin), and other
antibiotics including chloramphenicol, clindamycin, cycloserine,
isoniazid, rifampin, vancomycin, aztreonam, clavulanic acid,
imipenem, polymyxin, bacitracin, amphotericin and nystatin.
[0108] Particular non-limiting classes of anti-virals include
reverse transcriptase inhibitors; protease inhibitors; thymidine
kinase inhibitors; sugar or glycoprotein synthesis inhibitors;
structural protein synthesis inhibitors; nucleoside analogues; and
viral maturation inhibitors. Specific non-limiting examples of
anti-virals include nevirapine, delavirdine, efavirenz, saquinavir,
ritonavir, indinavir, nelfinavir, amprenavir, zidovudine (AZT),
stavudine (d4T), larnivudine (3TC), didanosine (DDI), zalcitabine
(ddC), abacavir, acyclovir, penciclovir, valacyclovir, ganciclovir,
1,-D-ribofuranosyl-1,2,4-triazole-3 carboxamide,
9->2-hydroxy-ethoxy methylguanine, adamantanamine,
5-iodo-2'-deoxyuridine, trifluorothymidine, interferon and adenine
arabinoside.
[0109] Exemplary antifungals include agents such as benzoic acid,
undecylenicalkanolamide, ciclopiroxolamine, polyenes, imidazoles,
allylamine, thicarbamates, amphotericin B, butylparaben,
clindamycin, econaxole, amrolfine, butenafine, naftifine,
terbinafine, ketoconazole, elubiol, econazole, econaxole,
itraconazole, isoconazole, miconazole, sulconazole, clotrimazole,
enilconazole, oxiconazole, tioconazole, terconazole, butoconazole,
thiabendazole, voriconazole, saperconazole, sertaconazole,
fenticonazole, posaconazole, bifonazole, fluconazole, flutrimazole,
nystatin, pimaricin, amphotericin B, flucytosine, natamycin,
tolnaftate, mafenide, dapsone, caspofungin, actofunicone,
griseofulvin, potassium iodide, Gentian Violet, ciclopirox,
ciclopiroxolamine, haloprogin, ketoconazole, undecylenate, silver
sulfadiazine, undecylenic acid, undecylenicalkanolamide and
Carbol-Fuchsin.
[0110] The pH can be adjusted by use or addition of
pharmacologically acceptable acids or bases. Examples of inorganic
acids include: hydrochloric acid, hydrobromic acid, nitric acid,
sulfuric acid, and/or phosphoric acid. Examples of organic acids
are: ascorbic acid, citric acid, malic acid, tartaric acid, maleic
acid, succinic acid, fumaric acid, acetic acid, formic acid and/or
propionic acid, etc. Acids which form an acid addition salt with
the active ingredient may also be used. Examples of bases include
alkali metal hydroxides and alkali metal carbonates. If such bases
are used, the resulting salts which are contained in the
pharmaceutical formulation, are typically compatible with the acid.
If desired, mixtures of acids or bases may also be used.
[0111] Pharmaceutical compositions can optionally be formulated to
be compatible with a particular route of administration. Thus,
pharmaceutical compositions include carriers (excipients, diluents,
vehicles or filling agents) suitable for administration by various
routes and delivery to targets, locally, regionally or
systemically.
[0112] Exemplary routes of administration for contact or in vivo
delivery which a composition can optionally be formulated include
respiratory system (nasal, inhalation, respiration, intubation,
intrapulmonary instillation), oral, buccal, intrapulmonary,
intrauterine, intradermal, topical, dermal, parenteral, sublingual,
subcutaneous, intravascular, intrathecal, intraarticular,
intracavity, transdermal, iontophoretic, intraocular, ophthalmic,
optical, intravenous, intramuscular, intraglandular, intraorgan,
intralymphatic.
[0113] Nasal and instillation formulations typically include
aqueous solutions of active ingredient (compounds or agents)
optionally with one or more preservative or isotonic agents. Such
formulations are typically adjusted to a pH and isotonic state
compatible with nasal mucous membranes. A solvent may include only
water, or it may be a mixture of water and one or more other
components (e.g., ethanol). Typically, the maximum ethanol is up to
about 70-75%% by volume. The remaining volume may consist of water
or one or more other solvents in various proportions.
[0114] Formulations that include respirable or inhalable liquid or
solid particles of the active ingredient (e.g., compound, binding
agent) can have particles of a size sufficiently small to pass
through the mouth and larynx upon inhalation and continue into the
airways of the lungs (e.g., bronchi and alveoli). Particles
typically range in size from about 0.05, about 0.1, about 0.5,
about 1, about 2 to about 4, about 6, about 8, about 10 microns in
diameter. Particles of non-respirable size can be included in an
aerosol or spray to deposit in the throat. For nasal administration
or intrapulmonary instillation, a particle size in the range of
about 8, about 10, about 20, about 25 to about 35, about 50, about
100, about 150, about 250, about 500 .mu.m (diameter) is typical
for retention in nasal cavity or for instillation into lung.
[0115] Formulations suitable for parenteral administration comprise
aqueous and non-aqueous solutions, suspensions or emulsions of the
active compound, which preparations are typically sterile and can
be isotonic with the blood of the intended recipient. Non-limiting
illustrative examples include water, saline, dextrose, fructose,
ethanol, animal, vegetable or synthetic oils.
[0116] For transmucosal or transdermal administration (e.g.,
topical contact), penetrants can be included in the pharmaceutical
composition. Penetrants are known in the art, and include, for
example, for transmucosal administration, detergents, bile salts,
and fusidic acid derivatives. For transdermal administration, the
active ingredient can be formulated into aerosols, sprays,
ointments, salves, gels, or creams as generally known in the art.
For contact with skin, pharmaceutical compositions typically
include ointments, creams, lotions, pastes, gels, sprays, aerosols,
or oils. Carriers which may be used include Vaseline, lanolin,
polyethylene glycols, alcohols, transdermal enhancers, and
combinations thereof.
[0117] Compounds including LIGHT inhibitors, either alone or in
combination with a pharmaceutically acceptable carrier, second
compound, drug, etc. can be administered into the respiratory
system of a subject by inhalation, respiration, intubation, or
intrapulmonary instillation (into the lungs), for example.
Respiratory administration can be achieved using an aerosol or
spray of a gas, liquid or powdered nasal, intrapulmonary,
respirable or inhalable in a particle form. The particles include
the compound or binding agent, and optionally any other component
(e.g., second compound), and are administered or delivered to the
subject by inhalation, by nasal administration or instillation into
the airways or the lung.
[0118] Administration to airways can be accomplished using an
article of manufacture, such as container with or without an
aerosol. Liquid formulations may be squirted into the respiratory
system (e.g., nose) and the lung from a container by pressure or
using an aerosol propellant or a spray device or delivery system.
Administration can be passive or it can be assisted by a
pressurized delivery system or device. An aerosol, delivery system
or device can include a pressurized container containing liquid,
gas or dry powder.
[0119] An "aerosol formulation" refers to a preparation that
includes droplets or particles of active ingredient (e.g.,
compound, binding agent) suitable for delivery to respiratory
system (e.g., lung, airway, nasal and sinus epithelium). The
aerosol formulation can include a sufficient or effective amount of
a compound or agent and a pharmaceutically acceptable carrier,
optionally a propellant, in a container or aerosol or spray device
or delivery system. Aerosol formulations can deliver high
concentrations into airways with relatively low systemic
absorption, and include for example nasal sprays, inhalation
solutions, inhalation suspensions, and inhalation sprays. Nasal
sprays typically contain active ingredient dissolved or suspended
in solution or in an excipient, in nonpressurized dispensers that
deliver a metered dose of the ingredient.
[0120] For aerosol delivery, pH of the formulation is typically
between 5.0 and 7.0. If the aerosol is too acidic or basic, it can
cause bronchospasm and cough. The tolerized pH range is relative
and depends on a patient's tolerance: some patients tolerate a
mildly acidic aerosol, which in others will cause bronchospasm.
Typically, an aerosol formulation having a pH less than 4.5 induces
bronchospasm.
[0121] Compositions including compounds and binding agents can be
formulated in a dry powder for delivery into the endobronchial
space. Dry powder formulations provide stability, high volume
delivery per puff, and low susceptibility to microbial growth. Dry
powder formulations typically are stable at ambient temperature,
and have a physiologically acceptable pH of 4.0-7.5. Dry powder
formulations are convenient because they do not require any further
handling, such as dilution, prior to administration. Depending on
delivery device efficiency, effective dry powder dosage levels
typically fall in the range of about 10 to about 100 mg. Dry powder
formulations can be used directly in metered dose or dry powder
inhalers.
[0122] Aerosol and spray delivery systems and devices, also
referred to as "aerosol generators" and "spray generators" are
known in the art and include metered dose inhalers (MDI),
nebulizers (ultrasonic, electronic and other nebulizers), nasal
sprayers and dry powder inhalers.
[0123] MDIs typically include an actuator, a metering valve, and a
container that holds a suspension or solution, propellant, and
surfactant (e.g., oleic acid, sorbitan trioleate, lecithin). The
container may be pressurized or not, but typically it is either
squeezed to dispense the ingredient, or has an actuator connected
to a metering valve so that activation of the actuator causes a
predetermined amount to be dispensed from the container in the form
of an aerosol, which is inhaled by the subject. MDIs typically use
liquid propellant. Typically, metered-dose aerosol inhalers create
droplets that are 15 to 30 microns in diameter. Currently, MDI
technology is optimized to deliver masses of 1 microgram to 10 mg
of a therapeutic.
[0124] Nebulizers, also referred to as atomizers, are devices that
turn medication into a fine mist inhalable by a subject through a
face mask that covers the mouth and nose. Nebulizers provide small
droplets and high mass output which can be delivered to upper and
lower respiratory airways. Typically, nebulizers create droplets
down to about 1 micron in diameter. Doses administered by
nebulizers are typically larger than doses administered by
MDIs.
[0125] Nebulizers include air-jet and ultrasonic nebulizers, in
fluid connection with a reservoir containing disposed therein a
solution or suspension of active ingredient. Nebulizers (air-jet,
ultrasonic or electronic) are typically used for acute care of
nonambulatory patients and in infants and children. Airjet
nebulizers are relatively large but considered portable because of
the availability of small compressed air pumps. Ultrasonic and
electronic nebulizers are typically more portable because they
usually do not require a source of compressed air. An example of an
airjet nebulizer is the NE-C25 CompAir XLT Compressor Nebulizer
System (Omron.RTM. Healthcare). Examples of ultrasonic nebulizers
include the Zewa Portable Ultrasonic Nebulizer (Zewa, Inc.); the
MabisMist II Ultrasonic Nebulizer (Mabis Healthcare, Inc.); and the
MICROAir Ultrasonic Nebulizer (Omron.RTM. Healthcare). An example
of an electronic nebulizer is the Micro-Air.RTM. Electronic
Nebulizer with V.M.T. (Omron.RTM. Healthcare). Modified nebulizers
can have the addition of a one-way flow valve (e.g., Pari LC
Plus.TM., Pari Respiratory Equipment, Inc.), which delivers up to
20% more drug than unmodified nebulizers.
[0126] Components of the nebulizer are typically made of a material
suitable for their intended function. The housing of the nebulizer
and, if the function allows, other parts can be made of plastic
(PVC, Polycarbonate, polystyrene, polypropylene, polybutylene,
etc.). Plastic can be formed by injection molding. For medical
applications, physiologically acceptable materials are used.
[0127] Dry-powder inhalers (DPI) can be used to deliver the
compounds or agents, either alone or in combination with a
pharmaceutically acceptable carrier, second compound, etc. Dry
powder inhalers deliver active ingredient to airways and lungs
while the subject inhales through the device. DPIs typically do not
contain propellants or any other ingredients, only the medication,
but may optionally include other components. DPIs are typically
breath-activated, but may involve air or gas pressure to assist
delivery. For breath-activated DPIs, a subject need not coordinate
breathing with the activation of the inhaler.
[0128] There are two major DPI design classes. The first is a
device-metering design in which a reservoir of drug is stored
within the device and the subject `loads` a dose of the device into
the inhalation chamber, and the inspiratory flow of the patient
accelerates the powder out of the device and into the oral cavity.
The second type of DPI may also employ an air source, a gas source,
or electrostatics, in order to deliver the active ingredient.
Non-limiting examples of DPIs include Spinhaler.RTM. (Rhone-Poulenc
Rorer Pharmaceuticals, Collegeville, Pa.), Inhalator.RTM.
(Boehringer Ingelheim, Ingelheim, Germany), Rotahaler.RTM.
(GlaxoSmithKline), Turbulaler.RTM. (Astra Draco Pharmaceuticals,
Lund, Sweden) and Accuhaler (GlaxoSmithKline).
[0129] An aerosol, delivery system or device can include a
propellant. Exemplary propellants include chlorofluorocarbons
(e.g., trichlorofluoromethane, dichlorodifluoromethane,
dichlorotetrafluoromethane, CFC-11, CFC-12) and the non-d
chlorofluorocarbons, HFC-134A and HFC-227. Suitable fluorocarbon
(HFA) propellants are known in the art and include, for example,
HFA134a (1,1,1,2-tetrafluoroethane), HFA227
(1,1,1,2,3,3,3-heptafluoro-n-propane) and mixtures of HFA134a and
HFA227.
[0130] Pharmaceutical compositions and delivery systems appropriate
for compositions and methods of the invention are known to the
skilled artisan (see, e.g., Remington: The Science and Practice of
Pharmacy (2003) 20.sup.th ed., Mack Publishing Co., Easton, Pa.;
Remington's Pharmaceutical Sciences (1990) 18.sup.th ed., Mack
Publishing Co., Easton, Pa.; The Merck Index (1996) 12.sup.th ed.,
Merck Publishing Group, Whitehouse, N.J.; Pharmaceutical Principles
of Solid Dosage Forms (1993), Technonic Publishing Co., Inc.,
Lancaster, Pa.; Ansel and Stoklosa, Pharmaceutical Calculations
(2001) 11.sup.th ed., Lippincott Williams & Wilkins, Baltimore,
Md.; and Poznansky et al., Drug Delivery Systems (1980), R. L.
Juliano, ed., Oxford, N.Y., pp. 253-315)
[0131] LIGHT inhibitors and pharmaceutical compositions thereof can
be packaged in unit dosage form (capsules, troches, cachets,
lozenges, or tablets) for ease of administration and uniformity of
dosage. "Unit dosage form" as used herein refers to physically
discrete units suited as dosages for treatment or therapy. Each
unit contains a predetermined quantity of agent in association with
the pharmaceutical carrier (excipient, diluent, vehicle or filling
agent) which, when administered in one or more doses, is calculated
to produce a desired beneficial effect. Unit dosage forms also
include, for example, ampules and vials, which may include a
composition in a freeze-dried or lyophilized state; a sterile
liquid carrier, for example, can be added prior to administration
or delivery in vivo. Unit dosage forms additionally include, for
example, ampules and vials with liquid compositions disposed
therein. Unit dosage forms further include compositions for
transdermal administration, such as "patches" adapted to remain in
contact with the epidermis of the intended recipient for an
extended or brief period of time. The individual unit dosage forms
can be included in multi-dose kits or containers.
[0132] Dose amounts, frequency and duration for binding agents,
including LIGHT inhibitors, or pro-drugs therof, can be can be
empirically determined in appropriate animal models. Dose amounts,
frequency and duration can also be determined and optimized in
human clinical trials.
[0133] The dosage amount can range from about 0.0001 mg/kg of
subject body weight/day to about 1,000.0 mg/kg of subject body
weight/day. Of course, doses can be more or less, as appropriate,
for example, 0.00001 mg/kg of subject body weight to about 10,000.0
mg/kg of subject body weight, about 0.001 mg/kg, to about 1,000
mg/kg, about 0.01 mg/kg, to about 100 mg/kg, or about 0.1 mg/kg, to
about 10 mg/kg of subject body weight over a given time period,
e.g., 1, 2, 3, 4, 5 or more hours, days, weeks, months, years, in
single bolus or in divided/metered doses.
[0134] As a non-limiting example, for treatment of lung or airway
inflammation, or asthma (e.g., allergic or non-allergic asthma or
rhinitis), a subject may be administered in single bolus or in
divided/metered doses in the range of about 10 to 50,000 micrograms
("mcg")/day, 10 to 20,000 mcg/day, 10 to 10,000 mcg/day, 25-1,000
mcg/day, 25 to 400 mcg/day, 25-200 mcg/day, 25-100 mcg/day or 25-50
mcg/day, which can be adjusted to be greater or less according to
the weight of the subject, e.g., per pound, kilogram, etc.
[0135] LIGHT inhibitors, combinations of LIGHT inhibitors and other
actives and pharmaceutical formulations thereof can be administered
to a subject at any frequency, as a single bolus or in
divided/metered doses, one, two, three, four or more times over a
given time period, e.g., per hour, day, week, month or year.
Exemplary dosage frequencies for airway or lung conditions,
disorders or diseases, such as asthma can vary, but are typically
from 1-7 times, 1-5 times, 1-3 times, 2-times or once, daily,
weekly or monthly, to reduce, inhibit, decrease, delay, prevent,
halt or eliminate progression, severity, frequency, duration, or
probability of one or more adverse symptoms of the conditions,
disorders or diseases, as set forth herein or that would be
apparent to one skilled in the art. Timing of contact,
administration or in vivo delivery can be dictated by the
condition, disorder or disease to be treated. For example, an
amount can be administered to the subject substantially
contemporaneously with, or within about 1-60 minutes or hours of
the onset of a symptom associated with or caused by lung or airway
inflammation, asthma (e.g., non-allergic asthma, allergic asthma,
or an asthmatic episode) or airway-constriction, -narrowing or
-obstruction, or a respiratory, interstitial or pulmonary disease
or disorder.
[0136] Dosage amount, frequency or duration can be increased, if
necessary, or reduced, for example, once control of the condition,
disorder or disease is achieved, dose amounts, frequency or
duration can be reduced. Other conditions, disorders or diseases of
the airways and lungs can be similarly treated, dosing amount,
frequency or duration reduced, when adequate control of the
condition, disorder or disease is achieved.
[0137] Of course, the dosage amount, frequency and duration can
vary depending upon the judgment of the skilled artisan which will
consider various factors such as whether the treatment is
prophylactic or therapeutic, the type or severity of the condition,
disorder or disease, the associated symptom to be treated, the
clinical endpoint(s) desired such as the type and duration of
beneficial or therapeutic effect. Additional non-limiting factors
to consider in determining appropriate dosage amounts, frequency,
and duration include previous or simultaneous treatments, potential
adverse systemic, regional or local side effects, the individual
subject (e.g., general health, age, gender, race, bioavailability),
condition of the subject such as other disorders or diseases
present and other treatments or therapies that the subject has or
is undergoing (e.g., medical history). The skilled artisan will
appreciate the factors that may influence the dosage, frequency and
duration required to provide an amount sufficient to provide a
subject with a beneficial effect, such as a therapeutic
benefit.
[0138] The invention provides kits including LIGHT inhibitors
suitable for practicing the methods, treatment protocols or
therapeutic regimes herein, and suitable packing material. In one
embodiment, a kit includes a LIGHT inhibitor, and instructions for
administering or using the LIGHT inhibitor. In another embodiment,
a kit includes a LIGHT inhibitor, an article of manufacture for
delivery of the LIGHT inhibitor to the target area, organ, tissue
or system (e.g., lungs or airways), and instructions for
administering the LIGHT inhibitor.
[0139] The term "packing material" refers to a physical structure
housing a component of the kit. The material can maintain the
components sterilely, and can be made of material commonly used for
such purposes (e.g., paper, corrugated fiber, glass, plastic, foil,
ampules, vials, tubes, etc.).
[0140] Kits of the invention can include labels or inserts. Labels
or inserts include "printed matter," e.g., paper or cardboard, or
separate or affixed to a component, a kit or packing material
(e.g., a box), or attached to a ampule, tube or vial containing a
kit component. Labels or inserts can additionally include a
computer readable medium, such as a disk (e.g., floppy diskette,
ZIP disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3,
magnetic tape, or an electrical storage media such as RAM and ROM
or hybrids of these such as magnetic/optical storage media, FLASH
media or memory type cards.
[0141] Labels or inserts can include identifying information of one
or more components therein (e.g., the binding agent or
pharmaceutical composition), dose amounts, clinical pharmacology of
the active agent(s) including mechanism of action, pharmacokinetics
and pharmacodynamics. Labels or inserts can include information
identifying manufacturer information, lot numbers, and location and
date of manufacture.
[0142] Labels or inserts can include information on a condition,
disorder or disease for which a kit component may be used. Labels
or inserts can include instructions for the clinician or subject
for using one or more of the kit components in a method, or
treatment protocol or therapeutic regimen. Instructions can include
dosage amounts, frequency or duration, and instructions for
practicing any of the methods, treatment protocols or therapeutic
regimes described herein.
[0143] Labels or inserts can include information on any benefit
that a component may provide, such as a therapeutic benefit. For
example, a non-limiting examples of a benefit would be improved
breathing or respiration, increased or improved airway dilation,
etc. A benefit could also include a reduced need (amount, frequency
or duration) for other medications, treatment protocols or
therapeutic regimes that the subject may be using or have used for
treatment of the condition, disorder or disease.
[0144] Labels or inserts can include information on potential
adverse side effects, such as warnings to the subject or clinician
regarding situations where it would not be appropriate to use a
particular composition (e.g., a LIGHT inhibitor). For example,
adverse side effects are generally more likely to occur at higher
dose amounts, frequency or duration of the active agent and,
therefore, instructions could include recommendations against
higher dose amounts, frequency or duration. Adverse side effects
could also occur when the subject has, will be or is currently
taking one or more other medications that may be incompatible with
the composition, or the subject has, will be or is currently
undergoing another treatment protocol or therapeutic regimen which
would be incompatible with the composition and, therefore,
instructions could include information regarding such
incompatibilities. Non-limiting examples of adverse side effects
include, for example, hypersensitivity, rash, neurological effects
such as tachycardia; palpitations; headache; tremor and
nervousness.
[0145] In accordance with the invention, there are provided methods
of identifying an agent that reduces or inhibits lung or airway
inflammation, methods of identifying an agent for treating asthma
and methods of identifying an agent for treating fibrosis. In one
embodiment, a method includes administering a test inhibitor of
LIGHT (p30 polypeptide) to a subject; and measuring lung or airway
inflammation in the subject, wherein a reduction or inhibition of
lung or airway inflammation identifies the test inhibitor as an
agent that reduces or inhibits lung or airway inflammation. In
another embodiment, a method includes administering a test
inhibitor of LIGHT (p30 polypeptide) to a subject; and measuring a
symptom of asthma in the subject, wherein a reduction or inhibition
of a symptom of asthma identifies the test inhibitor as an agent
for treating asthma. In a further embodiment, a method includes
administering a test inhibitor of LIGHT (p30 polypeptide) to a
subject; and measuring a symptom of fibrosis in the subject,
wherein a reduction or inhibition of a symptom of fibrosis
identifies the test inhibitor as an agent for treating
fibrosis.
[0146] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention relates. Although
methods and materials similar or equivalent to those described
herein can be used in the practice or testing of the present
invention, suitable methods and materials are described herein.
[0147] All applications, publications, patents and other
references, GenBank citations and ATCC citations cited herein are
incorporated by reference in their entirety. In case of conflict,
the specification, including definitions, will control.
[0148] As used herein, the singular forms "a", "and," and "the"
include plural referents unless the context clearly indicates
otherwise. Thus, for example, reference to "a LIGHT inhibitor"
includes a plurality of LIGHT inhibitors; and reference to "a
symptom" includes a plurality of symptoms (e.g., adverse or
undesirable). Of course, this does not preclude limiting certain
embodiments of the invention to specific LIGHT inhibitors or
antagonists, particular symptoms, particular conditions, disorders
or diseases, particular subjects, etc., using appropriate
language.
[0149] As used herein, all numerical values or numerical ranges
include integers within such ranges and fractions of the values or
the integers within ranges unless the context clearly indicates
otherwise. Thus, to illustrate, reference to a range of 90-100%,
includes 91%, 92%, 93%, 94%, 95%, 95%, 97%, etc., as well as 91.1%,
91.2%, 91.3%, 91.4%, 91.5%, etc., 92.1%, 92.2%, 92.3%, 92.4%,
92.5%, etc., and so forth. Reference to a range of 0-72 hrs,
includes 1, 2, 3, 4, 5, 6, 7 hrs, etc., as well as 1, 2, 3, 4, 5,
6, 7 minutes, etc., and so forth. Reference to a range of doses,
such as 0.1-1 ug/kg, 1-10 ug/kg, 10-25 ug/kg, 25-50 ug/kg, 50-100
ug/kg, 100-500 ug/kg, 500-1,000 ug/kg, 1-5 mg/kg, 5-10 mg/kg, 10-20
mg/kg, 20-50 mg/kg, 50-100 mg/kg, 100-250 mg/kg, 250-500 mg/kg,
includes 0.11-0.9 ug/kg, 2-9 ug/kg, 11.5-24.5 ug/kg, 26-49 ug/kg,
55-90 ug/kg, 125-400 ug/kg, 750-800 ug/kg, 1.1-4.9 mg/kg, 6-9
mg/kg, 11.5-19.5 mg/kg, 21-49 mg/kg, 55-90 mg/kg, 125-200 mg/kg,
275.5-450.1 mg/kg, etc.
[0150] The invention is generally disclosed herein using
affirmative language to describe the numerous embodiments. The
invention also specifically includes embodiments in which
particular subject matter is excluded, in full or in part, such as
substances or materials, method steps and conditions, protocols,
procedures, assays or analysis disclosed herein. As an example, the
invention includes embodiments in which specific subject matter
disclosed herein is excluded from the embodiments. Thus, even
though the invention is generally not expressed herein in terms of
what the invention does not include, aspects that are not expressly
included in the invention are nevertheless expressly or inherently
disclosed herein.
[0151] A number of embodiments of the invention have been
described. Nevertheless, it will be understood that various
modifications may be made without departing from the spirit and
scope of the invention. Accordingly, the following examples are
intended to illustrate but not limit the scope of invention
described in the claims.
EXAMPLES
Example 1
[0152] This example includes studies showing LIGHT plays a role in
the development of chronic allergic lung inflammation and airway
remodeling.
[0153] Wild type C57BL/6 and LIGHT-deficient (LIGHT-/-) mice were
sensitized with 50 ug ovalbumin (OVA) with 0.5 mg alum
intraperitoneally (i.p.) on days 0 and 12 followed by 20 ug OVA
intranasal challenges on days 24, 26, 28 and then two times per
week for 4 weeks. Percent of BAL eosinophils at 1 day and 3 days
after last OVA challenge was determined. Results are shown in FIG.
1. BAL eosinophils are from 4 mice per group for each time
point.
[0154] Another study was conducted using wild type C57BL/6 and
LIGHT-deficient (LIGHT-/-) mice sensitized with 50 ug ovalbumin
(OVA) with 0.5 mg alum intraperitoneally (i.p.) on days 0 and 12
followed by 20 ug intranasal OVA challenges on days 24, 26, 28 and
then two times per week for 6 weeks. Lung sections were stained
with trichrome to measure fibrosis, and for alpha-smooth muscle
actin to measure development of smooth muscle mass, both features
of airway remodeling; histographs are shown in FIG. 2A. The area of
fibrosis or smooth muscle was quantified using image analysis with
normalization for bronchial size, as shown in FIG. 2B. Results are
means+/-SEM of 36-48 bronchial regions per group.
[0155] Additionally naive CD4 cells from wild-type (wt) or LIGHT-/-
OT-II TCR transgenic mice were adoptively transferred into wt B6.PL
recipients. Mice were immunized i.p. with OVA in Alum to generate
Th2 cells. Transferred OT-II cells were visualized on day 8 by
staining for Thy1.2+ and CD4, as shown in FIG. 3A and FIG. 3C. The
degree of apoptosis occurring within these populations was
determined by co-staining for annexin V and 7-AAD after gating on
Thy1.2+ cells, as shown in FIG. 3B and FIG. 3D. The percentages of
early and late apoptotic cells are indicated. Data are
representative of 4 mice per group.
[0156] As described above, when LIGHT-deficient mice were
sensitized with ovalbumin (OVA) followed by repetitive intranasal
OVA challenges for four to six weeks, they exhibited reduced
eosinophilic lung inflammation (FIG. 1). Additionally, markedly
reduced peribronchial fibrosis and smooth muscle mass was found in
LIGHT-deficient mice. There was a 40-50% reduction in subepithelial
fibrosis and smooth muscle mass, important pathologic remodeling
features of chronic asthma (FIG. 2).
[0157] LIGHT may be directly acting in the lung to induce chronic
asthmatic changes. A potential source of LIGHT in the inflamed lung
are CD4+ T cells which are recovered at high levels in BAL
specimens from human asthmatics.
[0158] To investigate the role of LIGHT on CD4 cells,
LIGHT-deficient CD4 T cells were evaluated in adoptive recipients
that were immunized with OVA. When OVA-reactive T cells were
enumerated at the peak of the primary response (day 7), there was a
strong reduction in their number (80-90%) when LIGHT was not
expressed. As evidence that LIGHT controls the longevity and
survival of T cells, staining for annexin V and 7-AAD in FIGS. 3B
and 3D demonstrated that OVA-reactive CD4 cells displayed enhanced
percentages undergoing apoptosis, a prelude to death, in the
absence of LIGHT.
Example 2
[0159] This example includes studies demonstrating the requirement
of LIGHT in lung inflammation by controlling T cells, in a system
whereby T cells that could not express LIGHT were used to try to
induce asthmatic lung inflammation.
[0160] Naive wild-type (wt) or LIGHT-/- OT-II CD4 T cells were
activated in vitro for 3 days with anti-CD3 and anti-CD28 plus
IL-4, IL-2, and anti-IFN-.gamma., and then recultured without
further stimulation for 3 days. The resultant Th2 cells were
transferred into naive B6.PL recipients. Mice were exposed to
aerosolized OVA or PBS and then rested for several weeks. Mice were
then re-exposed to aerosolized OVA or PBS for 2 consecutive days. 1
day after the last challenge, lung and bronchial lavage samples
were obtained. Lung histology, by H&E; sections from two
individual OVA-challenged mice are shown in FIG. 4A. Total
leukocyte and eosinophil counts by differential cytospin stain; and
IL-5 and IL-13 expression by ELISA, were measured, results are
shown in FIG. 4B. First set of data in each case, animals
challenged with PBS. Second set, animals challenged with OVA. Data
from individual mice are shown with 3 mice per group.
[0161] In another study, using the experimental protocol in FIG. 4,
the total number of wt OT-II (left two bars) and LIGHT-/- OT-II
(right two bars) CD4 T cells accumulating after PBS or OVA
challenge were enumerated in mediastinal lymph nodes and lung after
staining for CD4 and Thy1.2 (FIG. 5). Data were average numbers
from 3 mice per group.
[0162] In another study, naive wild-type (Wt) or LIGHT-/- OT-II CD4
T cells were activated in vitro as in FIG. 4. The Th2 cells were
adoptively transferred i.v. into naive C57/BL6 WT hosts. Mice
received 20 ug OVA intranasal challenges on day 1, 3, 5 and then
chronic airway challenges two times per week for four weeks
beginning one day after cell transfer and were sacrificed one day
after last challenge. Percentages (left) and absolute numbers
(right) of donor CD4 Th2 cells expressing OVA-specific TCR
V.alpha.2V.beta.5 were determined in Bronchoalveolar lavage (BAL;
FIG. 6A), Lung (FIG. 6B), and lung-draining lymph node (FIG. 6C).
Samples were pooled from 3 mice in each group.
[0163] Transfer of primed Th2 cells into naive wild-type recipients
followed by administration of inhaled antigen showed that lung
inflammation was profoundly impaired when LIGHT was absent (FIG.
4). Inflammatory infiltrates in the lung were reduced based on
histological examination (FIG. 4A), and the levels of Th2 cytokines
and eosinophils present in bronchial lavages were reduced when
LIGHT-deficient CD4 cells were used (FIG. 4B). The accumulation of
LIGHT-deficient T cells in lungs and lung draining lymph nodes was
substantially lower after airway challenge such that a 70-80%
reduction in numbers was observed compared to animals receiving
control T cells that expressed LIGHT (FIG. 5).
[0164] To evaluate how LIGHT controls Th2 cells after chronic
repetitive allergen challenges that may be more relevant to human
asthma, LIGHT deficient and wild type CD4 cells were adoptively
transferred into wt mice followed by 11 intranasal challenges over
5 weeks. Strikingly, LIGHT-deficient T cells completely failed to
accumulate in the lung, bronchoalveolar lavage (BAL), and lung
draining lymph nodes (FIG. 6). The data show that LIGHT is
essential for controlling T cells in hosts that are repetitively
challenged with antigen in the lung over a long period of time.
Example 3
[0165] This example includes shows reduction of lung inflammation
after treatment with lymphotoxin beta receptor fusion protein
during chronic allergen challenge via the airways.
[0166] Wild type C57BL/6 mice were sensitized with 50 ug ovalbumin
(OVA) with 0.5 mg alum intraperitoneally (i.p.) on days 0 and 12
followed by 20 ug intranasal OVA challenges on days 24, 26, 28.
Mice were then intranasally challenged two times per week for four
more weeks with OVA, and lymphotoxin beta receptor Ig fusion
protein (LT.beta.R-Ig) was administered i.p. (50 ug) twice per week
starting one day before these OVA challenges. FIG. 7A shows total
cell infiltrate and eosinophils in BAL and FIG. 7B shows Total cell
infiltrate and eosinophils in lungs. BAL results from 6 mice per
group+/-SEM and Lung cell results are from pooled lungs from 3 mice
per group.
[0167] In order to test a therapeutic intervention in the model of
chronic asthma, a fusion protein (as described above) which
contains the lymphotoxin beta receptor (LT.beta.R) attached to the
constant region of human immunoglobulin IgG (LT.beta.R-Ig) was
administered to mice only after acute OVA-induced lung inflammation
was established, and treatment continued for four weeks during
repetitive antigen challenges via the airways. Compared with mice
that received control IgG there were reduced BAL leukocytes and
eosinophils, along with markedly decreased total lung cells and
eosinophils (FIG. 7). These results show that treatments targeting
LIGHT can be efficacious in chronic asthma.
[0168] The data show that the TNFR superfamily member LIGHT is
critical to the development of allergen induced airway remodeling
and fibrosis. Disruption of the LIGHT.quadrature.pathways by
targeting LIGHT therapeutically reduces lung inflammation. The
foregoing data therefore indicate that treatment targeting LIGHT
can be efficacious in asthma as well as other fibroproliferative
diseases in the lung, and other organs.
Sequence CWU 1
1
31240PRTHomo sapiens 1Met Glu Glu Ser Val Val Arg Pro Ser Val Phe
Val Val Asp Gly Gln1 5 10 15Thr Asp Ile Pro Phe Thr Arg Leu Gly Arg
Ser His Arg Arg Gln Ser 20 25 30Cys Ser Val Ala Arg Val Gly Leu Gly
Leu Leu Leu Leu Leu Met Gly 35 40 45Ala Gly Leu Ala Val Gln Gly Trp
Phe Leu Leu Gln Leu His Trp Arg 50 55 60Leu Gly Glu Met Val Thr Arg
Leu Pro Asp Gly Pro Ala Gly Ser Trp65 70 75 80Glu Gln Leu Ile Gln
Glu Arg Arg Ser His Glu Val Asn Pro Ala Ala 85 90 95His Leu Thr Gly
Ala Asn Ser Ser Leu Thr Gly Ser Gly Gly Pro Leu 100 105 110Leu Trp
Glu Thr Gln Leu Gly Leu Ala Phe Leu Arg Gly Leu Ser Tyr 115 120
125His Asp Gly Ala Leu Val Val Thr Lys Ala Gly Tyr Tyr Tyr Ile Tyr
130 135 140Ser Lys Val Gln Leu Gly Gly Val Gly Cys Pro Leu Gly Leu
Ala Ser145 150 155 160Thr Ile Thr His Gly Leu Tyr Lys Arg Thr Pro
Arg Tyr Pro Glu Glu 165 170 175Leu Glu Leu Leu Val Ser Gln Gln Ser
Pro Cys Gly Arg Ala Thr Ser 180 185 190Ser Ser Arg Val Trp Trp Asp
Ser Ser Phe Leu Gly Gly Val Val His 195 200 205Leu Glu Ala Gly Glu
Glu Val Val Val Arg Val Leu Asp Glu Arg Leu 210 215 220Val Arg Leu
Arg Asp Gly Thr Arg Ser Tyr Phe Gly Ala Phe Met Val225 230 235
2402283PRTHomo sapiens 2Met Glu Pro Pro Gly Asp Trp Gly Pro Pro Pro
Trp Arg Ser Thr Pro1 5 10 15Lys Thr Asp Val Leu Arg Leu Val Leu Tyr
Leu Thr Phe Leu Gly Ala 20 25 30Pro Cys Tyr Ala Pro Ala Leu Pro Ser
Cys Lys Glu Asp Glu Tyr Pro 35 40 45Val Gly Ser Glu Cys Cys Pro Lys
Cys Ser Pro Gly Tyr Arg Val Lys 50 55 60Glu Ala Cys Gly Glu Leu Thr
Gly Thr Val Cys Glu Pro Cys Pro Pro65 70 75 80Gly Thr Tyr Ile Ala
His Leu Asn Gly Leu Ser Lys Cys Leu Gln Cys 85 90 95Gln Met Cys Asp
Pro Ala Met Gly Leu Arg Ala Ser Arg Asn Cys Ser 100 105 110Arg Thr
Glu Asn Ala Val Cys Gly Cys Ser Pro Gly His Phe Cys Ile 115 120
125Val Gln Asp Gly Asp His Cys Ala Ala Cys Arg Ala Tyr Ala Thr Ser
130 135 140Ser Pro Gly Gln Arg Val Gln Lys Gly Gly Thr Glu Ser Gln
Asp Thr145 150 155 160Leu Cys Gln Asn Cys Pro Pro Gly Thr Phe Ser
Pro Asn Gly Thr Leu 165 170 175Glu Glu Cys Gln His Gln Thr Lys Cys
Ser Trp Leu Val Thr Lys Ala 180 185 190Gly Ala Gly Thr Ser Ser Ser
His Trp Val Trp Trp Phe Leu Ser Gly 195 200 205Ser Leu Val Ile Val
Ile Val Cys Ser Thr Val Gly Leu Ile Ile Cys 210 215 220Val Lys Arg
Arg Lys Pro Arg Gly Asp Val Val Lys Val Ile Val Ser225 230 235
240Val Gln Arg Lys Arg Gln Glu Ala Glu Gly Glu Ala Thr Val Ile Glu
245 250 255Ala Leu Gln Ala Pro Pro Asp Val Thr Thr Val Ala Val Glu
Glu Thr 260 265 270Ile Pro Ser Phe Thr Gly Arg Ser Pro Asn His 275
2803435PRTHomo sapiens 3Met Leu Leu Pro Trp Ala Thr Ser Ala Pro Gly
Leu Ala Trp Gly Pro1 5 10 15Leu Val Leu Gly Leu Phe Gly Leu Leu Ala
Ala Ser Gln Pro Gln Ala 20 25 30Val Pro Pro Tyr Ala Ser Glu Asn Gln
Thr Cys Arg Asp Gln Glu Lys 35 40 45Glu Tyr Tyr Glu Pro Gln His Arg
Ile Cys Cys Ser Arg Cys Pro Pro 50 55 60Gly Thr Tyr Val Ser Ala Lys
Cys Ser Arg Ile Arg Asp Thr Val Cys65 70 75 80Ala Thr Cys Ala Glu
Asn Ser Tyr Asn Glu His Trp Asn Tyr Leu Thr 85 90 95Ile Cys Gln Leu
Cys Arg Pro Cys Asp Pro Val Met Gly Leu Glu Glu 100 105 110Ile Ala
Pro Cys Thr Ser Lys Arg Lys Thr Gln Cys Arg Cys Gln Pro 115 120
125Gly Met Phe Cys Ala Ala Trp Ala Leu Glu Cys Thr His Cys Glu Leu
130 135 140Leu Ser Asp Cys Pro Pro Gly Thr Glu Ala Glu Leu Lys Asp
Glu Val145 150 155 160Gly Lys Gly Asn Asn His Cys Val Pro Cys Lys
Ala Gly His Phe Gln 165 170 175Asn Thr Ser Ser Pro Ser Ala Arg Cys
Gln Pro His Thr Arg Cys Glu 180 185 190Asn Gln Gly Leu Val Glu Ala
Ala Pro Gly Thr Ala Gln Ser Asp Thr 195 200 205Thr Cys Lys Asn Pro
Leu Glu Pro Leu Pro Pro Glu Met Ser Gly Thr 210 215 220Met Leu Met
Leu Ala Val Leu Leu Pro Leu Ala Phe Phe Leu Leu Leu225 230 235
240Ala Thr Val Phe Ser Cys Ile Trp Lys Ser His Pro Ser Leu Cys Arg
245 250 255Lys Leu Gly Ser Leu Leu Lys Arg Arg Pro Gln Gly Glu Gly
Pro Asn 260 265 270Pro Val Ala Gly Ser Trp Glu Pro Pro Lys Ala His
Pro Tyr Phe Pro 275 280 285Asp Leu Val Gln Pro Leu Leu Pro Ile Ser
Gly Asp Val Ser Pro Val 290 295 300Ser Thr Gly Leu Pro Ala Ala Pro
Val Leu Glu Ala Gly Val Pro Gln305 310 315 320Gln Gln Ser Pro Leu
Asp Leu Thr Arg Glu Pro Gln Leu Glu Pro Gly 325 330 335Glu Gln Ser
Gln Val Ala His Gly Thr Asn Gly Ile His Val Thr Gly 340 345 350Gly
Ser Met Thr Ile Thr Gly Asn Ile Tyr Ile Tyr Asn Gly Pro Val 355 360
365Leu Gly Gly Pro Pro Gly Pro Gly Asp Leu Pro Ala Thr Pro Glu Pro
370 375 380Pro Tyr Pro Ile Pro Glu Glu Gly Asp Pro Gly Pro Pro Gly
Leu Ser385 390 395 400Thr Pro His Gln Glu Asp Gly Lys Ala Trp His
Leu Ala Glu Thr Glu 405 410 415His Cys Gly Ala Thr Pro Ser Asn Arg
Gly Pro Arg Asn Gln Phe Ile 420 425 430Thr His Asp 435
* * * * *