U.S. patent application number 16/941515 was filed with the patent office on 2021-06-17 for serum amyloid p derivatives and their preparation and use.
The applicant listed for this patent is Promedior, Inc.. Invention is credited to Richard J. Caimi, W. Scott Willett.
Application Number | 20210179679 16/941515 |
Document ID | / |
Family ID | 1000005419531 |
Filed Date | 2021-06-17 |
United States Patent
Application |
20210179679 |
Kind Code |
A1 |
Willett; W. Scott ; et
al. |
June 17, 2021 |
SERUM AMYLOID P DERIVATIVES AND THEIR PREPARATION AND USE
Abstract
One aspect of the present invention relates to the surprising
discovery that modification of a glycan structure on a human SAP
polypeptide can increase the biological activity of the SAP
polypeptide relative to a corresponding sample of wild-type SAP
isolated from human serum. The disclosure provides both variant
human SAP polypeptides and methods for making the same. In
particular, the present invention provides methods and compositions
for in vitro and in vivo addition, deletion, or modification of
sugar residues to produce SAP polypeptides, such as a human SAP
polypeptide, having a desired glycosylation pattern.
Inventors: |
Willett; W. Scott;
(Doylestown, PA) ; Caimi; Richard J.; (Maple Glen,
PA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Promedior, Inc. |
Lexington |
MA |
US |
|
|
Family ID: |
1000005419531 |
Appl. No.: |
16/941515 |
Filed: |
July 28, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16731320 |
Dec 31, 2019 |
|
|
|
16941515 |
|
|
|
|
16417537 |
May 20, 2019 |
|
|
|
16731320 |
|
|
|
|
16156978 |
Oct 10, 2018 |
|
|
|
16417537 |
|
|
|
|
15492085 |
Apr 20, 2017 |
|
|
|
16156978 |
|
|
|
|
15264707 |
Sep 14, 2016 |
|
|
|
15492085 |
|
|
|
|
15054640 |
Feb 26, 2016 |
|
|
|
15264707 |
|
|
|
|
12794132 |
Jun 4, 2010 |
9296800 |
|
|
15054640 |
|
|
|
|
61217931 |
Jun 4, 2009 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 14/47 20130101;
A61K 38/00 20130101 |
International
Class: |
C07K 14/47 20060101
C07K014/47 |
Claims
1. A glycosylated human Serum Amyloid P (SAP) polypeptide
comprising an N-linked oligosaccharide chain, wherein at least one
branch of the oligosaccharide chain terminates with a
.alpha.2,3-linked sialic acid moiety.
2. A glycosylated human SAP polypeptide comprising an N-linked
oligosaccharide chain, wherein the oligosaccharide chain has at
least 50% fewer .alpha.2,6-linked sialic acid moieties than
wild-type SAP isolated from human serum.
3. The glycosylated human SAP polypeptide of claim 1, wherein all
branches of the oligosaccharide chain terminate with
.alpha.2,3-linked sialic acid moieties.
4. The glycosylated human SAP polypeptide of claim 1, wherein the
oligosaccharide chain is substantially free of .alpha.2,6-linked
sialic acid moieties.
5. The glycosylated human SAP polypeptide of claim 1, wherein the
polypeptide comprises an amino acid sequence at least 95% identical
to SEQ ID NO: 1.
6. The glycosylated human SAP polypeptide of claim 1, wherein the
polypeptide is a fusion protein comprising an SAP domain and one or
more heterologous domains.
7. The glycosylated human SAP polypeptide of claim 1, wherein the
polypeptide comprises one or more modified amino acid residues.
8. The glycosylated human SAP polypeptide of claim 7, wherein the
one or more modified amino acid residues comprise a PEGylated amino
acid, a prenylated amino acid, an acetylated amino acid, a
biotinylated amino acid, and/or an amino acid conjugated to an
organic derivatizing agent.
9. The glycosylated human SAP polypeptide of claim 1, wherein the
SAP polypeptide has an IC.sub.50 for inhibiting the differentiation
of monocytes into fibrocytes in vitro that is less than one-half
that of a corresponding sample of wild-type SAP isolated from human
serum.
10. A pharmaceutical preparation suitable for use in a mammal
comprising the human SAP polypeptide of claim 1 and a
pharmaceutically acceptable carrier.
11. A method of treating or preventing a-disorder or condition in a
patient, the method comprising administering to a patient in need
thereof a therapeutically effective amount of the SAP polypeptide
of claim 1, wherein the disorder or condition is selected from a
fibrotic or fibroproliferative disorder or condition, a
hypersensitivity disorder or condition, an autoimmune disorder or
condition, an inflammatory disorder or condition, and
mucositis.
12. A method of making a human SAP polypeptide, comprising: i)
expressing a human SAP polypeptide in a CHO cell; and ii) isolating
the human SAP polypeptide from the cell.
13. The method of claim 12, wherein the isolated SAP polypeptide
comprises an N-linked oligosaccharide chain, and wherein at least
one branch of the oligosaccharide chain terminates with a
.alpha.2,3-linked sialic acid moiety.
14. The method claim 12, wherein the isolated SAP polypeptide
comprises an N-linked oligosaccharide chain, and wherein the
oligosaccharide chain has at least 50% fewer .alpha.2,6-linked
sialic acid moieties than wild-type SAP isolated from human
serum.
15. The method of claim 12, wherein the isolated human SAP
polypeptide has an IC.sub.50 for inhibiting the differentiation of
monocytes into fibrocytes in vitro that is less than one-half that
of a corresponding sample wild-type SAP isolated from human
serum.
16. The method of claim 12, further comprising enzymatically or
chemically altering the isolated SAP polypeptide to produce an SAP
polypeptide having a modified oligosaccharide chain.
17. The method of claim 16, wherein the process of enzymatically or
chemically altering the isolated SAP polypeptide removes one or
more terminal .alpha.2,6-linked sialic acid moieties from the
oligosaccharide chain.
18. The method of claim 16, wherein the process of enzymatically or
chemically altering the isolated SAP polypeptide replaces one or
more terminal .alpha.2,6-linked sialic acid moieties on the
oligosaccharide chain with one or more .alpha.2,3-linked sialic
acid moieties.
19. A method of making an SAP polypeptide, comprising: i) providing
an SAP polypeptide, and ii) enzymatically or chemically altering
the SAP polypeptide to produce a glycosylated SAP polypeptide
comprising an N-linked oligosaccharide.
20. The method of claim 19, wherein the N-linked oligosaccharide
chain has at least 50% fewer .alpha.2,6-linked sialic acid moieties
than a wild-type human SAP protein isolated from human serum.
21. The method of claim 19, wherein at least one branch of the
oligosaccharide chain terminates in an .alpha.2,3-linked sialic
acid moiety.
22. The human SAP polypeptide of claim 19, wherein the glycosylated
SAP polypeptide has an IC.sub.50 for inhibiting the differentiation
of monocytes into fibrocytes in vitro that is less than one-half
that of a corresponding sample wild-type SAP isolated from human
serum.
23. A human SAP polypeptide prepared by a process comprising: i)
expressing a SAP polypeptide in a CHO cell; and ii) isolating the
SAP polypeptide from the cell.
24. The human SAP polypeptide of claim 23, wherein the SAP
polypeptide has an IC.sub.50 for inhibiting the differentiation of
monocytes into fibrocytes in vitro that is less than one-half that
of a corresponding sample of wild-type SAP isolated from human
serum.
25. A CHO cell comprising a nucleic acid encoding an exogenous SAP
polypeptide.
26. A human SAP polypeptide having an IC.sub.50 for inhibiting the
differentiation of monocytes into fibrocytes in vitro that is less
than one-half that of a corresponding sample of wild-type SAP
isolated from human serum.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 16/731,320, filed Dec. 31, 2019, (pending)
which is a continuation of U.S. application Ser. No. 16/417,537,
filed May 20, 2019, which is a continuation of U.S. patent
application Ser. No. 16/156,978, filed Oct. 10, 2018, which is a
continuation of U.S. patent application Ser. No. 15/492,085, filed
Apr. 20, 2017, which is a continuation of U.S. patent application
Ser. No. 15/264,707, filed Sep. 14, 2016, which is a continuation
of U.S. patent application Ser. No. 15/054,640, filed Feb. 26,
2016, which is a continuation of U.S. patent application Ser. No.
12/794,132, filed Jun. 4, 2010, now U.S. Pat. No. 9,296,800, which
claims the benefit of U.S. Provisional Application Ser. No.
61/217,931, filed on Jun. 4, 2009. All of the teachings of each of
the above-referenced applications are incorporated herein by
reference.
BACKGROUND OF THE INVENTION
[0002] Serum Amyloid P (SAP) is a member of the pentraxin family of
proteins. SAP is secreted by the liver and circulates in the blood
as a stable pentamer. Previous research demonstrates SAP has an
important role in both the initiation and resolution phases of the
immune response. SAP can bind to sugar residues on the surface of
bacteria and thereby promote their opsonization and engulfment by
antigen-presenting cells. SAP also binds to free DNA and chromatin
generated by apoptotic cells at the resolution of an immune
response, thus preventing a secondary inflammatory response against
these antigens. Molecules bound by SAP are removed from
extracellular areas due to the ability of SAP to bind to all three
classical Fc.gamma.. receptors (Fc.gamma.R), having a particular
affinity for Fc.gamma.RII (CD32) and Fc.gamma.RIII (CD16). After
receptor binding, SAP and any attached complex are generally
internalized and processed by the cell.
[0003] Recently, it has been suggested that SAP can be used as a
therapeutic agent to treat various disorders, including
fibrosis-related disorders, hypersensitivity disorders, autoimmune
disorders, mucositis, and inflammatory disorders such as those
cause by microbial infection. See, for example, U.S. patent
application Ser. Nos. 11/707,333, 12/217,617, 12/720,845, and
12/720,847. Protein therapeutics for treating human disease have
revolutionized the health care industry. However, there are many
difficulties in producing a protein therapeutic having the
necessary potency and/or in sufficient quantity to be useful as a
therapeutic agent. Many potential therapeutic agents are modified
to increase their biological activity, such as plasma half-life,
relative to the naturally-derived protein. Recombinant expression
technology is usually implemented to produce polypeptides in
sufficient quantity. Unfortunately, many recombinant systems
produce polypeptides having different biological properties than
the naturally-derived forms, which may affect the pharmacokinetics,
safety, and efficacy of a therapeutic product.
[0004] Therefore, a need remains for developing SAP polypeptides,
and methods of manufacturing them, suitable for therapeutic
treatment of humans.
SUMMARY OF THE INVENTION
[0005] In part, the disclosure provides variant Serum Amyloid P
(SAP) polypeptides and methods for producing them. The present
invention includes methods and compositions for in vitro and in
vivo addition, deletion, or modification of sugar residues to
produce variant SAP polypeptides having a desired glycosylation
pattern.
[0006] In certain aspects, the disclosure provides a glycosylated
human SAP polypeptide, comprising an N-linked or O-linked
oligosaccharide chain that has at least one branch terminating with
a .alpha.2,3-linked sialic acid moiety.
[0007] In certain aspects, the disclosure provides a glycosylated
human SAP polypeptide, comprising an N-linked or O-linked
oligosaccharide chain that has at least 50% fewer .alpha.2,6-linked
sialic acid moieties than wild-type SAP isolated from human
serum.
[0008] In certain aspects, the disclosure provides methods of
making a glycosylated human SAP polypeptide, comprising expressing
a SAP polypeptide in a cell and isolating the SAP polypeptide from
the cell. In a preferred embodiment, the cell is a CHO cell. In
certain aspects, the cell is a CHO--S cell.
[0009] In certain aspects, the disclosure provides methods of
making a human SAP polypeptide, comprising expressing a human SAP
polypeptide in a CHO cell and isolating the human SAP polypeptide
from the cell.
[0010] In certain aspects, the disclosure provides methods of
making a human SAP polypeptide, comprising providing a glycosylated
human SAP polypeptide containing an N-linked or O-linked
oligosaccharide chain and enzymatically or chemically altering the
N-linked or O-linked oligosaccharide chain of the SAP polypeptide
to produce a modified glycosylated SAP polypeptide.
[0011] In certain aspects, the disclosure provides methods of
making a human SAP polypeptide, comprising providing a human SAP
polypeptide and enzymatically or chemically altering the SAP
polypeptide to produce a glycosylated SAP polypeptide comprising an
N-linked or O-linked oligosaccharide.
[0012] In certain aspects, the disclosure provides a human SAP
polypeptide prepared by a process comprising expressing a SAP
polypeptide in a CHO cell and isolating the SAP polypeptide from
the cell.
[0013] In certain aspects, the disclosure provides a CHO cell that
contains a human SAP polypeptide with an N-linked oligosaccharide
chain having at least one branch of the oligosaccharide chain
terminating with a .alpha.2,3-linked sialic acid moiety.
[0014] In certain aspects, the disclosure provides a CHO cell
containing a polynucleotide sequence encoding a human SAP
polypeptide.
[0015] In certain aspects, the disclosure provides a human SAP
polypeptide having an IC.sub.50 for inhibiting the differentiation
of monocytes into fibrocytes in vitro that is less than one-half,
less than one-third, less than one-fourth, less than one-tenth, or
less than one-hundredth than that of a corresponding sample of
wild-type SAP isolated from human serum.
[0016] In preferred embodiments, human SAP polypeptides of the
invention have an N-linked oligosaccharide chain. In some
embodiments, at least one branch of the N-linked oligosaccharide
chain terminates with a .alpha.2,3-linked sialic acid moiety. In
some embodiments, the N-linked oligosaccharide chain has at least
50% fewer .alpha.2,6-linked sialic acid moieties than a wild-type
SAP isolated from human serum. In some embodiments, all branches of
the N-linked oligosaccharide chain terminate with .alpha.2,3-linked
sialic acid moieties. In some embodiments, the N-linked
oligosaccharide chain is substantially free of .alpha.2,6-linked
sialic acid moieties. Glycovariant SAP polypeptides of the
invention may comprise one or more branches, e.g., the N-linked
oligosaccharide chain may be characterized as having a
bi-antennary, tri-antennary, tetra-antennary, or a penta-antennary
structure. In some embodiments, the N-linked oligosaccharide chain
comprises a pentasaccharide core of
Man[(.alpha.1,6-)-(Man(.alpha.1,3)]-Man(.beta.1,4)-GlcNAc(.beta.1,4)-GlcN-
Ac(.beta.1,N)-Asn. In some embodiments, the N-linked
oligosaccharide chain comprises at least one branch having the
structure NeuNAc2.alpha.3Gal.beta.4GlcNAc.beta.2Man.alpha.6. In
some embodiments, at least one branch of the N-linked
oligosaccharide chain is substantially free of galactose and
N-acetylglucosamine. In some embodiments, all the branches of the
N-linked oligosaccharide chain are substantially free of galactose
and N-acetylglucosamine. In some embodiments, at least one branch
of the N-linked oligosaccharide chain comprises one or more mannose
residues. In some embodiments, the N-linked oligosaccharide chain
comprises at least one fucose residue. Any of the glycovariant SAP
polypeptides of the invention may comprise at least one modified
glycosyl residue. A modified glycosyl residue may be conjugated to
one or more modifying groups selected from water-soluble and
-insoluble polymers, therapeutic moieties, diagnostic agents, and
biomolecules.
[0017] In certain aspects, the SAP polypeptide of the invention may
be a recombinant polypeptide. SAP polypeptide of the invention may
comprise an amino acid sequence at least 85%, 90%, 95%, 96%, 97%,
98%, 99% or 100% identical to SEQ ID Nos. 1, 2, 3, or 4.
Preferably, the SAP polypeptide is a human SAP protein. A human SAP
polypeptide of the invention may comprise an amino acid sequence at
least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID
NO: 1.
[0018] In certain aspects, the human SAP polypeptide of the
invention is a fusion protein comprising an SAP domain and one or
more heterologous domains. The heterologous domain may enhance one
or more of in vivo stability, in vivo half-life,
uptake/administration, tissue localization or distribution,
formation of protein complexes, and/or purification.
[0019] In certain aspects, the human SAP polypeptide of the
invention comprises one or more modified amino acid residues, e.g.,
a PEGylated amino acid, a glycosylated (e.g., O-linked
glycosylation) amino acid, a prenylated amino acid, an acetylated
amino acid, a biotinylated amino acid, and/or an amino acid
conjugated to an organic derivatizing agent. The modified amino
acid residues may enhance one or more of in vivo stability, in vivo
half-life, uptake/administration, tissue localization or
distribution, formation of protein complexes, and/or
purification.
[0020] In preferred embodiments, human SAP polypeptides of the
invention have increased biological activity relative to a
corresponding sample of wild-type SAP isolated from human serum. In
certain aspects, the SAP polypeptides of the invention have an
IC.sub.50 for inhibiting the differentiation of monocytes into
fibrocytes in vitro that is less than one-half, less than
one-third, less than one-fourth, less than one-tenth, or less than
one-hundredth that of a corresponding sample of wild-type SAP
isolated from human serum.
[0021] In certain aspects, methods of making any of the human SAP
polypeptides of the invention comprise an additional step of
enzymatically or chemically altering the SAP polypeptide to attach
an N-linked or O-linked oligosaccharide chain to the SAP
polypeptide or to modify the existing N-linked or O-linked
oligosaccharide chain of the SAP polypeptide. In some embodiments,
enzymatically or chemically altering the SAP polypeptide comprises
treating the SAP polypeptide with one or more enzymatic proteins
selected from glycosyltransferases, glycosidases, and phosphatases.
In some embodiments, the process of enzymatically or chemically
altering the SAP polypeptide is effected in the presence of one or
more sugar precursors. Suitable sugar precursors include, but are
not limited to, UDP-N-acetylglucosamine, CMP-N-glycolylneuraminic
acid UDP-N-acetylgalactosamine, CMP-N-acetylneuraminic acid,
UDP-galactose, and GDP-fucose. In some embodiments, the process of
enzymatically or chemically altering the SAP polypeptide removes
one or more terminal .alpha.2,6-linked sialic acid moieties from
the N-linked or O-linked oligosaccharide chain. In some
embodiments, the process of enzymatically or chemically altering
the isolated SAP polypeptide replaces one or more terminal
.alpha.2,6-linked sialic acid moieties on the oligosaccharide chain
with one or more .alpha.2,3-linked sialic acid moieties.
[0022] The disclosure further provides pharmaceutical preparations
of human SAP polypeptides of the invention suitable for use in a
mammal. Pharmaceutical preparations of the invention include at
least one of the SAP polypeptides disclosed herein and a
pharmaceutically acceptable carrier. In some embodiments, the
pharmaceutical preparation further comprises an additional active
agent. In some embodiments, the pharmaceutical preparation is
prepared as a sustained release formulation. In some embodiments,
pharmaceutical preparations of the disclosure are suitable for
administration to a patient topically, by injection, by intravenous
injection, by inhalation, by continuous depot, or by pump.
[0023] The disclosure further provides methods for treating or
preventing SAP-responsive disorders or conditions by administering
to a patient in need thereof a therapeutically effective amount of
one or more of the SAP polypeptides of the invention.
SAP-responsive disorders or conditions include, but are not limited
to, fibrotic or fibroproliferative disorders or conditions,
hypersensitivity disorders or conditions, autoimmune disorders or
conditions, inflammatory diseases or conditions, and mucositis. The
SAP polypeptide of the invention may be administered to a patient
topically, by injection, by intravenous injection, by inhalation,
by continuous depot or pump, or a combination thereof. In some
embodiments, the SAP polypeptide of the invention is administered
with one or more additional active agents.
BRIEF DESCRIPTIONS OF THE DRAWINGS
[0024] FIG. 1. Fibrocyte differentiation assay. An ELISA-based
assay was used to measure production of MDC after incubation of
monocytes with SAP polypeptides. The Y-axis indicates the average
potency (i.e., average of 7 independent experiments) of human
serum-derived SAP (hSAP) compared to recombinant human SAP (rhSAP)
isolated from CHO--S cells. Relative activity of hSAP is set at
1.0.
[0025] FIGS. 2A-2F. Glycan structural analysis of variant SAP
polypeptides. Liquid Chromatography Mass Spectrometry (LCMS)
analysis (FIG. 2A) and Anion-Exchange High Performance Liquid
Chromatography (AEX-HPLC) analysis (FIG. 2B) was used to determine
the sialic acid linkages on glycoremodeled recombinant human SAP
isolated from CHO--S cells. Liquid Chromatography Mass Spectrometry
(LCMS) analysis (FIG. 2C) and Anion-Exchange High Performance
Liquid Chromatography (AEX-HPLC) analysis (FIG. 2D) was used to
determine the sialic acid linkages on glycoremodeled hSAP (human
serum-derived SAP). Liquid Chromatography Mass Spectrometry (LCMS)
analysis (FIG. 2E) and Anion-Exchange High Performance Liquid
Chromatography (AEX-HPLC) analysis (FIG. 2F) was used to determine
the sialic acid linkages on rhSAP that was treated with an
.alpha.2,3-sialyltransferase to increase the number of terminal
2,3-linked sialic acids on the SAP glycans. For LCMS figures, the
X-axis represents mass in Daltons, and the Y-axis is represents
relative intensity. For the HPLC traces, the X-axis is the time in
minutes, and the Y-axis is absorbance units (mAU).
[0026] FIG. 3. Fibrocyte differentiation assay. An ELISA-based
assay was used to measure production of MDC after incubation of
monocytes with SAP variant polypeptides. The Y-axis indicates the
average relative activity of each SAP variant compared to a hSAP
reference standard, for which the activity is set at 1.0 (see the
left-most bar).
[0027] FIG. 4. Fibrocyte differentiation assay. Monocytes were
treated with hMCSF and then subsequently quantified for fibrocyte
differentiation. The X-axis represents the concentration of hMCSF
incubated with donor monocytes. The Y-axis indicates the amount of
fibrocyte proliferation at day five as measured by the enumeration
of fibrocytes per 5.0.times.10.sup.4 cells.
[0028] FIG. 5. Fibrocyte differentiation assay. Monocytes were
treated with hSAP and then subsequently quantified for fibrocyte
differentiation. The X-axis indicates the concentration of hSAP
incubated with donor monocytes. The Y-axis indicates the amount of
fibrocyte proliferation at day five as measured by the enumeration
of fibrocytes per 5.0.times.10.sup.4 cells.
DETAILED DESCRIPTION OF THE INVENTION
Overview
[0029] Most naturally occurring peptides have carbohydrate moieties
(i.e., glycans) attached to the peptide via specific linkages to
certain amino acids along the length of the primary peptide chain,
thus forming "glycopeptides." The glycosylation pattern on any
given peptide can have enormous implications for the function of
that peptide. For example, the structure of the N-linked glycans on
a peptide can impact various characteristics of the peptide,
including protease susceptibility, intracellular trafficking,
secretion, tissue targeting, biological half-life, and
antigenicity. The alteration of one or more of these
characteristics greatly affects the efficacy of a peptide in its
natural setting.
[0030] The glycan structures found in naturally occurring
glycopeptides are typically divided into two classes, N-linked and
O-linked glycans. Peptides expressed in eukaryotic cells are
typically N-glycosylated on asparagine residues at sites in the
peptide primary structure containing the sequence
asparagine-X-serine/threonine, where X can be any amino acid except
proline and aspartic acid. The carbohydrate portion of such
peptides is known as an N-linked glycan or N-linked
oligosaccharide. The early events of N-glycosylation occur in the
endoplasmic reticulum (ER) and are conserved in mammals, plants,
insects and other higher eukaryotes. First, an oligosaccharide
chain comprising fourteen sugar residues is constructed on a lipid
carrier molecule. As the nascent peptide is translated and
translocated into the ER, the entire oligosaccharide chain is
transferred to the amide group of the asparagine residue in a
reaction catalyzed by a membrane-bound glycosyltransferase enzyme.
The N-linked glycan is further processed both in the ER and in the
Golgi apparatus. The further processing generally entails removal
of some of the sugar residues and addition of other sugar residues
in reactions catalyzed by glycosylases and glycosyltransferases
specific for the sugar residues removed and added.
[0031] Typically, the final structures of the N-linked glycans are
dependent upon the organism in which the peptide is produced. For
example, peptides produced in bacteria are generally
unglycosylated. Peptides expressed in insect cells typically
contain high mannose or pauci-mannose N-linked oligosaccharide
chains. Peptides produced in mammalian cell culture are usually
differentially glycosylated depending upon the species and cell
culture conditions. Even in the same species and under the same
conditions, a certain amount of heterogeneity in the glycosyl chain
is sometimes encountered. In general, peptides produced in plant
cells comprise glycan structures that differ significantly from
those produced in animal cells.
[0032] A variety of methods have been proposed in the art to
customize the glycosylation pattern of a peptide, including methods
described in the Published International Applications Nos. WO
99/22764, WO 98/58964, and WO 99/54342 as well as in U.S. Pat. No.
5,047,335. Essentially, many of the enzymes required for the in
vitro glycosylation of peptides have been cloned and sequenced. In
some instances, these enzymes have been used in vitro to add
specific sugars to a glycan on a peptide. In other instances, cells
have been genetically engineered to express a combination of
enzymes and desired peptides such that addition of a desired sugar
moiety to an expressed peptide occurs within the cell.
[0033] Two principal classes of enzymes are used in the synthesis
of carbohydrates: glycosyltransferases and glycosidases.
Glycosyltransferases add or modify the existing oligosaccharide
structures on a peptide. Glycosyltransferases are effective for
producing specific products with good stereochemical and
regiochemical control. Glycosyltransferases have been used to
prepare oligosaccharides and to modify terminal N- and O-linked
carbohydrate structures, particularly on peptides produced in
mammalian cells. For example, the terminal oligosaccharides of
glycopeptides can be completely sialylated and/or fucosylated to
provide more consistent sugar structures using
glycosyltransferases, which may improves glycopeptide
pharmacodynamics and a variety of other biological properties.
[0034] The glycosidases are further classified as exoglycosidases
(e.g., .beta.-mannosidase, .beta.-glucosidase), and
endoglycosidases (e.g. Endo-A, Endo-M). Glycosidases normally
catalyze the hydrolysis of a glycosidic bond. However, under
appropriate conditions, they can be used to form this linkage. Most
glycosidases used for carbohydrate synthesis are exoglycosidases;
the glycosyl transfer occurs at the non-reducing terminus of the
substrate. The glycosidase binds a glycosyl donor in a
glycosyl-enzyme intermediate that is either intercepted by water to
yield the hydrolysis product, or by an acceptor, to generate a new
glycoside or oligosaccharide. An exemplary pathway using an
exoglycosidase is the synthesis of the core trisaccharide of all
N-linked glycopeptides, including the .beta.-mannoside linkage,
which is formed by the action of .beta.-mannosidase (Singh et al.,
Chem. Commun. 993-994 (1996)). Although their use is less common
than that of the exoglycosidases, endoglycosidases are also
utilized to prepare carbohydrates. Endoglycosidases can be used to
transfer an entire oligosaccharide chain, rather than a
monosaccharide, onto a polypeptide. Oligosaccharide fragments have
been added to substrates using endo-.beta.-N-acetylglucosamines,
such as endo-F andendo-M (Wang et al., Tetrahedron Lett. 37:
1975-1978; and Haneda et al., Carbohydr. Res. 292: 61-70 (1996).
Each of these classes of enzymes has been successfully used produce
glycosylated peptides. For a general review, see, Crout et al.,
Curr. Opin. Chem. Biol. 2: 98-111(1998).
[0035] Serum amyloid P (SAP) is a naturally occurring serum protein
in mammals composed of five identical subunits, or "promoters",
which are non-covalently associated in a disk-like complex. SAP
belongs to the pentraxin super family of proteins, which are
characterized by this cyclic pentameric structure. The classical
short pentraxins include SAP as well as C-reactive protein (Osmand,
A. P., et al., Proc. Nat. Acad. Sci., 74: 739-743, 1997). SAP is
normally synthesized in the liver and has a physiological half-life
of twenty-four hours. The sequence of the human SAP subunit is
disclosed below, which corresponds to amino acids 20-223 of Gene
bank Accession NO. NP_001630 (signal sequence not depicted).
TABLE-US-00001 (SEQ ID NO: 1)
HTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSL
FSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVS
WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKPD
RSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIR GYVIIKPLVWV
[0036] The sequence of the Gallus gallus SAP subunit is disclosed
below.
TABLE-US-00002 (SEQ ID NO: 2)
QEDLYRKVFVFREDPSDAYVLLQVQLERPLLNFTVCLRSYTDLTRPHS
LFSYATKAQDNEILLFKPKPGEYRFYVGGKYVTFRVPENRGEWEHVC
ASWESGSGIAEFWLNGRPWPRKGLQKGYEVGNEAVVMLGQEQDAY
GGGFDVYNSFTGEMADVHLWDAGLSPDKMRSAYLALRLPPAPLAWG
RLRYEAKGDVVVKPRLREALGA
[0037] The sequence of the Bos taurus SAP subunit is disclosed
below.
TABLE-US-00003 (SEQ ID NO: 3)
QTDLRGKVFVFPRESSTDHVTLITKLEKPLKNLTLCLRAYSDLSRGYSL
FSYNIHSKDNELLVFKNGIGEYSLYIGKTKVTVRATEKFPSPVHICTSW
ESSTGIAEFWINGKPLVKRGLKQGYAVGAHPKIVLGQEQDSYGGGFD
KNQSFMGEIGDLYMWDSVLSPEEILLVYQGSSSISPTILDWQALKYEIK GYVIVKPMVWG
[0038] The sequence of the Cricetulus migratorius SAP subunit is
disclosed below.
TABLE-US-00004 (SEQ ID NO: 4)
QTDLTGKVFVFPRESESDYVKLIPRLEKPLENFTLCFRTYTDLSRPHSLF
SYNTKNKDNELLIYKERMGEYGLYIENVGAIVRGVEEFASPVHFCTSW
ESSSGIADFWVNGIPWVKKGLKKGYTVKTQPSIILGQEQDNYGGGFDK
SQSFVGEMGDLNMWDSVLTPEEIKSVYEGSWLEPNILDWRALNYEMS GYAVIRPRVWH
[0039] One aspect of the present invention relates to the
surprising discovery that modification of a glycan structure on a
human SAP polypeptide can increase the biological activity of the
SAP polypeptide relative to a corresponding sample of wild-type SAP
isolated from human serum. As demonstrated by the examples of the
disclosure, isolated SAP from human serum contains only
.alpha.2,6-linked sialic acid residues. In contrast, recombinant
human SAP produced in CHO cells contains only .alpha.2,3-linked
sialic acid residues. Using in vitro cell-based bioassays,
.alpha.2,3-linked sialic acid SAP polypeptides were demonstrated to
have consistently higher activity than wild-type SAP (i.e., SAP
comprising .alpha.2,6-linked sialic acid moieties) isolated from
human serum. The variant SAP polypeptides of the invention would be
more effective as therapeutic agents due to their increased
biological potency. For example, more potent SAP variants may
require lower dosing and/or less frequent dosing relative to
wild-type SAP isolated from human serum. The present disclosure
provides both variant human SAP polypeptides and methods for making
the same. In particular, the disclosure includes methods and
compositions for in vitro and in vivo addition, deletion, or
modification of sugar residues to produce a human SAP polypeptide
having a desired glycosylation pattern.
Definitions
[0040] Unless defined otherwise, all technical and scientific terms
used herein generally have the same meaning as commonly understood
by one of ordinary skill in the art. Generally, the nomenclature
used herein and the laboratory procedures in cell culture,
molecular genetics, organic chemistry, and nucleic acid chemistry
and hybridization are those well known and commonly employed in the
art. Standard techniques are used for nucleic acid and peptide
synthesis. The techniques and procedures are generally performed
according to conventional methods in the art and various general
references (e.g., Sambrook et al., 1989, Molecular Cloning: A
Laboratory Manual, 2d ed. Cold Spring Harbor Laboratory Press, Cold
Spring Harbor, N.Y.), which are provided throughout this
document.
[0041] The articles "a" and "an" are used herein to refer to one or
to more than one (i.e., to at least one) of the grammatical object
of the article. By way of example, "an element" means one element
or more than one element.
[0042] As used herein, the terms "treatment" and "treating", refer
to obtaining a desired pharmacologic and/or physiologic effect. The
effect may be prophylactic in terms of completely or partially
preventing a disorder or symptom thereof and/or may be therapeutic
in terms of a partial or complete cure for a disorder and/or
adverse affect attributable to the disorder. "Treatment", as used
herein, covers any treatment of a disease in a mammal, particularly
in a human, and includes: (a) increasing survival time; (b)
decreasing the risk of death due to the disease; (c) inhibiting the
disease, i.e., arresting its development or reducing the rate of
disease progression; and (d) relieving the disease, i.e., causing
regression of the disease.
[0043] As used herein, a therapeutic that "inhibits" or "prevents"
a disorder or condition is a compound that, in a statistical
sample, reduces the occurrence of the disorder or condition in the
treated sample relative to an untreated control sample, or delays
the onset or reduces the severity of one or more symptoms of the
disorder or condition relative to the untreated control sample.
[0044] As used herein the terms "subject" and "patient" refer to
animals including mammals, such as humans. The term "mammal"
includes primates, domesticated animals including dogs, cats,
sheep, cattle, horses, goats, pigs, mice, rats, rabbits, guinea
pigs, captive animals such as zoo animals, and wild animals.
[0045] As used herein the term "tissue" refers to an organ or set
of specialized cells such as skin tissue, lung tissue, kidney
tissue, and other types of cells.
[0046] The term "therapeutic effect" is art-recognized and refers
to a local or systemic effect in animals, particularly mammals, and
more particularly humans caused by a pharmacologically active
substance. The phrase "therapeutically effective amount" means that
amount of such a substance that produces some desired local or
systemic effect at a reasonable benefit/risk ratio applicable to
any treatment. The therapeutically effective amount of such
substance will vary depending upon the subject and disease
condition being treated, the weight and age of the subject, the
severity of the disease condition, the manner of administration,
which can readily be determined by one of ordinary skill in the
art. For example, certain compositions described herein may be
administered in a sufficient amount to produce a desired effect at
a reasonable benefit/risk ratio applicable to such treatment.
[0047] As used herein, the term "nucleic acid" refers to a
polynucleotide such as deoxyribonucleic acid (DNA), and, where
appropriate, ribonucleic acid (RNA). The term should also be
understood to include, as equivalents, analogs of either RNA or DNA
made from nucleotide analogs, and, as applicable to the embodiment
being described, single-stranded (such as sense or antisense) and
double-stranded polynucleotide.
[0048] The terms "peptides", "proteins" and "polypeptides" are used
interchangeably herein. The term "purified protein" refers to a
preparation of a protein or proteins that are preferably isolated
from, or otherwise substantially free of, other proteins normally
associated with the protein(s) in a cell or cell lysate. The term
"substantially free of other cellular proteins" or "substantially
free of other contaminating proteins" is defined as encompassing
individual preparations of each of the proteins comprising less
than 20% (by dry weight) contaminating protein, and preferably
comprises less than 5% contaminating protein. Functional forms of
each of the proteins can be prepared as purified preparations by
using a cloned gene as is well known in the art. By "purified", it
is meant that the indicated molecule is present in the substantial
absence of other biological macromolecules, such as other proteins
(particularly other proteins which may substantially mask,
diminish, confuse or alter the characteristics of the component
proteins either as purified preparations or in their function in
the subject reconstituted mixture). The term "purified" as used
herein preferably means at least 80% by dry weight, more preferably
in the range of 85% by weight, more preferably 95-99% by weight,
and most preferably at least 99.8% by weight, of biological
macromolecules of the same type present (but water, buffers, and
other small molecules, especially molecules having a molecular
weight of less than 5000, can be present). The term "pure" as used
herein preferably has the same numerical limits as "purified"
immediately above.
[0049] "N-linked" oligosaccharides are those oligosaccharides that
are linked to a peptide backbone through asparagine, by way of an
asparagine-N-acetylglucosamine linkage. N-linked oligosaccharides
are also called "N-glycans." Naturally occurring N-linked
oligosaccharides have a common pentasaccharide core of
Man[(.alpha.1,6-)-(Man(.alpha.1,3)]-Man(.beta.1,4)-GlcNAc(.beta.1,4)-GlcN-
Ac(.beta.1,N). They differ in the presence of, and in the number of
branches (also called antennae) of peripheral sugars such as
N-acetylglucosamine, galactose, N-acetylgalactosamine, fucose, and
sialic acid. Optionally, this structure may also contain a core
fucose molecule and/or a xylose molecule.
[0050] The term "sialic acid" refers to any member of a family of
nine-carbon carboxylated sugars. The most common member of the
sialic acid family is N-acetyl-neuraminic acid (often abbreviated
as Neu5Ac, NeuAc, or NANA). A second member of the family is
N-glycolyl-neuraminic acid (Neu5Gc or NeuGc), in which the N-acetyl
group of NeuAc is hydroxylated. A third sialic acid family member
is 2-keto-3-deoxy-nonulosonic acid (KDN) (Nadano et al. (1986) J.
Biol. Chem. 261: 11550-11557; Kanamori et al., J. Biol. Chem. 265:
21811-21819 (1990)). Also included are 9-substituted sialic acids
such as a 9-O--C.sub.1C.sub.6-acyl-Neu5Ac like 9-O-lactyl-Neu5Ac or
9-O-acetyl-Neu5Ac, 9-deoxy-9-fluoro-Neu5Ac and
9-azido-9-deoxy-Neu5Ac. For review of the sialic acid family, see,
e.g., Varki, Glycobiology 2: 25-40 (1992); Sialic Acids: Chemistry,
Metabolism and Function, R. Schauer, Ed. (Springer-Verlag, New York
(1992)).
[0051] A "genetically engineered" or "recombinant" cell is a cell
having one or more modifications to the genetic material of the
cell. Such modifications include, but are not limited to,
insertions of genetic material, deletions of genetic material and
insertion of genetic material that is extrachromosomal whether such
material is stably maintained or not.
[0052] As used herein, the term "modified sugar," refers to a
naturally- or non-naturally-occurring carbohydrate that is
enzymatically added onto an amino acid or a glycosyl residue of a
peptide in a process of the invention. The modified sugar is
selected from a number of enzyme substrates including, but not
limited to, sugar nucleotides (mono-, di-, and tri-phosphates),
activated sugars (e.g., glycosyl halides, glycosyl mesylates) and
sugars that are neither activated nor nucleotides. A "modified
sugar" maybe covalently functionalized with a "modifying group."
Useful modifying groups include, but are not limited to,
water-soluble and -insoluble polymers, therapeutic moieties,
diagnostic moieties, biomolecules. The locus of functionalization
with the modifying group is selected such that it does not prevent
the "modified sugar" from being added enzymatically to a peptide or
glycosyl residue of the peptide.
Variant SAP Polypeptides
[0053] In part, the disclosure provides variant Serum Amyloid P
(SAP) polypeptides. In particular, SAP variants of the invention
include glycosylated human SAP polypeptides that comprise one or
more N-linked or O-linked oligosaccharide chains each independently
having one, two, three, four, five or more branches terminating
with an .alpha.2,3-linked sialic acid moiety. In some embodiments,
all the branches of the N-linked or O-linked oligosaccharide chains
terminate in .alpha.2,3-linked moieties. Other SAP variants of the
invention include glycosylated human SAP polypeptides that contain
an N-linked or O-linked oligosaccharide chains having at least 20%,
25%, 30%, 35% 40%, 45%, 50%, 55%, 60%, 65% 75%, 80%, 85%, or even
at least 95% fewer .alpha.2,6-linked sialic acid moieties than a
wild-type SAP polypeptide derived from human serum. In some
embodiments, the N-linked or O-linked oligosaccharide chains are
substantially free of .alpha.2,6-linked sialic acid moieties, e.g.,
having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99%
.alpha.2,6-linked sialic acid moieties relative to a wild-type SAP
polypeptide derived from human serum). Glycovariant SAP
polypeptides of the invention may comprise an N-linked
oligosaccharide or O-linked chain having one or more branches
(e.g., having a bi-antennary, tri-antennary, tetra-antennary,
penta-antennary, etc. structure). In certain embodiments, SAP
polypeptides of the invention comprise an N-linked or O-linked
oligosaccharide chain wherein one, two, three, four, or five
branches of the oligosaccharide chain are substantially free of
galactose and N-acetylglucosamine (e.g., having less than 80%, 85%,
90%, 95%, 97%, 98% or even less than 99% N-acetylglucosamine
relative to a wild-type SAP polypeptide derived from human serum).
Certain SAP polypeptides of the invention have N-linked or O-linked
oligosaccharide chains that are substantially free of galactose and
N-acetylglucosamine (e.g., having less than 80%, 85%, 90%, 95%,
97%, 98% or even less than 99% galactose and/or N-acetylglucosamine
relative to a wild-type SAP polypeptide derived from human serum).
In some embodiments, SAP polypeptides of the invention comprise an
N-linked or O-linked oligosaccharide chain wherein one, two, three,
four, or five branches of the oligosaccharide chain contain one or
more mannose residues. In certain embodiments, the SAP polypeptide
of the invention comprises an N-linked oligosaccharide having a
pentasaccharide core of
Man[(.alpha.1,6-)-(Man(.alpha.1,3)]-Man(.beta.1,4)-GlcNAc(.beta.1,4)-GlcN-
Ac(.beta.1,N)-Asn. This pentasaccharide core also may comprise one
or more fucose or xylose residues. In certain embodiments, SAP
polypeptides of the invention comprise an N-linked oligosaccharide
chain wherein one, two, three, four, or five branches of the
oligosaccharide chain have the structure
NeuNAc2.alpha.3Gal.beta.4GlcNAc.beta.2Man.alpha.6. SAP polypeptides
of the invention also may comprise an N-linked oligosaccharide
chain wherein all branches have the structure
NeuNAc2.alpha.3Gal.beta.4GlcNAc.beta.2Man.alpha.6.
[0054] Variant SAP polypeptides of the invention may comprise one
or more "modified" sugar residues. Modified sugars are substituted
at any position that allows for the attachment of the modifying
moiety or group. In preferred aspects, modified sugar is
substituted at a position that still allows the sugar to function
as a substrate for an enzyme used to couple the modified sugar to
the SAP peptide. A modifying group can be attached to a sugar
moiety by enzymatic means, chemical means or a combination thereof,
thereby producing a modified sugar, e.g., modified galactose,
fucose, or sialic acid. Modifying groups suitable for use in the
present invention as well as methods for conjugating these
modifying groups to sugar residues are described in the following
section.
[0055] In preferred aspects, variant SAP polypeptides of the
invention have an IC.sub.50 for inhibiting the differentiation of
monocytes into fibrocytes in vitro that is less than one-half that
of a corresponding sample of wild-type SAP isolated from human
serum. In some embodiments, variant SAP polypeptides of the
invention have an IC.sub.50 for inhibiting the differentiation of
monocytes into fibrocytes in vitro that is less than 1/3, less than
1/4, less than 1/10, or less than 1/100 that of a corresponding
sample of wild-type SAP isolated from human serum.
[0056] Variant SAP polypeptides of the invention may be at least
60%, at least 70%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
or 100% identical to the amino acid sequence of SEQ ID NO: 1, as
determined using the FASTDB computer program based on the algorithm
of Brutlag et al. (Comp. App. Biosci., 6:237-245 (1990)). In a
specific embodiment, parameters employed to calculate percent
identity and similarity of an amino acid alignment comprise:
Matrix=PAM 150, k-tuple=2, Mismatch Penalty=1, Joining Penalty=20,
Randomization Group Length=0, Cutoff Score=1, Gap Penalty=5 and Gap
Size Penalty=0.05.
[0057] The term "SAP polypeptide" encompasses functional fragments
and fusion proteins comprising any of the preceding. Generally, an
SAP polypeptide will be designed to be soluble in aqueous solutions
at biologically relevant temperatures, pH levels and osmolarity.
The SAP protomers that non-covalently associate together to form a
pentameric SAP complex may have identical amino acid sequences
and/or post-translational modifications or, alternatively,
individual SAP protomers within a single complex may have different
sequences and/or modifications. The term SAP polypeptide includes
polypeptides comprising any naturally occurring SAP polypeptide as
well as any variant thereof (including mutants, fragments, and
fusions). A SAP polypeptide of the invention may be a recombinant
polypeptide. In preferred embodiments, the SAP polypeptide of the
invention is a human SAP polypeptide.
[0058] In some embodiments, pharmaceutical compositions are
provided comprising a variant SAP polypeptide of the invention, or
a functional fragment thereof. In some aspects, the amino acid
sequence of a SAP variant may differ from SEQ ID NO: 1 by one or
more conservative or non-conservative substitutions. As used
herein, "conservative substitutions" are residues that are
physically or functionally similar to the corresponding reference
residues, i.e., a conservative substitution and its reference
residue have similar size, shape, electric charge, and/or chemical
properties (e.g., the ability to form covalent or hydrogen bonds).
Preferred conservative substitutions are those fulfilling the
criteria defined for an accepted point mutation in Dayhoff et al.,
Atlas of Protein Sequence and Structure 5:345-352 (1978 &
Supp.). Examples of conservative substitutions are substitutions
within the following groups: (a) valine, glycine; (b) glycine,
alanine; (c) valine, isoleucine, leucine; (d) aspartic acid,
glutamic acid; (e) asparagine, glutamine; (f) serine, threonine;
(g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine.
Additional guidance concerning which amino acid changes are likely
to be phenotypically silent can be found in Bowie et al., Science
247:1306-1310 (1990).
[0059] Variant SAP polypeptides and fragments thereof that retain
biological function are useful in the pharmaceutical compositions
and methods described herein. In some embodiments, a variant SAP
polypeptide or fragment thereof binds Fc.gamma.RI, Fc.gamma.RIIA,
and/or Fc.gamma.RIIIB. In some embodiments, a variant SAP
polypeptide or fragment thereof inhibits one or more of fibrocyte,
fibrocyte precursor, myofibroblast precursor, and/or hematopoietic
monocyte precursor differentiation. SAP variants may be generated
by modifying the structure of an SAP polypeptide for such purposes
as enhancing therapeutic efficacy or stability (e.g., ex vivo shelf
life and resistance to proteolytic degradation in vivo).
[0060] In certain aspects, the variant SAP polypeptides of the
disclosure may further comprise post-translational modifications in
addition to any that are naturally present in the SAP polypeptide.
Such modifications include, but are not limited to, acetylation,
carboxylation, glycosylation (e.g., O-linked oligosaccharides,
N-linked oligosaccharides, etc.), phosphorylation, and lipidation.
As a result, the modified SAP polypeptide may contain non-amino
acid elements, such as polyethylene glycols, lipids, poly- or
mono-saccharides, and phosphates.
[0061] In certain aspects, one or more modifications to the SAP
polypeptide described herein may enhance the stability of the SAP
polypeptide. For example, such modifications may enhance the in
vivo half-life of the SAP polypeptide or reduce proteolytic
degradation of the SAP polypeptide.
[0062] In certain aspects, variant SAP polypeptides of the
invention include fusion proteins having at least a portion of the
human SAP polypeptide and one or more fusion domains or
heterologous portions. Well known examples of such fusion domains
include, but are not limited to, polyhistidine, Glu-Glu,
glutathione S transferase (GST), thioredoxin, protein A, protein G,
and immunoglobulin heavy chain constant region (Fc), maltose
binding protein (MBP), or human serum albumin. A fusion domain may
be selected so as to confer a desired property. For example, some
fusion domains are particularly useful for isolation of the fusion
proteins by affinity chromatography. For the purpose of affinity
purification, relevant matrices for affinity chromatography, such
as glutathione-, amylase-, and nickel-, or cobalt-conjugated resins
are used. As another example, a fusion domain may be selected so as
to facilitate detection of the SAP polypeptides. Examples of such
detection domains include the various fluorescent protein (e.g.,
GFP) as well as "epitope tags," which are usually short peptide
sequences for which a specific antibody is available. Well known
epitope tags for which specific monoclonal antibodies are readily
available include FLAG, influenza virus hemagglutinin (HA) and
c-myc tags. In some cases, the fusion domains have a protease
cleavage site that allows the relevant protease to partially digest
the fusion proteins and thereby liberate the recombinant protein
therefrom. The liberated proteins can then be isolated from the
fusion domain by subsequent chromatographic separation. In some
cases, the SAP polypeptide may be fused to a heterologous domain
that stabilizes the SAP polypeptide in vivo. By "stabilizing" is
meant anything that increases serum half-life, regardless of
whether this is because of decreased destruction, decreased
clearance by the kidney, or other pharmacokinetic effect. Fusions
with the Fc portion of an immunoglobulin and serum albumin are
known to confer increased stability.
[0063] It is understood that different elements of the fusion
proteins may be arranged in any manner that is consistent with the
desired functionality. For example, an SAP polypeptide may be
placed C-terminal to a heterologous domain, or, alternatively, a
heterologous domain may be placed C-terminal to an SAP polypeptide.
The SAP polypeptide and the heterologous domain need not be
adjacent in a fusion protein, and additional domains or amino acid
sequences (e.g., linker sequences) may be included C- or N-terminal
to either domain or between the domains.
Methods of Producing Altered N-Glycosylation Molecules
[0064] Described herein are methods of producing variant human SAP
polypeptides. The methods generally involve a step of contacting an
SAP polypeptide with one or more chemical or enzymatic agents to
produce or modify a glycosylation structure on the SAP polypeptide.
The methods can be cell-based or non-cell based.
[0065] Enzymes useful for producing or modifying glycan structures
are well known in the art. Most enzymes/proteins useful in the
methods of the disclosure can be categorized into one of two
functional classes: glycosyltransferases and glycosidases.
Glycosyltransferases (e.g., N-acetylglucosaminyl-transferases,
galactosyl-transferases, fucosyl-transferases, sialyl-transferases,
glucosyl-transferases, mannosyl-transferases, etc.), as used
herein, refers to any enzyme/protein that has the ability to
transfer a donor sugar to an acceptor moiety. Glycosidases (e.g.,
glucosidases, mannosidases, N-acetylglucosaminidases, sialidases,
fucosidases, etc.), as used herein, refers to any enzyme/protein
that has the ability to catalyze the hydrolysis of the glycosidic
linkage between sugar moieties.
[0066] Cell-based methods for producing altered glyco-forms of an
SAP polypeptide use either wild-type (e.g., CHO cells) or
genetically engineered cells that have at least one modified
glycosylation activity relative to a human cell. Cells suitable for
the methods of the disclosure include, for example, fungal cells,
prokaryotic cell (i.e., bacteria, Archaea) plant cells, or animal
cells (e.g., nematode, insect, plant, bird, reptile, or mammal
(e.g., a mouse, rat, rabbit, hamster, gerbil, dog, cat, goat, pig,
cow, horse, whale, monkey, or human)). The cells can be primary
cells, immortalized cells, or transformed cells. Such cells can be
obtained from a variety of commercial sources and research resource
facilities, e.g., the American Type Culture Collection (Rockville,
Md.). In certain aspects, the cell used for producing a variant SAP
polypeptide is a CHO cell.
[0067] The term "glycosylation activity" refers to any activity
that is (i) capable of adding N-linked or O-linked glycans to a
target molecule (i.e., an oligosaccharyl-transferase activity);
(ii) removing N-linked or O-linked glycans from a target molecule;
(iii) modifying one or more N-linked or O-linked glycans on a
target molecule; (iv) modifying dolichol-linked oligosaccharides;
(v) capable of aiding the activity of one or more of the activities
under i-iv. Accordingly, glycosylation activity includes, for
example, glycosidase activity, glycosyltransferase activity, sugar
nucleotide synthesis, modification, or transporter activity.
Modification of one or more N-linked or O-linked glycans on a
target molecule includes the action of a
mannosylphosphoryl-transferase activity, a kinase activity, or a
phosphatase activity, e.g., a mannosylphosphoryl-transferase, a
kinase, or a phosphatase activity that alters the phosphorylation
state of glycans on target molecules.
[0068] Engineered cells useful in the methods of the disclosure may
have one or more genetic modifications including, but not limited
to: (i) deletion of an endogenous gene encoding a protein having
glycosylation activity; (ii) introduction of a recombinant nucleic
acid encoding a mutant form of a protein (e.g., endogenous or
exogenous protein) having an glycosylation activity; (iii)
introduction or expression of an RNA molecule that interferes with
the functional expression of a protein having the glycosylation
activity; (iv) introduction of a recombinant nucleic acid encoding
a wild-type (e.g., endogenous or exogenous) protein having
glycosylation activity; or (v) altering the promoter or enhancer
elements of one or more endogenous genes encoding proteins having
glycosylation activity to thus alter the expression of the encoded
proteins. RNA molecules described above include, for example,
small-interfering RNA (siRNA), short hairpin RNA (shRNA),
anti-sense RNA, or micro RNA (miRNA). It is understood that item
(ii) includes, for example, replacement of an endogenous gene
(e.g., by homologous recombination) with a gene encoding a protein
having greater glycosylation activity relative to the endogenous
gene so replaced.
[0069] The genetically engineered cells described herein have one
or more altered glycosylation activities such as: (i) an increase
in one or more glycosylation activities in the genetically modified
cell, (ii) a decrease in one or more glycosylation activities in
the genetically modified cell, (iii) a change in the localization
or intracellular distribution of one or more glycosylation
activities in the genetically modified cell, or (iv) a change in
the ratio of one or more glycosylation activities in the
genetically modified cell relative to an unmodified cell of the
same origin. It is understood that an increase in the amount of
glycosylation activity can be due to overexpression of one or more
proteins having glycosylation activity, an increase in copy number
of an endogenous gene (e.g., gene duplication), or an alteration in
the promoter, enhancer, or suppressor of an endogenous gene that
stimulates an increase in expression of the protein encoded by the
gene. A decrease in one or more glycosylation activities can be due
to overexpression of a mutant form (e.g., a dominant negative form)
of one or more proteins having glycosylation-altering activities,
introduction or expression of one or more interfering RNA molecules
that reduce the expression of one or more proteins having an
glycosylation activity, or deletion of one or more endogenous genes
that encode a protein having glycosylation activity.
[0070] Genetically engineered cells used by the methods of the
disclosure can express (e.g., overexpress) wild-type or mutant
genes encoding proteins having glycosylation activity. Such genes
include, but are not limited to, ALG7, ALG13, ALG14, ALG1, ALG2,
ALG11, RFT1, ALG3, ALG9, ALG12, ALG6, ALG8, ANL1, ALG10, ALG5,
OST3, OST4, OST6, STT3, OST1, OST5, WBP1, SWP1, OST2, DPM1, SEC59,
OCH1, MNN9, VAN1, MNN8, MNN10, MNN11, HOC1, MNN2, MNN5, MNN6, KTR1,
YUR1, MNN4, KRE2, KTR2, KTR3, MNN1, MNS1, MNN4, PNO1, MNN9,
glucosidase I, glucosidase II, or endomannosidase. Genes encoding
proteins having glycosylation activity can be from any species
(e.g., lower eukaryotes (e.g., fungus (including yeasts) or
trypanosomes), prokaryotes (i.e., bacteria or Archaea), plant, or
animal (e.g., insect, bird, reptile, or mammal, such as mouse or
rat, dog, cat, horse, goat, cow, pig, non-human primate, or human).
It is understood that genetically engineered cells used for the
methods of the disclosure can express any number of genes (e.g.,
genes encoding proteins having glycosylation activity) and/or any
combination of one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9 10, 11,
12, 15, or 20 or more) of any of the genes recited herein. In
addition, any genetically engineered cells used by the methods of
the disclosure may comprise any number of mutations that alter or
abrogate one or more glycosylation activities.
[0071] In some embodiments, the term "gene expression" or
"expression" refers to the cellular processes by which a
biologically active polypeptide is produced from a DNA sequence and
exhibits a biological activity in a cell. As such, gene expression
involves the processes of transcription and translation, but also
involves post-transcriptional and post-translational processes that
can influence a biological activity of a gene or gene product.
These processes include, but are not limited to, RNA syntheses,
processing, and transport, as well as polypeptide synthesis,
transport, and post-translational modification of polypeptides.
[0072] For example, the disclosure provides methods for making an
SAP polypeptide of the invention by expressing a SAP gene in a
cell. In some embodiments, the cell may contain an endogenous SAP
gene or fragment thereof. In other embodiments, a polynucleotide
coding for an exogenous SAP polypeptide or fragment thereof may be
introduced (e.g., transformed, transfected, etc.) into a cell.
Suitable SAP polynucleotides that can be introduced into a cell
include nucleic acid fragments as well as nucleic acid constructs
or expression vectors. In preferred embodiments, the endogenous or
exogenous gene encodes a human SAP polypeptide.
[0073] In some embodiments, the nucleic acid fragment, e.g.,
encoding a human SAP polypeptide, used to transform the host cell
may include a Shine-Dalgarno site (e.g., a ribosome binding site)
and a start site (e.g., the codon ATG) to initiate translation of
the transcribed message to produce the enzyme. It may, also include
a termination sequence to end translation. A termination sequence
is typically a codon for which there exists no corresponding
aminoacetyl-tRNA, thus ending polypeptide synthesis. In some
embodiments, a nucleic acid construct encoding an SAP polypeptide
can be delivered, for example, as an expression plasmid that, when
transcribed in the cell, produces as SAP polypeptide.
[0074] In some embodiments, a suitable expression vector comprises
a nucleotide sequence encoding an SAP polypeptide of the invention
operably linked to at least one regulatory sequence. Regulatory
sequences are art-recognized and are selected to direct expression
of any of the polypeptides of the disclosure. Accordingly, the term
regulatory sequence includes promoters, enhancers and other
expression control elements. Exemplary regulatory sequences are
described in Goeddel; Gene Expression Technology: Methods in
Enzymology, Academic Press, San Diego, Calif. (1990). For instance,
any expression control sequence that regulates the expression of a
DNA sequence when operatively linked to it may be used in these
vectors to express any of the polypeptides of the disclosure. Such
useful expression control sequences, include, for example, the
early and late promoters of SV40, tet promoter, adenovirus or
cytomegalovirus immediate early promoter, the lac system, the trp
system, the TAC or TRC system, T7 promoter whose expression is
directed by T7 RNA polymerase, the major operator and promoter
regions of phage lambda, the control regions for fd coat protein,
the promoter for 3-phosphoglycerate kinase or other glycolytic
enzymes, the promoters of acid phosphatase, e.g., Pho5, the
promoters of the yeast .alpha.-mating factors, the polyhedron
promoter of the baculovirus system and other sequences known to
control the expression of genes of prokaryotic or eukaryotic cells
or their viruses, and various combinations thereof. It should be
understood that the design of the expression vector may depend on
such factors as the choice of the host cell to be transformed
and/or the type of protein desired to be expressed. Moreover, the
vector's copy number, the ability to control that copy number and
the expression of any other protein encoded by the vector, such as
antibiotic markers, should also be considered.
[0075] In some embodiments, the nucleic acid fragment or expression
system used to transform the host cell optionally may include one
or more marker sequences. Generally speaking, suitable marker
sequences typically encode a gene product, usually an enzyme that
inactivates or otherwise detects or is detected by a compound in
the growth medium. For example, the inclusion of a marker sequence
may render the transformed cell resistant to an antibiotic, or it
may confer compound-specific metabolism on the transformed cell.
Examples of suitable marker sequences that confer resistance
include kanamycin, ampicillin, chloramphenicol and tetracycline.
Alternatively, rather than selective pressure, a marker gene may be
used that allows for detection of particular colonies containing
the gene, such as .beta.-galactosidase, where a substrate is
employed that provides for a colored product.
[0076] A variety of methods are suitable for transforming a cell of
the present invention with a nucleic acid fragment or expression
vector. Common transformation methods include electroporation,
liposomal-mediated transformation, calcium-mediated transformation,
and viral-mediated transfection
[0077] In certain aspects, when a host cell is transformed with a
nucleic acid fragment or expression system of the present
invention, the gene (e.g., human SAP) in said system can be
integrated into the chromosomal DNA of the host cells by a
so-called homologous recombination and the expression system will
be carried stably in the host.
[0078] In order to integrate the expression system in the vector
into chromosomal DNA of the host cells, an appropriate selection
marker gene may be used wherein said marker gene has a sequence
homologous to the gene on chromosomal DNA of the specific host
cell. Selection markers for such a purpose can be easily selected
by a skilled person. As an example, a preferred marker is a gene
that exists on a chromosome and relates to the metabolism of the
host cells. Namely, it is preferred to use a host which has been
modified in such a manner that the above-mentioned gene on the
chromosome will be inactivated by an appropriate means such as a
mutation. The host can then be subjected to a homologous
recombination with an expression vector containing the
corresponding intact gene, whereupon only transformants which
contain the normal metabolism gene can grow to be selected.
Therefore, if such a marker gene has been introduced to the
expression vector, a homologous recombination will take place
between the marker gene in said expression vector and the
corresponding portion of the chromosomal DNA, whereby the
expression cassette of the heterologous gene will simultaneously be
integrated into the chromosomal DNA.
[0079] In some embodiments, the term "expressing" a protein in a
cell also includes methods of introducing a protein itself into
cells. Therefore, in certain aspects, the disclosure provides
methods for making an SAP polypeptide of the invention by
introducing an SAP polypeptide into a cell. Techniques for
introducing polypeptides directly into a cell are known in the art
and generally involve a process of cell membrane permeation. Such
techniques include, but are not limited to, microinjection of SAP
polypeptides; encapsulating an SAP polypeptide within membrane
vesicles (e.g., liposomes, capsular bodies, erythrocyte ghosts,
protoplasts, etc.) and contacting them with a cell membrane to
thereby cause intracellular introduction of the SAP polypeptide by
fusion; using physical methods (e.g., mechanical, chemical,
electrical, etc.) that rely on macromolecules entering cells by
diffusion through holes transiently introduced in their plasma
membranes (e.g., scrape-loading, bead-loading, etc.); and by uptake
through natural endocytosis owing to cellular phagocytosis. A
method of intracellular introduction may utilize a
receptor-mediated pathway, wherein one of various receptors
expressed on the cell surface is set as a target and an SAP
polypeptide is attached (covalently or non-covalently) to the
cognate ligand that acts as a carrier moiety. Several methods have
been described for introducing proteins into living cells using
electrostatic adsorption, wherein the protein is first cationized
and then contacted with the negatively charged surface of a cell
(See Japanese Patent Publication No. 2004/049214).
[0080] In certain aspects, the disclosure provides CHO cells that
express a SAP polypeptide. In some embodiments, the CHO cell
expresses an exogenous SAP polypeptide. In preferred embodiments,
the CHO cell expresses a human SAP polypeptide. In some
embodiments, the disclosure provides CHO cells comprising a
polynucleotide sequence encoding an SAP polypeptide. In preferred
embodiments, the polynucleotide sequence encodes a human SAP
polypeptide. Any of the aforementioned techniques may be used to
"express" an SAP polypeptide of the invention in a CHO cell or any
other suitable cell disclosed herein.
[0081] Where any of the glycosylation activities of the wild-type
or genetically engineered cell are inducible or conditional on the
presence of an inducing cue (e.g., a chemical or physical cue), the
wild-type or genetically engineered cell can, optionally, be
cultured in the presence of an inducing agent before, during, or
subsequent to the introduction of the nucleic acid encoding a SAP
polypeptide or a SAP polypeptide. For example, following
introduction of the SAP polypeptide into the cell can be exposed to
a chemical inducing agent that is capable of promoting the
expression of one or more proteins having a wild-type or altered
N-glycosylation activity. Where multiple inducing cues induce
conditional expression of one or more proteins having wild-type
and/or altered N-glycosylation activity, a cell can be contacted
with multiple inducing agents. In some embodiments, the culture
medium may be modified to produce the desired glycan structure on
the SAP polypeptide. For example, the serum, glucose, and/or lipid
(e.g., dolichol) concentration of the medium may be modified for
optimal production of the desired SAP glycovariant. In some
embodiments, the temperature, pH, and/or osmolarity of culture
medium may be altered for optimal production of the desired SAP
glycovariant.
[0082] A variant SAP polypeptide of the invention can be further
processed in vivo or can be processed in vitro prior to or
following isolation from the cell or cell medium. The further
processing can include modification of one or more glycan residues
of the SAP polypeptide or modification to the SAP polypeptide other
than to its glycan structure(s). In some embodiments, the
additional processing of the SAP polypeptide can include the
addition (covalent or non-covalent joining) of one or more
heterologous moieties. In some embodiments, the further processing
involves enzymatic or chemical treatment of the SAP polypeptide.
Enzymatic treatment can involve contacting the SAP polypeptide with
one or more glycosidase, phosphodiesterase, phospholipase,
glycosyltransferase, or protease for a time sufficient to induce
the modification, addition, or deletion of glycan residues (e.g.,
galactose, mannose, fucose, sialic acid, xylose,
N-acetylglucosamine, etc.) on the SAP polypeptide. Customization of
an N-linked oligosaccharide chain may be accomplished by the
sequential modification, addition, or deletion of the desired sugar
moieties, using techniques well known in the art. Enzymatic
cleavage of carbohydrate moieties on peptide variants can be
achieved by the use of a variety of endo- and exo-glycosidases as
described by Thotakura et al., 1987, Meth. Enzymol. 138: 350.
Exemplary methods of adding sugar moieties are disclosed in U.S.
Pat. Nos. 5,876,980, 6,030,815, 5,728,554, and 5,922,577.
[0083] In certain embodiments, modification of the SAP glycan
structure requires the presence of one or more sugar nucleotides.
Exemplary sugar nucleotides that are used in the present invention
include nucleotide mono-, di- or triphosphates or analogs thereof.
In a preferred embodiment, the modified sugar nucleotide is
selected from a UDP-glycoside, CMP-glycoside, or a GDP-glycoside.
Even more preferably, the sugar nucleotide is selected from an
UDP-galactose, UDP-galactosamine, UDP-glucose, UDP-glucosamine,
GDP-mannose, GDP-fucose, CMP-sialic acid, CMP-N-glycolylneuraminic
acid or CMP-NeuAc. In certain embodiments, a modified sugar
nucleotide is utilized to add a modified sugar residue to the SAP
polypeptide. N-acetylamine derivatives of the sugar nucleotides are
also of use in the method of the invention.
[0084] Chemical addition or removal of glycosyl moieties can be
carried out by any suitable method. For example, chemical
deglycosylation may involve exposure of the SAP polypeptide to
trifluoromethanesulfonic acid, or another strong acid. This
treatment results in the cleavage of most or all sugars except the
linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while
leaving the peptide intact. Methods of chemical deglycosylation are
described by Haldmuddin et al., 1987, Arch. Biochem. Biophys. 259:
52 and by Edge et al., 1981, Anal. Biochem. 118: 131. Chemical
treatment can, for example, involve contacting the altered SAP
polypeptide with an acid, such as hydrofluoric acid, for a time
sufficient to induce modification of the SAP polypeptide.
Hydrofluoric acid treatment, under certain conditions, specifically
removes the mannose residues that are phosphodiester-linked to
glycans, while leaving the phosphate on the glycan. An altered SAP
polypeptide can be further processed by addition or removal of a
phosphate group from one or more N-glycans. For example, an altered
SAP polypeptide can be contacted with a mannosyl kinase or a
mannosyl phosphatase.
[0085] In certain aspects, it is desirable to modify only terminal
sugar moieties on the SAP polypeptide glycan structure (N-linked or
O-linked oligosaccharide). In some embodiments, one or more
branches of the SAP glycan structure are modified by the addition,
removal, substitution or modification of at least one terminal
sialic acid residue. Suitable methods for modifying glycans
described herein may be used to alter only the terminal sugar
moiety on the SAP glycan structure. In some embodiments, a terminal
sialic acid residue having an .alpha.2,6-linkage,
.alpha.2,8-linkage, or .alpha.2,9-linkage is replaced with one or
more terminal .alpha.2,3-linked sialic acid residue. In a
particular aspect, human SAP comprising terminal .alpha.2,6-linked
sialic residues is modified according to one of methods of the
disclosure in order to replace one or more of the terminal
.alpha.2,6-linked sialic residues with one or more
.alpha.2,3-linked sialic acid residues. In some embodiments, a
terminal .alpha.2,3-linked sialic acid residue is modified to add
one or more .alpha.2,6-linked, .alpha.2,8-linked, and/or
.alpha.2,9-linked sialic acid residues.
[0086] In certain aspects, the process of making an SAP polypeptide
of the invention involves a first step of deglycosylating the SAP
polypeptide. The SAP polypeptide may be partially or fully
deglycosylated. In some embodiments, the first step of
deglycosylation involves removing only terminal sugar moieties from
at least one branch of the glycan structure on the SAP polypeptide.
In some embodiments, the first step of deglycosylation removes at
least one .alpha.2,6-linked sialic acid residue. In some
embodiments, the first step of deglycosylation removes at least one
O-linked glycan. In some embodiments, the first step of
deglycosylation removes at least one N-linked glycan. In some
embodiments, the first step of deglycosylation removes all O-linked
and N-linked glycans. In some embodiments, a deglycosylated SAP
polypeptide (partially or fully) is further processed according to
the methods of the disclosure, which includes but is not limited
to, enzymatically or chemically modifying the partially or fully
deglycosylated SAP polypeptide, introducing the partially or fully
deglycosylated SAP polypeptide into a cell, or combination thereof,
wherein the method(s) produce a variant SAP polypeptide of the
invention. In some embodiments, after a partially or fully
deglycosylated SAP polypeptide has been introduced into a cell, it
may be further modified, in vivo or in vitro, according to the
methods of the disclosure to produce a variant SAP polypeptide of
the invention. Similarly, a partial or fully deglycosylated SAP
polypeptide that is modified in vitro, using enzymatic or chemical
methods described herein, may be introduced into a cell to produce
a variant SAP polypeptide of the invention.
[0087] It is understood that an SAP polypeptide of the invention
can be, but need not be, processed in a cell. For example, the
disclosure also provides cell-free methods of producing a variant
SAP polypeptide of the invention. In some aspects the cell-free
methods include the step of contacting an SAP polypeptide, under
glycosylation conditions, with a cell lysate prepared from a
wild-type cell (e.g., a fungal cell, a plant cell, or an animal
cell) or genetically engineered cell having at least one modified
glycosylation activity, wherein contacting the SAP polypeptide with
the cell lysate attaches an N-linked or O-linked oligosaccharide to
the SAP polypeptide or modifies an existing N-linked or O-linked
oligosaccharide on the SAP polypeptide. By "N-glycosylation
conditions" is meant that a mixture (e.g., of SAP polypeptide and
cell lysate) is incubated under conditions that allow for the
desired altered N-glycosylation.
[0088] Suitable methods for obtaining cell lysates that preserve
the activity or integrity of one or more glycosylation activities
in the lysate can include the use of appropriate buffers and/or
inhibitors, including nuclease, protease and phosphatase inhibitors
that preserve or minimize changes in N-glycosylation activities in
the cell lysate. Such inhibitors include, for example, chelators
such as ethylenediaminetetraacetic acid (EDTA), ethylene glycol
bis(P-aminoethyl ether) N,N,N1,N1-tetraacetic acid (EGTA), protease
inhibitors such as phenylmethylsulfonyl fluoride (PMSF), aprotinin,
leupeptin, antipain, and phosphatase inhibitors such as phosphate,
sodium fluoride, and vanadate. Inhibitors can be chosen such that
they do not interfere with or only minimally adversely affect the
N-glycosylation activity, or activities, of interest. Appropriate
buffers and conditions for obtaining lysates containing enzymatic
activities are described in, e.g., Ausubel et al. Current Protocols
in Molecular Biology (Supplement 47), John Wiley & Sons, New
York (1999); Harlow and Lane, Antibodies: A Laboratory Manual Cold
Spring Harbor Laboratory Press (1988); Harlow and Lane, Using
Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1999);
Tietz Textbook of Clinical Chemistry, 3rd ed. Burtis and Ashwood,
eds. W.B. Saunders, Philadelphia, (1999).
[0089] A cell lysate can be further processed to eliminate or
minimize the presence of interfering substances, as appropriate. If
desired, a cell lysate can be fractionated by any of a variety of
methods well known to those skilled in the art, including
subcellular fractionation, and chromatographic techniques such as
ion exchange, hydrophobic and reverse phase, size exclusion,
affinity, and hydrophobic charge-induction chromatography (see,
e.g., Scopes, Protein Purification: Principles and Practice, third
edition, Springer-Verlag, New York (1993); Burton and Harding, J.
Chromatogr. A 814:71-81 (1998)), or any other suitable purification
technique.
[0090] A cell lysate can be prepared in which whole cellular
organelles remain intact and/or functional. For example, a lysate
can contain one or more of intact rough endoplasmic reticulum,
intact smooth endoplasmic reticulum, or intact Golgi apparatus.
Suitable methods for preparing lysates containing intact cellular
organelles and testing for the functionality of the organelles are
described in, e.g., Moreau et al. (1991) J. Biol. Chem.
266(7):4329-4333; Moreau et al. (1991) J. Biol. Chem.
266(7):4322-4328; Rexach et al. (1991) J. Cell Biol.
114(2):219-229; and Paulik et al. (1999) Arch. Biochem. Biophys.
367(2):265-273; the disclosures of each of which are incorporated
herein by reference in their entirety.
[0091] The SAP polypeptide can be contacted with just one purified
protein having glycosylation activity. In some embodiments, the SAP
polypeptide can be contacted with more than one purified proteins
having glycosylation activity. One or more proteins having
glycosylation activity can be purified using standard protein
isolation techniques. An SAP polypeptide can be contacted with one
or more proteins in a suitable buffer for a time sufficient to
induce modification of the SAP polypeptides as described above. The
SAP polypeptide can be contacted with more than one protein at the
same time or sequentially. Where the SAP polypeptide is contacted
sequentially to more than one protein having glycosylation
activity, the SAP polypeptide can, but need not, be purified after
one or more steps. That is, an SAP polypeptide can be contacted
with protein activity "A" and then purified before contacting the
molecule to protein activity "B". Methods of modifying peptides as
such are known in the art, e.g., Lee and Park (2002) 30(6):716-720
and Fujita and Takegawa (2001) Biochem. Biophys. Res. Commun.
282(3):678-682, the disclosures of which are incorporated herein by
reference in their entirety.
[0092] In certain aspects, the methods of the disclosure comprise a
step of isolating an SAP polypeptide, e.g., from a cell or from
components of a cell lysate. Many standard techniques for protein
isolation are known in the art. For example, methods of isolating
polypeptides include, but are not limited to, size-exclusion
chromatography, reverse-phase chromatography, liquid chromatography
(e.g., HPLC), affinity chromatography (e.g., metal chelation or
immunoaffinity chromatography), ion-exchange chromatography,
hydrophobic-interaction chromatography, precipitation, differential
solubilization, immunoprecipitation, centrifugation (e.g.,
ultracentrifugation, sucrose gradient centrifugation, etc.) or any
combination thereof. In some embodiments, the SAP polypeptide may
be conjugated to an affinity tag to facilitate purification of the
polypeptide. Suitable affinity tags for SAP purification include,
but are not limited to, chitin binding protein (CBP), maltose
binding protein (MBP), glutathione-S-transferase (GST),
streptavidin, biotin, and poly(His) tags. Affinity tags may be
produced as part of the recombinant protein (i.e., as a fusion
protein comprising a heterologous affinity tag domain and an SAP
polypeptide domain) or attached (covalently or non-covalently) in
vivo or in vitro to the SAP polypeptide. In some embodiments,
multiple steps of purification can be used to isolate an SAP
polypeptide. For example, an SAP polypeptide comprising a
purification tag can be affinity-purified from a cell lysate or
multi-component mixture using affinity purification. Then the
affinity-purified SAP polypeptide can be further purified to remove
any minor unwanted contaminants by an additional purification step,
e.g., size exclusion chromatography or RP-HPLC. Where a polypeptide
of the invention is produced in a cell, the SAP polypeptide can be
isolated from the cell itself or from the media in which cell was
cultured. In some embodiments, SAP polypeptides of the invention
are produced and secreted from a cell into the culture media. In
these embodiments, isolation may comprise separation of the
cellular fraction from the soluble, SAP-containing fraction (e.g.,
by centrifugation).
[0093] In some aspects, it can be advantageous to link the SAP
polypeptide to a solid-phase support prior to contacting the target
molecule with one or more N-glycosylation activities. Such linkage
can allow for easier purification following the N-glycosylation
modifications. Suitable solid-phase supports include, but are not
limited to, multi-well assay plates, particles (e.g., magnetic or
encoded particles), a chromatography column, or a membrane.
[0094] In some embodiments, any of the altered SAP polypeptides
described herein can be attached to a heterologous moiety using
enzymatic or chemical means. A "heterologous moiety" refers to any
constituent that is joined (e.g., covalently or non-covalently) to
the altered target molecule, which constituent is different from a
constituent originally present on the SAP polypeptide. Heterologous
moieties include, for example, water-soluble and -insoluble
polymers, targeting moieties, therapeutic moieties, diagnostic
moieties, and biomolecules.
[0095] SAP polypeptides of the invention may comprise one or more
"modified" sugar residues. A modifying group can be attached to a
sugar moiety by enzymatic means, chemical means or a combination
thereof, thereby producing a modified sugar, e.g., modified
galactose, fucose, or sialic acid. When a modified sialic acid is
used, either a sialyl-transferase or a trans-sialidase can be used
in these methods. The sugars may be substituted at any position
that allows for the attachment of the modifying moiety, yet which
still allows the sugar to function as a substrate for the enzyme
used to couple the modified sugar to the peptide.
[0096] In general, the sugar moiety and the modifying group are
linked together through the use of reactive groups, which are
typically transformed by the linking process into a new organic
functional group or unreactive species. The sugar reactive
functional group(s) may be located at any position on the sugar
moiety. Reactive groups and classes of reactions useful in
practicing the present invention are generally those that are well
known in the art of bioconjugate chemistry. Currently favored
classes of reactions available with reactive sugar moieties are
those which proceed under relatively mild conditions. These
include, but are not limited to nucleophilic substitutions (e.g.,
reactions of amines and alcohols with acyl halides, active esters),
electrophilic substitutions (e.g., enamine reactions) and additions
to carbon-carbon and carbon-heteroatom multiple bonds (e.g.,
Michael reaction, Diels-Alder addition). These and other useful
reactions are discussed in, for example, Smith and March, Advanced
Organic Chemistry, 5th Ed., John Wiley & Sons, New York, 2001;
Hermanson, Bioconjugate Techniques, Academic Press, San Diego,
1996; and Feeney et al., Modification of Proteins; Advances in
Chemistry Series, Vol. 198, American Chemical Society, Washington,
D.C., 1982.
[0097] Useful reactive functional groups pendent from a sugar
nucleus or modifying group include, but are not limited to: (a)
carboxyl groups and various derivatives thereof (e.g.,
N-hydroxysuccinimide esters, N-hydroxybenzotriazole esters, acid
halides, acyl imidazoles, thioesters, p-nitrophenyl esters, alkyl,
alkenyl, alkynyl and aromatic esters); (b) hydroxyl groups, which
can be converted to, e.g., esters, ethers, aldehydes, etc.; (c)
haloalkyl groups, wherein the halide can be later displaced with a
nucleophilic group such as, for example, an amine, a carboxylate
anion, thiol anion, carbanion, or an alkoxide ion, thereby
resulting in the covalent attachment of a new group at the
functional group of the halogen atom; (d) dienophile groups, which
are capable of participating in Diels-Alder reactions such as, for
example, maleimido groups (e) aldehyde or ketone groups, such that
subsequent derivatization is possible via formation of carbonyl
derivatives such as, for example, imines, hydrazones,
semicarbazones or oximes, or via such mechanisms as Grignard
addition or alkyllithium addition; (f) sulfonyl halide groups for
subsequent reaction with amines, for example, to form sulfonamides;
(e) thiol groups, which can be, for example, converted to
disulfides or reacted with alkyl and acyl halides; (h) amine or
sulfhydryl groups, which can be, for example, acylated, alkylated
or oxidized; (i) alkenes, which can undergo, for example,
cycloadditions, acylation, Michael addition, metathesis, Heck
reaction, etc.; (j) epoxides, which can react with, for example,
amines and hydroxyl compounds.
[0098] The reactive functional groups can be chosen such that they
do not participate in, or interfere with, the reactions necessary
to assemble the reactive sugar nucleus or modifying group.
Alternatively, a reactive functional group can be protected from
participating in the reaction by the presence of a protecting
group. Those of skill in the art understand how to protect a
particular functional group such that it does not interfere with a
chosen set of reaction conditions. For examples of useful
protecting groups, see, for example, Greene et al., Protective
Groups in Organic Synthesis, John Wiley & Sons, New York,
1991.
[0099] In some embodiments, the modified sugar is an activated
sugar. Activated modified sugars useful in the present invention
are typically glycosides which have been synthetically altered to
include an activated leaving group. As used herein, the term
"activated leaving group" refers to those moieties which are easily
displaced in enzyme-regulated nucleophilic substitution reactions.
Many activated sugars are known in the art. See, for example,
Vocadlo et al., In Carbohydrate Chemistry and Biology, Vol. 2,
Ernst et al. Ed., Wiley-VCH Verlag: Weinheim, Germany, 2000; Kodama
et al., Tetrahedron Lett. 34: 6419 (1993); Lougheed, et al., J.
Biol. Chem. 274: 37717 (1999)). Examples of such leaving groups
include fluoro, chloro, bromo, tosylate, mesylate, triflate and the
like. Preferred activated leaving groups for use in the present
invention are those that do not significantly sterically encumber
the enzymatic transfer of the glycoside to the acceptor.
Accordingly, preferred embodiments of activated glycoside
derivatives include glycosyl fluorides and glycosyl mesylates, with
glycosyl fluorides being particularly preferred. Among the glycosyl
fluorides, .alpha.-galactosyl fluoride, .alpha.-mannosyl fluoride,
.alpha.-glucosyl fluoride, .alpha.-fucosyl fluoride,
.alpha.-xylosyl fluoride, .alpha.-sialyl fluoride,
.alpha.-N-acetylglucosaminyl fluoride, .alpha.-N-acetylglucosaminyl
fluoride, .beta.-galactosyl fluoride, .beta.-mannosyl fluoride,
.beta.-glucosyl fluoride, O-fucosyl fluoride, .beta.-xylosyl
fluoride, .beta.-sialyl fluoride, .beta.-N-acetylglucosaminyl
fluoride and .beta.-N-acetylgalactosaminyl fluoride are most
preferred.
[0100] In certain aspects, a modified sugar residue is conjugated
to one or more water-soluble polymers. Many water-soluble polymers
are known to those of skill in the art and are useful in practicing
the present invention. The term water-soluble polymer encompasses
species such as saccharides (e.g., dextran, amylose, hyaluronic
acid, poly(sialic acid), heparans, heparins, etc.); poly(amino
acids); nucleic acids; synthetic polymers (e.g., poly(acrylic
acid), poly(ethers), e.g., poly(ethylene glycol)); peptides,
proteins, and the like. The present invention may be practiced with
any water-soluble polymer with the sole limitation that the polymer
must include a point at which the remainder of the conjugate can be
attached.
[0101] Methods and chemistry for activation of water-soluble
polymers and saccharides as well as methods for conjugating
saccharides and polymers to various species are described in the
literature. Commonly used methods for activation of polymers
include activation of functional groups with cyanogen bromide,
periodate, glutaraldehyde, bi-epoxides, epichlorohydrin, divinyl
sulfone, carbodiimide, sulfonyl halides, trichlorotriazine, etc.
(see, R. F. Taylor, (1991), Protein Immobilization, Fundamentals
and Applications, Marcel Dekker, N.Y.; S. S. Wong, (1992),
Chemistry of Protein Conjugation and Crosslinking, CRC Press, Boca
Raton; G. T. Hermanson et al., (1993), Immobilized Affinity Ligand
Techniques, Academic Press, N.Y.; Dunn, R. L., et al., Eds.
Polymeric Drugs and Drug Delivery Systems, ACS Symposium Series
Vol. 469, American Chemical Society, Washington, D.C. 1991).
[0102] In certain aspects, a modified sugar residue is conjugated
to one or more water-insoluble polymers. In some embodiments,
conjugation to a water-insoluble polymer can be used to deliver a
therapeutic peptide in a controlled manner. Polymeric drug delivery
systems are known in the art. See, for example, Dunn et al., Eds.
Polymeric drugs and Drug Delivery Systems, ACS Symposium Series
Vol. 469, American Chemical Society, Washington, D.C. 1991. Those
of skill in the art will appreciate that substantially any known
drug delivery system is applicable to the conjugates of the present
invention.
[0103] Representative water-insoluble polymers include, but are not
limited to, polyphosphazenes, poly(vinyl alcohols), polyamides,
polycarbonates, polyalkylenes, polyacrylamides, polyalkylene
glycols, polyalkylene oxides, polyalkylene terephthalates,
polyvinyl ethers, polyvinyl esters, polyvinyl halides,
polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes,
poly(methyl methacrylate), poly(ethyl methacrylate), poly(butyl
methacrylate), poly(isobutyl methacrylate), poly(hexyl
methacrylate), poly(isodecyl methacrylate), poly(lauryl
methacrylate), poly(phenyl methacrylate), poly(methyl acrylate),
poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl
acrylate) polyethylene, polypropylene, poly(ethylene glycol),
poly(ethylene oxide), poly (ethylene terephthalate), poly(vinyl
acetate), polyvinyl chloride, polystyrene, polyvinyl pyrrolidone,
pluronics, and polyvinylphenol, and copolymers thereof.
[0104] These and the other polymers discussed herein can be readily
obtained from commercial sources such as Sigma Chemical Co. (St.
Louis, Mo.), Polysciences (Warrenton, Pa.), Aldrich (Milwaukee,
Wis.), Fluka (Ronkonkoma, N.Y.), and BioRad (Richmond, Calif.), or
else synthesized from monomers obtained from these suppliers using
standard techniques. Representative biodegradable polymers useful
in the conjugates of the invention include, but are not limited to,
polylactides, polyglycolides and copolymers thereof poly(ethylene
terephthalate), poly(butyric acid), poly(valeric acid),
poly(lactide-co-caprolactone), poly(lactide-co-glycolide),
polyanhydrides, polyorthoesters, blends and copolymers thereof. Of
particular use are compositions that form gels, such as those
including collagen, and pluronics.
[0105] In a preferred embodiment, one or more modified sugar
residues are conjugated to one or more PEG molecules.
[0106] In certain aspects, the modified sugar is conjugated to a
biomolecule. Biomolecule of the invention may include, but are not
limited to, functional proteins, enzymes, antigens, antibodies,
peptides, nucleic acids (e.g., single nucleotides or nucleosides,
oligonucleotides, polynucleotides and single- and higher-stranded
nucleic acids), lectins, receptors or a combination thereof. Some
preferred biomolecules are essentially non-fluorescent, or emit
such a minimal amount of fluorescence that they are inappropriate
for use as a fluorescent marker in an assay. Other biomolecules may
be fluorescent.
[0107] In some embodiments, the biomolecule is a targeting moiety.
A "targeting moiety" and "targeting agent", as used herein, refer
to species that will selectively localize in a particular tissue or
region of the body. In some embodiments, a biomolecule is selected
to direct the SAP polypeptide of the invention to a specific
intracellular compartment, thereby enhancing the delivery of the
peptide to that intracellular compartment relative to the amount of
underivatized peptide that is delivered to the tissue. The
localization is mediated by specific recognition of molecular
determinants, molecular size of the targeting agent or conjugate,
ionic interactions, hydrophobic interactions and the like. Other
mechanisms of targeting an agent to a particular tissue or region
are known to those of still in the art.
[0108] In some embodiments, the modified sugar includes a
therapeutic moiety. Those of skill in the art will appreciate that
there is overlap between the category of therapeutic moieties and
biomolecules, i.e., many biomolecules have therapeutic properties
or potential.
[0109] Classes of useful therapeutic moieties include, for example,
non-steroidal anti-inflammatory drugs; steroidal anti-inflammatory
drugs; adjuvants; antihistaminic drugs; antitussive drugs;
antipruritic drugs; anticholinergic drugs; anti-emetic and
antinauseant drugs; anorexic drugs; central stimulant drugs;
antiarrhythmic drugs; .beta.-adrenergic blocker drugs; cardiotonic
drugs; antihypertensive drugs; diuretic drugs; vasodilator drugs;
vasoconstrictor drugs; antiulcer drugs; anesthetic drugs;
antidepressant drugs; tranquilizer and sedative drugs;
antipsychotic drugs; and antimicrobial drugs.
[0110] Other drug moieties useful in practicing the present
invention include antineoplastic drugs, cytocidal agents,
anti-estrogens, and antimetabolites. Also included within this
class are radioisotope-based agents for both diagnosis (e.g.,
imaging) and therapy, and conjugated toxins.
[0111] The therapeutic moiety can also be a hormone, a muscle
relaxant, an antispasmodic, bone activating agent, endocrine
modulating agent, modulator of diabetes, androgen, antidiuretics,
or calcitonin drug.
[0112] Other useful modifying groups include immunomodulating
drugs, immunosuppressants, etc. Groups with anti-inflammatory
activity, such as sulindac, etodolac, ketoprofen and ketorolac, are
also of use. Other drugs of use in conjunction with the present
invention will be apparent to those of skill in the art.
[0113] The altered N-glycosylation SAP polypeptides produced by the
methods of the disclosure can be homogeneous (i.e., the sample of
SAP polypeptide is uniform in specific N-glycan structure) or
substantially homogeneous. By "substantially homogeneous" is meant
that at least about 25% (e.g., at least about 27%, at least about
30%, at least about 35%, at least about 40%, at least about 45%, at
least about 50%, at least about 55%, at least about 60%, at least
about 65%, at least about 70%, at least about 75%, at least about
80%, at least about 85%, at least about 90%, or at least about 95%,
or at least about 99%) of the SAP polypeptides contain the same
specific N-glycan structure.
[0114] In some embodiments, variant SAP polypeptides of the
invention have an IC.sub.50 for inhibiting the differentiation of
monocytes into fibrocytes in vitro that is less than 1/2, less than
1/3, less than 1/4, less than 1/100, or less than 1/100 that of a
corresponding sample of wild-type SAP isolated from human serum.
There are many well characterized methods for determining the
responsiveness of Peripheral Blood Mononuclear Cells (PBMCs) or
monocyte cells to SAP for fibrocyte differentiation. These methods
may be used to determine the relative potency of any of the SAP
variant polypeptides of the invention in comparison to a sample of
human serum-derived SAP, any other SAP variant polypeptide, or
other fibrocyte suppressant or activating agent. PBMCs or monocytes
suitable for use in these methods may be obtained from various
tissue culture lines. Alternatively, suitable cells for fibrocyte
differentiation assays may be obtained from any biological sample
that contains PBMC or monocyte cells. The biological sample may be
obtained from serum, plasma, healthy tissue, or fibrotic tissue. In
general, fibrocyte differentiation assays are conducted by
incubating PBMC or monocyte cells in media with various
concentrations of a SAP polypeptide to determine the degree of
fibrocyte differentiation. The concentration of SAP can range from
0.0001 .mu.g/mL to 1 mg/ml, and in some embodiments is 0.001
.mu.g/mL, 1.0 .mu.g/mL, 5 .mu.g/mL, 10 .mu.g/mL, 15 .mu.g/mL, 20
.mu.g/mL, 25 .mu.g/mL, 30 .mu.g/mL, 35 .mu.g/mL, 40 .mu.g/mL, 45
.mu.g/mL, 50 .mu.g/mL, 100 .mu.g/mL, 200 .mu.g/mL, 300 .mu.g/mL, or
500 .mu.g/mL. In some assays, the media can be supplemented with
between 1-100 ng/ml hMCSF; the preferred concentration of hMCSF
being 25 ng/mL. The indication that PBMC and monocytes have
differentiated into fibrocytes can be determined by one skilled in
the art. In general, fibrocytes are morphologically defined as
adherent cells with an elongated spindle-shape and the presence of
an oval nucleus. In some assays, cells are fixed and stained with
Hema 3 before enumerating fibrocytes by direct counting, e.g.,
using an inverted microscope. The amount of fibrocyte
differentiation is interpreted by one skilled in the art as an
indication of a cell's responsiveness to SAP. As indicated by the
examples of the disclosure, a greater suppression of fibrocyte
differentiation indicates a greater degree of SAP responsiveness.
An alternative method of measuring fibrocyte differentiation
involves determining the expression of fibrocyte-specific cell
surface markers or secreted factors, e.g., cytokines (e.g., IL-Ira,
ENA-78/CXCL-5, PAI-1), fibronectin, collagen-1. Methods of
detecting and/or quantifying cell surface markers or secreted
factors are well known in the art, including but not limited to
various ELISA- and FACS-based techniques using immunoreactive
antibodies against one or more fibrocyte specific markers. As
described in the examples of the disclosure, measuring the
expression of Macrophage Derived Chemokine (MDC) is an effective
method of determining fibrocyte differentiation.
[0115] Methods for detecting and/or characterizing N-glycosylation
(e.g., altered N-glycosylation) of a SAP polypeptide include DNA
sequencer-assisted (DSA), fluorophore-assisted carbohydrate
electrophoresis (FACE) or surface-enhanced laser
desorption/ionization time-of-flight mass spectrometry (SELDI-TOF
MS). For example, an analysis can utilize DSA-FACE in which, for
example, glycoproteins are denatured followed by immobilization on,
e.g., a membrane. The glycoproteins can then be reduced with a
suitable reducing agent such as dithiothreitol (DATA) or
.beta.-mercaptoethanol. The sulfhydryl groups of the proteins can
be carboxylated using an acid such as iodoacetic acid. Next, the
N-glycans can be released from the protein using an enzyme such as
N-glycosidase F. N-glycans, optionally, can be reconstituted and
derivatized by reductive amination. The derivatized N-glycans can
then be concentrated. Instrumentation suitable for N-glycan
analysis includes, for example, the ABI PRISM.RTM. 377 DNA
sequencer (Applied Biosystems). Data analysis can be performed
using, for example, GENESCAN.RTM.. 3.1 software (Applied
Biosystems). Optionally, isolated mannoproteins can be further
treated with one or more enzymes to confirm their N-glycan status.
Exemplary enzymes include, for example, .alpha.-mannosidase or
.alpha.-1,2 mannosidase. Additional methods of N-glycan analysis
include, for example, mass spectrometry (e.g., MALDI-TOF-MS),
high-pressure liquid chromatography (HPLC) on normal phase,
reversed phase and ion exchange chromatography (e.g., with pulsed
amperometric detection when glycans are not labeled and with UV
absorbance or fluorescence if glycans are appropriately labeled).
See also Callewaert et al. (2001) Glycobiology 11(4):275-281 and
Freire et al. (2006) Bioconjug. Chem. 17(2):559-564, the
disclosures of each of which are incorporated herein by reference
in their entirety
Treatment Methods
[0116] In one aspect, the disclosure provides methods for treating
an SAP-responsive disorder in a patient by administering a
therapeutically effective amount of a variant SAP polypeptide of
the invention to a patient in need thereof. The dosage and
frequency of treatment can be determined by one skilled in the art
and will vary depending on the symptoms, age and body weight of the
patient, and the nature and severity of the disorder to be treated
or prevented. In some embodiments, a variant SAP polypeptide is
administered to a patient once or twice per day, once or twice per
week, once or twice per month, or just prior to or at the onset of
symptoms.
[0117] Dosages may be readily determined by techniques known to
those of skill in the art or as taught herein. Toxicity and
therapeutic efficacy of SAP may be determined by standard
pharmaceutical procedures in experimental animals, for example,
determining the LD.sub.50 and the ED.sub.50. The ED.sub.50
(Effective Dose 50) is the amount of drug required to produce a
specified effect in 50% of an animal population. The LD.sub.50
(Lethal Dose 50) is the dose of drug which kills 50% of a sample
population.
[0118] In some embodiments, the SAP-responsive disorder is
fibrosis. The use of SAP as a therapeutic treatment for fibrosis is
described in U.S. Patent Application No. 2007/0243163, which is
hereby incorporated by reference. Fibrosis related disorders that
may be amenable to treatment with the subject method include, but
are not limited to, collagen disease, interstitial lung disease,
human fibrotic lung disease (e.g., obliterative bronchiolitis,
idiopathic pulmonary fibrosis, pulmonary fibrosis from a known
etiology, tumor stroma in lung disease, systemic sclerosis
affecting the lungs, Hermansky-Pudlak syndrome, coal worker's
pneumoconiosis, asbestosis, silicosis, chronic pulmonary
hypertension, AIDS-associated pulmonary hypertension, sarcoidosis,
moderate to severe asthma and the like), fibrotic vascular disease,
arterial sclerosis, atherosclerosis, varicose veins, coronary
infarcts, cerebral infarcts, myocardial fibrosis, musculoskeletal
fibrosis, post-surgical adhesions, human kidney disease (e.g.,
nephritic syndrome, Alport syndrome, HIV-associated nephropathy,
polycystic kidney disease, Fabry's disease, diabetic nephropathy,
chronic glomerulonephritis, nephritis associated with systemic
lupus, and the like), progressive systemic sclerosis (PSS), primary
scalloping cholangitis (PSC), liver fibrosis, liver cirrhosis,
renal fibrosis, pulmonary fibrosis, cystic fibrosis, chronic graft
versus host disease, scleroderma (local and systemic), Grave's
ophthalmopathy, diabetic retinopathy, glaucoma, Peyronie's disease,
penis fibrosis, urethrostenosis after cystoscope, inner accretion
after surgery, scarring, myelofibrosis, idiopathic retroperitoneal
fibrosis, peritoneal fibrosis from a known etiology, drug-induced
ergotism, fibrosis incident to benign or malignant cancer, fibrosis
incident to microbial infection (e.g., viral, bacterial, parasitic,
fungal, etc.), Alzheimer's disease, fibrosis incident to
inflammatory bowel disease (including stricture formation in
Crohn's disease and microscopic colitis), stromal cell tumors,
mucositis, fibrosis induced by chemical or environmental insult
(e.g., cancer chemotherapy, pesticides, or radiation (e.g., cancer
radiotherapy)).
[0119] In some embodiments, the fibrosis related disorder is
selected from systemic or local scleroderma, keloids, hypertrophic
scars, atherosclerosis, restenosis, pulmonary inflammation and
fibrosis, idiopathic pulmonary fibrosis, liver cirrhosis, fibrosis
as a result of chronic hepatitis B or C infection, kidney disease,
heart disease resulting from scar tissue, macular degeneration, and
retinal and vitreal retinopathy. In some embodiments, the fibrosis
related disorder results from chemotherapeutic drugs,
radiation-induced fibrosis, and injuries and burns. In some
embodiments, the fibrosis-related disorder or condition results
from post-surgical scarring, e.g., following trabeculectomy or
other filtration surgery of the eye.
[0120] In some embodiments, the SAP-responsive disorder is a
hypersensitivity disorder such as those mediated by Th1 or Th2
responses. The use of SAP as a therapeutic treatment for
hypersensitivity disorders is also described in U.S. Provisional
Application No. 61/209,795, which is hereby incorporated by
reference. Hypersensitivity related disorders that may be amenable
to treatment with SAP include, but are not limited to, allergic
rhinitis, allergic sinusitis, allergic conjunctivitis, allergic
bronchoconstriction, allergic dyspnea, allergic increase in mucus
production in the lungs, atopic eczema, dermatitis, urticaria,
anaphylaxis, pneumonitis, and allergic-asthma.
[0121] In some embodiments, a variant SAP polypeptide of the
invention may be used to treat allergen-specific immune responses,
such as anaphylaxis, to various antigens, including, but not
limited to, antimicrobials (e.g., cephalosporins, sulfonamides,
penicillin and other .beta.-lactams), anticonvulsants (e.g.,
phenytoin, phenobarbital, carbamazepine, dapsone, allopurinol, and
minocycline), chemotherapeutics (e.g., taxanes, platinum compounds,
asparaginases, and epipodophyllotoxins), heparin, insulin,
protamine, aspirin and other non-steroidal anti-inflammatory drugs,
muscle relaxants (e.g., succinylcholine, atracurium, vecuronium,
and pancuronium), induction agents (e.g., barbiturates, etomidate,
propofol), narcotics (e.g., fentanyl, meperidine, morphine),
colloids for intravascular volume expansion, radiocontrast
materials, blood products, latex, animal products, animal dander,
dust mites, insects (e.g., bites, stings or venom), cosmetics,
metals (e.g., nickel, cobalt, and chromate), plants, spores,
pollen, food (e.g., milk, eggs, wheat, soy, peanuts and tree nuts,
seafood), vaccination, and fungal antigens (e.g., Aspergillus,
Curvularia, Exserohilum, and Alternaria species).
[0122] In some embodiments, the SAP-responsive disorder is an
autoimmune disorder such as those mediated by Th1 or Th2 responses.
The use of SAP as a therapeutic treatment for autoimmune disorders
is also described in U.S. Provisional Application No. 61/209,845,
which is hereby incorporated by reference. Autoimmune related
disorders that may be amenable to treatment with SAP include, but
are not limited to, type I diabetes, multiple sclerosis, rheumatoid
arthritis, psoriatic arthritis, autoimmune myocarditis, pemphigus,
myasthenia gravis, Hashimoto's thyroiditis, Graves' disease,
Addison's disease, autoimmune hepatitis, chronic Lyme arthritis,
familial dilated cardiomyopathy, juvenile dermatomyositis,
polychondritis, Sjogren's syndrome, psoriasis, juvenile idiopathic
arthritis, inflammatory bowel disease, systemic lupus
erythematosus, chronic obstructive pulmonary disease, and
graft-versus-host disease.
[0123] In some embodiments, the SAP-responsive disorder is a
mucositis. The use of SAP as a therapeutic treatment for mucositis
is also described in U.S. application Ser. No. 12/217,614, which is
hereby incorporated by reference. Methods of the invention may be
useful for treating oral, esophageal, and gastrointestinal
mucositis, as well as gastric and duodenal ulcers, or erosions of
the stomach and esophagus.
[0124] In some embodiments, a variant SAP polypeptide of the
invention may be used to treat an inflammatory disease or
condition. In some embodiments, the inflammatory disease may be a
viral, bacterial, fungal, or parasitic infection. The use of SAP as
a therapeutic treatment for viral infection has also been described
in U.S. Pat. No. 6,406,698 and in International Patent Application
No. WO1997/026906, which are both incorporated by reference
herein.
Pharmaceutical Preparations and Formulations
[0125] In certain embodiments, the methods described herein involve
administration of at least one variant SAP polypeptide of the
invention to a subject as a therapeutic agent. The therapeutic
agents of the invention may be formulated in a conventional manner
using one or more physiologically acceptable carriers or
excipients. For example, therapeutic agents and their
physiologically acceptable salts and solvates may be formulated for
administration by, for example, injection (e.g. SubQ, IM, IP),
inhalation or insufflation (either through the mouth or the nose)
or oral, buccal, sublingual, transdermal, nasal, parenteral or
rectal administration. In certain embodiments, therapeutic agents
may be administered locally, at the site where the target cells are
present, i.e., in a specific tissue, organ, or fluid (e.g., blood,
cerebrospinal fluid, tumor mass, etc.).
[0126] The present invention further provides use of any variant
SAP polypeptide of the invention in the manufacture of a medicament
for the treatment or prevention of a disorder or a condition, as
described herein, in a patient, for example, the use of a variant
SAP polypeptide in the manufacture of medicament for the treatment
of a disorder or condition described herein. In some aspects, any
variant SAP polypeptide of the invention may be used to make a
pharmaceutical preparation for the use in treating or preventing a
disease or condition described herein.
[0127] Therapeutic agents can be formulated for a variety of modes
of administration, including systemic and topical or localized
administration. Techniques and formulations generally may be found
in Remington's Pharmaceutical Sciences, Meade Publishing Co.,
Easton, Pa. For parenteral administration, injection is preferred,
including intramuscular, intravenous, intraperitoneal, and
subcutaneous. For injection, the compounds can be formulated in
liquid solutions, preferably in physiologically compatible buffers
such as Hank's solution or Ringer's solution. In addition, the
compounds may be formulated in solid form and dissolved or
suspended immediately prior to use. Lyophilized forms are also
included. In some embodiments, the therapeutic agents can be
administered to cells by a variety of methods know to those
familiar in the art, including, but not restricted to,
encapsulation in liposomes, by iontophoresis, or by incorporation
into other vehicles, such as hydrogels, cyclodextrins,
biodegradable nanocapsules, and bioadhesive microspheres.
[0128] For oral administration, the pharmaceutical compositions may
take the form of, for example, tablets, lozenges, or capsules
prepared by conventional means with pharmaceutically acceptable
excipients such as binding agents (e.g., pregelatinized maize
starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose);
fillers (e.g., lactose, microcrystalline cellulose or calcium
hydrogen phosphate); lubricants (e.g., magnesium stearate, talc or
silica); disintegrants (e.g., potato starch or sodium starch
glycolate); or wetting agents (e.g., sodium lauryl sulphate). The
tablets may be coated by methods well known in the art. Liquid
preparations for oral administration may take the form of, for
example, solutions, syrups or suspensions, or they may be presented
as a dry product for constitution with water or other suitable
vehicle before use. Such liquid preparations may be prepared by
conventional means with pharmaceutically acceptable additives such
as suspending agents (e.g., sorbitol syrup, cellulose derivatives
or hydrogenated edible fats); emulsifying agents (e.g., lecithin or
acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl
alcohol or fractionated vegetable oils); and preservatives (e.g.,
methyl or propyl-p-hydroxybenzoates or sorbic acid). The
preparations may also contain buffer salts, flavoring, coloring and
sweetening agents as appropriate. Preparations for oral
administration may be suitably formulated to give controlled
release of the active compound.
[0129] For administration by inhalation (e.g., pulmonary delivery),
therapeutic agents may be conveniently delivered in the form of an
aerosol spray presentation from pressurized packs or a nebulizer,
with the use of a suitable propellant, e.g.,
dichlorodifluoromethane, trichlorofluoromethane,
dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In
the case of a pressurized aerosol the dosage unit may be determined
by providing a valve to deliver a metered amount. Capsules and
cartridges of e.g., gelatin, for use in an inhaler or insufflator
may be formulated containing a powder mix of the compound and a
suitable powder base such as lactose or starch.
[0130] In the methods of the invention, the pharmaceutical
compounds can also be administered by intranasal or intrabronchial
routes including insufflation, powders, and aerosol formulations
(for examples of steroid inhalants, see Rohatagi (1995) J. Clin.
Pharmacology. 35:1187-1193; Tjwa (1995) Ann. Allergy Asthma
Immunol. 75:107-111). For example, aerosol formulations can be
placed into pressurized acceptable propellants, such as
dichlorodifluoromethane, propane, nitrogen, and the like. They also
may be formulated as pharmaceuticals for non-pressured preparations
such as in a nebulizer or an atomizer. Typically, such
administration is in an aqueous pharmacologically acceptable
buffer.
[0131] Pharmaceutical compositions suitable for respiratory
delivery (e.g., intranasal, inhalation, etc.) of variant SAP
polypeptides may be prepared in either solid or liquid form.
[0132] SAP polypeptides of the invention may be formulated for
parenteral administration by injection, e.g., by bolus injection or
continuous infusion. Formulations for injection may be presented in
unit dosage form, e.g., in ampoules or in multi-dose containers,
with an added preservative. The compositions may take such forms as
suspensions, solutions or emulsions in oily or aqueous vehicles,
and may contain formulatory agents such as suspending, stabilizing
and/or dispersing agents. Alternatively, the active ingredient may
be in powder form for constitution with a suitable vehicle, e.g.,
sterile pyrogen-free water, before use.
[0133] In addition, SAP polypeptides of the invention may also be
formulated as a depot preparation. Such long-acting formulations
may be administered by implantation (for example subcutaneously or
intramuscularly) or by intramuscular injection. Thus, for example,
therapeutic agents may be formulated with suitable polymeric or
hydrophobic materials (for example as an emulsion in an acceptable
oil) or ion exchange resins, or as sparingly soluble derivatives,
for example, as a sparingly soluble salt. Controlled release
formula also includes patches.
[0134] In certain embodiments, the compounds described herein can
be formulated for delivery to the central nervous system (CNS)
(reviewed in Begley, Pharmacology & Therapeutics 104: 29-45
(2004)). Conventional approaches for drug delivery to the CNS
include: neurosurgical strategies (e.g., intracerebral injection or
intracerebroventricular infusion); molecular manipulation of the
agent (e.g., production of a chimeric fusion protein that comprises
a transport peptide that has an affinity for an endothelial cell
surface molecule in combination with an agent that is itself
incapable of crossing the blood-brain-barrier in an attempt to
exploit one of the endogenous transport pathways of the
blood-brain-barrier); pharmacological strategies designed to
increase the lipid solubility of an agent (e.g., conjugation of
water-soluble agents to lipid or cholesterol carriers); and the
transitory disruption of the integrity of the BBB by hyperosmotic
disruption (resulting from the infusion of a mannitol solution into
the carotid artery or the use of a biologically active agent such
as an angiotensin peptide).
[0135] In certain embodiments, SAP polypeptides of the invention
are incorporated into a topical formulation containing a topical
carrier that is generally suited to topical drug administration and
comprising any such material known in the art. The topical carrier
may be selected so as to provide the composition in the desired
form, e.g., as an ointment, lotion, cream, microemulsion, gel, oil,
solution, or the like, and may be comprised of a material of either
naturally occurring or synthetic origin. It is preferable that the
selected carrier not adversely affect the active agent or other
components of the topical formulation. Examples of suitable topical
carriers for use herein include water, alcohols and other nontoxic
organic solvents, glycerin, mineral oil, silicone, petroleum jelly,
lanolin, fatty acids, vegetable oils, parabens, waxes, and the
like.
[0136] Pharmaceutical compositions (including cosmetic
preparations) may comprise from about 0.00001 to 100% such as from
0.001 to 10% or from 0.1% to 5% by weight of one or more of the
variant SAP polypeptides described herein. In certain topical
formulations, the active agent is present in an amount in the range
of approximately 0.25 wt. % to 75 wt. % of the formulation,
preferably in the range of approximately 0.25 wt. % to 30 wt. % of
the formulation, more preferably in the range of approximately 0.5
wt. % to 15 wt. % of the formulation, and most preferably in the
range of approximately 1.0 wt. % to 10 wt. % of the
formulation.
[0137] Conditions of the eye can be treated or prevented by, e.g.,
systemic, topical, intraocular injection of therapeutic agents, or
by insertion of a sustained release device that releases
therapeutic agents. SAP polypeptides of the invention may be
delivered in a pharmaceutically acceptable ophthalmic vehicle, such
that the compound is maintained in contact with the ocular surface
for a sufficient time period to allow the compound to penetrate the
corneal and internal regions of the eye, as for example the
anterior chamber, conjunctiva, posterior chamber, vitreous body,
aqueous humor, vitreous humor, cornea, iris/ciliary, lens,
choroid/retina and sclera. The pharmaceutically acceptable
ophthalmic vehicle may, for example, be an ointment, vegetable oil
or an encapsulating material. Alternatively, the compounds may be
injected directly into the vitreous and aqueous humour. In a
further alternative, the compounds may be administered
systemically, such as by intravenous infusion or injection, for
treatment of the eye.
[0138] Therapeutic agents described herein may be stored in
oxygen-free environment according to methods in the art.
[0139] Exemplary compositions comprise an SAP polypeptide with one
or more pharmaceutically acceptable carriers and, optionally, other
therapeutic ingredients. The carrier(s) must be "pharmaceutically
acceptable" in the sense of being compatible with the other
ingredients of the composition and not eliciting an unacceptable
deleterious effect in the subject. Such carriers are described
herein or are otherwise well known to those skilled in the art of
pharmacology. In some embodiments, the pharmaceutical compositions
are pyrogen-free and are suitable for administration to a human
patient. In some embodiments, the pharmaceutical compositions are
irritant-free and are suitable for administration to a human
patient. In some embodiments, the pharmaceutical compositions are
allergen-free and are suitable for administration to a human
patient. The compositions may be prepared by any of the methods
well known in the art of pharmacy.
[0140] In some embodiments, an SAP polypeptide is administered in a
time release formulation, for example in a composition which
includes a slow release polymer. An SAP polypeptide can be prepared
with carriers that will protect against rapid release. Examples
include a controlled release vehicle, such as a polymer,
microencapsulated delivery system, or bioadhesive gel.
Alternatively, prolonged delivery of an SAP polypeptide may be
achieved by including in the composition agents that delay
absorption, for example, aluminum monostearate hydrogels and
gelatin.
[0141] Methods for delivering nucleic acid compounds are known in
the art (see, e.g., Akhtar et al., 1992, Trends Cell Bio., 2, 139;
and Delivery Strategies for Antisense Oligonucleotide Therapeutics,
ed. Akhtar, 1995; Sullivan et al., International Application No. WO
94/02595). These protocols can be utilized for the delivery of
virtually any nucleic acid compound. Nucleic acid compounds can be
administered to cells by a variety of methods known to those
familiar to the art, including, but not restricted to,
encapsulation in liposomes, by iontophoresis, or by incorporation
into other vehicles, such as hydrogels, cyclodextrins,
biodegradable nanocapsules, and bioadhesive microspheres.
Alternatively, the nucleic acid/vehicle combination is locally
delivered by direct injection or by use of an infusion pump. Other
routes of delivery include, but are not limited to, oral (tablet or
pill form) and/or intrathecal delivery (Gold, 1997, Neuroscience,
76, 1153-1158). Other approaches include the use of various
transport and carrier systems, for example though the use of
conjugates and biodegradable polymers. For a comprehensive review
on drug delivery strategies, see Ho et al., 1999, Curr. Opin. Mol.
Ther., 1, 336-343 and Jain, Drug Delivery Systems: Technologies and
Commercial Opportunities, Decision Resources, 1998 and Groothuis et
al., 1997, J. NeuroVirol., 3, 387-400. More detailed descriptions
of nucleic acid delivery and administration are provided in
Sullivan et al., supra, Draper et al., PCT W93/23569, Beigelman et
al., International Application No. WO99/05094, and Klimuk et al.,
International Publication No. WO99/04819.
[0142] The following examples serve to more fully describe the
manner of using the above-described invention, as well as to set
forth the best modes contemplated for carrying out various aspects
of the invention. It is understood that these examples in no way
serve to limit the true scope of this invention, but rather are
presented for illustrative purposes.
EXEMPLIFICATION
Example 1: Recombinant SAP is More Potent than Human Serum-Derived
SAP
[0143] Recombinant human SAP isolated from CHO--S cells (rhSAP) and
human serum-derived SAP (hSAP) were assayed for bioactivity using
an in vitro bioassay. In this assay, monocyte enriched Peripheral
Blood Mononuclear Cells (PBMCs) were incubated with varying
concentrations of either rhSAP or hSAP for 96 hours. Following this
incubation, resulting culture supernatants were removed and assayed
by ELISA to quantify the amount of Macrophage Derived Chemokine
(MDC) that was produced. MDC is produced by fibrocytes and
therefore an indicator of monocyte differentiation into fibrocytes.
By comparing the inhibitory concentration, 50% (IC.sub.50) of the
sample to the hSAP reference standard, the relative potency of a
SAP glycovariant can be determined. The result is expressed as an
IC.sub.50 ratio of the sample versus the hSAP reference
standard.
[0144] All SAP samples and standards were initially diluted to a
concentration of 1.0 mg/mL in Supplemented FibroLife Media. SAP
standards were serially diluted to generate working standard
concentrations of 60, 30, 20, 13.4, 8.8, 6.0, 3.0, 1.5, and 0.75
.mu.g/mL (final standard concentration of 30, 15, 10, 6.7, 4.4,
3.0, 1.5, 0.75, and 0.375 .mu.g/mL). See the following Table 1.
TABLE-US-00005 Working rhSAP Standard Volume of Concentration
Supplemented (.mu.g/mL) Volume of Standard FibroLife Media 60 60 (1
mg/mL) 940 30 600 (60 .mu.g/mL) 600 20 800 (30 .mu.g/mL Std) 400
13.4 800 (20 .mu.g/mL Std) 400 8.8 800 (13.4 .mu.g/mL Std) 400 6.0
800 (8.8 .mu.g/mL Std) 400 3.0 600 (6.0 .mu.g/mL Std) 600 1.5 600
(3.0 .mu.g/mL Std) 600 0.75 600 (1.5 .mu.g/mL Std) 600
[0145] To prepare for the ELISA assay, the capture antibody (i.e.,
mouse anti-human MDC) was diluted to the working concentration in
PBS without carrier protein. The diluted capture antibody was used
to coat 96-well plates, and then each plate was sealed and
incubated overnight at room temperature. Before using the coated
plates, each well was aspirated and washed with wash buffer,
repeating the process two times for a total of three washes. The
plates were then blocked by adding 300 .mu.L of reagent diluent to
each well and incubating at room temperature for one hour. After
incubation the aspiration and well-washing procedure was
repeated.
[0146] For the ELISA assay, 100 .mu.L samples of either the
supernatants from the monocyte/fibrocyte cultures or the SAP
standards were added to each well. The plate was then incubated at
room temperature for 2 hours before aspirating and washing the
wells. Then 100 .mu.L of a working dilution of Streptavidin-HRP was
added to each well. The plate was incubated for 20 minutes at room
temperature before adding 50 .mu.L of Stop Solution to each well.
Immediately, the optical density of each well was measured using a
microplate reader set to 450 nm. If wavelength correction was
available, the microplate reader was set to 540 nm or 570 nm. If
wavelength correction was not available, then the readings at 540
nm or 570 nm were subtracted from the readings at 450 nm. This
subtraction corrects for optical imperfections in the plate.
[0147] Both RHSAP and hSAP were assayed for bioactivity using this
assay (FIG. 1). On average, RHSAP is 3.4-fold more active than hSAP
(average of 7 independent experiments).
Example 2: Modification of SAP Glycan Structures
[0148] Using in vitro glycoremodeling techniques, glycan moieties
on a sample of recombinant human SAP (rhSAP) were modified to
replace terminal .alpha.2,3-linked sialic acid moieties with
.alpha.2,6-linked sialic acid moieties (FIGS. 2, A and B).
Similarly, a sample of human serum-derived SAP (hSAP) was also
modified to replace terminal .alpha.2,6-linked sialic acid moieties
with .alpha.2,3-linked sialic acid moieties (FIGS. 2, C and D). In
addition, as rhSAP isolated from CHO--S cells is only partially
sialylated, a sample of rhSAP was treated to fully sialylate the
attached glycan structures with .alpha.2,3-linked sialic acid
moieties (FIGS. 2, E and F).
[0149] Both rhSAP and hSAP (Calbiochem Cat #970549) were treated
with a .alpha.2,3,6,8,9-sialidase (Sigma Cat #N8271) to fully
desialylate the polypeptides. After sialidase treatment for 17
hours, desialylated (i.e. asialo) rhSAP and hSAP were purified
using phosphoethanolamine (PE) affinity and size exclusion
(Sephadex 200 prep grade) chromatography. Purified asialo SAP
polypeptides were then enzymatically treated using either
.alpha.2,3- or .alpha.2,6-sialyltransferases (Calbiochem Cat
#566223) in the presence of CMP-sialic acid (Calbiochem Cat
#233264) for 17 hours at 37.degree. C. The following tables provide
details on each reaction mixture.
TABLE-US-00006 Asialo rhSAP Reactions (Rxns) parameter units value
Treatment with .alpha.2,3 sialyltransferase (ST3Gal3) rhSAP,
ST3Gal3 [asialo rhSAP] stk mg/mL 10.8 reagent stocks asialo rhSAP
MW g/mol 116293 [asialo rhSAP] stk .mu.M 93 max [Galactose] .mu.M
929 [ST3Gal3] stk mg/mL 0.9 ST3Gal3 MW g/mol 84000 [ST3Gal3] stk
.mu.M 10.7 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk
mM 38 rxn volumes .mu.L asialo rhSAP in rxn .mu.L 260 .mu.L ST3Gal3
in rxn .mu.L 50 .mu.L CMP-SA in rxn .mu.L 75 buffer .mu.L 615 (10
mM HEPES/150 mM NaCl, pH 8) tot rxn vol .mu.L 1000 rxn [asialo
rhSAP] rxn .mu.M 24.1 concentrations max [Galactose] .mu.M 241
[SAP] rxn mg/mL 2.8 [ST3Gal3] rxn .mu.M 0.5357 [ST3Gal3] rxn mg/mL
0.045 [CMP-SA] rxn mM 2.85 asialo rhSAP:ST3 mass 62 ratio asialo
rhSAP:ST3 molar 45 ratio CMP-SA:ST3 molar 5316 ratio CMP-SA:asialo
rhSAP molar 118 ratio CMP-SA:Galactose molar 11.8 ratio Treatment
with .alpha.2,6 sialyltransferase (ST6 Rxn) rhSAP, ST6 [asialo
rhSAP] stk mg/mL 10.8 reagent stocks asialo rhSAP MW g/mol 116293
[asialo rhSAP] stk .mu.M 93 max [Galactose] .mu.M 929 [ST6] stk
mg/mL 0.205 ST6 MW g/mol 42000 [ST6] stk .mu.M 4.9 [CMP-SA] stk
mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes .mu.L
asialo rhSAP 1 in .mu.L 260 rxn .mu.L ST6 in rxn .mu.L 30 .mu.L
CMP-SA in rxn .mu.L 75 buffer .mu.L 635 (10 mM HEPES/150 mM NaCl,
pH 8) tot rxn vol .mu.L 1000 rxn [asialo rhSAP] rxn .mu.M 24.1
concentrations max [Galactose] .mu.M 241 [asialo rhSAP] rxn mg/mL
2.8 [ST6] rxn .mu.M 0.146 [ST6] rxn mg/mL 0.006 [CMP-SA] rxn mM
2.85 asialo rhSAP:ST6 mass 457 ratio asialo rhSAP:ST6 molar 165
ratio CMP-SA:ST6 molar 19448 ratio CMP-SA:asialo rhSAP molar 118
ratio CMP-SA:Galactose molar 11.8 ratio
TABLE-US-00007 Asialo hSAP Rxns parameter units value Treatment
with .alpha.2,3 sialyltransferase (ST3Gal3) hSAP, ST3Gal3 [asialo
hSAP] stk mg/mL 5.6 reagent stocks SAP MW g/mol 116293 [asialo
hSAP] stk .mu.M 48 max [Galactose] .mu.M 482 [ST3Gal3] stk mg/mL
0.9 ST3Gal3 MW g/mol 84000 [ST3Gal3] stk .mu.M 10.7 [CMP-SA] stk
mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes .mu.L
asialo hSAP in .mu.L 500 rxn .mu.L ST3Gal3 in rxn .mu.L 50 .mu.L
CMP-SA in rxn .mu.L 75 buffer .mu.L 375 (10 mM HEPES/150 mM NaCl,
pH 8) tot rxn vol .mu.L 1000 rxn [asialo hSAP] rxn .mu.M 24.1
concentrations max [Galactose] .mu.M 241 [asialo hSAP] rxn mg/mL
2.8 [ST3Gal3] rxn .mu.M 0.54 [ST3Gal3] rxn mg/mL 0.045 [CMP-SA] rxn
mM 2.85 asialo hSAP:ST3 mass 62 ratio asialo hSAP:ST3 molar 45
ratio CMP-SA:ST3 molar 5316 ratio CMP-SA:asialo molar 118 hSAP
ratio CMP-SA:Galactose molar 11.8 ratio Treatment with .alpha.2,6
sialyltransferase (ST6 Rxn) hSAP, ST6 [asialo hSAP] stk mg/mL 5.6
reagent stocks asialo hSAP MW g/mol 116293 [asialo hSAP] stk .mu.M
48 max [Galactose] .mu.M 482 [ST6] stk mg/mL 0.205 ST6 MW g/mol
42000 [ST6] stk .mu.M 4.9 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol
658.4 [CMP-SA] stk mM 38 rxn volumes .mu.L asialo hSAP in .mu.L 500
rxn .mu.L ST6 in rxn .mu.L 30 .mu.L CMP-SA in rxn .mu.L 75 buffer
.mu.L 395 (10 mM HEPES/150 mM NaCl, pH 8) tot rxn vol .mu.L 1000
rxn [asialo hSAP] rxn .mu.M 24.1 concentrations max [Galactose]
.mu.M 241 [asialo hSAP] rxn mg/mL 2.8 [ST6] rxn .mu.M 0.146 [ST6]
rxn mg/mL 0.006 [CMP-SA] rxn mM 2.85 asialo hSAP:ST6 mass 455 ratio
asialo hSAP:ST6 molar 164 ratio CMP-SA:ST6 molar 19448 ratio
CMP-SA:asialo molar 118 hSAP ratio CMP-SA:Galactose molar 11.8
ratio
[0150] In a separate reaction, complete sialylation of rhSAP using
the .alpha.2,3-sialyltransferase without first desialylating the
molecule was preformed at 37.degree. C. for 17 hours according to
the following table.
TABLE-US-00008 Treatment with .alpha.2,3 sialyltransferase
(ST3Gal3) parameter units value rhSAP [rhSAP] stk mg/mL 19.0
ST3Gal3 rhSAP MW g/mol 116293 reagent stocks [rhSAP] stk .mu.M 163
max [Galactose] .mu.M 1634 [ST3Gal3] stk mg/mL 0.9 ST3Gal3 MW g/mol
84000 [ST3Gal3] stk .mu.M 10.7 [CMP-SA] stk mg/mL 25 CMP-SA MW
g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes .mu.L rhSAP in rxn .mu.L
500 .mu.L ST3Gal3 in rxn .mu.L 50 .mu.L CMP-SA in rxn .mu.L 100
buffer .mu.L 350 (10 mM HEPES/150 mM NaCl, pH 8) tot rxn vol .mu.L
1000 rxn [rhSAP] rxn .mu.M 81.7 concentrations max [Galactose]
.mu.M 817 [rhSAP] rxn mg/mL 9.5 [ST3Gal3] rxn .mu.M 0.54 [ST3Gal3]
rxn mg/mL 0.045 [CMP-SA] rxn mM 3.80 BTA-02-17:ST3 mass 211 ratio
BTA-02-17:ST3 molar 152 ratio CMP-SA:ST3 molar 7088 ratio
CMP-SA:BTA-02- molar 46 17 ratio CMP-SA:Galactose molar 4.6
ratio
[0151] After sialylation treatment, both sialylated rhSAP and hSAP
variants were purified using PE affinity chromatography followed by
dialysis into 10 mMNaPi/5% sorbitol pH 7.5 (P5S buffer).
Confirmation of the desired sialic acid linkages (i.e,
.alpha.2,3-linked hSAP and .alpha.2,6-linked RHSAP) was preformed
using both Liquid Chromatography Mass Spectrometry (FIGS. 2; A, C,
and E) and Anion-Exchange High Performance Liquid Chromatography
(FIGS. 2; B, D, and F) following treatment of the glycovariant SAP
polypeptides with .alpha.2,3 sialidase (Calbiochem Cat #480706) at
37.degree. C. for 24 hours.
Example 3: In Vitro Bioassays to Determine SAP Glycovariant Potency
for Inhibiting Monocyte Differentiation into Fibrocytes
[0152] Glycoremodeled rhSAP and hSAP were assayed for bioactivity
using the same in vitro bioassay described in Example 1. In brief,
monocyte enriched peripheral blood mononuclear cells (PBMCs) were
incubated with varying concentrations of an SAP polypeptide for 96
hours. Following this incubation, resulting culture supernatants
were removed and assayed by ELISA to quantify the about of
Macrophage Derived Chemokine (MDC) that was produced. The results
were expressed as an IC.sub.50 ratio of the sample versus the hSAP
reference standard and plotted as relative activity (relative
activity of hSAP=1). All .alpha.2,3-sialic acid linkage containing
test materials are >2.4-fold more active than hSAP (FIG. 3).
Equal mixtures of .alpha.2,3- and .alpha.2,6-linked sialic acid
derivatives of SAP show intermediate activity levels between 100%
.alpha.2,6-linked and 100% .alpha.2,3-linked SAP as expected (two
rightmost bars in FIG. 3).
[0153] An alternative method of quantifying fibrocyte
differentiation involves directly enumerating the number of
fibrocytes that are generated after monocytes are incubated with a
fibrocyte suppressant (e.g., SAP or variant thereof) or activating
agent (e.g., M-CSF). In one experiment, monocytes were purified
from whole blood-derived PBMC using negative magnetic bead
selection standard in the art (e.g. CAT #113-41D, Invitrogen,
Carlsbad, Calif.) and cultured in a 96-Well tissue culture plate
containing FibroLife Media supplemented with 25 or 50 ng/ml of
M-CSF in triplicate. The plate was incubated for 96 hours at
37.degree. C. in a 5% CO2 incubator. The cells were then fixed with
paraformaldehyde and stained with Hema 3 stain (Cat #122-911, Hema
3 Stain, Fisher Scientific, Hampton, N.H.). The number of
fibrocytes per well were determined by summing the count of five
different fields per well using an inverted microscope. Fibrocytes
were defined morphologically as adherent cells with an elongated
spindle-shape and the presence of an oval nucleus. The data
indicated that either 25 or 50 ng/ml of M-CSF was sufficient to
increase the number of fibrocytes differentiating from monocytes by
.about.50% in this donor (FIG. 4). Subsequent experiments used
FibroLife Media supplemented with 25 ng/ml of M-CSF as needed and
defined below. [0154] Fibrolife Media: (Cat #LM-0001, Lifeline Cell
Technology, Walkersville, Md.) supplemented with 10 mM HEPES (Cat
#H0887, Sigma-Aldrich), 1.times. non-essential amino acids (Cat
#M7145, Sigma-Aldrich), 1 mM sodium pyruvate (Cat #S8636,
Sigma-Aldrich), 2 mM glutamine (Cat #25030-149, Invitrogen), 100
U/ml penicillin and 100 ug/ml streptomycin (Cat #P0781,
Sigma-Aldrich), and ITS-3 (Cat #12771, 500 ug/ml bovine serum
albumin, 10 ug/ml insulin, 5 .quadrature.ug/ml transferrin, 5 ng/ml
sodium selenite, 5 ug/ml linoleic acid, and 5 ug/ml oleic acid;
Sigma-Aldrich).
[0155] In an additional experiment, PBMC or monocytes were purified
from whole blood and cultured in FibroLife Media supplemented with
various amounts of SAP in triplicate (as described above). The
plate was incubated for 96 hours at 37.degree. C. in a 5% CO.sub.2
incubator. The cells were then fixed with paraformaldehyde and
stained with Hema 3 stain (Cat #122-911, Hema 3 Stain, Fisher
Scientific, Hampton, N.H.). The number of fibrocytes per well were
determined by summing the count of five different fields per well
using an inverted microscope. The minimum concentration of SAP
necessary to provide maximum inhibition of fibrocyte
differentiation in this system was determined to be 2 ug/ml (FIG.
5). The number of fibrocytes decreases with increasing SAP
concentration in all donors.
INCORPORATION BY REFERENCE
[0156] All publications and patents mentioned herein are hereby
incorporated by reference in their entirety as if each individual
publication or patent was specifically and individually indicated
to be incorporated by reference.
[0157] While specific embodiments of the subject matter have been
discussed, the above specification is illustrative and not
restrictive. Many variations will be apparent to those skilled in
the art upon review of this specification and the below-listed
claims. The full scope of the invention should be determined by
reference to the claims, along with their full scope of
equivalents, and the specification, along with such variations.
Sequence CWU 1
1
41204PRTHomo sapiens 1His Thr Asp Leu Ser Gly Lys Val Phe Val Phe
Pro Arg Glu Ser Val1 5 10 15Thr Asp His Val Asn Leu Ile Thr Pro Leu
Glu Lys Pro Leu Gln Asn 20 25 30Phe Thr Leu Cys Phe Arg Ala Tyr Ser
Asp Leu Ser Arg Ala Tyr Ser 35 40 45Leu Phe Ser Tyr Asn Thr Gln Gly
Arg Asp Asn Glu Leu Leu Val Tyr 50 55 60Lys Glu Arg Val Gly Glu Tyr
Ser Leu Tyr Ile Gly Arg His Lys Val65 70 75 80Thr Ser Lys Val Ile
Glu Lys Phe Pro Ala Pro Val His Ile Cys Val 85 90 95Ser Trp Glu Ser
Ser Ser Gly Ile Ala Glu Phe Trp Ile Asn Gly Thr 100 105 110Pro Leu
Val Lys Lys Gly Leu Arg Gln Gly Tyr Phe Val Glu Ala Gln 115 120
125Pro Lys Ile Val Leu Gly Gln Glu Gln Asp Ser Tyr Gly Gly Lys Phe
130 135 140Asp Arg Ser Gln Ser Phe Val Gly Glu Ile Gly Asp Leu Tyr
Met Trp145 150 155 160Asp Ser Val Leu Pro Pro Glu Asn Ile Leu Ser
Ala Tyr Gln Gly Thr 165 170 175Pro Leu Pro Ala Asn Ile Leu Asp Trp
Gln Ala Leu Asn Tyr Glu Ile 180 185 190Arg Gly Tyr Val Ile Ile Lys
Pro Leu Val Trp Val 195 2002208PRTGallus gallus 2Gln Glu Asp Leu
Tyr Arg Lys Val Phe Val Phe Arg Glu Asp Pro Ser1 5 10 15Asp Ala Tyr
Val Leu Leu Gln Val Gln Leu Glu Arg Pro Leu Leu Asn 20 25 30Phe Thr
Val Cys Leu Arg Ser Tyr Thr Asp Leu Thr Arg Pro His Ser 35 40 45Leu
Phe Ser Tyr Ala Thr Lys Ala Gln Asp Asn Glu Ile Leu Leu Phe 50 55
60Lys Pro Lys Pro Gly Glu Tyr Arg Phe Tyr Val Gly Gly Lys Tyr Val65
70 75 80Thr Phe Arg Val Pro Glu Asn Arg Gly Glu Trp Glu His Val Cys
Ala 85 90 95Ser Trp Glu Ser Gly Ser Gly Ile Ala Glu Phe Trp Leu Asn
Gly Arg 100 105 110Pro Trp Pro Arg Lys Gly Leu Gln Lys Gly Tyr Glu
Val Gly Asn Glu 115 120 125Ala Val Val Met Leu Gly Gln Glu Gln Asp
Ala Tyr Gly Gly Gly Phe 130 135 140Asp Val Tyr Asn Ser Phe Thr Gly
Glu Met Ala Asp Val His Leu Trp145 150 155 160Asp Ala Gly Leu Ser
Pro Asp Lys Met Arg Ser Ala Tyr Leu Ala Leu 165 170 175Arg Leu Pro
Pro Ala Pro Leu Ala Trp Gly Arg Leu Arg Tyr Glu Ala 180 185 190Lys
Gly Asp Val Val Val Lys Pro Arg Leu Arg Glu Ala Leu Gly Ala 195 200
2053205PRTBos taurus 3Gln Thr Asp Leu Arg Gly Lys Val Phe Val Phe
Pro Arg Glu Ser Ser1 5 10 15Thr Asp His Val Thr Leu Ile Thr Lys Leu
Glu Lys Pro Leu Lys Asn 20 25 30Leu Thr Leu Cys Leu Arg Ala Tyr Ser
Asp Leu Ser Arg Gly Tyr Ser 35 40 45Leu Phe Ser Tyr Asn Ile His Ser
Lys Asp Asn Glu Leu Leu Val Phe 50 55 60Lys Asn Gly Ile Gly Glu Tyr
Ser Leu Tyr Ile Gly Lys Thr Lys Val65 70 75 80Thr Val Arg Ala Thr
Glu Lys Phe Pro Ser Pro Val His Ile Cys Thr 85 90 95Ser Trp Glu Ser
Ser Thr Gly Ile Ala Glu Phe Trp Ile Asn Gly Lys 100 105 110Pro Leu
Val Lys Arg Gly Leu Lys Gln Gly Tyr Ala Val Gly Ala His 115 120
125Pro Lys Ile Val Leu Gly Gln Glu Gln Asp Ser Tyr Gly Gly Gly Phe
130 135 140Asp Lys Asn Gln Ser Phe Met Gly Glu Ile Gly Asp Leu Tyr
Met Trp145 150 155 160Asp Ser Val Leu Ser Pro Glu Glu Ile Leu Leu
Val Tyr Gln Gly Ser 165 170 175Ser Ser Ile Ser Pro Thr Ile Leu Asp
Trp Gln Ala Leu Lys Tyr Glu 180 185 190Ile Lys Gly Tyr Val Ile Val
Lys Pro Met Val Trp Gly 195 200 2054204PRTCricetulus migratorius
4Gln Thr Asp Leu Thr Gly Lys Val Phe Val Phe Pro Arg Glu Ser Glu1 5
10 15Ser Asp Tyr Val Lys Leu Ile Pro Arg Leu Glu Lys Pro Leu Glu
Asn 20 25 30Phe Thr Leu Cys Phe Arg Thr Tyr Thr Asp Leu Ser Arg Pro
His Ser 35 40 45Leu Phe Ser Tyr Asn Thr Lys Asn Lys Asp Asn Glu Leu
Leu Ile Tyr 50 55 60Lys Glu Arg Met Gly Glu Tyr Gly Leu Tyr Ile Glu
Asn Val Gly Ala65 70 75 80Ile Val Arg Gly Val Glu Glu Phe Ala Ser
Pro Val His Phe Cys Thr 85 90 95Ser Trp Glu Ser Ser Ser Gly Ile Ala
Asp Phe Trp Val Asn Gly Ile 100 105 110Pro Trp Val Lys Lys Gly Leu
Lys Lys Gly Tyr Thr Val Lys Thr Gln 115 120 125Pro Ser Ile Ile Leu
Gly Gln Glu Gln Asp Asn Tyr Gly Gly Gly Phe 130 135 140Asp Lys Ser
Gln Ser Phe Val Gly Glu Met Gly Asp Leu Asn Met Trp145 150 155
160Asp Ser Val Leu Thr Pro Glu Glu Ile Lys Ser Val Tyr Glu Gly Ser
165 170 175Trp Leu Glu Pro Asn Ile Leu Asp Trp Arg Ala Leu Asn Tyr
Glu Met 180 185 190Ser Gly Tyr Ala Val Ile Arg Pro Arg Val Trp His
195 200
* * * * *