U.S. patent application number 17/084279 was filed with the patent office on 2021-05-06 for hypersensitive response elicitor peptides and use thereof.
The applicant listed for this patent is Plant Health Care, Inc.. Invention is credited to Stephen Bornick, Zhongmin Wei, Gregory A. Zornetzer.
Application Number | 20210127671 17/084279 |
Document ID | / |
Family ID | 1000005332984 |
Filed Date | 2021-05-06 |
![](/patent/app/20210127671/US20210127671A1-20210506\US20210127671A1-2021050)
United States Patent
Application |
20210127671 |
Kind Code |
A1 |
Wei; Zhongmin ; et
al. |
May 6, 2021 |
HYPERSENSITIVE RESPONSE ELICITOR PEPTIDES AND USE THEREOF
Abstract
Disclosed are hypersensitive-response eliciting peptides that
exhibit improved solubility, stability, resistance to chemical
degradation, or a combination of these properties. Use of these
peptides or fusion polypeptides, or DNA constructs encoding the
same, for modulating plant biochemical signaling, imparting disease
resistance to plants, enhancing plant growth, imparting tolerance
to biotic stress, imparting tolerance and resistance to abiotic
stress, imparting desiccation resistance to cuttings removed from
ornamental plants, imparting post-harvest disease or post-harvest
desiccation resistance to a fruit or vegetable, or enhancing the
longevity of fruit or vegetable ripeness are also disclosed.
Inventors: |
Wei; Zhongmin; (Kirkland,
WA) ; Zornetzer; Gregory A.; (Seattle, WA) ;
Bornick; Stephen; (Raleigh, NC) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Plant Health Care, Inc. |
Raleigh |
NC |
US |
|
|
Family ID: |
1000005332984 |
Appl. No.: |
17/084279 |
Filed: |
October 29, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14872298 |
Oct 1, 2015 |
10856546 |
|
|
17084279 |
|
|
|
|
62140789 |
Mar 31, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A01N 37/22 20130101;
A01N 37/46 20130101; A01N 47/44 20130101; C12N 15/8279 20130101;
C07K 7/08 20130101; A01N 25/12 20130101; C12N 15/8283 20130101;
A01N 25/02 20130101; A01N 43/90 20130101; A01N 43/54 20130101; A01N
51/00 20130101; C07K 14/27 20130101; C07K 14/24 20130101; A01N
43/36 20130101; C07K 14/195 20130101; C07K 2319/20 20130101; A01N
63/10 20200101; A01N 63/00 20130101; C07K 14/415 20130101; C07K
2319/00 20130101; C07K 14/001 20130101 |
International
Class: |
A01N 37/46 20060101
A01N037/46; C12N 15/82 20060101 C12N015/82; A01N 63/10 20060101
A01N063/10; C07K 14/00 20060101 C07K014/00; A01N 25/02 20060101
A01N025/02; A01N 25/12 20060101 A01N025/12; A01N 37/22 20060101
A01N037/22; A01N 43/36 20060101 A01N043/36; A01N 43/54 20060101
A01N043/54; A01N 43/90 20060101 A01N043/90; A01N 47/44 20060101
A01N047/44; A01N 51/00 20060101 A01N051/00; C07K 7/08 20060101
C07K007/08; C07K 14/415 20060101 C07K014/415; A01N 63/00 20060101
A01N063/00; C07K 14/195 20060101 C07K014/195; C07K 14/24 20060101
C07K014/24; C07K 14/27 20060101 C07K014/27 |
Claims
1-207. (canceled)
208. An isolated peptide comprising the amino acid sequence of:
TABLE-US-00028 (SEQ ID NO: 93)
(L/I/V/F)-X-X-(L/I/V/F)-(L/I)-X-X-(L/I/V/F)-
(L/I/V/A)-X-X-(L/I)-(L/I/V/F)
wherein the peptide is free of cysteine and methionine; the peptide
has an average Kyte-Doolittle hydropathy index of less than 0.3;
the peptide includes up to 10 additional amino acids at the
N-terminal end of SEQ ID NO: 93, up to 10 additional amino acids at
the C-terminal end of SEQ ID NO: 93, or both; one of the X residues
at positions 2, 6, and 10 being optional, and each X at positions
2, 3, 6, 7, 10, and 11, when present, is selected independently
from R, K, D, isoD, E, N, Q, H, S, T, G, A, and .gamma.-glutamate;
wherein the X residues at positions 2, 3, 6, 7, 10, and 11, when
present, are not the same; wherein the isolated peptide, when
introduced onto plant leaf tissue, induces a hypersensitive
response.
209. The isolated peptide according to claim 208, wherein the
isolated peptide is stable when dissolved in water or aqueous
solution.
210. The isolated peptide according to claim 208, wherein the
isolated peptide is resistant to chemical degradation when
dissolved in an aqueous buffer solution containing a biocide.
211. The isolated peptide according to claim 208, wherein the
isolated peptide has a solubility of greater than about 5.0 mg/ml
in water or aqueous solution.
212. The isolated peptide according to claim 208, wherein the X
residues at positions 2, 6, and 10 are present.
213. The isolated peptide according to claim 208, wherein each X at
positions 2, 3, 6, 7, 10, and 11, when present, is selected
independently from D, isoD, E, N, Q, H, S, T, G, A, and
.gamma.-glutamate.
214. The isolated peptide according to claim 213, further
comprising a C-terminal Arg or Lys residue.
215. The isolated peptide according to claim 208, wherein the
peptide has an average Kyte-Doolittle hydropathy index of less than
0.0.
216. The isolated peptide according to claim 208, wherein the
peptide has an average Kyte-Doolittle hydropathy index of less than
-0.3.
217. The isolated peptide according to claim 208, wherein the
peptide has an average Kyte-Doolittle hydropathy index of less than
-0.7.
218. The isolated peptide according to claim 208, wherein the up to
10 additional amino acids at the N-terminal end and/or the
C-terminal end of SEQ ID NO: 93 comprises a hydrophilic amino acid
sequence.
219. The isolated peptide according to claim 208, wherein the
peptide comprises the amino acid sequence of: TABLE-US-00029 Avg.
KD Sequence index SQGISEKQLDQLLSQLIQALLQP (SEQ ID NO: 6) -0.117
SQGISEKQLDQLLSQLLQALLQP (SEQ ID NO: 119) -0.148
SEEEEELDQLLSQLIQALLQ (SEQ ID NO: 31) -0.375 SEEEEELDQLLSQLIQALL
(SEQ ID NO: 33) -0.210 EKQLDQLLSQLIQALLQP (SEQ ID NO: 95) -0.094
SEKQLDQLLSQLIQALLQP (SEQ ID NO: 96) -0.131 SEEEEELDQLLTQLIEALLQQ
(SEQ ID NO: 126) -0.519 SQGISEKQLDQLLQLIQALLQP (SEQ ID NO: 133)
-0.086 SEEEEELDQLLTQLIEALLQ (SEQ ID NO: 134) -0.37
SQGISEKQALDQLLSQLIQALLQP (SEQ ID NO: 140) -0.037
SEEEEELDQLLTQLIEALL (SEQ ID NO: 141) -0.205 SEEEEEGGIAKLISALIESLLE
(SEQ ID NO: 149) 0.031 SEEEEEIAKLISALIESLLE (SEQ ID NO: 150) 0.075
SEEEEEFTQLLEHIVGEIL (SEQ ID NO: 161) -0.3 SEEEEEIEQLAQLLAQLLKSLL
(SEQ ID NO: 166) -0.104 SEEEEELAQLLAQLLKSLL (SEQ ID NO: 167) 0.010
SEEEEEALEQLLEDLVKLLK (SEQ ID NO: 178) -0.565 SEEEELTLTVLQKLLKILEAL
(SEQ ID NO: 187) 0.290 SEEEEELTGVLQKLLKILEAL (SEQ ID NO: 188)
-0.042 SEEEEELTLTGVLQKLLKILEA (SEQ ID NO: 200) -0.072
SEEEEEVLQKLLKILEALV (SEQ ID NO: 201) 0.031 SEEEEELQKLLKILEALVQ (SEQ
ID NO: 202) -0.373 SEEELQQLLKLFSEILQSLF (SEQ ID NO: 206) 0.105
SEEEEELQQLLKLFSEILQSL (SEQ ID NO: 207) -0.366 SEEEEELQQLLKLFSEILQS
(SEQ ID NO: 208) -0.575 LQQLLKLFSEILQSLFEEEE (SEQ ID NO: 209) -0.03
LEQLLEDLVELLEEE (SEQ ID NO: 215) -0.066 LEELLEDLVELLEEE (SEQ ID NO:
216) -0.066 LEELLKLFEEILEELFEE (SEQ ID NO: 219) 0.055
LEELLELIERLLEE (SEQ ID NO: 223) 0.128 LEQLLEDLVKLLKEE (SEQ ID NO:
214) -0.12 LEELLKLIERLLEE (SEQ ID NO: 222) 0.1 LEELLKLIEELLEE (SEQ
ID NO: 224) 0.171 SEEEEELAELLAELLKSLL (SEQ ID NO: 231) 0.010
SEEEEELDQLLSQLIQALLQP (SEQ ID NO: 232) -0.433
220. A fusion polypeptide comprising a plurality of amino acid
sequences linked together in series, each of the plurality of amino
acid sequences comprising the peptide according to claim 208.
221. A composition comprising one or more peptides according to
claim 208 and a carrier.
222. The composition according to claim 221, wherein the
composition is a clarified cell extract.
223. The composition according to claim 221 further comprising an
additive selected from the group consisting of fertilizer,
herbicide, insecticide, fungicide, nematicide, a bactericidal
agent, a biological inoculant, a plant regulator, and mixtures
thereof.
224. The composition according to claim 223, wherein the
composition comprises clothianidin; a combination of clothianidin
and Bacillus firmus; imidicloprid; a combination of imidicloprid
and Bacillus firmus; thiamethoxam; a combination of thiamethoxam,
mefenoxam, and fludioxynil; a combination of thiamethoxam,
mefenoxam, fludioxynil and azoxystrobin; a combination of
thiamethoxam and abamectin; a combination of thiamethoxam,
abamectin, and a Pasteuria nematicide; a combination of
thiamethoxam, mefenoxam, fludioxynil, azoxystrobin, thiabendazole,
and abamectin; or a biological inoculant comprising a
Bradyrhizobium spp., a Bacillus spp., or a combination thereof.
225. The composition according to claim 221, wherein the carrier is
an aqueous carrier.
226. The composition according to claim 225, wherein the aqueous
carrier further comprises one or more of a biocidal agent, a
protease inhibitor, a non-ionic surfactant, or a combination
thereof.
227. The composition according to claim 221, wherein the carrier is
a solid carrier in particulate form.
228. The composition according to claim 227, wherein the solid
carrier is a dry powder.
229. A method of imparting disease resistance to plants comprising:
applying an effective amount of an isolated peptide according to
claim 208 to a plant or plant seed or the locus where the plant is
growing or is expected to grow, wherein said applying is effective
to impart disease resistance.
230. A method of enhancing plant growth comprising: applying an
effective amount of an isolated peptide according to claim 208 to a
plant or plant seed or the locus where the plant is growing or is
expected to grow, wherein said applying is effective to enhance
plant growth.
231. A method of increasing a plant's tolerance to biotic stress
comprising: applying an effective amount of an isolated peptide
according to claim 208 to a plant or plant seed or the locus where
the plant is growing or is expected to grow, wherein said applying
is effective to increase the plant's tolerance to biotic stress
factors selected from the group consisting of insects, arachnids,
nematodes, weeds, and combinations thereof.
232. A method of increasing a plant's tolerance to abiotic stress
comprising: applying an effective amount of an isolated peptide
according to claim 208 to a plant or plant seed or the locus where
the plant is growing or is expected to grow, wherein said applying
is effective to increase the plant's tolerance to abiotic stress
factors selected from the group consisting of salt stress, water
stress, ozone stress, heavy metal stress, cold stress, heat stress,
nutritional stress, and combinations thereof.
233. An isolated peptide comprising the amino acid sequence of:
TABLE-US-00030 (SEQ ID NO: 93)
(L/I/V/F)-X-X-(L/I/V/F)-(L/I)-X-X-(L/I/V/F)-
(L/I/V/A)-X-X-(L/I)-(L/I/V/F)
wherein the peptide is free of cysteine and methionine; the peptide
has an average Kyte-Doolittle hydropathy index of less than 0.0;
the peptide includes up to 10 additional amino acids at the
N-terminal end of SEQ ID NO: 93, up to 10 additional amino acids at
the C-terminal end of SEQ ID NO: 93, or both; one of the X residues
at positions 2, 6, and 10 being optional, and each X at positions
2, 3, 6, 7, 10, and 11, when present, is selected independently
from R, K, D, isoD, E, N, Q, H, S, T, G, A, and g-glutamate;
wherein the peptide does not contain three or more cationic amino
acids; wherein the isolated peptide, when introduced onto plant
leaf tissue, induces a hypersensitive response.
Description
[0001] This application is a continuation of U.S. patent
application Ser. No. 14/872,298, filed Oct. 1, 2015, which claims
the priority benefit of U.S. Provisional Patent Application Ser.
No. 62/058,535, filed Oct. 1, 2014, and U.S. Provisional Patent
Application Ser. No. 62/140,789, filed Mar. 31, 2015, each of which
is hereby incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to novel hypersensitive
response elicitor peptides and their use for inducing active plant
responses including, among others, growth enhancement, disease
resistance, pest or insect resistance, and stress resistance.
BACKGROUND OF THE INVENTION
[0003] The identification and isolation of harpin proteins came
from basic research at Cornell University attempting to understand
how plant pathogenic bacteria interact with plants. A first line of
defense is the hypersensitive response (HR), a localized plant cell
death at the site of infection. Cell death creates a physical
barrier to movement of the pathogen and in some plants dead cells
can release compounds toxic to the invading pathogen. Research had
indicated that pathogenic bacteria were likely to have a single
factor that was responsible for triggering the HR. A basic aim of
the Cornell research was to identify a specific bacterial protein
responsible for eliciting the HR. The target protein was known to
be encoded by one of a group of bacteria genes called the
Hypersensitive Response and Pathogenicity (hrp) gene cluster. The
hrp cluster in the bacterium Erwinia amylovora (Ea), which causes
fire blight in pear and apple, was dissected and a single protein
was identified that elicited HR in certain plants. This protein was
given the name harpin (and, later, harpin.sub.Ea) and the
corresponding gene designated hrpN. This was the first example of
such a protein and gene identified from any bacterial species.
[0004] A number of different harpin proteins have since been
identified from Erwinia, Pseudomonas, Ralstonia, Xanthomonas, and
Pantoea species, among others. Harpin proteins, while diverse at
the primary amino acid sequence level, share common biochemical and
biophysical characteristics as well as biological functions. Based
on their unique properties, the harpin proteins are regarded in the
literature as belonging to a single class of proteins.
[0005] Subsequent to their identification and isolation, it was
thereafter discovered that harpins could elicit disease resistance
in plants and increase plant growth. An important early finding was
that application of purified harpin protein made a plant resistant
to a subsequent pathogen attack, and in locations on the plant well
away from the injection site. This meant that harpin proteins can
trigger a Systemic Acquired Resistance (SAR), a plant defense
mechanism that provides resistance to a variety of viral,
bacterial, and fungal pathogens.
[0006] In crop protection, there is a continuous need for
compositions that improve the health of plants. Healthier plants
are desirable since they result in better yields and/or a better
quality of the plants or crops. Healthier plants also better resist
biotic and abiotic stress. A high resistance against biotic
stresses in turn allows the growers to reduce the quantity of
pesticides applied and consequently to slow down the development of
resistances against the respective pesticides.
[0007] Harpin.sub..alpha..beta. is a fusion protein that is derived
from several different harpins. Harpin.sub.ap has been shown to
suppress nematode egg production, enhance the growth, quality and
yield of a plant, and increase a plant's vigor. Its amino acid and
nucleotide sequences are described in detail in U.S. Application
Publ. No. 2010/0043095.
[0008] To date, harpin and harpin.sub..alpha..beta. production and
their use in agricultural and horticultural applications have been
as a powdered solid coated on starch. This limits the use and
versatility of the harpin proteins, because liquid suspensions of
the powdered harpin proteins in water have an effective useful life
of only 48-72 hours before significant degradation and loss of
activity occurs. Another problem with harpin solutions is protein
solubility and stability.
[0009] It would be desirable to identify synthetic and derivative
harpin peptides that are readily soluble in aqueous solution,
stable, resistant to chemical degradation, and effective in
initiating the hypersensitive response in plants.
[0010] The present invention is directed to overcoming these and
other limitations in the art.
SUMMARY OF THE INVENTION
[0011] A first aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
TABLE-US-00001 (SEQ ID NO: 93)
(L/I/V/F)-X-X-(L/I/V/F)-(L/I)-X-X-(L/I/V/F)-
(L/I/V/A)-X-X-(L/I)-(L/I/V/F)
wherein the peptide is free of cysteine and methionine; each X at
positions 2 and 6 is optional and, when present, is any amino acid;
and each X at positions 3, 7, 10, and 11 is any amino acid. In one
embodiment, X at only one of positions 2 and 6 is optional. In
certain embodiments, SEQ ID NO: 93 may further include an
additional amino acid residue between the hydrophobic doublets (two
of L/I/V/F/A, as indicated). In certain embodiments, the isolated
peptide further includes a hydrophilic amino acid sequence that is
located N-terminal or C-terminal to SEQ ID NO: 93.
[0012] A second aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
TABLE-US-00002 (SEQ ID NO: 93)
(L/I/V/F)-X-X-(L/I/V/F)-(L/I)-X-X-(L/I/V/F)-
(L/I/V/A)-X-X-(L/I)-(L/I/V/F)
wherein the peptide is free of cysteine and methionine; each X at
positions 2, 6, and 10 is optional and, when present, is any amino
acid; and each X at positions 3, 7, and 11 is any amino acid. In
one embodiment, X at only one of positions 2, 6, and 10 is
optional. In certain embodiments, SEQ ID NO: 93 may further include
an additional amino acid residue between the hydrophobic doublets
(two of L/I/V/F/A, as indicated). In certain embodiments, the
isolated peptide further includes a hydrophilic amino acid sequence
that is located N-terminal or C-terminal to SEQ ID NO: 93.
[0013] A third aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
TABLE-US-00003 (SEQ ID NO: 1, P1/P4 consensus)
XXGISEKXXXXXXXXXXXXXXXX,
wherein [0014] X at position 1 is optional and can be S, N, D,
isoD, G, A, or S; [0015] X at position 2 is optional and can be Q,
E, g-glutamate, G, A, or S; [0016] X at position 8 is Q, E,
g-glutamate, G, A, or S; [0017] X at position 9 is L, I, F, or V;
[0018] X at position 10 is optional and can be D or isoD; [0019] X
at position 11 is Q, E, g-glutamate, G, A, or S; [0020] X at
position 12 is M, L, I, or F; [0021] X at position 13 is M, L, or
I; [0022] X at position 14 is optional and can be any hydrophilic
amino acid, preferably C, S, T, A, D, isoD, K, or Q; [0023] X at
position 15 is Q, E, g-glutamate, G, A, S, K, or I; [0024] X at
position 16 is M, L, I, V, or F; [0025] X at position 17 is M, L,
I, A, or V; [0026] X at position 18 is Q, E, g-glutamate, G, A, S,
M, T, or K; [0027] X at position 19 is A, D, isoD, S, V, T, K, R,
E, H, or G; [0028] X at position 20 is M, L, or I; [0029] X at
position 21 is M, L, I, V, S, or F; [0030] X at position 22 is Q,
E, g-glutamate, G, A, S; [0031] X at position 23 is P, Q, E,
g-glutamate, G, A, or S; and wherein the isolated peptide comprises
one or more mutations relative to a corresponding wildtype amino
acid sequence. In certain embodiments, the one or more mutations
improve the aqueous solubility, stability, or resistance to
chemical degradation of the isolated peptide relative to a
polypeptide comprising the corresponding wildtype amino acid
sequence.
[0032] One exemplary family of peptides according to the third
aspect of the invention have the amino acid sequence of: [0033]
SXGISEKXXDXXXXXXXXAXXXP (SEQ ID NO: 2, P4 consensus), wherein
[0034] X at position 2 is Q, E, g-glutamate, G, A, or S; [0035] X
at position 8 is Q, E, g-glutamate, G, A, or S; [0036] X at
position 9 is L, A, D, isoD, I, V, or F; [0037] X at position 11 is
Q, E, g-glutamate, G, A, or S; [0038] X at position 12 is L, D,
isoD, I, or F; [0039] X at position 13 is L, I, V, or F; [0040] X
at position 14 is any hydrophilic amino acid, preferably C, S, or
T, S or T, or only S; [0041] X at position 15 is Q, E, g-glutamate,
G, A, S, K, or I; [0042] X at position 16 is L, A, I, V, M, or F;
[0043] X at position 17 is I, S, or F; [0044] X at position 18 is
Q, E, g-glutamate, G, A, or S; [0045] X at position 20 is L, I, V,
or F; [0046] X at position 21 is L or F; and [0047] X at position
22 is Q, E, g-glutamate, G, A, or S. In certain embodiments, these
peptides according to the third aspect of the invention also meet
the structural features defining the peptides according to the
first or second aspect of the invention.
[0048] Another exemplary family of peptides according to the third
aspect of the invention have the amino acid sequence of: [0049]
XXGISEKXLDXLLTXLIXALLXX (SEQ ID NO: 3, P1 consensus), wherein
[0050] X at position 1 is N, D, isoD, G, A, or S; [0051] X at
position 2 is Q, E, g-glutamate, G, A, or S; [0052] X at position 8
is Q, E, g-glutamate, G, A, or S; [0053] X at position 11 is Q, E,
g-glutamate, G, A, or S; [0054] X at position 15 is Q, E,
g-glutamate, G, A, or S; [0055] X at position 18 is M, T, K, E,
g-glutamate, G, A, or S; [0056] X at position 22 is Q, E,
g-glutamate, G, A, or S; and [0057] X at position 23 is Q, E,
g-glutamate, G, A, or S. In certain embodiments, these peptides
according to the third aspect of the invention also meet the
structural features defining the peptides according to the first or
second aspect of the invention.
[0058] A fourth aspect of the invention relates to an isolated
peptide having the amino acid sequence of: [0059] (i)
KPXDSXSXIAKLISXLIXSLLX (SEQ ID NO: 47, P15b/P20 consensus), wherein
[0060] X at position 3 is N, D, or isoD; [0061] X at position 6 is
Q, E, g-glutamate, G, A, or S; [0062] X at position 8 is N, D, or
isoD; [0063] X at position 15 is optional and can be any amino
acid; [0064] X at position 18 is M, E, g-glutamate, G, A, S, T, or
K; and [0065] X at position 22 is optional and can be Q, E,
g-glutamate, G, A, or S; or (ii) IAKLISXLIXSLLX (SEQ ID NO: 12,
P15/20 min consensus), wherein [0066] X at position 7 is optional
and can be any amino acid; [0067] X at position 10 is M, E,
g-glutamate, G, A, S, T, or K; and [0068] X at position 14 is
optional and can be Q, E, g-glutamate, G, A, or S. In certain
embodiments, the isolated peptide comprises one or more mutations
relative to a corresponding wildtype amino acid sequence, and the
one or more mutations improve the aqueous solubility, stability, or
resistance to chemical degradation of the isolated peptide relative
to a polypeptide comprising the corresponding wildtype amino acid
sequence. In certain embodiments, the peptides according to the
fourth aspect of the invention also meet the structural features
defining the peptides according to the first or second aspect of
the invention.
[0069] A fifth aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
(i) PSPXTXXLXXIVGXILXAXN (SEQ ID NO: 66, P6/6a consensus), wherein
[0070] X at position 4 is F or Y; [0071] X at position 6 is Q, E,
g-glutamate, G, A, or S; [0072] X at position 7 is optional and can
be L, M, E, g-glutamate, G, A, S, T, or K; [0073] X at position 9
is M, E, g-glutamate, G, A, S, T, or K; [0074] X at position 10 is
H or N; [0075] X at position 14 is E, g-glutamate, D, or isoD;
[0076] X at position 17 is Q, E, g-glutamate, G, A, or S; and
[0077] X at position 19 is Q, E, g-glutamate, G, A, or S; or (ii)
XTXXLXXIVGXIL (SEQ ID NO: 135, P6/6a min consensus), wherein [0078]
X at position 1 is F or Y; [0079] X at position 3 is Q, E,
g-glutamate, G, A, or S; [0080] X at position 4 is optional and,
according to one embodiment, can be M, E, g-glutamate, G, A, S, T,
or K; or according to another embodiment can be L; [0081] X at
position 6 is M, E, g-glutamate, G, A, S, T, or K; [0082] X at
position 7 is H or N; and [0083] X at position 11 is E,
g-glutamate, D, or isoD; wherein the isolated peptide comprises one
or more mutations relative to a corresponding wildtype amino acid
sequence, and the one or more mutations improve the aqueous
solubility, stability, or resistance to chemical degradation of the
isolated peptide relative to a polypeptide comprising the
corresponding wildtype amino acid sequence. In certain embodiments,
the peptides according to the fifth aspect of the invention also
meet the structural features defining the peptides according to the
first or second aspect of the invention.
[0084] A sixth aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
(i) XXXXXXLXXLLXXLVXLLK (SEQ ID NO: 13, P14d consensus), wherein
[0085] X at position 1 can be: Q, N, D, E, g-glutamate, isoD, or S;
[0086] X at position 2 can be: D, E, g-glutamate, isoD; [0087] X at
position 3 can be: P, D, E, isoD, or g-glutamate; [0088] X at
position 4 can be M, A, S, D, E, isoD, or g-glutamate [0089] X at
position 5 can be Q, E, or g-glutamate; [0090] X at position 6 can
be A, E, or g-glutamate; [0091] X at position 8 can be M, L, E, Q,
D, N, G, A, S, isoD, or g-glutamate; [0092] X at position 9 can be
Q, N, E, D, G, A, S, isoD, or g-glutamate; [0093] X at position 12
can be Q, N, E, D, G, A, S, isoD, or g-glutamate; [0094] X at
position 13 can be Q, N, E, D, G, A, S, isoD, or g-glutamate; and
[0095] X at position 16 can be K, Q, N, E, D, R, G, A, or S; or
(ii) LXXLLXXLVXLLK (SEQ ID NO: 14, P14d min consensus), wherein
[0096] X at position 2 can be M, L, E, Q, D, N, G, A, S, isoD, or
g-glutamate; [0097] X at position 3 can be Q, N, E, D, G, A, S,
isoD, or g-glutamate; [0098] X at position 6 can be Q, N, E, D, G,
A, S, isoD, or g-glutamate; [0099] X at position 7 can be Q, N, E,
D, G, A, S, isoD, or g-glutamate; and [0100] X at position 10 can
be K, Q, N, E, D, R, G, A, or S. In certain embodiments, the
isolated peptide comprises one or more mutations relative to a
corresponding wildtype amino acid sequence, and the one or more
mutations improve the aqueous solubility, stability, or resistance
to chemical degradation of the isolated peptide relative to a
polypeptide comprising the corresponding wildtype amino acid
sequence. In certain embodiments, the peptides according to the
sixth aspect of the invention also meet the structural features
defining the peptides according to the first or second aspect of
the invention.
[0101] A seventh aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
(i) LXXL(L/M)XILXXLV (SEQ ID NO: 16, P25 consensus), wherein [0102]
X at position 2 can be Q, N, E, g-glutamate, D, isoD, T, S, A, or
G; [0103] X at position 3 can be K, Q, N, E, g-glutamate, D, isoD,
T, S, A, or G; [0104] X at position 6 can be K, Q, N, E,
g-glutamate, D, isoD, T, S, A, or G; [0105] X at position 9 can be
E, g-glutamate, D, isoD, Q, N, T, S, A, or G; and [0106] X at
position 10 can be A, G, S, T, E, g-glutamate, D, isoD, Q, or N; or
(ii) LXXVLXXL(L/M)XILXXLV (SEQ ID NO: 17, P25 consensus), wherein X
at position 2 can be T, S, A, G, D, isoD, E, g-glutamate, Q, or N;
X at position 3 can be G, T, S, A, D, isoD, E, g-glutamate, Q, or
N; X at position 6 can be Q, N, E, g-glutamate, D, isoD, T, S, A,
or G; X at position 7 can be K, Q, N, E, g-glutamate, D, isoD, T,
S, A, or G; X at position 10 can be K, Q, N, E, g-glutamate, D,
isoD, T, S, A, or G; X at position 13 can be E, g-glutamate, D,
isoD, Q, N, T, S, A, or G; X at position 14 can be A, G, S, T, E,
g-glutamate, D, isoD, Q, or N; and [0107] V at position 16 is
optional. In certain embodiments, the isolated peptide comprises
one or more mutations relative to a corresponding wildtype amino
acid sequence, and the one or more mutations improve the aqueous
solubility, stability, or resistance to chemical degradation of the
isolated peptide relative to a polypeptide comprising the
corresponding wildtype amino acid sequence. In certain embodiments,
the peptides according to the seventh aspect of the invention also
meet the structural features defining the peptides according to the
first or second aspect of the invention.
[0108] An eighth aspect of the invention relates to an isolated
peptide having the amino acid sequence of: [0109] (i)
XXXXXXXXXXX(L/M)XXLLXXLLXXLLXXX (SEQ ID NO: 21, P17/18), wherein
[0110] X at position 1 can be any amino acid, but preferably Q, S,
E, g-glutamate, A, T, G, D, isoD, N, K, or R; [0111] X at position
2 can be any amino acid, but preferably Q, S, E, g-glutamate, A, T,
G, D, isoD, N, K, or R; [0112] X at position 3 can be any amino
acid, but preferably P, Q, S, E, g-glutamate, A, T, G, D, isoD, N,
K, or R; [0113] X at position 4 can be any amino acid, but
preferably I, Q, S, E, g-glutamate, A, T, G, D, N, isoD, K, or R;
[0114] X at position 5 can be any amino acid, but preferably D,
isoD, S, E, g-glutamate, A, T, G, N, Q, K, or R; [0115] X at
position 6 can be any amino acid, but preferably R, Q, S, E,
g-glutamate, A, T, G, D, isoD, N, or K; [0116] X of position 7 can
be any amino acid, but preferably Q, S, E, g-glutamate, A, T, G, D,
isoD, N, K, or R; [0117] X at position 8 can be any amino acid, but
preferably T, Q, S, E, g-glutamate, A, G, D, isoD, N, K, or R;
[0118] X at position 9 can be any amino acid, but preferably I, Q,
S, E, g-glutamate, A, T, G, D, isoD, N, K, or R; [0119] X at
position 10 can be any amino acid, but preferably E, g-glutamate,
Q, S, A, T, G, D, isoD, N, K, or R; [0120] X at position 11 can be
any amino acid, but preferably Q, S, E, g-glutamate, A, T, G, D,
isoD, N, K, or R; [0121] X at position 13 can be any amino acid,
but preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or R;
[0122] X at position 14 can be any amino acid, but preferably Q, A,
S, T, G, D, isoD, E, g-glutamate, N, K, or R; [0123] X at position
17 can be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or R; [0124] X at position 18 can be any
amino acid, but preferably Q, A, S, T, G, D, isoD, E, g-glutamate,
N, K, or R; [0125] X at position 21 can be any amino acid, but
preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or R;
[0126] X at position 22 can be any amino acid, but preferably S, A,
T, G, D, isoD, E, g-glutamate, Q, N, K, or R; [0127] X at position
25 can be any amino acid, but preferably S, A, T, G, D, isoD, E,
g-glutamate, Q, N, K, or R; [0128] X at position 26 can be any
amino acid, but preferably P, S, A, T, G, D, isoD, E, g-glutamate,
Q, N, K, or R; and [0129] X at position 27 can be any amino acid,
but preferably Q, S, A, T, G, D, isoD, E, g-glutamate, N, K, or R;
or (ii) (L/M)XXLLXXLLXXLL (SEQ ID NO: 25, P17/18 min consensus),
wherein [0130] X at position 2 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or R;
[0131] X at position 3 can be any amino acid, but preferably Q, A,
S, T, G, D, isoD, E, g-glutamate, N, K, or R; [0132] X at position
6 can be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or R; [0133] X at position 7 can be any amino
acid, but preferably Q, A, S, T, G, D, isoD, E, g-glutamate, N, K,
or R; [0134] X at position 10 can be any amino acid, but preferably
K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or R; and [0135] X at
position 11 can be any amino acid, but preferably S, A, T, G, D,
isoD, E, g-glutamate, Q, N, K, or R; wherein the isolated peptide
comprises one or more mutations relative to a corresponding
wildtype amino acid sequence, and the one or more mutations improve
the aqueous solubility, stability, or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising the corresponding wildtype amino acid sequence. In
certain embodiments, the peptides according to the eighth aspect of
the invention also meet the structural features defining the
peptides according to the first or second aspect of the
invention.
[0136] A ninth aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
XLXX(L/M)LXLIXX(L/I/V/F/M)(L/I/V/F/M) (SEQ ID NO: 26, P19
consensus), wherein [0137] X at position 1 is optional and can be
L, I, V, F, or M; [0138] X at position 3 can be any amino acid, but
preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or R;
[0139] X at position 4 can be any amino acid, but preferably A, S,
T, G, D, isoD, E, g-glutamate, Q, N, K, or R; [0140] X at position
7 can be any amino acid, but preferably K, A, S, T, G, D, isoD, E,
g-glutamate, Q, N, or R; [0141] X at position 10 can be any amino
acid, but preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K,
or R; and [0142] X at position 11 can be any amino acid, but
preferably R, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or K. In
certain embodiments, the isolated peptide comprises one or more
mutations relative to a corresponding wildtype amino acid sequence,
and the one or more mutations improve the aqueous solubility,
stability, or resistance to chemical degradation of the isolated
peptide relative to a polypeptide comprising the corresponding
wildtype amino acid sequence. In certain embodiments, the peptides
according to the ninth aspect of the invention also meet the
structural features defining the peptides according to the first or
second aspect of the invention.
[0143] A tenth aspect of the invention relates to an isolated
peptide that includes the amino acid sequence of [0144]
(L/M)XXLLX(L/M)FXXI(L/M)XX (SEQ ID NO: 15, P3 min consensus)
wherein [0145] X at position 2 can be Q, N, E, g-glutamate, D,
isoD, T, S, A, or G; [0146] X at position 3 can be Q, N, E,
g-glutamate, D, isoD, T, S, A, or G; [0147] X at position 6 can be
K, Q, N, E, g-glutamate, D, isoD, T, S, A, or G; [0148] X at
position 9 can be E, g-glutamate, D, isoD, Q, N, T, S, A, or G;
[0149] X at position 10 can be A, G, S, T, E, g-glutamate, D, isoD,
Q, or N; [0150] X at position 13 can be Q, N, E, g-glutamate, D,
isoD, T, S, A, or G; and [0151] X at position 14 can be Q, N, E,
g-glutamate, D, isoD, T, S, A, or G. In certain embodiments, the
isolated peptide comprises one or more mutations relative to a
corresponding wildtype amino acid sequence, and the one or more
mutations improve the aqueous solubility, stability, or resistance
to chemical degradation of the isolated peptide relative to a
polypeptide comprising the corresponding wildtype amino acid
sequence. In certain embodiments, the peptides according to the
tenth aspect of the invention also meet the structural features
defining the peptides according to the first or second aspect of
the invention.
[0152] A eleventh aspect of the invention relates to a fusion
protein that includes one of the peptides of the first through
eleventh aspects of the invention along with one or more of a
purification tag, a solubility tag, or a second peptide according
to one of the first through tenth aspects of the invention.
[0153] A twelfth aspect of the invention relates to a composition
that includes one or more peptides according to the first, second,
third, fourth, fifth, sixth, seventh, eighth, ninth, or tenth
aspects of the invention, or a fusion protein according to the
eleventh aspect of the invention, and a carrier.
[0154] A thirteenth aspect of the invention relates to a method of
imparting disease resistance to plants. This method includes:
applying an effective amount of an isolated peptide according to
the first, second, third, fourth, fifth, sixth, seventh, eighth,
ninth, or tenth aspects of the invention, a fusion protein
according to the eleventh aspect of the invention, or a composition
according to the twelfth aspect of the invention to a plant or
plant seed or the locus where the plant is growing or is expected
to grow, wherein said applying is effective to impart disease
resistance.
[0155] A fourteenth aspect of the invention relates to a method of
enhancing plant growth. This method includes: applying an effective
amount of an isolated peptide according to the first, second,
third, fourth, fifth, sixth, seventh, eighth, ninth, or tenth
aspects of the invention, a fusion protein according to the
eleventh aspect of the invention, or a composition according to the
twelfth aspect of the invention to a plant or plant seed or the
locus where the plant is growing or is expected to grow, wherein
said applying is effective to enhance plant growth.
[0156] A fifteenth aspect of the invention relates to a method of
increasing a plant's tolerance and resistance to biotic stressors.
This method includes: applying an effective amount of an isolated
peptide according to the first, second, third, fourth, fifth,
sixth, seventh, eighth, ninth, or tenth aspects of the invention, a
fusion protein according to the eleventh aspect of the invention,
or a composition according to the twelfth aspect of the invention
to a plant or plant seed or the locus where the plant is growing or
is expected to grow, wherein said applying is effective to increase
the plant's tolerance and resistance to biotic stress factors
selected from the group consisting of pests such as insects,
arachnids, nematodes, weeds, and combinations thereof.
[0157] A sixteenth aspect of the invention relates to a method of
increasing a plant's tolerance to abiotic stress. This method
includes: applying an effective amount of an isolated peptide
according to the first, second, third, fourth, fifth, sixth,
seventh, eighth, ninth, or tenth aspects of the invention, a fusion
protein according to the eleventh aspect of the invention, or a
composition according to the twelfth aspect of the invention to a
plant or plant seed or the locus where the plant is growing or is
expected to grow, wherein said applying is effective to increase
the plant's tolerance to abiotic stress factors selected from the
group consisting of salt stress, water stress (including drought
and flooding), ozone stress, heavy metal stress, cold stress, heat
stress, nutritional stress (phosphate, potassium, nitrogen
deficiency), bleaching and light-induced stress, and combinations
thereof.
[0158] A seventeenth aspect of the invention relates to a method
imparting desiccation resistance to cuttings removed from
ornamental plants. This method includes: applying an isolated
peptide according to the first, second, third, fourth, fifth,
sixth, seventh, eighth, ninth, or tenth aspects of the invention, a
fusion protein according to the eleventh aspect of the invention,
or a composition according to the twelfth aspect of the invention
to a plant or the locus where the plant is growing, wherein said
applying is effective to impart desiccation resistance to cuttings
removed from the ornamental plant.
[0159] An eighteenth aspect of the invention relates to a method of
imparting post-harvest disease or post-harvest desiccation
resistance to a fruit or vegetable. This method includes: applying
an effective amount of an isolated peptide according to the first,
second, third, fourth, fifth, sixth, seventh, eighth, ninth, or
tenth aspects of the invention, a fusion protein according to the
eleventh aspect of the invention, or a composition according to the
twelfth aspect of the invention to a plant containing a fruit or
vegetable or the locus where the plant is growing; or applying an
effective amount of the isolated peptide or the composition to a
harvested fruit or vegetable, wherein said applying is effective to
impart post-harvest disease resistance or desiccation resistance to
the fruit or vegetable.
[0160] A nineteenth aspect of the invention relates to a method of
enhancing the longevity of fruit or vegetable ripeness. This method
includes: applying an effective amount of an isolated peptide
according to the first, second, third, fourth, fifth, sixth,
seventh, eighth, ninth, or tenth aspects of the invention, a fusion
protein according to the eleventh aspect of the invention, or a
composition according to the twelfth aspect of the invention to a
plant containing a fruit or vegetable or the locus where the plant
is growing; or applying an effective amount of the isolated peptide
or the composition to a harvested fruit or vegetable, wherein said
applying is effective to enhance the longevity of fruit or
vegetable ripeness.
[0161] A twentieth aspect of the invention relates to a method of
modulating one or more biological signaling processes of a plant.
This method includes: applying an effective amount of an isolated
peptide according to the first, second, third, fourth, fifth,
sixth, seventh, eighth, ninth, or tenth aspects of the invention, a
fusion protein according to the eleventh aspect of the invention,
or a composition according to the twelfth aspect of the invention
to a plant or the locus where the plant is growing, wherein said
applying is effective in modulating one or more biochemical
signaling processes.
[0162] A twenty-first aspect of the invention relates to a DNA
construct including a first nucleic acid molecule encoding a
polypeptide according to the first, second, third, fourth, fifth,
sixth, seventh, eighth, ninth, or tenth aspects of the invention or
a fusion protein according to the eleventh aspect of the invention;
and a promoter-effective nucleic acid molecule operably coupled to
the first nucleic acid molecule. This aspect of the invention also
encompasses a recombinant expression vector containing the DNA
construct, a recombinant host cell containing the DNA construct, as
well as transgenic plants or plant seeds that include a recombinant
plant cell of the invention (which contains the DNA construct).
[0163] A twenty-second aspect of the invention relates to a method
of imparting disease resistance to plants, enhance plant growth,
impart tolerance and resistance to biotic stressors, impart
tolerance to abiotic stress, or modulating plant biochemical
signaling. This method includes providing a transgenic plant
transformed with a DNA construct according to the twenty-first
aspect of the invention; and growing the plant under conditions
effective to permit the DNA construct to express the peptide or the
fusion polypeptide to impart disease resistance, enhance plant
growth, impart tolerance to biotic stress, impart tolerance to
abiotic stress, or modulate biochemical signaling to the transgenic
plant.
[0164] A twenty-third aspect of the invention relates to a method
of imparting desiccation resistance to cuttings removed from
ornamental plants, imparting post-harvest disease or post-harvest
desiccation resistance to a fruit or vegetable, or enhancing the
longevity of fruit or vegetable ripeness. The method includes
providing a transgenic plant transformed with a DNA construct
including a first nucleic acid molecule encoding a polypeptide
according to the first, second, third, fourth, fifth, sixth,
seventh, eighth, ninth, or tenth aspects of the invention or a
fusion protein according to the eleventh aspect of the invention;
and growing the plant under conditions effective to permit the DNA
construct to express the peptide or the fusion polypeptide to
impart desiccation resistance to cuttings removed from a transgenic
ornamental plant, impart post-harvest disease resistance or
desiccation resistance to a fruit or vegetable removed from the
transgenic plant, or enhance longevity of ripeness for a fruit or
vegetable removed from the transgenic plant.
[0165] A twenty-fourth aspect of the invention relates to a method
of imparting disease resistance to plants, enhancing plant growth,
imparting tolerance and resistance to biotic stressors, imparting
tolerance to abiotic stress, or modulating biochemical signaling.
This method includes providing a transgenic plant seed transformed
with a DNA construct according to the twenty-first aspect of the
invention; planting the transgenic plant seed in soil; and
propagating a transgenic plant from the transgenic plant seed to
permit the DNA construct to express the peptide or the fusion
polypeptide to impart disease resistance, enhance plant growth,
impart tolerance to biotic stress, or impart tolerance to abiotic
stress
[0166] A twenty-fifth aspect of the invention relates to a method
of imparting desiccation resistance to cuttings removed from
ornamental plants, imparting post-harvest disease or post-harvest
desiccation resistance to a fruit or vegetable, or enhancing the
longevity of fruit or vegetable ripeness. The method includes
providing a transgenic plant seed transformed with a DNA construct
according to the twenty-first aspect of the invention; planting the
transgenic plant seed in soil; and propagating a transgenic plant
from the transgenic plant seed to permit the DNA construct to
express the peptide or the fusion polypeptide to impart desiccation
resistance to cuttings removed from a transgenic ornamental plant,
impart post-harvest disease resistance or desiccation resistance to
a fruit or vegetable removed from the transgenic plant, or enhance
longevity of ripeness for a fruit or vegetable removed from the
transgenic plant.
[0167] By providing HR-eliciting peptides that exhibit improved
solubility, stability, resistance to chemical degradation, or a
combination of these properties, it will afford growers with
greater flexibility in preparing, handling, and delivering to
plants in their fields or greenhouses effective amounts of
compositions containing these HR-eliciting peptides. Simplifying
the application process for growers will lead to greater compliance
and, thus, improved results with respect to one or more of disease
resistance, growth enhancement, tolerance and resistance to biotic
stressors, tolerance to abiotic stress, desiccation resistance for
cuttings removed from ornamental plants, post-harvest disease
resistance or desiccation resistance to fruit or vegetables
harvested from plants, and/or improved longevity of fruit or
vegetable ripeness for fruit or vegetables harvested from plants.
These and other benefits are described herein.
BRIEF DESCRIPTION OF THE DRAWINGS
[0168] FIG. 1 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in deionized water. The following peptides
are shown: P1 (SEQ ID NO: 4); P1-18A (SEQ ID NO: 44); P1-18K (SEQ
ID NO: 45); and P1-18T (SEQ ID NO: 42). The curve for 1* is
normalized to 100% of P1 at the day 1 time point; 1** is the
original P1 data.
[0169] FIG. 2 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM citrate, pH 5.6. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T. The curve for
1* is normalized to 100% of P1 at the day 1 time point; 1** is the
original P1 data.
[0170] FIG. 3 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM MES, pH 6. The following peptides
are shown: P1, P1-18A, P1-18K, and P1-18T. The curve for 1* is
normalized to 100% of P1 at the day 1 time point; 1** is the
original P1 data.
[0171] FIG. 4 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM MOPS, pH 6.5. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0172] FIG. 5 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM citrate, pH 7.2. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0173] FIG. 6 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM EDDS, pH 7.3. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0174] FIG. 7 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM imidazole, pH 7.5. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0175] FIG. 8 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM EDTA, pH 8. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0176] FIG. 9 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in phosphate, pH 8.0. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0177] FIG. 10 shows a solubility and stability test of peptide P1
and P1 mutants dissolved in 50 mM TES, pH 8.0. The following
peptides are shown: P1, P1-18A, P1-18K, and P1-18T.
[0178] FIG. 11 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in deionized water. The following peptides
are shown: P1, P1-18A, P1-18K, and P1-18T.
[0179] FIG. 12 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM citrate, pH 5.6. The following
peptides are shown: P4 (SEQ ID NO: 5); P4-14A (SEQ ID NO: 136);
P4-14D (SEQ ID NO: 137); P4-14K (SEQ ID NO: 138); P4-14Q (SEQ ID
NO: 139); and P4-14S (SEQ ID NO: 6).
[0180] FIG. 13 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM MES, pH 6. The following peptides
are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and P4-14S.
[0181] FIG. 14 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM MOPS, pH 6.5. The following
peptides are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and
P4-14S.
[0182] FIG. 15 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM citrate, pH 7.2. The following
peptides are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and
P4-14S.
[0183] FIG. 16 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM EDDS, pH 7.3. The following
peptides are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and
P4-14S.
[0184] FIG. 17 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM imidazole, pH 7.5. The following
peptides are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and
P4-14S.
[0185] FIG. 18 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM EDTA, pH 8. The following
peptides are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and
P4-14S.
[0186] FIG. 19 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in phosphate, pH 8. The following peptides
are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and P4-14S.
[0187] FIG. 20 shows a solubility and stability test of peptide P4
and P4 mutants dissolved in 50 mM TES, pH 8. The following peptides
are shown: P4, P4-14A, P4-14D, P4-14K, P4-14Q, and P4-14S.
[0188] FIG. 21 shows a comparison of the stability of peptide P4
and P4 mutants dissolved in 30% isopropanol, 5 mM DTPA, 0.5% sodium
thiosulfate, and 50 mM TES pH 8. The following peptides are shown:
P4, P4-14A, P4-14D, P4-14K, P4-14Q, and P4-14S
[0189] FIG. 22 shows a comparison of the stability of various
peptides dissolved in 50 mM TES pH 8. The following peptides are
shown: P1 (SEQ ID NO: 4); P4-14S (SEQ ID NO: 6); P1-15 (SEQ ID NO:
109); P1-14S (SEQ ID NO: 110); P1-18Q (SEQ ID NO: 115); and P1-23P
(SEQ ID NO:118).
[0190] FIG. 23 shows a solubility and stability test of peptide P18
(SEQ ID NO: 83) dissolved in either MES pH 6, MOPS pH 6.5, EDDS pH
7.3, imidazole pH 7.5, or EDTA pH 8.
[0191] FIG. 24 shows a solubility and stability test of peptide P18
and P18 mutants dissolved in 50 mM EDTA, pH 8. The following
peptides are shown: P18 (SEQ ID NO: 83), P18-1 (SEQ ID NO: 163),
and P18-4 (SEQ ID NO: 164).
[0192] FIG. 25 shows a stability test of peptide P19 (SEQ ID NO:
89) and P19-20L (SEQ ID NO: 90) mutant dissolved in 50 mM citrate,
pH 7.2.
[0193] FIG. 26 shows a stability test of peptide P19 (SEQ ID NO:
89) and P19-20L (SEQ ID NO: 90) mutant dissolved in 50 mM TES, pH
8.0.
DETAILED DESCRIPTION OF THE INVENTION
[0194] One aspect of the invention relates to novel peptides that
possess the ability to induce a hypersensitive response in plants
and promote active plant responses that afford one or more of the
following attributes: disease resistance, growth enhancement,
tolerance and resistance to biotic stressors, tolerance to abiotic
stress, desiccation resistance for cuttings removed from ornamental
plants, post-harvest disease resistance or desiccation resistance
to fruit or vegetables harvested from plants, and/or improved
longevity of fruit or vegetable ripeness for fruit or vegetables
harvested from plants.
[0195] As used herein, naturally occurring amino acids are
identified throughout by the conventional three-letter and/or
one-letter abbreviations, corresponding to the trivial name of the
amino acid, in accordance with the following list: Alanine (Ala,
A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D),
Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q),
Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine
(Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe,
F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T),
Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V). The
abbreviations are accepted in the peptide art and are recommended
by the IUPAC-IUB commission in biochemical nomenclature. Naturally
occurring variations of amino acids include, without limitation,
gamma-glutamate (g-Glu) and isoaspartate (iso-Asp or isoD).
[0196] The term "amino acid" further includes analogues,
derivatives, and congeners of any specific amino acid referred to
herein, as well as C-terminal or N-terminal protected amino acid
derivatives (e.g., modified with an N-terminal, C-terminal, or
side-chain protecting group, including but not limited to
acetylation, formylation, methylation, amidation, esterification,
PEGylation, and addition of lipids. Non-naturally occurring amino
acids are well known and can be introduced into peptides of the
present invention using solid phase synthesis as described below.
Furthermore, the term "amino acid" includes both D- and L-amino
acids. Hence, an amino acid which is identified herein by its name,
three letter or one letter symbol and is not identified
specifically as having the D or L configuration, is understood to
assume any one of the D or L configurations. In one embodiment, a
peptide comprises all L-amino acids.
[0197] In certain embodiments, peptides are identified to "consist
of" a recited sequence, in which case the peptide includes only the
recited amino acid sequence(s) without any extraneous amino acids
at the N- or C-terminal ends thereof. To the extent that a recited
sequence is in the form of a consensus sequence where one or more
of the denoted X or Xaa residues can be any of one or more amino
acids, then multiple peptide sequences are embraced by a peptide
consisting of such a recited sequence.
[0198] In certain other embodiments, peptides are identified to
"consist essentially of" a recited sequence, in which case the
peptide includes the recited amino acid sequence(s) optionally with
one or more extraneous amino acids at the N- and/or C-terminal ends
thereof, which extraneous amino acids do not materially alter one
or more of the following properties: (i) the ability of the peptide
to induce a hypersensitive response in plants, (ii) solubility of
the peptide in water or aqueous solutions, (iii) stability of the
peptide dissolved in water or aqueous solution at 50.degree. C.
over a period of time (e.g., 3 weeks), and (iv) resistance of the
peptide to chemical degradation in the presence of an aqueous
buffered solution that includes a biocidal agent (e.g., Proxel.RTM.
GXL) at 50.degree. C. over a period of time (e.g., 3 weeks).
[0199] Briefly, the stability and resistance to chemical
degradation of peptides can be assessed as follows using peptide
samples having an initial purity of at least about 80%, at least
about 82%, at least about 84%, at least about 86%, at least about
88%, at least about 90%, at least about 92%, at least about 94%, at
least about 96%, or at least about 98%. For water stability, the
peptide is dissolved directly in de-ionized water. For chemical
degradation tests, the peptide is dissolved in an aqueous solution
containing 50 mM pH buffer and 0.25% Proxel GXL. Exemplary pH
buffers include, without limitation: (i) Citrate pH 5.6; (ii) MES
pH 6.2; (iii) MOPS pH 6.5; (iv) imidazole pH 7.0; (v) Citrate pH
7.2; (vi) EDDS, pH 7.3; (vii) EDTA pH 8.0; (viii) sodium phosphate
pH 8.0; or (ix) TES pH 8.0. Peptides are first dissolved in the
aqueous solution at a concentration of 0.5 mg/ml. The samples are
incubated at 50.degree. C. to allow for accelerated degradation. An
initial sample of the peptide is removed, diluted 10.times. with
water, and analyzed by reverse-phase HPLC. Briefly, 20 .mu.l of the
sample is injected into the solvent flow of an HPLC instrument and
analyzed on a C18 HPLC column (YMC ProPack C18, YMC, Japan, or C18
Stablebond, Agilent Technologies, USA) using either a triethylamine
phosphate in water/acetonitrile gradient or a 0.1% TFA in
water/0.1% TFA in acetonitrile gradient to separate different
peptide species. Eluting peptides are monitored by UV absorbance at
218 nm and quantified based on the area under the peak. The area
under the peak for the initial peptide sample is treated as the
standard for relative quantification in subsequent runs. At regular
intervals (e.g., 1, 3, 7, 10, 14, 17, and 21 days), each peptide
sample is surveyed and analyzed by HPLC as described above. If
necessary to observe degradation (i.e., where the peptide exhibits
a high degree of chemical stability), this protocol can be extended
by several weeks to observe degradation. The quantification of
subsequent peptide runs is expressed as a percentage of the
original (day 0) HPLC result.
[0200] A peptide that is at least partially soluble in water or
aqueous solution exhibits a solubility of greater than 0.1 mg/ml,
preferably at least about 1.0 mg/ml, at least about 2.0 mg/ml, at
least about 3.0 mg/ml, or at least about 4.0 mg/ml. In certain
embodiments, the peptide exhibits high solubility in water or
aqueous solution, with a solubility of at least about 5.0 mg/ml, at
least about 10.0 mg/ml, at least about 15.0 mg/ml, or at least
about 20 mg/ml.
[0201] A peptide that is stable in water or aqueous solution
exhibits at least about 66%, at least about 68%, at least about
70%, at least about 72%, at least about 74%, at least about 76%, at
least about 78%, at least about 80%, at least about 82%, at least
about 84%, at least about 86%, at least about 88%, or at least
about 90% of the original peptide concentration over the designated
period of time incubated at 50.degree. C. In certain embodiments,
the designated period of time is 3 days, 7 days, 14 days, 21 days,
28 days, one month, two months, or three months.
[0202] A peptide that is resistant to chemical degradation exhibits
at least about 66%, at least about 68%, at least about 70%, at
least about 72%, at least about 74%, at least about 76%, at least
about 78%, at least about 80%, at least about 82%, at least about
84%, at least about 86%, at least about 88%, or at least about 90%
of the original peptide concentration over the designated period of
time incubated at 50.degree. C. In certain embodiments, the
designated period of time is 3 days, 7 days, 14 days, 21 days, 28
days, one month, two months, or three months.
[0203] A property of a peptide to elicit a hypersensitive response,
or not, upon infiltration or application of the peptide to plant
tissues can be measured by applying the peptide in dry powder form
or in solution form to a plant, particularly though not exclusively
a plant leaf. Application rates include 1-500 ug/ml for liquid
solution and 0.0001-0.5% (w/w for powder application. Exemplary
application of the peptide in solution form is described in the
accompanying Examples. Plants are considered HR-positive ("HR+") if
they exhibit wide-spread macroscopic cell death visible to the
naked eye, accompanied by wilting and browning of the affected
tissue within 48 hours. Plants are considered HR-negative ("HR-")
if they exhibit no discernible wilting or tissue death observable
by naked eye.
[0204] In certain embodiments, material alteration of the one or
more properties is intended to mean that there is less than 20%
variation, less than 15% variation, less than 10% variation, or
less than 5% variation in a recited property when comparing a
peptide possessing the one or more extraneous amino acids to an
otherwise identical peptide lacking the one or more extraneous
amino acids. In certain embodiments, the number of extraneous amino
acids at the N- or C-terminal ends is up to 20 amino acids at one
or both ends, up to 15 amino acids at one or both ends, up to 10
amino acids at one or both ends, up to 7 amino acids at one or both
ends, up to 5 amino acids at one or both ends, or up to 3 amino
acids at one or both ends. Further, to the extent that a recited
sequence is in the form of a consensus sequence where one or more
of the denoted X or Xaa residues can be any of one or more amino
acids, then multiple peptide sequences are embraced by the peptide
consisting essentially of such a recited sequence, without regard
to additional variations of such sequences that are afforded by the
presence of extraneous amino acids at the N- and/or C-terminal ends
thereof.
[0205] In various embodiments of the invention, the disclosed
peptides may include a hydrophilic amino acid sequence, e.g., at
either the N-terminal or C-terminal end of a designated peptide
sequence. The hydrophilic amino acid sequence is at least 3, at
least 4, at least 5, at least 6, at least 7, at least 8, at least
9, or at least 10 amino acids in length, and includes amino acid
residues that contribute to a hydrophilic property of the amino
acid sequence that is adjacent to the amino acid sequence of the
designated peptide (i.e., the peptide that induces an active plant
response). Different methods have been used in the art to calculate
the relative hydrophobicity/hydrophilicity of amino acid residues
and proteins (Kyte et al., "A Simple Method for Displaying the
Hydropathic Character of a Protein," J. Mol. Biol. 157: 105-32
(1982); Eisenberg D, "Three-dimensional Structure of Membrane and
Surface Proteins," Ann. Rev. Biochem. 53: 595-623 (1984); Rose et
al., "Hydrogen Bonding, Hydrophobicity, Packing, and Protein
Folding," Annu. Rev. Biomol. Struct. 22: 381-415 (1993); Kauzmann,
"Some Factors in the Interpretation of Protein Denaturation," Adv.
Protein Chem. 14: 1-63 (1959), which are hereby incorporated by
reference in their entirety). Any one of these hydrophobicity
scales can be used for the purposes of the present invention;
however, the Kyte-Doolittle hydrophobicity scale is perhaps the
most often referenced scale. These hydropathy scales provide a
ranking list for the relative hydrophobicity of amino acid
residues. For example, amino acids that contribute to
hydrophilicity include Arg (R), Lys (K), Asp (D), Glu (E), Gln (Q),
Asn (N), and His (H) as well as, albeit to a lesser extent, Ser
(S), Thr (T), Gly (G), Pro (P), Tyr (Y), and Trp (W). For example,
polyglutamate sequences can be used to enhance solubility of
proteins and other drug molecules (Lilie et al, Biological
Chemistry 394(8):995-1004 (2013); Li et al., Cancer Research 58:
2404-2409 (1998)), each of which is hereby incorporated by
reference in its entirety).
[0206] The "hydropathy index" of a protein or amino acid sequence
is a number representing its average hydrophilic or hydrophobic
properties. A negative hydropathy index defines the hydrophilicity
of the amino acid sequence of interest. The hydropathy index is
directly proportional to the hydrophilicity of the amino acid
sequence of interest; thus, the more negative the index, the
greater its hydrophilicity. In certain embodiments, the added
hydrophilic amino acid sequence described above has a hydropathy
index of less than 0, -0.4, -0.9, -1.3, -1.6, -3.5, -3.9, or -4.5.
In certain embodiments, the resulting entire peptide will have a
hydropathy index of less than 0.3, 0.2, 0.1, or 0.0, preferably
less than -0.1, -0.2, -0.3, -0.4, more preferably less than -0.5,
-0.6, -0.7, -0.8, -0.9, or -1.0.
[0207] In the peptides of the present invention, amino acids that
contribute to a hydrophilic hydropathy index, for either the
peptide as a whole or the added hydrophilic amino acid sequence,
include Arg (R), Lys (K), Asp (D), Glu (E), Gln (Q), Asn (N), His
(H), Ser (S), Thr (T), Gly (G), Pro (P), Tyr (Y), and Trp (W). Of
these, Asp (D), Glu (E), Gln (Q), Asn (N) or their variants are
preferred. Exemplary variants include g-glutamate for Glu and
isoaspartic acid (or isoD) for Asp.
[0208] As used herein, in this and in other aspects of the
invention, the term "hydrophobic amino acid" is intended to refer
to an amino acid that contributes hydrophobicity to the hydropathy
index of a designated amino acid sequence. Amino acids that
contribute to a hydrophobic hydropathy index, for either the
peptide as a whole or a particular amino acid sequence thereof,
include Ile (I), Val (V), Leu (L), Phe (F), Cys (C), Met (M), and
Ala (A). In certain embodiments, the term "hydrophobic amino acid"
may refer to any one of Ile (I), Val (V), Leu (L), Phe (F), Cys
(C), Met (M), and Ala (A); or, alternatively, to any one of Ile
(I), Val (V), Leu (L), Phe (F), and Ala (A). In certain other
embodiments, the term "hydrophobic amino acid" may refer to one of
Ile (I), Val (V), Leu (L), and Phe (F).
[0209] As used herein, the term "non-hydrophobic amino acid" is
intended to mean an amino acid that is hydrophilic (or not
hydrophobic) on one of the above-identified hydrophobicity scales.
This term generally refers to those amino acids that contribute to
a hydrophilic hydropathy index for either the peptide as a whole or
the added hydrophilic amino acid sequence.
[0210] In one aspect of the invention, the peptide includes the
amino acid sequence of:
TABLE-US-00004 (SEQ ID NO: 93)
(L/I/V/F)-X-X-(L/I/V/F)-(L/I)-X-X-(L/I/V/F)-
(L/I/V/A)-X-X-(L/I)-(L/I/V/F)
wherein the peptide is free of cysteine and methionine; each X at
positions 2 and 6 is optional and, when present, is any amino acid,
including any naturally occurring amino acid; and each X at
positions 3, 7, 10, and 11 is any amino acid, including any
naturally occurring amino acid.
[0211] In a related aspect of the invention, the peptide includes
the amino acid sequence of SEQ ID NO: 93 (shown above), wherein the
peptide is free of cysteine and methionine; each X at positions 2,
6, and 10 is optional and, when present, is any amino acid,
including any naturally occurring amino acid; and each X at
positions 3, 7, and 11 is any amino acid, including any naturally
occurring amino acid.
[0212] According to one embodiment, one or more of X at positions
2, 6, and 10 is not present (i.e., the gap between the first
hydrophobic amino acid and the first hydrophobic amino acid doublet
is reduced from two to one amino acid residue and/or the gap
between the first and second hydrophobic amino acid doublets is
reduced from two to one amino acid residue and/or the gap between
the second and third hydrophobic amino acid doublets is reduced
from two to one amino acid residue). In this embodiment, it is
contemplated that these peptides exclude the amino acid at only one
of positions 2, 6, and 10.
[0213] In an alternative embodiment, X at both of positions 2 and 6
is present (i.e., the gap between the hydrophobic amino acids is
maintained at two amino acid residues at both locations).
[0214] In another embodiment, X at each of positions 2, 6, and 10
is present (i.e., the gap between the hydrophobic amino acids is
maintained at two amino acid residues at each location).
[0215] In certain embodiments, SEQ ID NO: 93 may further include an
additional amino acid residue between the hydrophobic doublets (two
of L/I/V/F/A, as indicated) and the additional amino acid can be
any amino acid. In these embodiments, the gap before the first
hydrophobic doublet is three amino acids, the gap between the first
and second hydrophobic doublets is three amino acids, the gap
between the second and third hydrophobic doublet is three amino
acids, or combinations thereof.
[0216] The peptide length in this embodiment is less than 100 amino
acids, or alternatively less than 90 amino acids, less than 80
amino acids, less than 70 amino acids, less than 60 amino acids, or
less than about 50 amino acids. In certain embodiments, the peptide
length is between 13 and about 50 amino acids in length.
[0217] In the embodiments described above, where X at each of
positions 2, 3, 6, 7, 10, and 11 (when present) of SEQ ID NO: 93
can be any amino acid, in certain embodiments these residues are
hydrophilic in nature. As described above, these hydrophilic amino
acids include Arg (R), Lys (K), Asp (D), Glu (E), Gln (Q), Asn (N),
His (H), Ser (S), Thr (T), Gly (G), Pro (P), Tyr (Y), and Trp (W).
Of these, Asp (D), Glu (E), Gln (Q), Asn (N) or their variants are
preferred. Exemplary variants include g-glutamate for Glu and
isoaspartic acid (or isoD) for Asp.
[0218] In this embodiment, the isolated peptide is stable when
dissolved in water; resistant to chemical degradation in aqueous
conditions in the presence of a pH buffer and a biocide, as
described above; and/or has a solubility in an aqueous solution of
at least about 1.0 mg/ml.
[0219] Another aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
[0220] XXGISEKXXXXXXXXXXXXXXXX (SEQ ID NO: 1, P1/P4 consensus),
wherein [0221] X at position 1 is optional and can be S, N, D,
isoD, G, A, or S; [0222] X at position 2 is optional and can be Q,
E, g-glutamate, G, A, or S; [0223] X at position 8 is Q, E,
g-glutamate, G, A, or S; [0224] X at position 9 is L, I, F, or V;
[0225] X at position 10 is optional and can be D or isoD; [0226] X
at position 11 is Q, E, g-glutamate, G, A, or S; [0227] X at
position 12 is M, L, I, or F; [0228] X at position 13 is M, L, or
I; [0229] X at position 14 is optional and can be any hydrophilic
amino acid, preferably C, S, T, A, D, isoD, K, or Q; [0230] X at
position 15 is Q, E, g-glutamate, G, A, S, K, or I; [0231] X at
position 16 is M, L, I, V, or F; [0232] X at position 17 is M, L,
I, A, or V; [0233] X at position 18 is Q, E, g-glutamate, G, A, S,
M, T, or K; [0234] X at position 19 is A, D, isoD, S, V, T, K, R,
E, g-glutamate, H, or G; [0235] X at position 20 is M, L, or I;
[0236] X at position 21 is M, L, I, V, S, or F; [0237] X at
position 22 is Q, E, g-glutamate, G, A, S; [0238] X at position 23
is P, Q, E, g-glutamate, G, A, or S; and wherein the isolated
peptide comprises one or more mutations relative to a corresponding
wildtype amino acid sequence. In certain embodiments, the one or
more mutations improve the aqueous solubility, stability, or
resistance to chemical degradation of the isolated peptide relative
to a polypeptide comprising the corresponding wildtype amino acid
sequence.
[0239] In certain embodiments, these peptides according to the
second aspect of the invention also meet the structural features
defining the peptides of SEQ ID NO: 93, in which case methionine
and cysteine residues are not present.
[0240] In this embodiment, the corresponding wildtype amino acid
sequence, for purposes of comparing properties of the inventive
peptide, is a polypeptide comprising or the peptide consisting of
the amino acid sequence of NQGISEKQLDQLLTQLIMALLQQ (P1, SEQ ID NO:
4) or SQGISEKQLDQLLCQLIQALL (amino acids 1-21 of SEQ ID NO: 5, P4).
P1 (SEQ ID NO: 4) is derived from the full length protein of
Xanthomonas harpin HpaG (Kim et al., "Mutational Analysis of
Xanthomonas Harpin HpaG Identifies a Key Functional Region That
Elicits the Hypersensitive Response in Nonhost Plants," J.
Bacteriol. 186(18):6239-6247 (2004), which is hereby incorporated
by reference in its entirety). P4 (SEQ ID NO: 5) is derived from
the full length harpin of Xanthomonas oryzae pv. oryzae (Ji et al.,
"Two Coiled-Coil Regions of Xanthomonas oryzae pv. Oryzae Harpin
Differ in Oligomerization and Hypersensitive Response Induction,"
Amino Acids 40:381-392 (2011), which is hereby incorporated by
reference in its entirety).
[0241] In this embodiment, the isolated peptide is stable when
dissolved in water; resistant to chemical degradation in aqueous
conditions in the presence of a pH buffer and a biocide, as
described above; and/or has a solubility in an aqueous solution of
at least about 1.0 mg/ml.
[0242] The length of peptides according to this second aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide length is between 23 and about
50 amino acids in length.
[0243] One exemplary family of peptides according to the second
aspect of the invention have the amino acid sequence of:
[0244] SXGISEKXXDXXXXXXXXAXXXP (SEQ ID NO: 2, P4 consensus),
wherein [0245] X at position 2 is Q, E, g-glutamate, G, A, or S;
[0246] X at position 8 is Q, E, g-glutamate, G, A, or S; [0247] X
at position 9 is L, A, D, isoD, I, V, or F; [0248] X at position 11
is Q, E, g-glutamate, G, A, or S; [0249] X at position 12 is L, D,
isoD, I, or F; [0250] X at position 13 is L, I, V, or F; [0251] X
at position 14 is any hydrophilic amino acid, preferably C, S, or
T, S or T, or only S; [0252] X at position 15 is Q, E, g-glutamate,
G, A, S, K, or I [0253] X at position 16 is L, A, I, V, M, or F
[0254] X at position 17 is I, S, or F [0255] X at position 18 is Q,
E, g-glutamate, G, A, or S; [0256] X at position 20 is L, I, V, or
F; [0257] X at position 21 is L or F; and [0258] X at position 22
is Q, E, g-glutamate, G, A, or S.
[0259] In certain embodiments, these peptides according to SEQ ID
NO: 2 also meet the structural features defining the peptides of
SEQ ID NO: 93, in which case methionine and cysteine residues are
not present. Thus, in these embodiments, X at position 14 is S or
T, preferably S.
[0260] Exemplary peptides that share the consensus structure with
SEQ ID NO: 2, or are derived from SEQ ID NO: 2 and meet the
consensus structure of SEQ ID NO: 93, are identified in Table 1
below:
TABLE-US-00005 TABLE 1 Peptide Variants of Peptide P4 (SEQ ID NO:
5) SEQ ID Peptide Name Sequence NO: P4 SQGISEKQLDQLLCQLIQALLQP 5
P4-14s SQGISEKQLDQLLSQLIQALLQP 6 P4-14s-18e SEGISEKQLDQLLSQLIEALLQP
191 P4-14s-18s SQGISEKQLDQLLSQLISALLQP 7 P4-14s-2,18e
SEGISEKQLDQLLSQLIEALLQP 8 P4-2e-8e SEGISEKELDQLLSQLIQALLQP 9
P4-2e-8e-15e SEGISEKELDQLLSELIQALLQP 10 P4-allE
SEGISEKELDELLSELIEALLQP 11 P4-14s-9i SQGISEKQIDQLLSQLIQALLQP 196
P4-14s-9v SQGISEKQVDQLLSQLIQALLQP 19 P4-14s-9f
SQGISEKQFDQLLSQLIQALLQP 20 P4-14s-12i SQGISEKQLDQILSQLIQALLQP 22
P4-14s-12f SQGISEKQLDQFLSQLIQALLQP 23 P4-14s-13i
SQGISEKQLDQLISQLIQALLQP 24 P4-14s-15a SQGISEKQLDQLLSALIQALLQP 27
P4-14s-15k SQGISEKQLDQLLSKLIQALLQP 28 P4-14s-15s
SQGISEKQLDQLLSSLIQALLQP 29 P4-14s-15i SQGISEKQLDQLLSILIQALLQP 30
P4-14s-16i SQGISEKQLDQLLSQIIQALLQP 32 P4-14s-16f
SQGISEKQLDQLLSQFIQALLQP 34 P4-14s-20i SQGISEKQLDQLLSQLIQAILQP 37
P4-14s-21f SQGISEKQLDQLLSQLIQALFQP 40 P4-14s-dN6 KQLDQLLSQLIQALLQP
94 P4-14s-dN5 EKQLDQLLSQLIQALLQP 95 P4-14s-dN4 SEKQLDQLLSQLIQALLQP
96 P4-14s-dN2 GISEKQLDQLLSQLIQALLQP 97 P4-14s-3E
SQEISEKQLDQLLSQLIQALLQP 98 P4-14S-4L SQGLSEKQLDQLLSQLIQALLQP 99
P4-14S-4A SQGASEKQLDQLLSQLIQALLQP 100 P4-14S-4D
SQGDSEKQLDQLLSQLIQALLQP 101 P4-14s-5V SQGIVEKQLDQLLSQLIQALLQP 102
P4-14s-6R SQGISRKQLDQLLSQLIQALLQP 103 P4-14s-6V
SQGISVKQLDQLLSQLIQALLQP 104 P4-14s-7D SQGISEDQLDQLLSQLIQALLQP 105
P4-14s-7V SQGISEVQLDQLLSQLIQALLQP 106 P4-14S-8V
SQGISEKVLDQLLSQLIQALLQP 107 P4-14S-8S SQGISEKSLDQLLSQLIQALLQP 108
P4-14S-10V SQGISEKQLVQLLSQLIQALLQP 111 P4-14S-11V
SQGISEKQLDVLLSQLIQALLQP 112 P4-14S-12V SQGISEKQLDQVLSQLIQALLQP 113
P4-14S-12S SQGISEKQLDQSLSQLIQALLQP 114 P4-14S-14V
SQGISEKQLDQLLVQLIQALLQP 116 P4-14S-15V SQGISEKQLDQLLSVLIQALLQP 117
P4 SQGISEKQLDQLLCQLIQALLQP 5 P4-14s-17L SQGISEKQLDQLLSQLLQALLQP 119
P4-14s-17A SQGISEKQLDQLLSQLAQALLQP 120 P4-14s-17V
SQGISEKQLDQLLSQLVQALLQP 121 P4-14S-18V SQGISEKQLDQLLSQLIVALLQP 122
P4-14S-19V SQGISEKQLDQLLSQLIQVLLQP 123 P4-14S-19D
SQGISEKQLDQLLSQLIQDLLQP 124 P4-14S-19S SQGISEKQLDQLLSQLIQSLLQP 125
P4-14S-21S SQGISEKQLDQLLSQLIQALSQP 127 P4-14S-21I
SQGISEKQLDQLLSQLIQALIQP 128 P4-14S-21V SQGISEKQLDQLLSQLIQALVQP 129
P4-14S-22V SQGISEKQLDQLLSQLIQALLVP 130 P4-14S-dC2
SQGISEKQLDQLLSQLIQALL 131 p4-d10 SQGISEKQL_QLLSQLIQALLQP 132 p4-d14
SQGISEKQLDQLL_QLIQALLQP 133 P4-14A SQGISEKQLDQLLAQLIQALLQP 136
p4-14D SQGISEKQLDQLLDQLIQALLQP 137 P4-14K SQGISEKQLDQLLKQLIQALLQP
138 P4-14Q SQGISEKQLDQLLQQLIQALLQP 139 p4-i9A
SQGISEKQALDQLLSQLIQALLQP 140 polyE-minp4 SEEEEELDQLLSQLIQALLQP 232
polyE-min2p4 SEEEEELDQLLSQLIQALLQ 31 polyE-min3P4
SEEEEELDQLLSQLIQALL 33 P4-NpolyR RRRRRGGLDQLLSQLIQALLQP 35
P4-CpolyR LDQLLSQLIQALLQPGGRRRRR 36 P4-NpolyK
KKKKKGGLDQLLSQLIQALLQP 38 P4-CpolyK LDQLLSQLIQALLQPGGKKKKK 39
P4-7E-cR SQGISEEQLDQLLSQLIQALLQPR 194 minp4-PolyE
LDQLLSQLIQALLEEEEE 192 SEE-minp4-EE SEELDQLLSQLIQALLEE 193
[0261] Select peptides in Table 1 include solubility tags,
indicated by italic print, including SEEEEE, SEE, EEEEE, EE,
RRRRRGG, KKKKKGG, GGKKKKK, and GGRRRRR. Peptides comprising the
sequences shown in Table 1 but lacking these specific solubility
tags (or having a different solubility tag) are also contemplated
herein.
[0262] As noted above, the peptide P4 (SEQ ID NO: 5) is derived
from the harpin of Xanthomonas oryzae pv. oryzae (Ji et al., "Two
Coiled-Coil Regions of Xanthomonas oryzae pv. Oryzae Harpin Differ
in Oligomerization and Hypersensitive Response Induction," Amino
Acids 40:381-392 (2011), which is hereby incorporated by reference
in its entirety). Ji et al. discloses a fragment of this harpin
having the amino acid sequence SQGISEKQLDQLLCQLIQALL (i.e., amino
acids 1-21 of SEQ ID NO: 5). In certain embodiments, an isolated
peptide comprising the amino acid sequence of SEQ ID NO: 5 is a
peptide that has an overall length of less than about 100 amino
acids (i.e., from 23 amino acids up to about 100 amino acids in
length). In certain other embodiments, the isolated peptide
consists essentially of SEQ ID NO: 5, whereas in another embodiment
the isolated peptide consists of SEQ ID NO: 5.
[0263] Another exemplary family of peptides according to the second
aspect of the invention have the amino acid sequence of:
[0264] XXGISEKXLDXLLTXLIXALLXX (SEQ ID NO: 3, P1 consensus),
wherein [0265] X at position 1 is N, D, isoD, G, A, or S; [0266] X
at position 2 is Q, E, g-glutamate, G, A, or S; [0267] X at
position 8 is Q, E, g-glutamate, G, A, or S; [0268] X at position
11 is Q, E, g-glutamate, G, A, or S; [0269] X at position 15 is Q,
E, g-glutamate, G, A, or S; [0270] X at position 18 is M, T, K, E,
g-glutamate, G, A, or S; [0271] X at position 22 is Q, E,
g-glutamate, G, A, or S; and [0272] X at position 23 is Q, E,
g-glutamate, G, A, or S.
[0273] In certain embodiments, these peptides according to SEQ ID
NO: 3 also meet the structural features defining the peptides of
SEQ ID NO: 93, in which case methionine and cysteine residues are
not present. Thus, in those embodiments, X at position 18 is T, K,
E, g-glutamate, G, A, or S.
[0274] In certain embodiments, the peptides sharing the structure
of SEQ ID NO: 3 have at least one of the residues at positions 2,
8, 11, 15, 22, and 23 of SEQ ID NO: 3 being other than Gln (Q),
i.e., being E, g-glutamate, G, A, or S. In certain embodiments, two
or more of the residues at positions 2, 8, 11, 15, 22, and 23 of
SEQ ID NO: 3 are other than Gln (Q), including three, four, five,
or all six of these residues being other than Gln (Q).
[0275] Exemplary peptides that share the consensus structure with
SEQ ID NO: 3, or are derived from SEQ ID NO: 3 and meet the
consensus structure of SEQ ID NO: 93, are identified in Table 2
below:
TABLE-US-00006 TABLE 2 Peptide Variants of Peptide P1 (SEQ ID NO:
4) SEQ ID Peptide Name Sequence NO: P1 NQGISEKQLDQLLTQLIMALLQQ 4
P1-2E NEGISEKQLDQLLTQLIMALLQQ 41 P1-18T NQGISEKQLDQLLTQLITALLQQ 42
P1-18E NQGISEKQLDQLLTQLIEALLQQ 43 P1-18A NQGISEKQLDQLLTQLIAALLQQ 44
P1-18K NQGISEKQLDQLLTQLIKALLQQ 45 P1-2E,8E,11E,15E,18E
NEGISEKELDELLTELIEALLQQ 46 P1-1S SQGISEKQLDQLLTQLIMALLQQ 109 P1-14S
NQGISEKQLDQLLSQLIMALLQQ 110 P1-18Q NQGISEKQLDQLLTQLIQALLQQ 115
P1-23P NQGISEKQLDQLLTQLIMALLQP 118 polyE-minP1
SEEEEELDQLLTQLIEALLQQ 126 polyE-min2P1 SEEEEELDQLLTQLIEALLQ 134
polyE-min3P1 SEEEEELDQLLTQLIEALL 141 pl-allE-17A
NEGISEKELDELLTELAEALLQQ 195
Select peptides in Table 2 include solubility tags, indicated by
italic print, including SEEEEE. Peptides comprising the sequences
shown in Table 2 but lacking this specific solubility tag (or
having a different solubility tag) are also contemplated
herein.
[0276] As noted above, the peptide of SEQ ID NO: 4 is derived from
the harpin of Xanthomonas oryzae pv. oryzae (Ji et al., "Two
Coiled-Coil Regions of Xanthomonas oryzae pv. Oryzae Harpin Differ
in Oligomerization and Hypersensitive Response Induction," Amino
Acids 40:381-392 (2011), which is hereby incorporated by reference
in its entirety).
[0277] Yet another aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
(i) KPXDSXSXIAKLISXLIXSLLX (SEQ ID NO: 47, P15b/P20 consensus),
wherein [0278] X at position 3 is N, D, or isoD; [0279] X at
position 6 is Q, E, g-glutamate, G, A, or S; [0280] X at position 8
is N, D, or isoD; [0281] X at position 15 is optional and can be
any amino acid; [0282] X at position 18 is M, E, g-glutamate, G, A,
S, T, or K; and [0283] X at position 22 is optional and can be Q,
E, g-glutamate, G, A, or S; or (ii) IAKLISXLIXSLLX (SEQ ID NO: 12,
P15/20 min consensus), wherein [0284] X at position 7 is optional
and can be any amino acid; [0285] X at position 10 is M, E,
g-glutamate, G, A, S, T, or K; and [0286] X at position 14 is
optional and can be Q, E, g-glutamate, G, A, or S.
[0287] In certain embodiments, these peptides according to SEQ ID
NO: 47 or 12 also meet the structural features defining the
peptides of SEQ ID NO: 93, in which case methionine and cysteine
residues are not present. Thus, in those embodiments, X at position
15 of SEQ ID NO: 47 is other than M, and X at position 18 of SEQ ID
NO: 47 is E, g-glutamate, G, A, S, T, or K. Similarly, X at
position 7 of SEQ ID NO: 12 is other than M, and X at position 10
of SEQ ID NO: 47 is E, g-glutamate, G, A, S, T, or K.
[0288] The length of peptides according to this third aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide is between 20 and 44 amino
acids in length.
[0289] In certain embodiments, the peptides sharing the structure
of SEQ ID NO: 47 have at least one of the residues at positions 6
and 22 of SEQ ID NO: 47 being other than Gln (Q), i.e., being E,
g-glutamate, G, A, or S. In certain embodiments, both the residues
at positions 6 and 22 of SEQ ID NO: 47 are other than Gln (Q), or
the residue at position 6 is other than Gln (Q) while the residue
at position 22 is absent.
[0290] Exemplary peptides that share the consensus structure with
SEQ ID NO: 47 or 12, or are derived from one of SEQ ID NOS: 47 and
12, and meet the consensus structure of SEQ ID NO: 93, are
identified in Table 3 below:
TABLE-US-00007 TABLE 3 Peptide Variants of Peptide P15/P20
Consensus (SEQ ID NOS: 47 or 12) Peptide Name Sequence SEQ ID NO:
Wildtype QKDVNFGTPDSTVQNPQDASKPNDSQSNIAKLISALIMSLLQMLT 48 P15b
KPNDSQSNIAKLISALIMSLLQ 49 P15b-8D-18E KPNDSQSDIAKLISALIESLLQ 50
P15b-8D-18A KPNDSQSDIAKLISALIASLLQ 51 P15b-8D-18S
KPNDSQSDIAKLISALISSLLQ 52 P15b-8D-18T KPNDSQSDIAKLISALITSLLQ 53
P15b-8D-18K KPNDSQSDIAKLISALIKSLLQ 54 P15b-8D-6,18E
KPNDSESDIAKLISALIESLLQ 55 P15b-3,8D KPDDSQSDIAKLISALIMSLLQ 56
P15b-3,8D-6E KPDDSESDIAKLISALIMSLLQ 57 P15b-3,8D-18E
KPDDSQSDIAKLISALIESLLQ 58 P15b-3,8D-6,18E KPDDSESDIAKLISALIESLLQ 59
P15b-3,8D-allE KPDDSESDIAKLISALIESLLE 60 P15b-8D-allE
KPNDSESDIAKLISALIESLLE 61 P15b-3D-allE KPDDSESNIAKLISALIESLLE 62
P15a NFGTPDSTVQNPQDASKPNDSQSNIAKLISALIMSLLQM 63 P15a-34Q-39P
NFGTPDSTVQNPQDASKPNDSQSNIAKLISALIQSLLQP 142 P15a-39P
NFGTPDSTVQNPQDASKPNDSQSNIAKLISALIMSLLQP 143 P15a-34Q
NFGTPDSTVQNPQDASKPNDSQSNIAKLISALIQSLLQM 144 P15
KPNDSQSNIAKLISALIMSLLQM 64 P15-59G SEEEEEGGIAKLISALIESLLE 149
P15-59 SEEEEEIAKLISALIESLLE 150 P15-dn4 SQSNIAKLISALIMSLLQ 227 P20
GTPDSTVQNPQDASKPNDSQSNIAKLIS_LIMSLL 65 P20-5 KPNDSQSNIAKLIS_LIMSLL
151 P20-6 KPNDSQSNIAKLIS_LIESLL 152
[0291] Select peptides in Table 3 include solubility tags,
indicated by italic print, including SEEEEE. Peptides comprising
the sequences shown in Table 3 but lacking this specific solubility
tag (or having a different solubility tag) are also contemplated
herein.
[0292] In this embodiment, the corresponding wildtype amino acid
sequence corresponds to amino acids 52 to 96 of the Pseudomonas
syringae HrpW sequence identified in PCT Application WO 01/98501 to
Fan et al., which is hereby incorporated by reference in its
entirety. For purposes of comparing properties of the inventive
peptides, it is intended that the polypeptide comprising or the
peptide consisting of the amino acid sequence of SEQ ID NO: 48 is
used as a reference.
[0293] In certain embodiments, the peptide includes one or more
mutations relative to the corresponding wildtype amino acid
sequence of SEQ ID NO: 48. These one or more mutations include
deletions or substitutions relative to SEQ ID NO: 48. In certain
embodiments, the one or more mutations improve the solubility in
aqueous solution, stability, and/or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising or consisting of the corresponding wildtype amino acid
sequence of SEQ ID NO: 48. In this embodiment, the isolated peptide
is stable when dissolved in water; resistant to chemical
degradation in aqueous conditions in the presence of a pH buffer
and a biocide, as described above; and/or has a solubility in an
aqueous solution of at least about 1.0 mg/ml.
[0294] In certain embodiments, an isolated peptide comprising the
amino acid sequence of SEQ ID NO: 47 is a peptide that has an
overall length between 20 and 36 amino acids, and consists
essentially of SEQ ID NO: 49, SEQ ID NO: 63, or SEQ ID NO: 64,
whereas in another embodiment the isolated peptide consists of SEQ
ID NO: 49, SEQ ID NO: 63, or SEQ ID NO: 64.
[0295] In certain embodiments, an isolated peptide comprising the
amino acid sequence of SEQ ID NO: 47 is a peptide that has an
overall length of less than 100 amino acids and the amino acid
sequence includes SEQ ID NO: 65. In certain embodiments the amino
acid sequence of the peptide consists essentially of SEQ ID NO: 65,
whereas in another embodiment the isolated peptide consists of SEQ
ID NO: 65.
[0296] A further aspect of the invention relates to an isolated
peptide having the amino acid sequence of:
(i) PSPXTXXLXXIVGXILXAXN (SEQ ID NO: 66, P6/6a consensus), wherein
[0297] X at position 4 is F or Y; [0298] X at position 6 is Q, E,
g-glutamate, G, A, or S; [0299] X at position 7 is optional and,
according to one embodiment, can be M, E, g-glutamate, G, A, S, T,
or K; or according to another embodiment can be L; [0300] X at
position 9 is M, E, g-glutamate, G, A, S, T, or K; [0301] X at
position 10 is H or N; [0302] X at position 14 is E, g-glutamate,
D, or isoD; [0303] X at position 17 is Q, E, g-glutamate, G, A, or
S; and [0304] X at position 19 is Q, E, g-glutamate, G, A, or S; or
(ii) XTXXLXXIVGXIL (SEQ ID NO: 135, P6/6a min consensus), wherein
[0305] X at position 1 is F or Y; [0306] X at position 3 is Q, E,
g-glutamate, G, A, or S; [0307] X at position 4 is optional and,
according to one embodiment, can be M, E, g-glutamate, G, A, S, T,
or K; or according to another embodiment can be L; [0308] X at
position 6 is M, E, g-glutamate, G, A, S, T, or K; [0309] X at
position 7 is H or N; and [0310] X at position 11 is E,
g-glutamate, D, or isoD; wherein the isolated peptide comprises one
or more mutations relative to a corresponding wildtype amino acid
sequence. In certain embodiments, the one or more mutations improve
the aqueous solubility, stability, or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising the corresponding wildtype amino acid sequence.
[0311] A comparative wildtype sequence corresponds to amino acids
85-105 of the full length harpin of Xanthomonas oryzae pv. oryzae
(Ji et al., "Two Coiled-Coil Regions of Xanthomonas oryzae pv.
Oryzae Harpin Differ in Oligomerization and Hypersensitive Response
Induction," Amino Acids 40:381-392 (2011), which is hereby
incorporated by reference in its entirety). This comparative
wildtype sequence is the peptide consisting of the amino acid
sequence PSPFTQMLMHIVGEILQAQNG (SEQ ID NO: 153).
[0312] In certain embodiments, the peptide according to this aspect
does not consist of the amino acid sequence of PSPFTQMLMHIVGEILQAQN
(P6a, SEQ ID NO: 67), which corresponds to amino acids 85-104 of
the full length harpin of Xanthomonas oryzae pv. oryzae (Ji et al.,
"Two Coiled-Coil Regions of Xanthomonas oryzae pv. Oryzae Harpin
Differ in Oligomerization and Hypersensitive Response Induction,"
Amino Acids 40:381-392 (2011), which is hereby incorporated by
reference in its entirety).
[0313] In certain embodiments, the peptide of this aspect does not
comprise the peptide sequence of motif 2 as described in U.S. Pat.
No. 8,440,881, which is defined as
(P/A/V)S(P/Q/A)(F/L/Y)TQ(M/A)LM(H/N/Q)IV(G/M)(E/D/Q), SEQ ID NO:
154. By way of example, peptides according to SEQ ID NO: 66 do not
include peptides having M/A/T at position 7 when all other aligning
residues match the sequence of motif 2; or peptides according to
SEQ ID NO: 66 do not include peptides having H/N at position 10
when all other aligning residues match the sequence of motif 2; or
peptides according to SEQ ID NO: 66 do not include peptides having
E/D at position 14 when all other aligning residues match the
sequence of motif 2. Similarly, peptides according to SEQ ID NO:
135 do not include peptides having M/A/T at position 4 when all
other aligning residues match the sequence of motif 2; or peptides
according to SEQ ID NO: 135 do not include peptides having H/N at
position 7 when all other aligning residues match the sequence of
motif 2; or peptides according to SEQ ID NO: 135 do not include
peptides having E/D at position 11 when all other aligning residues
match the sequence of motif 2.
[0314] In certain embodiments, the peptide includes one or more
mutations relative to the corresponding wildtype amino acid
sequence of SEQ ID NO: 153. These one or more mutations include
deletions or substitutions relative to SEQ ID NO: 153. In certain
embodiments, the one or more mutations improve the solubility in
aqueous solution, stability, and/or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising or consisting of the corresponding wildtype amino acid
sequence of SEQ ID NO: 153.
[0315] The length of peptides according to this aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide is between 19 and 50 amino
acids in length.
[0316] In certain embodiments, the peptides according to SEQ ID
NOS: 66 and 135 also meet the structural features defining the
peptides of SEQ ID NO: 93, in which case methionine and cysteine
residues are not present. For example, in peptides according to SEQ
ID NO: 66 that are free of methionine amino acid residues, X at
position 7, if present, is E, g-glutamate, G, A, S, T, K, or L; and
X at position 9 is E, g-glutamate, G, A, S, T, or K. Similarly, for
peptides according to SEQ ID NO: 135 that are free of methionine
amino acid residues, X at position 4, if present, is E,
g-glutamate, G, A, S, T, K, or L; and X at position 6 is E,
g-glutamate, G, A, S, T, or K.
[0317] In certain embodiments, the peptides sharing the structure
of SEQ ID NO: 66 have at least one of the residues at positions 6,
17, and 19 of SEQ ID NO: 66 being other than Gln (Q), i.e., being
E, g-glutamate, G, A, or S. In certain embodiments, two or three of
the residues at positions 6, 17, and 19 of SEQ ID NO: 66 are other
than Gln (Q). Similarly, for peptides sharing the structure of SEQ
ID NO: 135, according to one embodiment these peptides have the
residue at positions 6 being other than Gln (Q), i.e., being E,
g-glutamate, G, A, or S.
[0318] Exemplary peptides that share the consensus structure with
SEQ ID NO: 66 or 135, or are derived from one of SEQ ID NOS: 66 and
135, and meet the consensus structure of SEQ ID NO: 93, are
identified in Table 4 below:
TABLE-US-00008 TABLE 4 Peptide Variants of Peptide P6/P6b Consensus
(SEQ ID NO: 66 or 135) SEQ ID Peptide Name Sequence NO: wildtype
PSPFTQMLMHIVGEILQAQNG 153 P6a PSPFTQMLMHIVGEILQAQN 67 P6
PSPFTQ_LMHIVGEILQAQN 68 P6a-7A PSPFTQALMHIVGEILQAQN 69 P6a-10N
PSPFTQMLMNIVGEILQAQN 70 P6a-4Y PSPYTQMLMHIVGEILQAQN 71 P6a-14D
PSPFTQMLMHIVGDILQAQN 72 P6a-7,9A PSPFTQALAHIVGEILQAQN 73 P6a-6E-7A
PSPFTEALMHIVGEILQAQN 74 P6a-6,17E-7A PSPFTEALMHIVGEILEAQN 75
P6a-allE-7A PSPFTEALMHIVGEILEAEN 76 P6a-allE-4Y-7A
PSPYTEALMHIVGEILEAEN 77 P6a-allE-7A-10N PSPFTEALMNIVGEILEAEN 78
P6a-allE-7A-14D PSPFTEALMHIVGDILEAEN 79 P6a-allE-4Y-7A-
PSPYTEALMNIVGDILEAEN 80 10N-14D P6b FTQMLMHIVGEILQAQN 155 P6c
PSPFTQMLMHIVGEIL 156 P6-7L PSPFTQLLMHIVGEILQAQN 157 P6-9E
PSPFTQMLEHIVGEILQAQN 158 P6a-7L,9E PSPFTQLLEHIVGEILQAQN 159 P6d
SEEEEEFTQMLMHIVGEIL 160 P6d-7L-9E SEEEEEFTQLLEHIVGEIL 161
p6a-dN3-sol SEEFTQMLMHIVGEILQAQN 197 p6a-dC4-sol
SEEEPSPFTQMLMHIVGEIL 198
[0319] Select peptides in Table 4 include solubility tags,
indicated by italic print, including SEE, SEEE, and SEEEEE.
Peptides comprising the sequences shown in Table 4 but lacking
these specific solubility tags (or having a different solubility
tag) are also contemplated herein.
[0320] Another aspect of the invention relates to a peptide having
the amino acid sequence of:
(i) XXXXXXXXXXX(L/M)XXLLXXLLXXLLXXX (SEQ ID NO: 18, P17/18),
wherein [0321] X at position 1 can be any amino acid, but
preferably Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or R;
[0322] X at position 2 can be any amino acid, but preferably Q, S,
E, g-glutamate, A, T, G, D, isoD, N, K, or R; [0323] X at position
3 can be any amino acid, but preferably P, Q, S, E, g-glutamate, A,
T, G, D, isoD, N, K, or R; [0324] X at position 4 can be any amino
acid, but preferably I, Q, S, E, g-glutamate, A, T, G, D, N, isoD,
K, or R; [0325] X at position 5 can be any amino acid, but
preferably D, isoD, S, E, g-glutamate, A, T, G, N, Q, K, or R;
[0326] X at position 6 can be any amino acid, but preferably R, Q,
S, E, g-glutamate, A, T, G, D, isoD, N, or K; [0327] X of position
7 can be any amino acid, but preferably Q, S, E, g-glutamate, A, T,
G, D, isoD, N, K, or R; [0328] X at position 8 can be any amino
acid, but preferably T, Q, S, E, g-glutamate, A, G, D, isoD, N, K,
or R; [0329] X at position 9 can be any amino acid, but preferably
I, Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or R; [0330] X at
position 10 can be any amino acid, but preferably E, g-glutamate,
Q, S, A, T, G, D, isoD, N, K, or R; [0331] X at position 11 can be
any amino acid, but preferably Q, S, E, g-glutamate, A, T, G, D,
isoD, N, K, or R; [0332] X at position 13 can be any amino acid,
but preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or R;
[0333] X at position 14 can be any amino acid, but preferably Q, A,
S, T, G, D, isoD, E, g-glutamate, N, K, or R; [0334] X at position
17 can be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or R; [0335] X at position 18 can be any
amino acid, but preferably Q, A, S, T, G, D, isoD, E, g-glutamate,
N, K, or R; [0336] X at position 21 can be any amino acid, but
preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or R;
[0337] X at position 22 can be any amino acid, but preferably S, A,
T, G, D, isoD, E, g-glutamate, Q, N, K, or R; [0338] X at position
25 can be any amino acid, but preferably S, A, T, G, D, isoD, E,
g-glutamate, Q, N, K, or R; [0339] X at position 26 can be any
amino acid, but preferably P, S, A, T, G, D, isoD, E, g-glutamate,
Q, N, K, or R; and [0340] X at position 27 can be any amino acid,
but preferably Q, S, A, T, G, D, isoD, E, g-glutamate, N, K, or R;
or (ii) (L/M)XXLLXXLLXXLL (SEQ ID NO: 25, P17/18 min consensus),
wherein [0341] X at position 2 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or R;
[0342] X at position 3 can be any amino acid, but preferably Q, A,
S, T, G, D, isoD, E, g-glutamate, N, K, or R; [0343] X at position
6 can be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or R; [0344] X at position 7 can be any amino
acid, but preferably Q, A, S, T, G, D, isoD, E, g-glutamate, N, K,
or R; [0345] X at position 10 can be any amino acid, but preferably
K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or R; and [0346] X at
position 11 can be any amino acid, but preferably S, A, T, G, D,
isoD, E, g-glutamate, Q, N, K, or R.
[0347] In certain embodiments, the peptide includes one or more
mutations relative to a corresponding wildtype amino acid sequence
of Erwinia amylovora HrpW. These one or more mutations include
deletions or substitutions relative to the wildtype HrpW sequence.
In certain embodiments, the one or more mutations improve the
solubility in aqueous solution, stability, and/or resistance to
chemical degradation of the isolated peptide relative to a
polypeptide comprising or consisting of the corresponding wildtype
amino acid sequence of Erwinia amylovora HrpW.
[0348] PCT Application WO 01/98501 to Fan et al., which is hereby
incorporated by reference in its entirety, identifies two
hypersensitive response eliciting domains of HrpW.sub.Ea. The first
extends from amino acid 5 to amino acid 64, particularly from amino
acid 31 to amino acid 57 of HrpW.sub.Ea. The second domain extends
from amino acid 103 to amino acid 146, particularly from amino acid
116 to amino acid 140 of HrpW.sub.Ea. Despite this description in
Fan et al., the reference identifies only a single peptide fragment
of HrpW.sub.Ea, which is the peptide consisting of amino acids 10
to 59.
[0349] A comparative wildtype sequence corresponds to amino acids
10 to 59 of the full length Erwinia amylovora HrpW sequence
identified in PCT Application WO 01/98501 to Fan et al., which is
hereby incorporated by reference in its entirety. For purposes of
comparing properties of the inventive peptides, it is intended that
the peptide consisting of amino acids 10 to 59 of the Erwinia
amylovora HrpW is used as a reference.
[0350] In certain embodiments, the peptide of this aspect does not
consist of the amino acid sequence
TSSSPGLFQSGGDNGLGGHNANSALGQQPIDRQTIEQMAQLLAELLKSLL (SEQ ID NO:
162), which corresponds to amino acids 10 to 59 of the full length
Erwinia amylovora HrpW (PCT Application WO 01/98501 to Fan et al.,
which is hereby incorporated by reference in its entirety).
[0351] In certain embodiments, the peptide includes one or more
mutations relative to the corresponding wildtype amino acid
sequence of SEQ ID NO: 162. These one or more mutations include
deletions or substitutions relative to SEQ ID NO: 162. In certain
embodiments, the one or more mutations improve the solubility in
aqueous solution, stability, and/or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising or consisting of the corresponding wildtype amino acid
sequence of SEQ ID NO: 162.
[0352] The length of peptides according to this fourth aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide is between 13 and 50 amino
acids in length, or even between 13 and 40 amino acids in
length.
[0353] In certain embodiments, the peptides according to SEQ ID
NOS: 18 and 25 also meet the structural features defining the
peptides of SEQ ID NO: 93, in which case methionine and cysteine
residues are not present. For example, when the peptide comprising
SEQ ID NO: 18 is free of methionine amino acid residues, the amino
acid at position 12 is L. Similarly, when the peptide comprising
SEQ ID NO: 25 is free of methionine amino acid residues, the amino
acid at position 1 is L.
[0354] In certain other embodiments, one or more of amino acids 1
to 11 and/or 25 to 27 is not present in the isolated peptide of SEQ
ID NO: 18. For example, peptides lacking amino acids 25 to 27
exhibit improved stability relative to the wildtype sequence.
[0355] Exemplary peptides that share the consensus structure with
SEQ ID NO: 18 or 25, or are derived from one of SEQ ID NOS: 18 and
25, or meet the consensus structure of SEQ ID NO: 93, are
identified in Table 5 below:
TABLE-US-00009 TABLE 5 Peptide Variants of Peptides P17/P18
Consensus (SEQ ID NO: 18 or 25) SEQ Peptide ID Name Sequence NO:
wildtype [*]QQPIDRQTIEQMAQLLAELLKSLL 162 P17
[*]QQPIDRQTIEQMAQLLAQLLKSLL 81 P17a [*]QQPIDRQTIEQLAQLLAQLLKSLL 82
P18 QQPIDRQTIEQMAQLLAQLLKSLLSPQ 83 P18a QQPIDRQTIEQLAQLLAQLLKSLLSPQ
84 P18b IEQMAQLLAQLLKSLL 85 P18c IEQLAQLLAQLLKSLL 86 P18d
DRQTIEQMAQLLAQLLKSLL 87 P18e DRQTIEQLAQLLAQLLKSLL 88 P18-1
QQPIDRQTIEQMAQLLAQLLKSLL 163 P18-3 QQPIDRQTIEQLAQLLAQLLKSLLSP 228
P18-4 DRQTIEQLAQLLAQLLKSLLSP 164 P18-5 QTIEQLAQLLAQLLKSLLSP 165
P18-6 SEEEEEIEQLAQLLAQLLKSLL 166 P18-7 SEEEEELAQLLAQLLKSLL 167
P18-10 SEEEEELAELLAELLKSLL 231 In P17, P17a, and the wildtype
sequence, [*]= TSSSPGLFQSGGDNGLGGHNANSALG
Select peptides in Table 5 include solubility tags, indicated by
italic print, including SEEEEE. Peptides comprising the sequences
shown in Table 5 but lacking these specific solubility tags (or
having a different solubility tag) are also contemplated
herein.
[0356] In this embodiment, the wildtype amino acid sequence
corresponds to amino acids 10 to 59 of the Erwinia amylovora HrpW
sequence identified in PCT Application WO 01/98501 to Fan et al.,
which is hereby incorporated by reference in its entirety. For
purposes of comparing properties of the inventive peptides, it is
intended that the peptide consisting of amino acids 10 to 59 of the
Erwinia amylovora HrpW is used as a reference.
[0357] A further aspect of the invention relates to a peptide
having the amino acid sequence of:
[0358] XLXX(L/M)LXLIXX(L/I/V/F/M)(L/I/V/F/M) (SEQ ID NO: 26, P19
consensus), wherein [0359] X at position 1 is optional and can be
L, I, V, F, or M; [0360] X at position 3 can be any amino acid, but
preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or R;
[0361] X at position 4 can be any amino acid, but preferably A, S,
T, G, D, isoD, E, g-glutamate, Q, N, K, or R; [0362] X at position
7 can be any amino acid, but preferably K, A, S, T, G, D, isoD, E,
g-glutamate, Q, N, or R; [0363] X at position 10 can be any amino
acid, but preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K,
or R; and [0364] X at position 11 can be any amino acid, but
preferably R, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or K.
[0365] As noted above, PCT Application WO 01/98501 to Fan et al.,
which is hereby incorporated by reference in its entirety,
identifies two hypersensitive response eliciting domains of
HrpW.sub.Ea, one of which extends from amino acid 103 to amino acid
146, particularly from amino acid 116 to amino acid 140 of
HrpW.sub.Ea. Despite this description in Fan et al., this reference
does not identify a peptide fragment of HrpW.sub.Ea containing this
domain.
[0366] A comparative wildtype sequence corresponds to amino acids
116 to 140 of the full length Erwinia amylovora HrpW sequence
identified in PCT Application WO 01/98501 to Fan et al., which is
hereby incorporated by reference in its entirety. For purposes of
comparing properties of the inventive peptides, it is intended that
the peptide consisting of amino acids 116 to 140 of the Erwinia
amylovora HrpW is used as a reference.
[0367] In certain embodiments, the peptide of this aspect does not
consist of the amino acid sequence ITPDGQGGGQIGDNPLLKAMLKLIA (SEQ
ID NO: 89), which corresponds to amino acids 116 to 140 of the full
length Erwinia amylovora HrpW (PCT Application WO 01/98501 to Fan
et al., which is hereby incorporated by reference in its
entirety).
[0368] In certain embodiments, the peptide includes one or more
mutations relative to the corresponding wildtype amino acid
sequence of SEQ ID NO: 89. These one or more mutations include
deletions or substitutions relative to SEQ ID NO: 89. In certain
embodiments, the one or more mutations improve the solubility in
aqueous solution, stability, and/or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising or consisting of the corresponding wildtype amino acid
sequence of SEQ ID NO: 89.
[0369] The length of peptides according to this aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide is between 18 and 50 amino
acids in length.
[0370] Exemplary peptides that share the consensus structure with
SEQ ID NO: 26, or are derived from SEQ ID NO: 26 and meet the
consensus structure of SEQ ID NO: 93, are identified in Table 6
below:
TABLE-US-00010 TABLE 6 Peptide Variants of Peptide P19 Consensus
(SEQ ID NO: 26) SEQ Peptide ID Name Sequence NO: P19
ITPDGQGGGQIGDNPLLKAMLKLIA 89 P19-20L ITPDGQGGGQIGDNPLLKALLKLIA 90
P19a ITPDGQGGGQIGDNPLLKAMLKLIARMMDG 91 P19a-allL
ITPDGQGGGQIGDNPLLKALLKLIARLLDG 92 P19-4 QGGGQIGDNPLLKAMLKLIARMMDG
226 P19-5 SEEEEEIGDNPLLKALLKLIARLLDG 168 P19-5a
SEEEEEIGDDELLKALLKLIARLLDG 169 P19-6 SEEEEELLKALLKLIARLLDG 170
P19-11 SEEEEEIGDNPLLKALLKLIARLL 171 P19-7 SEEEEELLKALLKLIARLL 172
P19-8 SEEEEELKALLKLIARLL 173
Select peptides in Table 6 include solubility tags, indicated by
italic print, including SEEEEE. Peptides comprising the sequences
shown in Table 6 but lacking this specific solubility tag (or
having a different solubility tag) are also contemplated
herein.
[0371] Certain peptides in Table 6 also meet the structural
features defining the peptides of SEQ ID NO: 93, in which case
methionine and cysteine residues are not present. When these
peptides also meet the limitations of SEQ ID NO: 93, amino acid
residue 1 of SEQ ID NO: 26, when present, is L, I, V, or F; amino
acid 5 of SEQ ID NO: 26 is L; and amino acids 12 and 13 of SEQ ID
NO: 26 are independently L, I, V, or F.
[0372] Still another aspect of the invention relates to a peptide
having the amino acid sequence:
(i) XXXXXXLXXLLXXLVXLLK (SEQ ID NO: 13, P14d consensus), wherein
[0373] X at position 1 can be: Q, N, D, E, g-glutamate, isoD, or S;
[0374] X at position 2 can be: D, E, g-glutamate, isoD; [0375] X at
position 3 can be: P, D, E, isoD, or g-glutamate; [0376] X at
position 4 can be M, A, S, D, E, isoD, or g-glutamate [0377] X at
position 5 can be Q, E, or g-glutamate; [0378] X at position 6 can
be A, E, or g-glutamate; [0379] X at position 8 can be M, L, E, Q,
D, N, G, A, S, isoD, or g-glutamate; [0380] X at position 9 can be
Q, N, E, D, G, A, S, isoD, or g-glutamate; [0381] X at position 12
can be Q, N, E, D, G, A, S, isoD, or g-glutamate; [0382] X at
position 13 can be Q, N, E, D, G, A, S, isoD, or g-glutamate; and
[0383] X at position 16 can be K, Q, N, E, D, R, G, A, or S; or
(ii) LXXLLXXLVXLLK (SEQ ID NO: 14, P14d min consensus), wherein
[0384] X at position 2 can be M, L, E, Q, D, N, G, A, S, isoD, or
g-glutamate; [0385] X at position 3 can be Q, N, E, D, G, A, S,
isoD, or g-glutamate; [0386] X at position 6 can be Q, N, E, D, G,
A, S, isoD, or g-glutamate; [0387] X at position 7 can be Q, N, E,
D, G, A, S, isoD, or g-glutamate; and [0388] X at position 10 can
be K, Q, N, E, D, R, G, A, or S.
[0389] In certain embodiments, the peptide includes one or more
mutations relative to the corresponding wildtype amino acid
sequence of Ralstonia solanacearum (previously Pseudomonas
solanacearum) PopA. These one or more mutations include deletions
or substitutions relative to the wildtype PopA sequence. In certain
embodiments, the one or more mutations improve the solubility in
aqueous solution, stability, and/or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising or consisting of the corresponding wildtype amino acid
sequence of Ralstonia solanacearum PopA.
[0390] A comparative wildtype sequence corresponds to amino acids
92 to 125 of the Ralstonia solanacearum (previously Pseudomonas
solanacearum) PopA sequence identified in PCT Application WO
01/98501 to Fan et al., which is hereby incorporated by reference
in its entirety. For purposes of comparing properties of the
inventive peptides, it is intended that the wildtype peptide of Fan
et al., consisting of amino acids 92 to 125 of the Ralstonia
solanacearum PopA, is used as a reference.
[0391] In certain embodiments, the peptide of this aspect does not
consist of the amino acid sequence of
QAPQSANKTGNVDDANNQDPMQALMQLLEDLVKL (SEQ ID NO: 174), which
corresponds to amino acids 92 to 125 of the Ralstonia solanacearum
PopA (see PCT Application WO 01/98501 to Fan et al., which is
hereby incorporated by reference in its entirety).
[0392] The length of peptides according to this aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide is between 12 and 50 amino
acids in length.
[0393] Exemplary peptides that share the consensus structure with
SEQ ID NOS: 13 or 14, or are derived from SEQ ID NO: 13 and meet
the consensus structure of SEQ ID NO: 93, are identified in Table 7
below:
TABLE-US-00011 TABLE 7 Peptide Variants of Peptide P14d (SEQ ID NO:
13) Peptide Name Sequence SEQ ID NO: wildtype
QAPQSANKTGNVDDANNQDPMQALMQLLEDLVKL 174 P14d QDPMQALMQLLEDLVKLLK 175
P14e QDPAQALLQLLEDLVKLLK 176 P14f QDPAQALEQLLEDLVKLLK 177 P14-30
SEEEEEALEQLLEDLVKLLK 178 P14c QAGPQSANKTGNVDDANNQDPMQALMQLLEDLVKLLK
199
Select peptides in Table 7 include solubility tags, indicated by
italic print, including SEEEEE. Peptides comprising the sequences
shown in Table 7 but lacking this specific solubility tag (or
having a different solubility tag) are also contemplated
herein.
[0394] It is notable that a C-terminal lysine residue seems to be
necessary for HR elicitation by p14d variants. This is a slight
deviation from the canonical sequence of SEQ ID NO: 93. Without
being bound by belief, it is believed that the C-terminal lysine
may be necessary due to the single hydrophilic amino acid between 2
hydrophobic doublet sequences within the p14d variants (LVKLL).
[0395] Certain peptides according to this aspect also meet the
structural features defining the peptides of SEQ ID NO: 93, in
which case methionine and cysteine residues are not present. For
example, for peptides comprising SEQ ID NO: 13, amino acid residue
4 of SEQ ID NO: 13 is A, S, D, isoD, E, or g-glutamate, and amino
acid residue 8 of SEQ ID NO: 13 is L, E, g-glutamate, Q, D, isoD,
N, G, A, or S. Similarly, for peptides comprising SEQ ID NO: 14 the
amino acid residue at position 2 is L, E, g-glutamate, Q, D, isoD,
N, G, A, or S.
[0396] Yet another aspect of the invention relates to a peptide
having the amino acid sequence:
(i) LXXL(L/M)XILXXLV (SEQ ID NO: 16, P25 consensus) wherein
[0397] X at position 2 can be Q, N, E, g-glutamate, D, isoD, T, S,
A, or G;
[0398] X at position 3 can be K, Q, N, E, g-glutamate, D, isoD, T,
S, A, or G;
[0399] X at position 6 can be K, Q, N, E, g-glutamate, D, isoD, T,
S, A, or G;
[0400] X at position 9 can be E, g-glutamate, D, isoD, Q, N, T, S,
A, or G; and
[0401] X at position 10 can be A, G, S, T, E, g-glutamate, D, isoD,
Q, or N; or
(ii) LXXVLXXL(L/M)XILXXLV (SEQ ID NO: 17, P25 consensus)
wherein
[0402] X at position 2 can be T, S, A, G, D, isoD, E, g-glutamate,
Q, or N;
[0403] X at position 3 can be G, T, S, A, D, isoD, E, g-glutamate,
Q, or N;
[0404] X at position 6 can be Q, N, E, g-glutamate, D, isoD, T, S,
A, or G;
[0405] X at position 7 can be K, Q, N, E, g-glutamate, D, isoD, T,
S, A, or G;
[0406] X at position 10 can be K, Q, N, E, g-glutamate, D, isoD, T,
S, A, or G;
[0407] X at position 13 can be E, g-glutamate, D, isoD, Q, N, T, S,
A, or G;
[0408] X at position 14 can be A, G, S, T, E, g-glutamate, D, isoD,
Q, or N; and
[0409] V at position 16 is optional.
[0410] In certain embodiments, the peptide includes one or more
mutations relative to a corresponding wildtype amino acid sequence
of Ralstonia solanacearum (previously Pseudomonas solanacearum)
PopA. These one or more mutations include deletions or
substitutions relative to the wildtype PopA sequence. In certain
embodiments, the one or more mutations improve the solubility in
aqueous solution, stability, and/or resistance to chemical
degradation of the isolated peptide relative to a polypeptide
comprising or consisting of the corresponding wildtype amino acid
sequence of Ralstonia solanacearum PopA.
[0411] A comparative wildtype sequence corresponds to amino acids
206 to 260 of the Ralstonia solanacearum (previously Pseudomonas
solanacearum) PopA sequence, which is identified in PCT Application
WO 01/98501 to Fan et al., which is hereby incorporated by
reference in its entirety, as a hypersensitive response domain. For
purposes of comparing properties of the inventive peptides, it is
intended that the wildtype peptide of Fan et al., consisting of
amino acids 206 to 260 of the Ralstonia solanacearum PopA, is used
as a reference.
[0412] In certain embodiments, the peptide of this aspect does not
consist of the amino acid sequence of
NGADGGNGVNGNQANGPQNAGDVNGANGADDGSEDQGGLTGVLQK LMKILNALVQ (SEQ ID
NO: 179), which corresponds to amino acids 206 to 260 of the
Ralstonia solanacearum PopA (see PCT Application WO 01/98501 to Fan
et al., which is hereby incorporated by reference in its
entirety).
[0413] The length of peptides according to this aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, or less than about 50 amino acids.
In certain embodiments, the peptide is between 12 and 50 amino
acids in length.
[0414] Exemplary peptides that share the consensus structure with
one of SEQ ID NOS: 16 or 17, or are derived from one of SEQ ID NOS:
16 or 17 and meet the consensus structure of SEQ ID NO: 93, are
identified in Table 8 below:
TABLE-US-00012 TABLE 8 Peptide Variants of Peptides P2 (SEQ ID NO:
180) and P25 (SEQ ID NO: 182) Peptide Name Sequence SEQ ID NO:
wildtype [*] ANGADDGSEDQGG_LTGVLQK 179 LMKILNALVQ P2
ANGADDGSEDQGGLTLTGVLQKLMK 180 ILNALVQ P25-4
EDQGGLTLTGVLQKLMKILNALVQ 181 P25 GGLTLTGVLQKLMKILNAL 182 P25s
EDQGGLTLTGVLQKLMKILNAL 183 P25-7 EDQGGLTLTGVLQKLLKILNAL 184 P25-8
EDQGGLTLTGVLQELMEILNAL 185 P25-20E EDQGGLTLTGVLQKLLKILEALVQ 186
P25-10 SEEEELTLTGVLQKLLKILEAL 187 P25-11 SEEEEELTGVLQKLLKILEAL 188
P25-15 SEEEEELTLTGVLQKLLKILEA 200 P25-16 SEEEEEVLQKLLKILEALV 201
P25-17 SEEEEELQKLLKILEALVQ 202 [*] = N-terminal sequence
NGADGGNGVNGNQANGPQNAGDVNG
Select peptides in Table 8 include solubility tags, indicated by
italic print, including SEEEEE. Peptides comprising the sequences
shown in Table 8 but lacking these specific solubility tags (or
having a different solubility tag) are also contemplated
herein.
[0415] Notably, a number of these derivative peptides in Table 8
include a repeated LT sequence not observed in the wildtype
sequence. However, one should note that these sequences require a
larger hydrophobic sequence to cause a hypersensitive response as
compared with SEQ ID NO: 93. Without being bound by belief, it is
believed that this may be due to the presence of the amino acid
valine in the sequence rather than leucine as well as the presence
of only a single hydrophilic amino acid between the hydrophobic
doublets (LLKIL). Although these changes are deleterious to HR,
their effect can be reversed by the addition of additional
hydrophobic residues at the C-terminus of the peptide ( . . . KIL
versus . . . KILEALV or . . . KILNALV).
[0416] Certain peptides according to this aspect also meet the
structural features defining the peptides of SEQ ID NO: 93, in
which case methionine and cysteine residues are not present. For
example, for peptides comprising SEQ ID NO: 16, amino acid residue
5 is L; and for peptides comprising SEQ ID NO: 17, amino acid
residue 9 is L.
[0417] Yet another aspect of the invention relates to a peptide
having the amino acid sequence:
(i) (L/M)XXLLX(L/M)FXXI(L/M)XX (SEQ ID NO: 15, P3 min consensus)
wherein [0418] X at position 2 can be Q, N, E, g-glutamate, D,
isoD, T, S, A, or G; [0419] X at position 3 can be Q, N, E,
g-glutamate, D, isoD, T, S, A, or G; [0420] X at position 6 can be
K, Q, N, E, g-glutamate, D, isoD, T, S, A, or G; [0421] X at
position 9 can be E, g-glutamate, D, isoD, Q, N, T, S, A, or G;
[0422] X at position 10 can be A, G, S, T, E, g-glutamate, D, isoD,
Q, or N; [0423] X at position 13 can be Q, N, E, g-glutamate, D,
isoD, T, S, A, or G; and [0424] X at position 14 can be Q, N, E,
g-glutamate, D, isoD, T, S, A, or G.
[0425] In certain embodiments, the peptide includes one or more
mutations relative to a corresponding wildtype amino acid sequence
of Erwinia amylovora HrpN. These one or more mutations include
deletions or substitutions relative to the wildtype HrpN sequence.
In certain embodiments, the one or more mutations improve the
solubility in aqueous solution, stability, and/or resistance to
chemical degradation of the isolated peptide relative to a
polypeptide comprising or consisting of the corresponding wildtype
amino acid sequence of Erwinia amylovora HrpN.
[0426] A comparative wildtype sequence corresponds to amino acids
137 to 180 or 150 to 180 of the Erwinia amylovora HrpN sequence,
which are identified in U.S. Pat. No. 7,132,525 to Wei et al.,
which is hereby incorporated by reference in its entirety. The HrpN
peptide containing aa 137 to 180 was identified as a hypersensitive
response-eliciting fragment, whereas the HrpN peptide containing aa
150 to 180 could not be expressed and tested. For purposes of
comparing properties of the inventive peptides, it is intended that
the wildtype peptide of Wei et al., consisting of either amino
acids 137 to 180 or 150 to 180 of the Erwinia amylovora HrpN, is
used as a reference.
[0427] In certain embodiments, the peptide of this aspect does not
consist of the amino acid sequence of
S.sub.137TSQNDDSTSGTDS.sub.150TSDSSDPMQQLLKMFSEIMQSLFGDGQDGT.sub.180
(SEQ ID NO: 230), which corresponds to amino acids 137 to 180 of
the Erwinia amylovora HrpN (see U.S. Pat. No. 7,132,525 to Wei et
al., which is hereby incorporated by reference in its entirety), or
the 31-amino acid peptide corresponding to aa 150 to 180
thereof.
[0428] The length of peptides according to this aspect is
preferably less than about 100 amino acids, or alternatively less
than 90 amino acids, less than 80 amino acids, less than 70 amino
acids, less than 60 amino acids, less than about 50 amino acids,
less than about 40 amino acids, or less than 30 amino acids. In
certain embodiments, the peptide is between 12 and 30 amino acids
in length.
[0429] Exemplary peptides that share the consensus structure with
SEQ ID NOS: 15, or are derived from SEQ ID NOS: 15 and meet the
consensus structure of SEQ ID NO: 93, are identified in Table 9
below:
TABLE-US-00013 TABLE 9 Peptide Variants of Peptide P3 Consensus
(SEQ ID NO: 15) Peptide SEQ Name Sequence ID NO: wildtype
STSQNDDSTSGTDSTSDSSDPM 203 QQLLKMFSEIMQSLFGDGQDGT P3
QNDDSTSGTDSTSDSSDPMQQL 204 LKMFSEIMQSLFGDGQDGT P3-3
SDPMQQLLKMFSEIMQSLF 205 P3-4 SEEELQQLLKLFSEILQSLF 206 P3-6
SEEEEELQQLLKLFSEILQSL 207 P3-7 SEEEEELQQLLKLFSEILQS 208 P3-11
LQQLLKLFSEILQSLFEEEE 209
Select peptides in Table 9 include solubility tags, indicated by
italic print, including SEEE, SEEEEE, and EEEE. Peptides comprising
the sequences shown in Table 9 but lacking these specific
solubility tags (or having a different solubility tag) are also
contemplated herein.
[0430] It is notable that the minimal P3 sequence requires a longer
sequence than the minimal HR-box sequence of SEQ ID NO: 93. Without
being bound by belief, it is believed that this may be due to the
presence of two phenylalanine residues within the hydrophobic
sequence.
[0431] Certain peptides according to this aspect also meet the
structural features defining the peptides of SEQ ID NO: 93, in
which case methionine and cysteine residues are not present. For
example, for peptides comprising SEQ ID NO: 15, amino acid residues
1, 7, and 12 are L.
[0432] Based on the disclosed consensus sequence (SEQ ID NO: 93),
it is possible to generate novel peptide sequences with predicted
HR activity that deviate significantly from bacterial protein
sequences. These peptides can contain hydrophilic residues
optimized for maximum solubility and chemical stability. In a
preferred embodiment, these hydrophilic residues are glutamate.
Lysine and arginine are also possible choices, however a large
number of these residues will cause a toxic response in the
plant.
[0433] In addition to the foregoing peptides that are modeled (and
modified) based on naturally occurring sequences within larger
HR-eliciting proteins, the present invention also contemplates
entirely synthetic peptides that meet the consensus of SEQ ID NO:
93. Ideally, these synthetic peptides include a number of strongly
hydrophilic amino acids spanning between the hydrophobic residues
specified by SEQ ID NO: 93. Exemplary synthetic peptides are listed
in Table 10 below. These peptides contain the necessary hydrophobic
peptides associated with HR elicitation. The intervening
hydrophilic residues are chosen for maximum solubility, preferably
with charged amino acids. It is possible to use uncharged amino
acids, but larger proportions of uncharged amino acids may cause
the resulting peptide to aggregate in solution and form a
precipitate or gel. Glutamate is preferred for chemical stability
over aspartate. Although lysine and arginine have even superior
solubility characteristics, poly-cations produced a toxic response
in the tested plants. As a result, arginine-rich sequences such as
P30-1 (SEQ ID NO: 211) should be avoided.
TABLE-US-00014 TABLE 10 Other HR-box peptides Peptide Name Sequence
SEQ ID NO: P30-2 SEELEELLEELIEELL 189 P30-3 LEELLEELIEELLEE 190
P30-4 LEELLEELIEELL 210 P30-1 RLRRLLRRLIRRLLRP 211 P30-5
LDDLLDDLIDDLLDD 212 P18-13 LEELLEELLEELLEE 213 P14-54 LEQLLEDLVKLL
EE 214 P14-55 LEQLLEDLVELL EE 215 P14-56 LEELLEDLVELL EE 216 P14-57
LEELLEELVELL EE 217 P3-12 LEELLELFEEILEELFEE 218 P3-13
LEELLKLFEEILEELFEE 219 P20-50a IEELIELIEELLEE 220 P15-67
IEELIEELIEELLEE 221 P19-54c LEELLKLIERLLEE 222 P19-54b
LEELLELIERLLEE 223 P19-54a LEELLKLIEELLEE 224 P19-54 LEELLELIEELLEE
225
Select peptides in Table 10 include solubility tags, indicated by
italic print, including SEE, EE, DD, or EEE. Peptides comprising
the sequences shown in Table 10 but lacking these specific
solubility tags (or having different solubility tags) are also
contemplated herein.
[0434] The isolated peptides of the invention can also be presented
in the form of a fusion peptide that includes, in addition, a
second amino acid sequence coupled to the inventive peptides via
peptide bond. The second amino acid sequence can be a purification
tag, such as poly-histidine (His6-), a glutathione-S-transferase
(GST-), or maltose-binding protein (MBP-), which assists in the
purification but can later be removed, i.e., cleaved from the
peptide following recovery. Protease-specific cleavage sites or
chemical-specific cleavage sites (i.e., in a cleavable linker
sequence) can be introduced between the purification tag and the
desired peptide. Protease-specific cleavage sites are well known in
the literature and include, without limitation, the enterokinase
specific cleavage site (Asp).sub.4-Lys, which is cleaved after
lysine; the factor Xa specific cleavage site Ile-(Glu or
Asp)-Gly-Arg, which is cleaved after arginine; the trypsin specific
cleavage site, which cleaves after Lys and Arg; and the
Genenase.TM. I specific cleavage site Pro-Gly-Ala-Ala-His-Tyr.
Chemicals and their specific cleavage sites include, without
limitation, cyanogen bromide (CNBr), which cleaves at methionine
(Met) residues; BNPS-skatole, which cleaves at tryptophan (Trp)
residues; formic acid, which cleaves at aspartic acid-proline
(Asp-Pro) peptide bonds; hydroxylamine, which cleaves at
asparagine-glycine (Asn-Gly) peptide bonds; and
2-nitro-5-thiocyanobenzoic acid (NTCB), which cleaves at cysteine
(Cys) residues (see Crimmins et al., "Chemical Cleavage of Proteins
in Solution," Curr. Protocol. Protein Sci., Chapter 11: Unit 11.4
(2005), which is hereby incorporated by reference in its entirety).
In order to use one of these cleavage methods, it may be necessary
to remove unwanted cleavage sites from within the desired peptide
sequences by mutation. For example, p4-7E-cR (SEQ ID NO: 40) has
been mutated for compatibility with trypsin: the lysine residue at
position 7 is mutated to a glutamate and a C-terminal arginine is
added to represent the product of a theoretical trypsin cleavage.
Likewise, p19-5 (SEQ ID NO: 168) contains the sequence `NP` which
can be cleaved under acidic conditions. Mutation of these residues
to `DE` in p19-5a (SEQ ID NO: 169) prevents this particular
cleavage mechanism. The desired peptide product can be purified
further to remove the cleaved purification tags.
[0435] The isolated peptides of the invention can also be presented
in the form of a fusion peptide that includes multiple peptide
sequences of the present invention linked together by a linker
sequence, which may or may not take the form of a cleavable amino
acid sequence of the type described above. Such multimeric fusion
proteins may or may not include purification tags. In one
embodiment, each monomeric sequence can include a purification tag
linked to a peptide of the invention by a first cleavable peptide
sequence; and the several monomeric sequences can be linked to
adjacent monomeric sequences by a second cleavable peptide
sequence. Consequently, upon expression of the multimeric fusion
protein, i.e., in a host cell, the recovered fusion protein can be
treated with a protease or chemical that is effective to cleave the
second cleavable peptide sequence, thereby releasing individual
monomeric peptide sequences containing purification tags. Upon
affinity purification, the recovered monomeric peptide sequences
can be treated with a protease or chemical that is effective to
cleave the first cleavable peptide sequence and thereby release the
purification tag from the peptide of interest. The latter can be
further purified using gel filtration and/or HPLC as described
infra.
[0436] According to one approach, the peptides of the present
invention can be synthesized by standard peptide synthesis
operations. These include both FMOC (9-fluorenylmethyloxy-carbonyl)
and tBoc (tert-butyloxy-carbonyl) synthesis protocols that can be
carried out on automated solid phase peptide synthesis instruments
including, without limitation, the Applied Biosystems 431 A, 433 A
synthesizers and Peptide Technologies Symphony or large scale
Sonata or CEM Liberty automated solid phase peptide synthesizers.
The use of alternative peptide synthesis instruments is also
contemplated. Peptides prepared using solid phase synthesis are
recovered in a substantially pure form.
[0437] The peptides of the present invention may be also prepared
by using recombinant expression systems followed by separation and
purification of the recombinantly prepared peptides. Generally,
this involves inserting an encoding nucleic acid molecule into an
expression system to which the molecule is heterologous (i.e., not
normally present). One or more desired nucleic acid molecules
encoding a peptide of the invention may be inserted into the
vector. The heterologous nucleic acid molecule is inserted into the
expression system or vector in proper sense (5'-3') orientation and
correct reading frame relative to the promoter and any other 5' and
3' regulatory molecules.
[0438] Representative nucleotide sequences for expression in
bacteria and plant hosts are included in Table 11 below:
TABLE-US-00015 TABLE 11 Peptide & SEQ ID Optimized Host
Nucleotide Sequence NO: P4-14s TCTCAAGGAATTTCTGAAAAGCAA 145 A.
thaliana CTTGATCAACTTCTTTCTCAACTT ATTCAAGCTCTTCTTCAACCT P4-14s
AGCCAGGGTATTAGCGAAAAACAG 146 E. coli CTGGATCAGCTGCTGAGCCAGCTG
ATTCAGGCACTGCTGCAGCCG P1-2E, 8E, AATGAAGGAATTTCTGAAAAGGAA 147 11E,
15E, 18E CTTGATGAACTTCTTACTGAACTT A. thaliana ATTGAAGCTCTTCTTCAACAA
P1-2E, 8E, AATGAAGGTATTAGCGAAAAAGAA 148 11E, 15E, 18E
CTGGATGAACTGCTGACCGAACTG E. coli ATTGAAGCACTGCTGCAGCAG
With knowledge of the encoded amino acid sequence listed herein and
the desired transgenic organism, additional codon-optimized DNA
sequences and RNA sequences can be generated with nothing more than
routine skill.
[0439] Expression (including transcription and translation) of a
peptide or fusion polypeptide of the invention by the DNA construct
may be regulated with respect to the level of expression, the
tissue type(s) where expression takes place and/or developmental
stage of expression. A number of heterologous regulatory sequences
(e.g., promoters and enhancers) are available for controlling the
expression of the DNA construct. These include constitutive,
inducible and regulatable promoters, as well as promoters and
enhancers that control expression in a tissue- or temporal-specific
manner. Exemplary constitutive promoters include the raspberry E4
promoter (U.S. Pat. Nos. 5,783,393 and 5,783,394, each of which is
hereby incorporated by reference in its entirety), the nopaline
synthase (NOS) promoter (Ebert et al., Proc. Natl. Acad. Sci.
(U.S.A.) 84:5745-5749 (1987), which is hereby incorporated by
reference in its entirety), the octopine synthase (OCS) promoter
(which is carried on tumor-inducing plasmids of Agrobacterium
tumefaciens), the caulimovirus promoters such as the cauliflower
mosaic virus (CaMV) 19S promoter (Lawton et al., Plant Mol. Biol.
9:315-324 (1987), which is hereby incorporated by reference in its
entirety) and the CaMV 35S promoter (Odell et al., Nature
313:810-812 (1985), which is hereby incorporated by reference in
its entirety), the figwort mosaic virus 35S-promoter (U.S. Pat. No.
5,378,619, which is hereby incorporated by reference in its
entirety), the light-inducible promoter from the small subunit of
ribulose-1,5-bis-phosphate carboxylase (ssRUBISCO), the Adh
promoter (Walker et al., Proc. Natl. Acad. Sci. (U.S.A.)
84:6624-6628 (1987), which is hereby incorporated by reference in
its entirety), the sucrose synthase promoter (Yang et al., Proc.
Natl. Acad. Sci. (U.S.A.) 87:4144-4148 (1990), which is hereby
incorporated by reference in its entirety), the R gene complex
promoter (Chandler et al., Plant Cell 1:1175-1183 (1989), which is
hereby incorporated by reference in its entirety), the chlorophyll
a/b binding protein gene promoter, the CsVMV promoter (Verdaguer et
al., Plant Mol Biol., 37:1055-1067 (1998), which is hereby
incorporated by reference in its entirety), and the melon actin
promoter (PCT Publ. No. WO00/56863, which is hereby incorporated by
reference in its entirety). Exemplary tissue-specific promoters
include the tomato E4 and E8 promoters (U.S. Pat. No. 5,859,330,
which is hereby incorporated by reference in its entirety) and the
tomato 2AII gene promoter (Van Haaren et al., Plant Mol Bio.,
21:625-640 (1993), which is hereby incorporated by reference in its
entirety).
[0440] In one preferred embodiment, expression of the DNA construct
is under control of regulatory sequences from genes whose
expression is associated with early seed and/or embryo development.
Indeed, in a preferred embodiment, the promoter used is a
seed-enhanced promoter. Examples of such promoters include the 5'
regulatory regions from such genes as napin (Kridl et al., Seed
Sci. Res. 1:209:219 (1991), which is hereby incorporated by
reference in its entirety), globulin (Belanger and Kriz, Genet.
129: 863-872 (1991), GenBank Accession No. L22295, each of which is
hereby incorporated by reference in its entirety), gamma zein Z 27
(Lopes et al., Mol Gen Genet. 247:603-613 (1995), which is hereby
incorporated by reference in its entirety), L3 oleosin promoter
(U.S. Pat. No. 6,433,252, which is hereby incorporated by reference
in its entirety), phaseolin (Bustos et al., Plant Cell 1(9):839-853
(1989), which is hereby incorporated by reference in its entirety),
arcelin5 (U.S. Application Publ. No. 2003/0046727, which is hereby
incorporated by reference in its entirety), a soybean 7S promoter,
a 7Sa promoter (U.S. Application Publ. No. 2003/0093828, which is
hereby incorporated by reference in its entirety), the soybean
75.alpha..beta. conglycinin promoter, a 7S.alpha. promoter (Beachy
et al., EMBO J. 4:3047 (1985); Schuler et al., Nucleic Acid Res.
10(24):8225-8244 (1982), each of which is hereby incorporated by
reference in its entirety), soybean trypsin inhibitor (Riggs et
al., Plant Cell 1(6):609-621 (1989), which is hereby incorporated
by reference in its entirety), ACP (Baerson et al., Plant Mol.
Biol., 22(2):255-267 (1993), which is hereby incorporated by
reference in its entirety), stearoyl-ACP desaturase (Slocombe et
al., Plant Physiol. 104(4):167-176 (1994), which is hereby
incorporated by reference in its entirety), soybean a' subunit of
.beta.-conglycinin (Chen et al., Proc. Natl. Acad. Sci.
83:8560-8564 (1986), which is hereby incorporated by reference in
its entirety), Vicia faba USP (U.S. Application Publ. No.
2003/229918, which is hereby incorporated by reference in its
entirety) and Zea mays L3 oleosin promoter (Hong et al., Plant Mol.
Biol., 34(3):549-555 (1997), which is hereby incorporated by
reference in its entirety).
[0441] Nucleic acid molecules encoding the peptides of the present
invention can be prepared via solid-phase synthesis using, e.g.,
the phosphoramidite method and phosphoramidite building blocks
derived from protected 2'-deoxynucleosides. To obtain the desired
oligonucleotide, the building blocks are sequentially coupled to
the growing oligonucleotide chain in the order required by the
sequence of the product. Upon the completion of the chain assembly,
the product is released from the solid phase to solution,
deprotected, collected, and typically purified using HPLC. The
limits of solid phase synthesis are suitable for preparing
oligonucleotides up to about 200 nt in length, which encodes
peptides on the order of about 65 amino acids or less. The ends of
the synthetized oligonucleotide can be designed to include specific
restriction enzyme cleavage site to facilitate ligation of the
synthesized oligonucleotide into an expression vector.
[0442] For longer peptides, oligonucleotides can be prepared via
solid phase synthesis and then the synthetic oligonucleotide
sequences ligated together using various techniques. Recombinant
techniques for the fabrication of whole synthetic genes are
reviewed, for example, in Hughes et al., "Chapter Twelve--Gene
Synthesis: Methods and Applications," Methods in Enzymology
498:277-309 (2011), which is hereby incorporated by reference in
its entirety.
[0443] Once a suitable expression vector is selected, the desired
nucleic acid sequences are cloned into the vector using standard
cloning procedures in the art, as described by Sambrook et al.,
Molecular Cloning: A Laboratory Manual, Cold Springs Laboratory,
Cold Springs Harbor, N.Y. (1989), or U.S. Pat. No. 4,237,224 to
Cohen and Boyer, which are hereby incorporated by reference in
their entirety. The vector is then introduced to a suitable
host.
[0444] A variety of host-vector systems may be utilized to
recombinantly express the peptides of the present invention.
Primarily, the vector system must be compatible with the host used.
Host-vector systems include, without limitation, the following:
bacteria transformed with bacteriophage DNA, plasmid DNA, or cosmid
DNA; microorganisms such as yeast containing yeast vectors;
mammalian cell systems infected with virus (e.g., vaccinia virus,
adenovirus, etc.); insect cell systems infected with virus (e.g.,
baculovirus); and plant cells infected by Agrobacterium. The
expression elements of these vectors vary in their strength and
specificities. Depending upon the host-vector system utilized, any
one of a number of suitable transcription and translation elements
can be used to carry out this and other aspects of the present
invention.
[0445] Purified peptides may be obtained by several methods. The
peptide is preferably produced in purified form (preferably at
least about 80% or 85% pure, more preferably at least about 90% or
95% pure) by conventional techniques. Depending on whether the
recombinant host cell is made to secrete the peptide into growth
medium (see U.S. Pat. No. 6,596,509 to Bauer et al., which is
hereby incorporated by reference in its entirety), the peptide can
be isolated and purified by centrifugation (to separate cellular
components from supernatant containing the secreted peptide)
followed by sequential ammonium sulfate precipitation of the
supernatant. The fraction containing the peptide is subjected to
gel filtration in an appropriately sized dextran or polyacrylamide
column to separate the peptides from other proteins. If necessary,
the peptide fraction may be further purified by HPLC.
[0446] Alternatively, if the peptide of interest of interest is not
secreted, it can be isolated from the recombinant cells using
standard isolation and purification schemes. This includes
disrupting the cells (e.g., by sonication, freezing, French press,
etc.) and then recovering the peptide from the cellular debris.
Purification can be achieved using the centrifugation,
precipitation, and purification procedures described above. The use
of purification tags, described above, can simplify this
process.
[0447] In certain embodiments, purification is not required. Where
purification is not performed, cell-free lysates (i.e., clarified
cell extracts) can be recovered following centrifugation for
removal of cellular debris. The resulting cell-free lysate can be
treated with heat for a sufficient amount of time to deactivate any
native proteases in the recovered fraction, e.g., 10 min at
100.degree. C. If desired, one or more of biocidal agents, protease
inhibitors, and non-ionic surfactants can be introduced to such a
cell-free preparation (see U.S. Application Publ. No. 20100043095
to Wei, which is hereby incorporated by reference in its
entirety).
[0448] Once the peptides of the present invention are recovered,
they can be used to prepare a composition that includes a carrier,
and one or more additives selected from the group consisting of a
bacteriocidal or biocidal agent, a protease inhibitor, a non-ionic
surfactant, a fertilizer, an herbicide, an insecticide, a
fungicide, a nematicide, biological inoculants, plant regulators,
and mixtures thereof.
[0449] In certain embodiments, the compositions include greater
than about 1 nM of the peptide, greater than about 10 nM of the
peptide, greater than about 20 nM of the peptide, greater than
about 30 nM of the peptide, greater than about 40 nM of the
peptide, greater than about 50 nM of the peptide, greater than
about 60 nM of the peptide, greater than about 70 nM of the
peptide, greater than 80 about nM of the peptide, greater than
about 90 nM of the peptide, greater than about 100 nM of the
peptide, greater than about 150 nM of the peptide, greater than
about 200 nM of the peptide, or greater than about 250 nM of the
peptide. In certain embodiments, the compositions include less than
about 1 nM of the peptide. For example, certain peptides can be
present at a concentration of less than about 2 ng/ml, less than
about 1.75 ng/ml, less than about 1.5 ng/ml, less than about 1.25
ng/ml, less than about 1.0 ng/ml, less than about 0.75 ng/ml, less
than about 0.5 ng/ml, less than about 0.25 ng/ml, or even less than
about 0.1 ng/ml.
[0450] Suitable carriers include water, aqueous solutions
optionally containing one or more co-solvents, slurries, and solid
carrier particles. Exemplary solid carriers include mineral earths
such as silicates, silica gels, talc, kaolins, limestone, lime,
chalk, bole, loess, clays, dolomite, diatomaceous earth, calcium
sulfate, magnesium sulfate, magnesium oxide, ground synthetic
materials, and products of vegetable origin, such as cereal meal,
tree bark meal, wood meal and nutshell meal, cellulose powders,
starches and starch derivatives, as well as other mono-, di-, and
poly-saccharides.
[0451] Suitable fertilizers include, without limitation, ammonium
sulfate, ammonium phosphate, ammonium nitrate, ureas, and
combinations thereof.
[0452] Suitable insecticides include, without limitation, members
of the neonicotinoid class such as imidicloprid, clothianidin, and
thiamethoxam; members of the organophosphate class such as
chlorpyrifos and malathion; members of the pyrethroid class such as
permethrin; other natural insecticides such as nicotine,
nornicotine, and pyrethrins; members of the carbamate class such as
aldicarb, carbofuran, and carbaryl; members of the macrocyclic
lactone class such as various abamectin, avermectin, and ivermectin
products; members of the diamide class such as chlorantraniliprole,
cyantraniliprole, and flubendiamide; chitin synthesis inhibitors,
particularly those of the benzoylurea class such as lufenuron and
diflubenzuron; and any combination thereof, including combinations
of two or more, three or more, or four or more insecticides.
Additional insecticides are listed in the Compendium of Pesticide
Common Names, which is database operated by Alan Wood and available
in electronic form at the alanwood.net internet site.
[0453] Suitable fungicides include, without limitation, members of
the strobilurin class such as azoxystrobin, pyraclostrobin,
trifloxystrobin, picoxystrobin, and fluoxastrobin; members of the
triazole class such as ipconazole, metconazole, tebuconazole,
triticonazole, tetraconazole, difenoconazole, flutriafol,
propiconazole and prothioconazole; members of the succinate
dehydrogenase class such as carboxin, fluxapyroxad, boscalid and
sedaxane: members of the phenylamide class such as metalaxyl,
mefenoxam, benalaxyl, and oxadiyxl; members of the phenylpyrrole
class such as fludioxonil; members of the phthalimide class such as
captan; members of the dithiocarbamate class such as mancozeb and
thiram; members of the benzimidazole class such as thiabendazole;
and any combination thereof, including combinations of two or more,
three or more, or four or more fungicides. Additional fungicides
are listed in the Compendium of Pesticide Common Names, which is a
database operated by Alan Wood and available in electronic form at
the alanwood.net internet site.
[0454] Suitable nematicides include, without limitation, chemicals
of the carbamate class such as aldicarb, aldoxycarb, oxamyl,
carbofuran, and cleothocarb; and chemicals of the organophosphate
class such as thionazin, ethoprophos, fenamiphos, fensulfothion,
terbufos, isazofos, and ebufos. Additional nematicides are listed
in the Compendium of Pesticide Common Names, which is a database
operated by Alan Wood and available in electronic form at the
alanwood.net internet site.
[0455] Suitable bactericides include, without limitation, those
based on dichlorophene and benzylalcohol hemi formal (Proxel.RTM.
from ICI or Acticide.RTM. RS from Thor Chemie and Kathon.RTM. MK
from Rohm & Haas) and isothiazolinone derivatives such as
alkylisothiazolinones and benzisothiazolinones (Acticide.RTM. MBS
from Thor Chemie; Proxel.RTM. GXL from ICI). Additional
bactericides are listed in the Compendium of Pesticide Common
Names, which is a database operated by Alan Wood and available in
electronic form at the alanwood.net internet site.
[0456] Suitable inoculants include, without limitation,
Bradyrhizobium spp., particularly Bradyrhizobium japonicum (BASF
Vault.RTM. products), Bacillus subtilis, Bacillus firmus, Bacillus
pumilis, Streptomyces lydicus, Trichoderma spp., Pasteuria spp.,
other cultures of rhizobial cells (BASF Nodulator.RTM. and
Rhizo-Flo.RTM.), and any combination thereof, including
combinations of two or more, three or more, or four or more
inoculants.
[0457] Plant regulators are chemical substances, either natural or
synthetic, that either stimulate or inhibit plant biochemical
signaling. These are usually, but not exclusively, recognized by
receptors on the surface of the cell, causing a cascade of
reactions in the cell. Suitable plant regulators include, without
limitation, ethephon; ethylene; salicylic acid; acetylsalicylic
acid; jasmonic acid; methyl jasmonate; methyl dihydrojasmonate;
chitin; chitosan; abscisic acid; any auxin compound or inhibitor,
including but not limited to (4-chlorophenoxy)acetic acid,
(2,4-dichlorophenoxy)acetic acid, and 2,3,5-triiodobenzoic acid;
any cytokinin, including but not limited to kinetin and zeatin;
gibberellins; brassinolide; and any combination thereof, including
combinations of two or more, three or more, or four or more
regulators.
[0458] Other suitable additives include buffering agents, wetting
agents, coating agents, and abrading agents. These materials can be
used to facilitate application of the compositions in accordance
with the present invention. In addition, the compositions can be
applied to plant seeds with other conventional seed formulation and
treatment materials, including clays and polysaccharides.
[0459] Compositions or systems use for plant seed treatment
include: one or more of the peptides of the present invention,
preferably though not exclusively one of P1, P4-14S, P6a, P14d,
P15a, P18, P19, or P25, in combination with one or more
insecticides, nematicides, fungicides, other inoculants, or other
plant regulators, including combinations of multiple insecticides,
or multiple nematicides, multiple fungicides, multiple other
inoculants, or multiple plant regulators. Suitable insecticides,
nematicides, fungicides, inoculants, and plant regulators for these
combination treatments include those identified above. These
compositions are presented in the form of a single composition at
the time of seed treatment. In contrast, a system used for seed
treatment may involve multiple treatments, e.g., a composition
containing the peptides is used in one treatment and a composition
containing the one or more insecticides, nematicides, fungicides,
plant regulators and/or bactericides, is used in a separate
treatment. In the latter embodiment, both of these treatments are
carried out at about the same time, i.e., before planting or at
about the time of planting.
[0460] One such example includes one or more of peptides of the
present invention, including (without limitation) one of P1,
P4-14S, P6a, P14d, P15a, P18, P19, or P25, in combination with
Poncho.TM. (clothianidin) available from Bayer Crop Science,
Poncho.TM. VOTiVO (clothianidin and Bacillus firmus biological
nematicide) available from Bayer Crop Science, and Gaucho.TM.
(imidicloprid) available from Bayer Crop Science.
[0461] Another example includes one or more of peptides of the
present invention, including (without limitation) one of P1,
P4-14S, P6a, P14d, P15a, P18, P19, or P25, in combination with
Cruiser.TM. (thiamethoxam) available from Syngenta, CruiserMaxx.TM.
(thiamethoxam, mefenoxam, and fludioxynil) available from Syngenta,
Cruiser Extreme.TM. (thiamethoxam, mefenoxam, fludioxynil, and
azoxystrobin) available from Syngenta, Avicta.TM. (thiamethoxam and
abamectin) available from Syngenta, and Avicta.TM. Complete
(thiamethoxam, abamectin, and Clariva Complete.TM. which contains
the Pasteuria nishizawae--Pn1 biological inoculant) available from
Syngenta, and Avicta Complete.TM. Corn (thiamethoxam, mefenoxam,
fludioxynil, azoxystrobin, thiabendazole and abamectin) available
from Syngenta.
[0462] Another example includes one or more of peptides of the
present invention, including (without limitation) one of P1,
P4-14S, P6a, P14d, P15a, P18, P19, or P25, in combination with
Vault Liquid plus Integral (Bradyrhizobium species and Bacillus
subtilis strain MBI 600 inoculants) available from BASF, Vault NP
(Bradyrhizobium japonicum inoculant) available from BASF, and
Subtilex NG (Bacillus subtilis biological inoculant) available from
BASF.
[0463] The present invention further relates to methods of
imparting disease resistance to plants, enhancing plant growth,
effecting pest control, imparting biotic or abiotic stress
tolerance to plants, and/or modulating plant biochemical signaling.
These methods involve applying an effective amount of an isolated
peptide of the invention, or a composition of the invention to a
plant or plant seed or the locus where the plant is growing or is
expected to grow. As a consequence of such application, the peptide
contacts cells of the plant or plant seed, and induces in the plant
or a plant grown from the plant seed disease resistance, growth
enhancement, tolerance to biotic stress, tolerance to abiotic
stress, or altered biochemical signaling. Alternatively, the
peptide or composition of the invention can be applied to plants
such that seeds recovered from such plants themselves are able to
impart disease resistance in plants, to enhance plant growth, to
affect insect control, to impart tolerance to biotic or abiotic
stress, and/or to modulate biochemical signaling, to modulate
maturation.
[0464] In these embodiments, it is also possible to select plants
or plant seeds or the locus to which the isolated peptide or
composition of the invention is applied. For example, for fields
known to contain a high nematode content, the plants or plant seeds
to be grown in such fields, or the fields (locus), can be
selectively treated by applying the isolated peptide or composition
of the invention as described herein; whereas no such treatment may
be necessary for plants or plant seeds grown in fields containing
low nematode content. Similarly, for fields having reduced
irrigation, the plants or plant seeds to be grown in such fields,
or the fields (locus), can be selectively treated by applying the
isolated peptide or composition of the invention as described
herein; whereas no such treatment may be necessary for plants or
plant seeds grown in fields having adequate irrigation. Likewise,
for fields prone to flooding, the plants or plant seeds to be grown
in such fields, or the fields (locus), can be selectively treated
by applying the isolated peptide or composition of the invention as
described herein; whereas no such treatment may be necessary for
plants or plant seeds grown in fields that are not prone to
flooding. As yet another example of such selection, for fields
prone to insect attack at certain times of the growing season, the
plants or plant seeds to be grown in such fields, or the fields
(locus), can be selectively treated by applying the isolated
peptide or composition of the invention as described herein;
whereas the same field may not be treated at ineffective times of
the growing season or other fields that are not prone to such
attack may go untreated. Such selection steps can be carried out
when practicing each of the methods of use described herein, i.e.,
imparting disease resistance to plants, enhancing plant growth,
effecting pest control (including insects and nematodes), imparting
biotic or abiotic stress tolerance to plants, and/or modulating
plant biochemical signaling.
[0465] As an alternative to applying an isolated peptide or a
composition containing the same to plants or plant seeds in order
to impart disease resistance in plants, to effect plant growth, to
control insects, to impart stress resistance and/or modulated
biochemical signaling to the plants or plants grown from the seeds,
transgenic plants or plant seeds can be utilized. When utilizing
transgenic plants, this involves providing a transgenic plant
transformed with a DNA molecule encoding a peptide of the invention
and growing the plant under conditions effective to permit that DNA
molecule to impart disease resistance to plants, to enhance plant
growth, to control insects, to impart tolerance to biotic or
abiotic stress, and/or to modulate biochemical signaling.
Alternatively, a transgenic plant seed transformed with a DNA
molecule encoding a peptide of the invention can be provided and
planted in soil. A plant is then propagated from the planted seed
under conditions effective to permit that DNA molecule to express
the peptide and thereby impart disease resistance to the transgenic
plant, to enhance plant growth, to control insects, to impart
tolerance to biotic or abiotic stress, and/or to modulate
biochemical signaling.
[0466] The present invention further relates to methods of
improving desiccation resistance for cuttings removed from
ornamental plants, post-harvest disease resistance or desiccation
resistance to fruit or vegetables harvested from plants, and/or
improved longevity of fruit or vegetable ripeness for fruit or
vegetables harvested from plants. These methods involve applying an
effective amount of an isolated peptide of the present invention or
a composition according to the present invention to a plant or the
locus where the plant is growing. As a consequence of such
application, the peptide contacts cells of the plant or plant seed,
and induces desiccation resistance for cuttings removed from
ornamental plants, post-harvest disease resistance or desiccation
resistance to fruit or vegetables harvested from plants, and/or
improved longevity of fruit or vegetable ripeness for fruit or
vegetables harvested from plants. Alternatively, an effective
amount of an isolated peptide of the present invention or a
composition according to the present invention can be applied to a
harvested fruit or vegetable. As a consequence of such application,
the peptide contacts cells of the harvested fruit or vegetable, and
induces post-harvest disease resistance or desiccation resistance
to the treated fruit or vegetables, and/or improved longevity of
fruit or vegetable ripeness for the treated fruit or
vegetables.
[0467] As an alternative to applying an isolated peptide or a
composition containing the same to plants or plant seeds in order
to induce desiccation resistance to cuttings removed from
ornamental plants, post-harvest disease resistance or desiccation
resistance to fruit or vegetables harvested from plants, and/or
improved longevity of fruit or vegetable ripeness for fruit or
vegetables harvested from plants, transgenic plants or plant seeds
can be utilized. When utilizing transgenic plants, this involves
providing a transgenic plant transformed with a DNA molecule
encoding a peptide of the invention and growing the plant under
conditions effective to permit that DNA molecule to induce
desiccation resistance for cuttings removed from ornamental plants,
post-harvest disease resistance or desiccation resistance to fruit
or vegetables harvested from the transgenic plants, and/or improved
longevity of fruit or vegetable ripeness for fruit or vegetables
harvested from the transgenic plants. Alternatively, a transgenic
plant seed transformed with a DNA molecule encoding a peptide of
the invention can be provided and planted in soil. A plant is then
propagated from the planted seed under conditions effective to
permit that DNA molecule to express the peptide and thereby induce
desiccation resistance for cuttings removed from ornamental plants,
post-harvest disease resistance or desiccation resistance to fruit
or vegetables harvested from the transgenic plants, and/or improved
longevity of fruit or vegetable ripeness for fruit or vegetables
harvested from the transgenic plants.
[0468] In these embodiments, it is also possible to select
transgenic plants or plant seeds for carrying out the present
invention. For example, for fields known to contain a high nematode
content, the transgenic plants or plant seeds can be selectively
grown in such fields; whereas non-transgenic plants or plant seeds
can be grown in fields containing low nematode content. Similarly,
for fields having reduced irrigation, the transgenic plants or
plant seeds can be selectively grown in such fields; whereas
non-transgenic plants or plant seeds can be grown in fields having
adequate irrigation. Likewise, for fields prone to flooding, the
transgenic plants or plant seeds can be grown in such fields;
whereas non-transgenic plants or plant seeds can be grown in fields
that are not prone to flooding. As yet another example of such
selection, for fields prone to insect attack at certain times of
the growing season, the transgenic plants or plant seeds can be
selectively grown in such fields; whereas non-transgenic plants or
plant seeds can be grown in fields that are not prone to such
insect attack. Such selection steps can be carried out when
practicing each of the methods of use described herein, i.e.,
imparting disease resistance to plants, enhancing plant growth,
effecting pest control (including insects and nematodes), imparting
biotic or abiotic stress tolerance to plants, and/or modulating
plant biochemical signaling.
[0469] The present invention further relates to methods of
improving desiccation resistance for cuttings removed from
ornamental plants, post-harvest disease resistance or desiccation
resistance to fruit or vegetables harvested from plants, and/or
improved longevity of fruit or vegetable ripeness for fruit or
vegetables harvested from plants. These methods involve applying an
effective amount of an isolated peptide of the present invention or
a composition according to the present invention to a plant or the
locus where the plant is growing. As a consequence of such
application, the peptide contacts cells of the plant or plant seed,
and induces desiccation resistance for cuttings removed from
ornamental plants, post-harvest disease resistance or desiccation
resistance to fruit or vegetables harvested from plants, and/or
improved longevity of fruit or vegetable ripeness for fruit or
vegetables harvested from plants. Alternatively, an effective
amount of an isolated peptide of the present invention or a
composition according to the present invention can be applied to a
harvested fruit or vegetable. As a consequence of such application,
the peptide contacts cells of the harvested fruit or vegetable, and
induces post-harvest disease resistance or desiccation resistance
to the treated fruit or vegetables, and/or improved longevity of
fruit or vegetable ripeness for the treated fruit or
vegetables.
[0470] In these embodiments, it is also possible to select plants,
cuttings, fruits, vegetables, or the locus to which the isolated
peptide or composition of the invention is applied. For example,
for harvested cuttings or fruit or vegetables that are being
shipped great distances or stored for long periods of time, then
these can be selectively treated by applying the isolated peptide
or composition of the invention as described herein; whereas
harvested cuttings or fruit or vegetables that are being shipped
locally and intended to be consumed without substantially periods
of storage can be excluded from such treatment.
[0471] As an alternative to applying an isolated peptide or a
composition containing the same to plants or plant seeds in order
to induce desiccation resistance to cuttings removed from
ornamental plants, post-harvest disease resistance or desiccation
resistance to fruit or vegetables harvested from plants, and/or
improved longevity of fruit or vegetable ripeness for fruit or
vegetables harvested from plants, transgenic plants or plant seeds
can be utilized. When utilizing transgenic plants, this involves
providing a transgenic plant transformed with a DNA molecule
encoding a peptide of the invention and growing the plant under
conditions effective to permit that DNA molecule to induce
desiccation resistance for cuttings removed from ornamental plants,
post-harvest disease resistance or desiccation resistance to fruit
or vegetables harvested from the transgenic plants, and/or improved
longevity of fruit or vegetable ripeness for fruit or vegetables
harvested from the transgenic plants. Alternatively, a transgenic
plant seed transformed with a DNA molecule encoding a peptide of
the invention can be provided and planted in soil. A plant is then
propagated from the planted seed under conditions effective to
permit that DNA molecule to express the peptide and thereby induce
desiccation resistance for cuttings removed from ornamental plants,
post-harvest disease resistance or desiccation resistance to fruit
or vegetables harvested from the transgenic plants, and/or improved
longevity of fruit or vegetable ripeness for fruit or vegetables
harvested from the transgenic plants.
[0472] In these embodiments, it is also possible to select
transgenic plants or plant seeds for carrying out the present
invention. For example, transgenic plants or plant seeds can be
selected for growing when it is known that harvested cuttings or
fruit or vegetables are intended to be shipped great distances or
stored for long periods of time post-harvest; whereas
non-transgenic plants or plant seeds can be selected for growing
when it is known that harvested cuttings or fruit or vegetables are
intended to be shipped locally and/or consumed without
substantially periods of storage.
[0473] Suitable plants include dicots and monocots, including
agricultural, silvicultural, ornamental and horticultural plants,
whether in a natural or genetically modified form. Exemplary plants
include, without limitation, alfalfa, apple, apricot, asparagus,
avocados, bananas, barley, beans, beech (Fagus spec.), begonia,
birch, blackberry, blueberry, cabbage, camphor, canola, carrot,
castor oil plant, cherry, cinnamon, citrus, cocoa bean, coffee,
corn, cotton, cucumber, cucurbit, eucalyptus, fir, flax, fodder
beet, fuchsia, garlic, geranium, grapes, ground nut, hemp, hop,
juneberry, juncea (Brassica juncea), jute, lentil, lettuce,
linseed, melon, mustard, nectarine, oak, oats, oil palm, oil-seed
rape, olive, onion, paprika, pea, peach, pear, pelargonium,
peppers, petunia, pine (Pinus spec.), plum, poplar (Populus spec.),
pome fruit, potato, rape, raspberry, rice, rubber tree, rye,
sorghum, soybean, spinach, spruce, squash, strawberry, sugar beet,
sugar cane, sunflower, tea, teak, tobacco, tomato, triticale, turf,
watermelon, wheat and willow (Salix spec.), Arabidopsis thaliana,
Saintpaulia, poinsettia, chrysanthemum, carnation, and zinnia.
[0474] With respect to modified biochemical signaling, this
includes both enhancement of certain plant biochemical pathways and
diminishment of certain other plant biochemical pathways.
Biochemical signaling pathways that can be altered in accordance
with the present invention include gene expression and protein
production, production of metabolites, and production of signaling
molecules/secondary metabolites. Exemplary biochemical signaling
pathways and their modifications include, without limitation,
induction of nitric oxide production, peroxide production, and
other secondary metabolites; agonist of the ethylene signaling
pathway and induction of ethylene-responsive gene expression (see
Dong et al., Plant Phys. 136:3628-3638 (2004); Li et al., Planta
239:831-46 (2014); Chang et al., PLoS One 10, e0125498 (2015), each
of which is hereby incorporated by reference in its entirety);
agonist of the salicylic acid signaling pathway and induction of
salicylic acid-responsive gene expression (see Dong et al., Plant
J. 20:207-215 (1999), which is hereby incorporated by reference in
its entirety); agonist of the abscisic acid pathway and induction
of abscisic acid-responsive gene expression (see Dong et al.,
Planta 221: 313-327 (2005), which is hereby incorporated by
reference in its entirety); agonist of the gibberellin signaling
pathway and induction of gibberellin-responsive gene expression
(see Li et al., Planta 239:831-46 (2014), which is hereby
incorporated by reference in its entirety); antagonist of jasmonic
acid signaling and inhibiting expression of jasmonic
acid-responsive genes (see Dong et al., Plant Phys. 136:3628-3638
(2004), which is hereby incorporated by reference in its entirety);
inducing protease inhibitor expression (see Laluk and Mengiste,
Plant J. 68:480-494 (2011); Xia et al., Chin. Sci. Bull 56:
2351-2358 (2011), each of which is hereby incorporated by reference
in its entirety); inducing reactive oxygen species production in
plant tissues; inducing immune-related and antimicrobial peptide
production, such as, without limitation, peroxidase, superoxide
dismutase, chitinase, and .beta.-1,3-glucanase (Wang et al., J.
Agric. Food Chem. 59:12527-12533 (2011), which is hereby
incorporated by reference in its entirety); and inducing expansin
gene expression and production (see Li et al., Planta 239:831-46
(2014), which is hereby incorporated by reference in its
entirety).
[0475] With respect to disease resistance, absolute immunity
against infection may not be conferred, but the severity of the
disease is reduced and symptom development is delayed. Lesion
number, lesion size, and extent of sporulation of fungal pathogens
are all decreased. This method of imparting disease resistance has
the potential for treating previously untreatable diseases,
treating diseases systemically which might not be treated
separately due to cost, and avoiding the use of infectious agents
or environmentally harmful materials.
[0476] The method of imparting pathogen resistance to plants in
accordance with the present invention is useful in imparting
resistance to a wide variety of pathogens including viruses,
bacteria, and fungi. Resistance, inter alia, to the following
viruses can be achieved by the method of the present invention:
Tobacco mosaic virus and Tomato mosaic virus. Resistance, inter
alia, to the following bacteria can also be imparted to plants in
accordance with present invention: pathogenic Pseudomonas spp.,
pathogenic Erwinia spp., pathogenic Xanthomonas spp., and
pathogenic Ralstonia spp. Plants can be made resistant, inter alia,
to the following fungi by use of the method of the present
invention: Fusarium spp. and Phytophthora spp.
[0477] With regard to the use of the peptides or compositions of
the present invention to enhance plant growth, various forms of
plant growth enhancement or promotion can be achieved. This can
occur as early as when plant growth begins from seeds or later in
the life of a plant. For example, plant growth according to the
present invention encompasses greater yield, increased plant vigor,
increased vigor of seedlings (i.e., post-germination), increased
plant weight, increased biomass, increased number of flowers per
plant, higher grain and/or fruit yield, increased quantity of seeds
produced, increased percentage of seeds germinated, increased speed
of germination, increased plant size, decreased plant height (for
wheat), greater biomass, more and bigger fruit, earlier fruit
coloration, earlier bud, fruit and plant maturation, more tillers
or side shoots, larger leaves, delayed leaf senescence, increased
shoot growth, increased root growth, altered root/shoot allocation,
increased protein content, increased oil content, increased
carbohydrate content, increased pigment content, increased
chlorophyll content, increased total photosynthesis, increased
photosynthesis efficiency, reduced respiration (lower O.sub.2
usage), compensation for yield-reducing treatments, increased
durability of stems (and resistance to stem lodging), increased
durability of roots (and resistance to root lodging), better plant
growth in low light conditions, and combinations thereof. As a
result, the present invention provides significant economic benefit
to growers. For example, early germination and early maturation
permit crops to be grown in areas where short growing seasons would
otherwise preclude their growth in that locale. Increased
percentage of seed germination results in improved crop stands and
more efficient seed use. Greater yield, increased size, and
enhanced biomass production allow greater revenue generation from a
given plot of land.
[0478] With regard to the use of the peptides or compositions of
the present invention to control pests (including but not limited
to insects and nematodes, which are biotic stressors), such pest
control encompasses preventing pests from contacting plants to
which the peptide or composition of the invention has been applied,
preventing direct damage to plants by feeding injury, causing pests
to depart from such plants, killing pests proximate to such plants,
interfering with insect larval feeding on such plants, preventing
pests from colonizing host plants, preventing colonizing insects
from releasing phytotoxins, interfering with egg deposition on host
plants, etc. The present invention also prevents subsequent disease
damage to plants resulting from pest infection.
[0479] The present invention is effective against a wide variety of
insects (biotic stressors). European corn borer is a major pest of
corn (dent and sweet corn) but also feeds on over 200 plant species
including green, wax, and lima beans and edible soybeans, peppers,
potato, and tomato plus many weed species. Additional insect larval
feeding pests which damage a wide variety of vegetable crops
include the following: beet armyworm, cabbage looper, corn ear
worm, fall armyworm, diamondback moth, cabbage root maggot, onion
maggot, seed corn maggot, pickleworm (melonworm), pepper maggot,
and tomato pinworm. Collectively, this group of insect pests
represents the most economically important group of pests for
vegetable production worldwide. The present invention is also
effective against nematodes, another class of economically
important biotic stressors. Soybean Cyst Nematode (Heterodera
glycines) is a major pest of soybeans. Reniform Nematode
(Rotylenchulus reniformis) is a major pest of cotton as can
parasitize additional crop species, notably soy and corn.
Additional nematode pests include the root knot nematodes of the
genus Meloidogyne (particularly in cotton, wheat, and barley),
cereal cyst nematodes of the genus Heterodera (particularly in soy,
wheat, and barley), root lesion nematodes of the genus
Pratylenchus, seed gall nematodes of the genus Anguina
(particularly in wheat, barley, and rye), and stem nematodes of the
genus Ditylenchus. Other biotic stressors include arachnids, weeds,
and combinations thereof.
[0480] With regard to the use of the peptides or compositions of
the present invention to impart abiotic stress resistance to
plants, such abiotic stress encompasses any environmental factor
having an adverse effect on plant physiology and development.
Examples of such environmental stress include climate-related
stress (e.g., drought, flood, frost, cold temperature, high
temperature, excessive light, and insufficient light), air
pollution stress (e.g., carbon dioxide, carbon monoxide, sulfur
dioxide, NO.sub.x, hydrocarbons, ozone, ultraviolet radiation,
acidic rain), chemical (e.g., insecticides, fungicides, herbicides,
heavy metals), nutritional stress (e.g., over- or under-abundance
of fertilizer, micronutrients, macronutrients, particularly
potassium, nitrogen derivatives, and phosphorus derivatives), and
improved healing response to wounding. Use of peptides of the
present invention imparts resistance to plants against such forms
of environmental stress.
[0481] A further aspect of the present invention relates to the use
of the peptides of the present invention as a safener in
combination with one or more of the active agents (i.e., in a
composition or in separate compositions) for the control of aquatic
weeds in a body of water as described in U.S. Publ. No. 20150218099
to Mann, which is hereby incorporated by reference in its
entirety.
[0482] Yet another aspect of the present invention relates to the
use of the peptides of the present invention as a plant
strengthener in a composition for application to plants grown under
conditions of reduced water irrigation, which composition also
includes at least one antioxidant and at least one radiation
manager, and optionally at least one plant growth regulator, as
described in U.S. Publ. No. 20130116119 to Rees et al., which is
hereby incorporated by reference in its entirety.
[0483] The methods of the present invention involving application
of the peptide or composition can be carried out through a variety
of procedures when all or part of the plant is treated, including
leaves, stems, roots, propagules (e.g., cuttings), fruit, etc. This
may (but need not) involve infiltration of the peptide into the
plant. Suitable application methods include high or low pressure
spraying, injection, and leaf abrasion proximate to when peptide
application takes place. When treating plant seeds, in accordance
with the application embodiment of the present invention, the
hypersensitive response elicitor protein or polypeptide can be
applied by low or high pressure spraying, coating, immersion (e.g.,
soaking), or injection. Other suitable application procedures can
be envisioned by those skilled in the art provided they are able to
effect contact of the hypersensitive response elicitor polypeptide
or protein with cells of the plant or plant seed. Once treated with
the peptides or compositions of the present invention, the seeds
can be planted in natural or artificial soil and cultivated using
conventional procedures to produce plants. After plants have been
propagated from seeds treated in accordance with the present
invention, the plants may be treated with one or more applications
of the peptides or compositions of the invention to impart disease
resistance to plants, to enhance plant growth, to control insects
on the plants, to impart biotic or abiotic stress tolerance, to
improve desiccation resistance of removed cuttings, to impart
post-harvest disease resistance or desiccation resistance to
harvested fruit or vegetables, and/or improved longevity of fruit
or vegetable ripeness for harvested fruit or vegetables.
[0484] The peptides or compositions of the invention can be applied
to plants or plant seeds in accordance with the present invention
alone or in a mixture with other materials. Alternatively, the
peptides or compositions can be applied separately to plants with
other materials being applied at different times.
[0485] In the alternative embodiment of the present invention
involving the use of transgenic plants and transgenic seeds, a
peptide of the invention need not be applied topically to the
plants or seeds. Instead, transgenic plants transformed with a DNA
molecule encoding a peptide of the invention are produced according
to procedures well known in the art. A vector suitable for
expression in plants (i.e., containing translation and
transcription control sequences operable in plants) can be
microinjected directly into plant cells by use of micropipettes to
transfer mechanically the recombinant DNA. Crossway, Mol. Gen.
Genetics, 202:179-85 (1985), which is hereby incorporated by
reference in its entirety. The genetic material may also be
transferred into the plant cell using polyethylene glycol. Krens,
et al., Nature, 296:72-74 (1982), which is hereby incorporated by
reference in its entirety.
[0486] Another approach to transforming plant cells with a gene
encoding the peptide of the invention is particle bombardment (also
known as biolistic transformation) of the host cell. This can be
accomplished in one of several ways. The first involves propelling
inert or biologically active particles at cells. This technique is
disclosed in U.S. Pat. Nos. 4,945,050, 5,036,006, and 5,100,792,
all to Sanford et al., which are hereby incorporated by reference.
Generally, this procedure involves propelling inert or biologically
active particles at the cells under conditions effective to
penetrate the outer surface of the cell and to be incorporated
within the interior thereof. When inert particles are utilized, the
vector can be introduced into the cell by coating the particles
with the vector containing the heterologous DNA. Alternatively, the
target cell can be surrounded by the vector so that the vector is
carried into the cell by the wake of the particle. Biologically
active particles (e.g., dried bacterial cells containing the vector
and heterologous DNA) can also be propelled into plant cells.
[0487] Yet another method of introduction is fusion of protoplasts
with other entities, either minicells, cells, lysosomes or other
fusible lipid-surfaced bodies. Fraley, et al., Proc. Natl. Acad.
Sci. USA, 79:1859-63 (1982), which is hereby incorporated by
reference in its entirety. The DNA molecule may also be introduced
into the plant cells by electroporation. Fromm et al., Proc. Natl.
Acad. Sci. USA, 82:5824 (1985), which is hereby incorporated by
reference in its entirety. In this technique, plant protoplasts are
electroporated in the presence of plasmids containing the
expression cassette. Electrical impulses of high field strength
reversibly permeabilize biomembranes allowing the introduction of
the plasmids. Electroporated plant protoplasts reform the cell
wall, divide, and regenerate.
[0488] Another method of introducing the DNA molecule into plant
cells is to infect a plant cell with Agrobacterium tumefaciens or
A. rhizogenes previously transformed with the gene. Under
appropriate conditions known in the art, the transformed plant
cells are grown to form shoots or roots, and develop further into
plants. Generally, this procedure involves inoculating the plant
tissue with a suspension of bacteria and incubating the tissue for
48 to 72 hours on regeneration medium without antibiotics at
25-28.degree. C. Agrobacterium is a representative genus of the
gram-negative family Rhizobiaceae. Its species are responsible for
crown gall (A. tumefaciens) and hairy root disease (A. rhizogenes).
The plant cells in crown gall tumors and hairy roots are induced to
produce amino acid derivatives known as opines, which are
catabolized only by the bacteria. The bacterial genes responsible
for expression of opines are a convenient source of control
elements for chimeric expression cassettes. In addition, assaying
for the presence of opines can be used to identify transformed
tissue. Heterologous genetic sequences can be introduced into
appropriate plant cells, by means of the Ti plasmid of A.
tumefaciens or the Ri plasmid of A. rhizogenes. The Ti or Ri
plasmid is transmitted to plant cells on infection by Agrobacterium
and is stably integrated into the plant genome. J. Schell, Science,
237:1176-83 (1987), which is hereby incorporated by reference in
its entirety.
[0489] After transformation, the transformed plant cells must be
regenerated. Plant regeneration from cultured protoplasts is
described in Evans et al., Handbook of Plant Cell Cultures, Vol. 1:
(MacMillan Publishing Co., New York, 1983); and Nasil I. R. (ed.),
Cell Culture and Somatic Cell Genetics of Plants, Acad. Press,
Orlando, Vol. 1, 1984, and Vol. III (1986), which are hereby
incorporated by reference in their entirety.
[0490] It is known that practically all plants can be regenerated
from cultured cells or tissues. Means for regeneration vary from
species to species of plants, but generally a suspension of
transformed protoplasts or a petri plate containing transformed
explants is first provided. Callus tissue is formed and shoots may
be induced from callus and subsequently rooted. Alternatively,
embryo formation can be induced in the callus tissue. These embryos
germinate as natural embryos to form plants. The culture media will
generally contain various amino acids and hormones, such as auxin
and cytokinins. It is also advantageous to add glutamic acid and
proline to the medium, especially for such species as corn and
alfalfa. Efficient regeneration will depend on the medium, on the
genotype, and on the history of the culture. If these three
variables are controlled, then regeneration is usually reproducible
and repeatable.
[0491] After the expression cassette is stably incorporated in
transgenic plants, it can be transferred to other plants by sexual
crossing. Any of a number of standard breeding techniques can be
used, depending upon the species to be crossed.
[0492] Once transgenic plants of this type are produced, the plants
themselves can be cultivated in accordance with conventional
procedure with the presence of the gene encoding the hypersensitive
response elicitor resulting in disease resistance, enhanced plant
growth, control of insects on the plant, abiotic or biotic stress
tolerance, improved desiccation resistance of removed cuttings,
post-harvest disease resistance or desiccation resistance in
harvested fruit or vegetables, and/or improved longevity of fruit
or vegetable ripeness for harvested fruit or vegetables.
[0493] Alternatively, transgenic seeds are recovered from the
transgenic plants. These seeds can then be planted in the soil and
cultivated using conventional procedures to produce transgenic
plants. The transgenic plants are propagated from the planted
transgenic seeds under conditions effective to impart disease
resistance to plants, to enhance plant growth, to control insects,
to impart abiotic or biotic stress tolerance, to improve
desiccation resistance of removed cuttings, to impart post-harvest
disease resistance or desiccation resistance in harvested fruit or
vegetables, and/or to impart improved longevity of fruit or
vegetable ripeness for harvested fruit or vegetables.
[0494] When transgenic plants and plant seeds are used in
accordance with the present invention, they additionally can be
treated with the same materials as are used to treat the plants and
seeds to which a peptide of the invention or composition of the
invention is applied. These other materials, including peptides or
composition of the invention, can be applied to the transgenic
plants and plant seeds by the above-noted procedures, including
high or low pressure spraying, injection, coating, and immersion.
Similarly, after plants have been propagated from the transgenic
plant seeds, the plants may be treated with one or more
applications of the peptides or compositions of the invention to
impart disease resistance, enhance growth, control insects, abiotic
or biotic stress tolerance, desiccation resistance of removed
cuttings, post-harvest disease resistance or desiccation resistance
in harvested fruit or vegetables, and/or improved longevity of
fruit or vegetable ripeness for harvested fruit or vegetables.
[0495] Such transgenic plants may also be treated with conventional
plant treatment agents, e.g., bacteriocidal or biocidal agents,
protease inhibitors, non-ionic surfactants, fertilizers,
herbicides, insecticides, fungicides, nematicides, biological
inoculants, plant regulators, and mixtures thereof, as described
above.
EXAMPLES
[0496] The following examples are provided to illustrate
embodiments of the present invention but are by no means intended
to limit its scope.
Example 1--Development of "HR Box" Peptides of SEQ ID NO: 93
[0497] The HR box was originally developed based on examination of
a number of Hypersensitive Response-Inducing sequences (P1, SEQ ID
NO: 4; P4, SEQ ID NO: 5; and P15, SEQ ID NO: 64, among others). A
repeating sequence of leucine and isoleucine residues was
identified. P4 was chosen as a representative sequence as the basis
for mutational studies that would reveal the sequence determinants
of HR elicitation. HR in tobacco was tested as described in Wei,
Science 257:85-88 (1992), which is hereby incorporated by reference
in its entirety. Briefly, peptides were dissolved at a
concentration of 500 mg/ml in aqueous solution. Four serial
dilutions were performed with an equal volume of water, yielding
peptide samples at 500, 250, 125, 62.5, 31.25 .mu.g/ml peptide
solutions. Nicotiana tabacum cultivar xanthi plants were used at
5-7 weeks old (preflowering). Leaves were lightly punctured with a
toothpick in a middle leaf panel. Peptide solutions were then
infused via needle-less syringe into the wound, filling the panel.
Each peptide sample was infused into a leaf of 2 different plants.
The leaves were observed and scored over the next 48 hours for
withering and browning, lesions typical of programmed cell death.
These mutational studies had three main goals: (1) increase the
solution stability of the peptides; (2) make disruptive mutations
to verify the residues which are most important for HR elicitation;
and (3) make conservative mutations to identify the degree of
specificity for particular amino acids.
[0498] Peptides were assessed for one or more of solubility,
stability against chemical degradation, effect of bulking agents on
solution stability, oxidation protection, and solution stability
studies.
[0499] Solubility was assessed by creating 0.2% AI (active
ingredient) solutions of pure, chemically synthesized peptide in
deionized water, and observing the solution for evidence of
precipitation over 48 hours at room temperature. P1 (SEQ ID NO: 4)
was largely insoluble in water. However, the mutant with several
glutamine residues replacing glutamate residues
(P1-2E,8E,11E,15E,18E, SEQ ID NO: 46) was soluble. P4 (SEQ ID NO:
5) and P4-14S (SEQ ID NO: 6) were also completely soluble.
[0500] Subsequent experiments were run to better quantify peptide
solubility. 20-50 mg of pure peptide were mixed with 0.25 ml of
water and increasing amounts of water were added until the peptide
dissolved. These experiments estimate the solubility of P1 (SEQ ID
NO: 4) at <1 mg/ml, the solubility of P4 (SEQ ID NO: 5) at 100
mg/ml, and the solubility of P1-18K (SEQ ID NO: 45) at 20
mg/ml.
[0501] Stability against chemical degradation was assessed in
various pH buffers by creating 0.2% AI solutions of pure,
chemically synthesized peptide in deionized water, 0.25% weight to
volume of Proxel.RTM. GXL (biocide), and 50 millimolar (mM) of
eight buffers (separately) as follows: MES pH 5.6, MOPS pH 6.5,
Citrate pH 7.2, EDDS pH 7.3, EDTA pH 8, Phosphate pH 8, Imidazole
pH 8, and TES pH 8. The solutions were observed on HPLC for
evidence of degradation (% loss of the peptide signal over time,
relative to the time 0 sample) over a period of weeks at elevated
temperature (50.degree. C.). P1-2E, -8E,-11E,-15E,-18E (SEQ ID NO:
46) was more stable than P1 (SEQ ID NO: 4) (40 days vs 20 days over
80%), and P4-14S (SEQ ID NO: 6) was significantly more stable than
P4 (SEQ ID NO: 5) (35 days vs 3 days over 80%). The best buffers
for P1 and P4-14S are TES pH 8 and Citrate pH 7.2, in that order.
Precipitation of P1 was observed after several days. Other peptides
(P1-2E,-8E,-11E,-15E,-18E; P4, and P4-14s) remained in
solution.
[0502] Effect of bulking agents on the chemical degradation of P1
and P1-2E,-8E,-11E,-15E,-18E was assessed by creating 0.2% AI
solutions of pure, chemically synthesized peptide in a solution of
50 mM TES pH 8.0 in water and 20% weight to volume (of solution) of
the bulking agents trehalose, maltrin, sucrose or talc (separate
formulas). These solutions were observed on HPLC for evidence of
degradation (% loss of the peptide signal over time, relative to
the time 0 sample) over time at elevated temperature (50.degree.
C.). The concentration of P1 in all mixtures dropped to less than
60% of the original peptide concentration after 6 days of
incubation. In contrast, the concentration of
p1-2E,-8E,-11E,-15E,-18E in all samples remained above 80% of the
original concentration for at least 14 days. The best bulking agent
for P1-2E,-8E,-11E,-15E,-18E is talc powder (44 days above
80%).
[0503] Solution stability studies were carried out by creating 0.2%
AI solutions of pure, chemically synthesized peptide in deionized
water, 50 mM of TES buffer, 0.25% Proxel GXL, and 30% isopropanol.
Peptides solutions were analyzed by HPLC for % loss of the peptide
signal over time, relative to the time 0 sample. Maximum lifetime
of P1-2E,-8E,-11E,-15E,-18E is 45 days over 80%. Maximum lifetime
of P4-14S is 140 days over 80%.
[0504] Solution stability mutations: Solution stability was
increased by choosing a peptide sequence (P4, SEQ ID NO: 5) which
did not contain methionine residues. However, this peptide
contained a cysteine residue, leading to very poor stability.
Mutation of this cysteine to the conservative replacement serine
(sulfur to oxygen change in chemical structure) generated P4-14s
(SEQ ID NO: 6), which retained its ability to elicit the HR. It was
subsequently shown (as noted above) that P4-14s is a highly stable
peptide. Additional studies replaced one or more glutamine residues
with glutamate residues to reduce the chance of deamidation in
solution. In particular, a variant of P1, termed P1-2E, 8E, 11E,
15E, 18E (SEQ ID NO: 46), contained these mutations at positions 2,
8, 11, 15, and 18. This peptide exhibited both improved solubility
and stability when compared with P1.
[0505] Based on the P4-14s stable backbone (SEQ ID NO: 6),
disruptive single mutations were introduced at specific residues
within the sequence. In the case of Leucine residues, these were
mutated to alanine (smaller and less hydrophobic sidechain, a
moderately disruptive mutation) and/or aspartic acid (negatively
charged sidechain, a highly disruptive mutation). The intervening
sequences, depending on the identity of the amino acid in question,
were mutated to have a negative charge (aspartic acid or glutamic
acid), have a hydrophobic sidechain (valine), a minimal sidechain
(alanine), or a small polar sidechain (serine). These mutant
peptides were tested for elicitation of the hypersensitive
response. Additional mutations were chosen based on the initial HR
results. In addition, the spacing between the leucine/isoleucine
residues was evaluated by either deleting a single residue between
the leucine repeats (denoted with `del`) or by inserting an alanine
residue between the leucine repeats (denoted with iA).
[0506] For those amino acids that were important for HR
elicitation, more conservative mutations were chosen to determine
the specificity of interactions. The leucine residues were mutated
to isoleucine, valine, phenylalanine or tyrosine, with the latter 2
residues being less conservative. As above, these mutants were
tested for HR elicitation.
[0507] The results of these mutation studies are summarized in
Table 12 below:
TABLE-US-00016 TABLE 12 Summary of Mutations and HR Elicitation
Results 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23
P4-14S S Q G I S E K Q L D Q L L S Q L I Q A L L Q P HR Positive E
E L V R V D E iA del V I I S E I M E D I F V Mutations dN2 A dN5
dN6 V V I V V M T A M V S S M I dC2 D S V M A I F L M V M dN4 F V K
T D S K K V V Q del Weak HR F V A A V Mutations S S HR Negative A
iA D A iA A D del S D Mutations D D S S iA V Y V F F S F Q
[0508] In Table 12, the sequence of P4-14s is shown along with all
mutations tested at each position. Those mutations that did not
interfere with the hypersensitive response are listed in the
labeled "HR Positive Mutations". Those mutations that caused a
reduction in the severity of the hypersensitive response are shown
in the row labeled "Weak HR Mutations". Mutations that eliminated
the hypersensitive response are shown in the red row labeled "HR
Negative Mutations". The notation dN2 and dN4 denote a deletion of
2 or 4 residues, respectively, from the beginning of the peptide;
dC2 denotes a deletion of 2 residues from the end of the peptide;
del denotes a deletion of the residue at that position; and iA
represents the insertion of an alanine residue before that
position.
Example 2--Solubility and Stability of P1 and Mutant Peptides
[0509] As described above, P1 and P1-derived sequences mutated at
position 18 (methionine replaced with alanine, threonine, or
lysine) were assessed for solution stability and chemical
compatibility for 14 days. Notably, P1 exhibited solubility
problems at lower pH (in deionized water solution, in 50 mM citrate
pH 5.6, and in 50 mM MES pH 6.0). In these cases, the peptide
concentration increased after 24-hour incubation at 50.degree. C.
Notably, the mutant peptides generally did not exhibit this issue.
As shown in FIGS. 1-3, data were normalized to 100% peptide at the
day 1 time point (shown as peptide 1* in the legend and the
original peptide 1 data is marked with a double asterisk**). In a
stability test dissolved in water (FIG. 1), peptide 1 was modestly
stable, but exhibited solubility issues. The 18K and 18A mutants
exhibited slightly higher stability (10-25% after 14 days).
Dissolved in a slightly acidic citrate buffer (FIG. 2), P1
exhibited both solubility and stability issues. It was not detected
by HPLC after 14 days in solution. By contrast the 18T and 18K
mutants retained 80% of the original concentration, and the 18A
mutant retained .about.60% of the original concentration. As shown
in FIG. 3, in 50 mM MES pH 6.0, P1 exhibited stronger solubility
problems, with a 50% increase in soluble concentration after 24
hour incubation at 50.degree. C. However, it exhibited better
stability than the mutants (10-30% after 14 days). In citrate pH
7.2 (FIG. 6), P1 did not exhibit solubility problems, but did
exhibit poor stability (20% of original concentration after 7 days
at 50.degree. C. By contrast, the 18K and 18T mutants exhibited
>60% stability after 14 days. In 50 mM EDDS, pH 7.3 (FIG. 7),
Peptide 1 exhibited poor stability, with only 10% of the material
remaining after 7 days. By comparison, the mutants retained at
least 50% of starting material after 14 days. In 50 mM imidazole,
pH 8.0 (FIG. 8), Peptide 1 exhibited particularly poor stability,
reduced to less that 10% of the original concentration after only 3
days. By comparison, all mutants exhibited greater stability, with
18K and 18T mutants retaining 60-75% of the original material after
14 days. Peptide 1 exhibited better stability in a solution of 50
mM EDTA, pH 8.0 (FIG. 9), matching the performance of the 18A
mutant. However, the 18K and 18T mutants exhibited better tability
after 14 days incubated at 50.degree. C. (15-20% improvement). When
dissolved in phosphate, pH 8.0 (FIG. 10), Peptide 1 appears to
outperform the stability of the mutants, although it does exhibit
solubility problems (some cloudiness in solution). In a solution of
50 mM TES, pH 8.0 (FIG. 11), Peptide 1 is more than 90% degraded
after 1 week of incubation at 80.degree. C. By comparison, 18T,
18K, and 18A mutants exhibit better performance (71%, 58%, and 47%
remaining after 14 days incubation at 50.degree. C.).
[0510] In general, Peptide 1 either exhibits solubility problems or
poor stability in a wide variety of buffered solutions. This is
addressed by mutation of methionine to other residues. Bulkier
residues (threonine and lysine) generally seem preferred over
alanine for stability.
Example 3--Solubility and Stability of P4 and Mutant Peptides
[0511] As described above, P4 and P4-derived sequences mutated at
position 14 (cysteine replaced with alanine/A, aspartic acid/D,
lysine/K, glutamine/Q, and serine/S) were assessed for solution
stability and chemical compatibility for 14 days. In general,
peptide 4 exhibited very poor stability due to the presence of
cysteine (FIGS. 12-21). After less than 1 day, the original P4 HPLC
peak was not detected in the samples. By comparison, all mutants
exhibited better stability. Most of these retained at least 50% of
the original material for 14 days at 50.degree. C. In general,
peptide 4 mutants exhibit better stability at higher pH values
(>7.0). Notably, p4-14s can regularly exhibit stability of 90%
after 14 days, depending on conditions. All of the mutant peptides
exhibited the hypersensitive response when infiltrated into tobacco
leaves (as in example 1).
Example 4--Comparison of Peptide 1 and Peptide 4 Stability
[0512] Although peptide 1 and peptide 4 exhibit a high degree of
sequence similarity, the stabilized mutants of peptide 4 are more
stable than the p1 mutants. A series of mutations of p1 were made
to confer stability similar to p4-14s. These are: p1-1S (SEQ ID NO:
109, Table 1), p1-14S (SEQ ID NO: 110, Table 1), p1-18Q (SEQ ID NO:
115, Table 1), p1-23P (SEQ ID NO: 118, Table 1). These peptides,
along with p1 and p4-14s, were dissolved in 30% isopropanol, 5 mM
DTPA, and 50 mM TES pH 8.0 and tested for stability at 50 C.
Similar stability was observed for p4-14S and p1-1S, indicating
that the N-terminal amino acid exhibits a strong effect on peptide
stability.
Example 5--Solubility for P15b and Mutants
[0513] Initial results suggest that p15b has solubility problems.
It has a relatively high hydrophobicity (0.19). At 0.2% w/v, it was
partially soluble in water, insoluble in 50 mM of each of citrate
pH .about.5.2, citrate pH 7.0, phosphate pH 7.0 (check), TES pH
8.0, EDTA pH 8.0, and EDDS pH 7.0. It was at least partially
soluble in 50 mM MES pH 6.0, and MOPS pH 6.5. However, P15a
dissolves more easily in aqueous solutions. Its solubility is
>10 mg/ml in 50 mM TES pH 8.0. Additional p15 variants were
synthesized that included poly-glutamate solubility tags (p15-59G
and p15-59, SEQ ID NOS: 149 and 150, respectively). When p15-59 was
dissolved in 50 mM TES, pH 8.0, it exhibited solubility >10
mg/ml (1% w/v).
Example 6--Stability of P17/P18 & Variants
[0514] As described above, P18 (SEQ ID NO: 83) was tested for
stability and chemical compatibility with different pH buffers. P18
exhibits relatively poor stability in aqueous buffer solutions at
50.degree. C. Most samples degraded to 20% of original
concentration in 3 days. One exception is a 50 mM EDTA solution,
which degrades to 35% after 7 days (FIG. 24). Mutation of the
methionine at position 12 to leucine (in P18-4, SEQ ID NO: 164)
causes moderate stabilization: 60% stability after 14 days.
Notably, truncation of the last 3 amino acids from the C-terminus
(P18-1, SEQ ID NO: 163) also leads to dramatically increased
stability (>90% stability over the 14-day trial).
Example 7--Stability of P19 & Variants
[0515] In general, P19 (SEQ ID NO: 89) exhibits relatively high
stability, >80% stability over 14 days at 50.degree. C. under a
variety of conditions. The exceptions were peptide dissolved in
water alone (52%) or 50 mM TES pH 8.0 (62%). Mutation of its one
methionine residue at position 12 to leucine (P19-20L, SEQ ID NO:
90) leads to a modest increase in stability when dissolved in 50 mM
citrate pH 7.2 or 50 mM TES, pH 8.0 (FIGS. 25 and 26). When using
buffers at lower pH (5.5-7.0), the performance of P19 and P19-20L
was observed to be similar; more than 80% peptide was retained for
14 days.
Example 8--P14d, P14e, P14f Stability
[0516] P14d sequence (SEQ ID NO: 175) is derived from the popA
sequence of Ralstonia solanacearum. It conforms to the HR-box motif
and causes HR in tobacco leaves. Mutation of the methionine
residues generated the stabilized peptides P14e (SEQ ID NO: 176)
and P14f (SEQ ID NO: 177). The mutated peptides exhibit >85%
stability for >50 days at 50.degree. C. (in 50 mM TES, pH 8.0
and 30% isopropanol). During the same period of time, P14d exhibits
around 50% chemical stability.
Example 9--Growth Tests
[0517] For growth tests, corn and soy seeds were planted in flats
with 2 seeds per cell within the flat at a greenhouse facility. The
seeds were allowed to germinate and the smaller plant is culled,
leaving one plant per cell. Once the first true leaves are fully
expanded and the second leaves are beginning to expand, the plants
were initially measured for height. This was performed by
stretching the highest leaf upward and measuring the distance to
the soil. Peptides were dissolved in water at the indicated
concentrations (below). The plants were then treated with a foliar
spray using widely available spray bottles until liquid was
dripping from the leaves. 4 flats of 14 plants each were treated
per condition (peptide or control). Corn and soy were treated as
indicated in Table 13 and compared with matched water-treated
control plants. The plants were allowed to grow for 14 days. The
height of the plants was again measured and compared to the
original height to quantify growth. In some cases, the plants were
allowed to grow without watering for 2-4 days until the onset of
wilting and drought stress. At this time, the above-ground portions
of the plants were harvested and weighed to determine the fresh
mass. Finally, the above-ground material was dried at 70.degree. C.
for 48 hours and weighed to determine dry biomass. The results of
these growth trials are shown in Table 13. Growth, dry biomass, and
fresh mass are calculated as the % increase over the water-treated
control.
TABLE-US-00017 TABLE 13 Growth Trial Results SEQ ID Growth Dry
biomass Fresh mass Peptide NO: Rate Host (% difference) (%
difference) (% difference) P15a 63 0.2 Corn 6.0 5.0 N.D. P15b 49
0.2 Corn 0.9 2.0 13.9 P18 83 0.2 Corn 15.0 9.0 N.D. P18 83 0.2 Soy
18.0 15.0 N.D. P19 89 0.2 Soy 18.0 12.6 N.D. P25 182 5.0 Corn 7.0
11.0 N.D. P25 182 0.2 Soy 10.0 2.0 N.D. P4-14s-18E 191 2.0 Soy 9.0
0.8 N.D. P30-3 190 0.2 Corn 8.7 8.0 13.4 P25-11 188 0.2 Corn 4.1
4.7 1.6 P25-11 188 5 Corn 1.0 6.2 10.9 N.D. = Not determined.
[0518] Several of the tested peptides exhibit growth and/or biomass
increases in corn and soy. Notably, although P15b did not cause an
overt growth or dry biomass phenotype, it did cause an increase in
fresh biomass, which is suggestive of increased water uptake or
retention. This is an indication of drought tolerance in those
treated plants. Another peptide, P30-3, was observed to cause an
increase in growth, fresh mass, and dry biomass.
Example 10--Minimal Sequences Required for HR Response
[0519] After determining the residues most critical for
hypersensitive response elicitation, we designed additional mutants
to verify the smallest peptide sequence responsible for this
behavior. Due to the hydrophobic nature of the core HR sequence
(containing 7 leucine or isoleucine residues in 13 residues total),
it was recognized that solubility would be a problem for the
minimal peptide. As a result, hydrophilic sequences were added to
many peptides to bring the hydrophobicity on the Kyte-Doolittle
scale to around -0.2 for the peptides.
[0520] Initially, a poly-lysine or poly-arginine sequence was used,
i.e., P4 having an N-linked polyR or polyK sequence, or a C-linked
polyR or polyK sequence (SEQ ID NOS: 35, 36, 38, 39). However, when
infiltrated into tobacco leaves, these peptides caused necrotic
lesions not typical of HR. This led to the hypothesis that
poly-cationic sequences cause a toxic response when infiltrated
into tobacco leaves. When poly-lysine and poly-arginine alone was
infiltrated into the leaf, a similar necrotic lesion was observed.
As a result, testing of peptides containing cationic solubility
enhancing sequences was discontinued. Notably, HR+ peptides can
contain at least one or two cationic amino acids, but larger
numbers of positive charges appear to be detrimental. As a
substitute for cationic peptides, polyanions were considered,
specifically poly-glutamate. Poly-glutamate was chosen since
aspartate has a greater chance of isomerizing to iso-aspartate, and
serine was added at the N-terminus to eliminate the formation of
pyroglutamic acid at the N-terminus of the peptide. It is also
reasonable to add glutamate residues at the C-terminal end of the
peptide.
[0521] The hypersensitive response test was run as described in
example #1. For P4, the smallest variant peptide that elicited HR
was P4-polyE-min3 (SEQ ID NO: 33). For P1, the smallest variant
peptide that elicited HR was P1-polyE-min3 (SEQ ID NO: 141). For
P18, the smallest variant peptide that elicited HR was P18-7 (SEQ
ID NO: 167). For P19, the smallest variant peptide that elicited HR
was P19-8 (SEQ ID NO: 173). For P15, the smallest variant peptide
that elicited HR was P15-59 (SEQ ID NO: 150). For P14d, the
smallest variant peptide that elicited HR was P14-30 (SEQ ID NO:
178). For P25, the smallest variant peptide that elicited HR was
P25-11 (SEQ ID NO: 188). In addition, minimal peptide sequences
were generated incorporating the leucine repeat sequence
characteristic of the HR-box and glutamic acid residues in the
variable positions to increase solubility. These sequences are:
P30-2 (SEELEELLEELIEELL, SEQ ID NO: 189), P30-3 (LEELLEELIEELLEE,
SEQ ID NO: 190), and P30-4 (LEELLEELIEELL, SEQ ID NO: 210). These
minimal HR-box sequences were soluble >5 mg/ml in 50 mM TES and
produced an HR response when infiltrated into tobacco leaves.
[0522] Likewise, additional peptides were developed for enhanced
solubility based on the hydrophobic backbone sequences of P3, P25,
P14, P15, and P19. These are listed in Table 10, supra.
[0523] Based on the previously described behavior of harpins and
HR+ peptides, it is expected that these new peptides will have
wide-ranging bioactivity including inducing resistance to TMV,
resistance to nematodes, increased stress and drought resistance,
increased growth, and increased yield as described in PCT
Application WO 01/98501 to Fan et al., which is hereby incorporated
by reference in its entirety.
Example 11--Derivatives of Peptide P1 that Cause HR Response in
Tobacco
[0524] HR tests (described in Example 1) were run on variants of P1
to determine the minimal sequence required for HR and to identify
residues of importance. The following peptides of Table 14 were
determined to be positive for HR:
TABLE-US-00018 TABLE 14 Peptide Name Sequence SEQ ID NO: P1
NQGISEKQLDQLLTQLIMALLQQ 4 P1-allE, NEGISEKELDELLTELIEALLQQ 46
P1-18T NQGISEKQLDQLLTQLITALLQQ 42 P1-18E NQGISEKQLDQLLTQLIEALLQQ 43
P1-18A NQGISEKQLDQLLTQLIAALLQQ 44 P1-18K NQGISEKQLDQLLTQLIKALLQQ 45
P1-1S SQGISEKQLDQLLTQLIMALLQQ 109 P1-14S NQGISEKQLDQLLSQLIMALLQQ
110 P1-18Q NQGISEKQLDQLLTQLIQALLQQ 115 P1-23P
NQGISEKQLDQLLTQLIMALLQP 118 polyE-min3p1 SEEEEELDQLLTQLIEALL
141
Example 12--Derivatives of Peptide P3 that Cause HR Response in
Tobacco
[0525] HR tests (described in Example 1) were run on variants of P3
to determine the minimal sequence required for HR and to identify
residues of importance. The following peptides of Table 15 were
determined to be positive for HR.
TABLE-US-00019 TABLE 15 Peptide Name Sequence SEQ ID NO: P3
QNDDSTSGTDSTSDSSDPMQQL 204 LKMFSEIMQSLFGDGQDGT P3-3
SDPMQQLLKMFSEIMQSLF 205 P3-4 SEEELQQLLKLFSEILQSLF 206 P3-6
SEEEEELQQLLKLFSEILQSL 207 P3-7 SEEEEELQQLLKLFSEILQS 208
[0526] It is notable that P3 seems to require a longer sequence
than the minimal HR-box repeat for efficient HR elicitation. This
may be due to the sub-optimal phenylalanine residues and the
presence of only a single K residue to separate the hydrophobic
residues (LLKLF in P3 and its variants) present in this sequence.
However, it is important to note that additional hydrophobic
residues are not strictly necessary, considering that P3-6 and P3-7
cause HR.
Example 13--Derivatives of Peptide P25 that Cause HR Response in
Tobacco
[0527] HR tests (described in Example 1) were run on variants of
P25 to determine the minimal sequence required for HR and to
identify residues of importance. The following peptides of Table 16
were determined to be positive for HR.
TABLE-US-00020 TABLE 16 Peptide Name Sequence SEQ ID NO: P25
GGLTLTGVLQKLMKILNAL 182 P25s EDQGGLTLTGVLQKLMKILNAL 183 P25-4
EDQGGLTLTGVLQKLMKILNALVQ 181 P25-10 SEEEEELTLTGVLQKLLKILEAL 187
P25-11 SEEEEELTGVLQKLLKILEAL 188 P25-15 SEEEEELTLTGVLQKLLKILEA 200
P25-16 SEEEEEVLQKLLKILEALV 201 P25-17 SEEEEELQKLLKILEALVQ 202
[0528] It is important to note that P25 variants seem to require
more sequence than the minimal HR consensus (SEQ ID NO:93) to HR
elicitation. This may be due to the presence of valine residues
where leucine is preferred or due to the presence of a single
hydrophilic residue between the hydrophobic repeats (LLKIL).
Although we include P25-15, P25-16, and P25-17 as HR+, they
exhibited a very weak hypersensitive response that only occurred in
some tobacco plants at the highest application rate. Notably, the
additional sequence content does not seem to require
leucine/isoleucine/valine residues, as suggested by the biological
response to P25-15.
Example 14--Derivatives of Peptide P14d that Cause HR Response in
Tobacco
[0529] HR tests (described in Example 1) were run on variants of
P14 to determine the minimal sequence required for HR and to
identify residues of importance. The following peptides of Table 17
were determined to be positive for HR.
TABLE-US-00021 TABLE 17 Peptide Name Sequence SEQ ID NO: P14d
QDPMQALMQLLEDLVKLLK 175 P14e QDPAQALLQLLEDLVKLLK 176 P14f
QDPAQALEQLLEDLVKLLK 177 P14c QAGPQSANKTGNVDDANNQD 199
PMQALMQLLEDLVKLLK P14-30 SEEEEEALEQLLEDLVKLLK 178
[0530] It is important to note that P14d variants seem to require
more sequence than the minimal HR consensus (SEQ ID NO: 93) to HR
elicitation. In particular, the additional C-terminal lysine
residue seems to be required for activity. This may be due to the
presence of a single hydrophilic residue between the hydrophobic
repeats (LVKLL).
Example 15--Derivatives of Peptides P15/P20 that Cause HR Response
in Tobacco
[0531] HR tests (described in Example 1) were run on variants of
P15/P20 to determine the minimal sequence required for HR and to
identify residues of importance. The following peptides of Table 18
were determined to be positive for HR.
TABLE-US-00022 TABLE 18 SEQ Peptide name Sequence ID NO: P15a
NFGTPDSTVQNPQDASKPNDSQS 63 NIAKLISALIMSLLQM P15b
KPNDSQSNIAKLISALIMSLLQ 49 P20 GTPDSTVQNPQDASKPNDSQSN 65
IAKLIS_LIMSLL P15-8D-18E KPNDSQSDIAKLISALIESLLQ 50 P15-dN4
SQSNIAKLISALIMSLLQ 227 P15a-39P NFGTPDSTVQNPQDASKPNDSQS 143
NIAKLISALIMSLLQP P15a-34Q NFGTPDSTVQNPQDASKPNDSQS 144
NIAKLISALIQSLLQM p15-59 SEEEEEEIAKLISALIESLLE 150
Example 16--Derivatives of Peptides P17/P18 that Cause HR Response
in Tobacco
[0532] HR tests (described in Example 1) were run on variants of
P17 and P18 to determine the minimal sequence required for HR and
to identify residues of importance. The following peptides of Table
19 were determined to be positive for HR.
TABLE-US-00023 TABLE 19 Peptide Name Sequence SEQ ID NO: P17 [*]
QQPIDRQTIEQMAQLLAQLLKSLL 81 P18 QQPIDRQTIEQMAQLLAQLLKSLLSPQ 83
P18-1 QQPIDRQTIEQMAQLLAQLLKSLL 163 P18-2 QQPIDRQTIEQLAQLLAQLLKSLL
229 P18-3 QQPIDRQTIEQLAQLLAQLLKSLLSP 228 P18-4
DRQTIEQLAQLLAQLLKSLLSP 164 P18-5 QTIEQLAQLLAQLLKSLLSP 165 P18-6
SEEEEEIEQLAQLLAQLLKSLL 166 P18-7 SEEEEELAQLLAQLLKSLL 167 P18-10
SEEEEELAELLAELLKSLL 231 [*] = N-terminal sequence of
TSSSPGLFQSGGDNGLGGHNANSALG
Example 17--Derivatives of Peptides P19 that Cause HR Response in
Tobacco
[0533] HR tests (described in Example 1) were run on variants of
P19 to determine the minimal sequence required for HR and to
identify residues of importance. The following peptides of Table 20
were determined to be positive for HR.
TABLE-US-00024 TABLE 20 Peptide Name Sequence SEQ ID NO: P19
ITPDGQGGGQIGDNPLLKAMLKLIA 89 P19-20L ITPDGQGGGQIGDNPLLKALLKLIA 90
P19a ITPDGQGGGQIGDNPLLKAMLKLIA 91 RMMDG P19a-allL
ITPDGQGGGQIGDNPLLKALLKLIA 92 RLLDG P19-4 QGGGQIGDNPLLKAMLKLIARMMDG
226 P19-7 SEEEEEELLKALLKLIARLL 172 P19-8 SEEEEELKALLKLIARLL 173
P19-11 SEEEEEIGDNPLLKALLKLIARLL 171
[0534] It is important to note that although P19 and P19-1 exhibit
HR, they do not completely conform to the consensus HR-box sequence
(SEQ ID NO: 93). However, the addition of context sequence in P19-2
and P19-3 leads to a sequence that does conform to the consensus.
It is likely that the additional isoleucine residues in P19, and
P19-1 (N-terminal isoleucine and the IGDN sequence) increase the
propensity for HR elicitation.
Example 18--Induced Resistance of Tobacco to Infection with Tobacco
Mosaic Virus
[0535] Peptides were tested for the induction of resistance to
tobacco mosaic virus (TMV) in tobacco. Briefly, three tobacco
plants at 6-8 weeks old were selected per group (samples and
controls). The bottom-most leaf of the plant was covered and the
plant was sprayed with a solution of water (negative control),
peptide, or Proact (positive control). The spray was applied until
the leaves were fully wetted, indicated by liquid dripping from the
leaves. The plants were then allowed to dry and the leaf covering
was removed.
[0536] Three days post-treatment, the previously-covered leaf and a
leaf on the opposite side of the plant were then lightly dusted
with diatomaceous earth and 20 ul of a 1.7 ug/ml solution of
purified tobacco mosaic virus was applied. The TMV solution was
then spread across the leaf surface by lightly rubbing solution and
the diatomaceous earth across the surface of the leaves. Two
minutes after inoculation, the diatomaceous earth was rinsed off
the leaves with water. 3 days after TMV inoculation, the leaves
were scored based on the number of TMV lesions observed. The leaf
was also scored for signs of the hypersensitive response, including
yellowing and wilting of the affected leaves.
[0537] Effectiveness described in Table 21 refers to the % decline
in TMV lesions on treated vs UTC plants. A reduction of TMV on
covered leaves indicates a systemic immune response in the plant
while reduction on uncovered leaves indicates a local response.
Asterisks indicate that the P-value derived from a T-test was
<0.05.
TABLE-US-00025 TABLE 21 Summary of TMV Resistance Effectiveness
Effectiveness SEQ ID Concentration Uncovered Covered Peptide NO:
(ug/ml) (%) (%) P1 4 20 100* 91* P1-allE 46 5 74* 66* polyE-min3p1
141 10 92* 79* P4 5 20 88* 89* P4-14S 6 20 80* 97* polyE-min3p4 33
10 88* 86* P6 68 20 99* 93* P6a 67 20 72* 58 P14d 175 5 93* 96*
TABLE-US-00026 TABLE 21 Summary of TMV Resistance Effectiveness
Effectiveness SEQ ID Concentration Uncovered Covered Peptide NO:
(ug/ml) (%) (%) P14e 176 10 90 79* P14f 177 10 72 86* P14-30 178 10
74 25 P15 64 10 95* 72* P15a 63 10 88 55 P18 83 5 63* 80* P18-6 166
10 69* 86* P18-7 167 20 15* 30* P18-10 231 20 84* 87* P19 89 5 79*
90* P19-7 172 10 88* 82* P19-8 173 20 74* 77* P25 182 20 94* 94*
P25-11 188 10 100* 97* P30-2 189 10 94* 65* P30-3 190 10 95*
95*
[0538] In general, peptides that elicit a hypersensitive response
in tobacco also confer a strong resistance to TMV. The peptides
provided resistance in the leaves that received the treatment.
However, the peptides also caused "system acquired resistance"
whereby an immune response in one part of a plant triggers
signaling that increases immunity in other parts of the plant. This
was shown by the reduced TMV infection in covered leaves that did
not directly receive the peptide treatment. Peptides that caused
particularly strong immune responses included some of the minimal
HR box peptide sequences: P14d, P25-11, and P30-3.
Example 19--Effect of Peptide Seed Treatment on Root and Shoot
Growth
[0539] Peptides were tested for biological effects on the
allocation of growth resources to the shoot (above ground) and root
(below ground). Peptides were dissolved at 0.2, 2, or 5 .mu.g/ml in
a total volume of 100 ml deionized water. Corn or soybean seeds
were then soaked for one hour in the peptide solution. Untreated
control (UTC) plants were soaked in deionized water. Clear plastic
300 ml beverage cups (Solo.RTM., Dart Container Corporation) were
prepared for planting by marking the bottom with a cross, dividing
the bottom into four equal quadrants. The cups were then filled
with Sunshine Mix #1 soil (SunGro Horticulture) sieved to 1/4''.
100 ml of water was added to the soil. Treated seeds were then
planted by pressing the seed lightly into the top of the soil. The
seeds were then covered with an additional 50 ml of loose soil.
Seeds were allowed to germinate and grow for 12-14 days.
[0540] The length of the shoot was measured as the distance from
the soil to the lightly stretched tip of the highest leaf for each
plant. Plants that failed to germinate or exhibited stunted growth
were removed from the trial. Stunting was defined as lacking a
fully expanded true leaf at time of data collection or having an
expanded true leaf judged by eye to be <1/2 the average leaf
area of the treatment group. Generally, 30 seeds were planted per
treatment group and 15-25 plants were used for data collection.
[0541] Root growth was estimated by counting the number of times
that a primary root crosses the quadrant marks on the bottom of the
cup. These were often observed along the bottom circumference of
the cup, although some were visible along the side of the container
and were counted as if crossing a vertical extension of the
quadrant line. This number was divided by 4 to produce a root
growth index. This index was found to correlate .about.90% with
measured total primary root length (sum of lengths of all primary
roots after rinsing soil from roots and measuring directly).
TABLE-US-00027 TABLE 22 Summary of Root & Shoot Growth SEQ ID
Rate Root Shoot Peptide (Host) NO: (.mu.g/ml) (%) (%) P4-14s (soy)
6 0.2 13.5* -0.1 P14c (soy) 199 5.0 14.4* 9.0* P15a (corn) 63 0.2
14.2* -4.5 P15b (soy) 49 5.0 34* 15.6* P18 (corn) 83 2.0 7.7 -2.0
P30-3 (corn) 190 0.2 15.4* -0.7 P30-3 (soy) 190 2.0 -17.9* 11.4*
P30-3 (soy) 190 0.2 4.2 8.8* P15-59 (corn) 150 0.2 7.6 -8.6* P19-8
(corn) 89 5.0 4.1 -2.7
[0542] Having thus described the basic concept of the invention, it
will be rather apparent to those skilled in the art that the
foregoing detailed disclosure is intended to be presented by way of
example only, and is not limiting. Various alterations,
improvements, and modifications will occur and are intended to
those skilled in the art, though not expressly stated herein. These
alterations, improvements, and modifications are intended to be
suggested hereby, and are within the spirit and scope of the
invention. Additionally, the recited order of processing elements
or sequences, or the use of numbers, letters, or other designations
therefore, is not intended to limit the claimed processes to any
order except as may be specified in the claims. Accordingly, the
invention is limited only by the following claims and equivalents
thereto.
Sequence CWU 1
1
232123PRTArtificialP1/P4 consensusMISC_FEATURE(1)..(1)X at position
1 is optional, S, N, D, isoD, G, A, or SMISC_FEATURE(2)..(2)X at
position 2 is optional, Q, E, g-glutamate, G, A, or
SMISC_FEATURE(8)..(8)X at position 8 is Q, E, g-glutamate, G, A, or
SMISC_FEATURE(9)..(9)X at position 9 is L, I, F, or
VMISC_FEATURE(10)..(10)X at position 10 is optional, D or
isoDMISC_FEATURE(11)..(11)X at position 11 is Q, E, g-glutamate, G,
A, or SMISC_FEATURE(12)..(12)X at position 12 is M, L, I, or
FMISC_FEATURE(13)..(13)X at position 13 is M, L,
IMISC_FEATURE(14)..(14)X at position 14 is optional, any
hydrophilic amino acid, preferably C, S, T, A, D, isoD, K, or
QMISC_FEATURE(15)..(15)X at position 15 is Q, E, g-glutamate, G, A,
S, K, or IMISC_FEATURE(16)..(16)X at position 16 is M, L, I, V,
FMISC_FEATURE(17)..(17)X at position 17 is M, L, I, A, or
VMISC_FEATURE(18)..(18)X at position 18 is Q, E, g-glutamate, G, A,
S, M, T, or KMISC_FEATURE(19)..(19)X at position 19 is A, D, isoD,
S, V, T, K, R, E, H, or GMISC_FEATURE(20)..(20)X at position 20 is
M, L, or IMISC_FEATURE(21)..(21)X at position 21 is M, L, I, V, S,
or FMISC_FEATURE(22)..(22)X at position 22 is Q, E, g-glutamate, G,
A, or SMISC_FEATURE(23)..(23)X at position 23 is P, Q, E,
g-glutamate, G, A, or S 1Xaa Xaa Gly Ile Ser Glu Lys Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa Xaa Xaa Xaa
20223PRTArtificialP4 consensusMISC_FEATURE(2)..(2)X at position 2
is Q, E, g-glutamate, G, A, or SMISC_FEATURE(8)..(8)X at position 8
is Q, E, g-glutamate, G, A, or SMISC_FEATURE(9)..(9)X at position 9
is L, A, D, isoD, I, F, or VMISC_FEATURE(11)..(11)X at position 11
is Q, E, g-glutamate, G, A, or SMISC_FEATURE(12)..(12)X at position
12 is L, D, isoD, I, or FMISC_FEATURE(13)..(13)X at position 13 is
L, I, V, or FMISC_FEATURE(14)..(14)X at position 14 is any
hydrophilic amino acid, preferably C, S, or
TMISC_FEATURE(15)..(15)X at position 15 is Q, E, g-glutamate, G, A,
S, K, or IMISC_FEATURE(16)..(16)X at position 16 is L, A, I, V, M,
or FMISC_FEATURE(17)..(17)X at position 17 is I, S, or
FMISC_FEATURE(18)..(18)X at position 18 is Q, E, g-glutamate, G, A,
SMISC_FEATURE(20)..(20)X at position 20 is L, I, V,
FMISC_FEATURE(21)..(21)X at position 21 is L or
FMISC_FEATURE(22)..(22)X at position 22 is Q, E, g-glutamate, G, A,
or S 2Ser Xaa Gly Ile Ser Glu Lys Xaa Xaa Asp Xaa Xaa Xaa Xaa Xaa
Xaa1 5 10 15Xaa Xaa Ala Xaa Xaa Xaa Pro 20323PRTArtificialP1
consensusMISC_FEATURE(1)..(1)X at position 1 is N, D, isoD, G, A,
or SMISC_FEATURE(2)..(2)X at position 2 is Q, E, g-glutamate, G, A,
or SMISC_FEATURE(8)..(8)X at position 8 is Q, E, g-glutamate, G, A,
or SMISC_FEATURE(11)..(11)X at position 11 is Q, E, g-glutamate, G,
A, or SMISC_FEATURE(15)..(15)X at position 15 is Q, E, g-glutamate,
G, A, SMISC_FEATURE(18)..(18)X at position 18 is M, T, K, E,
g-glutamate, G, A, or SMISC_FEATURE(22)..(22)X at position 22 is Q,
E, g-glutamate, G, A, or SMISC_FEATURE(23)..(23)X at position 23 is
Q, E, g-glutamate, G, A, or S 3Xaa Xaa Gly Ile Ser Glu Lys Xaa Leu
Asp Xaa Leu Leu Thr Xaa Leu1 5 10 15Ile Xaa Ala Leu Leu Xaa Xaa
20423PRTArtificialsynthetic peptide 4Asn Gln Gly Ile Ser Glu Lys
Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile Met Ala Leu Leu Gln
Gln 20523PRTArtificialsynthetic peptide 5Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Cys Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 20623PRTArtificialsynthetic peptide 6Ser Gln Gly Ile Ser
Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu
Leu Gln Pro 20723PRTArtificialsynthetic peptide 7Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Ser Ala
Leu Leu Gln Pro 20823PRTArtificialsynthetic peptide 8Ser Glu Gly
Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Glu
Ala Leu Leu Gln Pro 20923PRTArtificialsynthetic peptide 9Ser Glu
Gly Ile Ser Glu Lys Glu Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile
Gln Ala Leu Leu Gln Pro 201023PRTArtificialsynthetic peptide 10Ser
Glu Gly Ile Ser Glu Lys Glu Leu Asp Gln Leu Leu Ser Glu Leu1 5 10
15Ile Gln Ala Leu Leu Gln Pro 201123PRTArtificialsynthetic peptide
11Ser Glu Gly Ile Ser Glu Lys Glu Leu Asp Glu Leu Leu Ser Glu Leu1
5 10 15Ile Glu Ala Leu Leu Gln Pro 201214PRTArtificialP15/20 min
consensusMISC_FEATURE(7)..(7)X of position 7 is optional, any amino
acidMISC_FEATURE(10)..(10)X at position 10 is M, E, g-glutamate, G,
A, S, T, or KMISC_FEATURE(14)..(14)X at position 14 is optional, Q,
E, g-glutamate, G, A, S 12Ile Ala Lys Leu Ile Ser Xaa Leu Ile Xaa
Ser Leu Leu Xaa1 5 101319PRTArtificialP14d
consensusMISC_FEATURE(1)..(1)X at position 1 is Q,N, D, E,
g-glutamate, isoD, or SMISC_FEATURE(2)..(2)X at position 2 can be
D, E, g-glutamate, isoDMISC_FEATURE(3)..(3)X at position 3 can be
P, D, E, isoD, or g-glutamateMISC_FEATURE(4)..(4)X at position 4
can be M, A, S, D, E, isoD, or g-glutamateMISC_FEATURE(5)..(5)X at
position 5 can be Q, E, or g-glutamateMISC_FEATURE(6)..(6)X at
position 6 can be A, E, or g-glutamateMISC_FEATURE(8)..(8)X at
position 8 can be M, L, E, Q, D, N, G, A, S, isoD, or
g-glutamateMISC_FEATURE(9)..(9)X at position 9 can be Q, N, E, D,
G, A, S, isoD or, g-glutamateMISC_FEATURE(12)..(12)X at position 12
can be Q, N, E, D, G, A, S, isoD or,
g-glutamateMISC_FEATURE(13)..(13)X at position 13 can be Q, N, E,
D, G, A, S, isoD or, g-glutamateMISC_FEATURE(16)..(16)X at position
16 can be K, Q, N, E, D, R, G, A, or S 13Xaa Xaa Xaa Xaa Xaa Xaa
Leu Xaa Xaa Leu Leu Xaa Xaa Leu Val Xaa1 5 10 15Leu Leu
Lys1413PRTArtificialP14d min consensusMISC_FEATURE(2)..(2)X at
position 2 can be M, L, E, Q, D, N, G, A, S, isoD, or
g-glutamateMISC_FEATURE(3)..(3)X at position 3 can be Q, N, E, D,
G, A, S, isoD or, g-glutamateMISC_FEATURE(6)..(6)X at position 6 is
Q, N, E, D, G, A, S, isoD or, g-glutamateMISC_FEATURE(7)..(7)X at
position 7 can be Q, N, E, D, G, A, S, isoD or,
g-glutamateMISC_FEATURE(10)..(10)X at position 10 can be K, Q, N,
E, D, R, G, A, or S 14Leu Xaa Xaa Leu Leu Xaa Xaa Leu Val Xaa Leu
Leu Lys1 5 101514PRTArtificialP3min consensusMISC_FEATURE(1)..(1)X
at position 1 is L or MMISC_FEATURE(2)..(2)X at position 2 can be
Q, N, E, g-glutamate, D, isoD, T, S, A, or GMISC_FEATURE(3)..(3)X
at position 3 can be Q, N, E, g-glutamate, D, isoD, T, S, A, or
GMISC_FEATURE(6)..(6)X at position 6 can be K, Q, N, E,
g-glutamate, D, isoD, T, S, A, or GMISC_FEATURE(7)..(7)X at
position 7 is L or MMISC_FEATURE(9)..(9)X at position 9 can be E,
g-glutamate, D, isoD, Q, N, T, S, A, or GMISC_FEATURE(10)..(10)X at
position 10 can be A, G, S, T, E, g-glutamate, D, isoD, Q, or
NMISC_FEATURE(12)..(12)X at position 12 is L or
MMISC_FEATURE(13)..(13)X at position 13 can be Q, N, E,
g-glutamate, D, isoD, T, S, A, or GMISC_FEATURE(14)..(14)X at
position 14 can be Q, N, E, g-glutamate, D, isoD, T, S, A, or G
15Xaa Xaa Xaa Leu Leu Xaa Xaa Phe Xaa Xaa Ile Xaa Xaa Xaa1 5
101612PRTArtificialP25 consensusMISC_FEATURE(2)..(2)X at position 2
can be Q, N, E, g-glutamate, D, isoD, T, S, A, or
GMISC_FEATURE(3)..(3)X at position 3 can be K, Q, N, E,
g-glutamate, D, isoD, T, S, A, or GMISC_FEATURE(5)..(5)X at
position 5 can be L or MMISC_FEATURE(6)..(6)X at position 6 can be
K, Q, N, E, g-glutamate, D, isoD, T, S, A, or
GMISC_FEATURE(9)..(9)X at position 9 can be E, g-glutamate, D,
isoD, Q, N, T, S, A, or GMISC_FEATURE(10)..(10)X at position 10 can
be A, G, S, T, E, g-glutamate, D, isoD, Q, or N 16Leu Xaa Xaa Leu
Xaa Xaa Ile Leu Xaa Xaa Leu Val1 5 101716PRTArtificialP25
consensusMISC_FEATURE(2)..(2)X at position 2 can be T, S, A, G, D,
isoD, E, g-glutamate, Q, or NMISC_FEATURE(3)..(3)X at position 3
can be G, T, S, A, D, isoD, E, g-glutamate, Q, or
NMISC_FEATURE(6)..(6)X at position 6 can be Q, N, E, g-glutamate,
D, isoD, T, S, A, or GMISC_FEATURE(7)..(7)X at position 7 can be K,
Q, N, E, g-glutamate, D, isoD, T, S, A, or GMISC_FEATURE(9)..(9)X
at position 9 can be L or MMISC_FEATURE(10)..(10)X at position 10
can be K, Q, N, E, g-glutamate, D, isoD, T, S, A, or
GMISC_FEATURE(13)..(13)X at position 13 can be E, g-glutamate, D,
isoD, Q, N, T, S, A, or GMISC_FEATURE(14)..(14)X at position 14 can
be A, G, S, T, E, g-glutamate, D, isoD, Q, or
NMISC_FEATURE(16)..(16)V at position 16 is optional 17Leu Xaa Xaa
Val Leu Xaa Xaa Leu Xaa Xaa Ile Leu Xaa Xaa Leu Val1 5 10
151827PRTArtificialP17/18 consensusMISC_FEATURE(1)..(1)X at
position 1 can be any amino acid, but preferably Q, S, E,
g-glutamate, A, T, G, D, isoD, N, K, or RMISC_FEATURE(2)..(2)X at
position 2 can be any amino acid, but preferably Q, S, E,
g-glutamate, A, T, G, D, isoD, N, K, or RMISC_FEATURE(3)..(3)X at
position 3 can be any amino acid, but preferably P, Q, S, E,
g-glutamate, A, T, G, D, isoD, N, K, or RMISC_FEATURE(4)..(4)X at
position 4 can be any amino acid, but preferably I, Q, S, E,
g-glutamate, A, T, G, D, N, isoD, K, or RMISC_FEATURE(5)..(5)X at
position 5 can be any amino acid, but preferably D, isoD, S, E,
g-glutamate, A, T, G, N, Q, K, or RMISC_FEATURE(6)..(6)X at
position 6 can be any amino acid, but preferably R, Q, S, E,
g-glutamate, A, T, G, D, isoD, N, or KMISC_FEATURE(7)..(7)X of
position 7 can be any amino acid, but preferably Q, S, E,
g-glutamate, A, T, G, D, isoD, N, K, or RMISC_FEATURE(8)..(8)X at
position 8 can be any amino acid, but preferably T, Q, S, E,
g-glutamate, A, G, D, isoD, N, K, or RMISC_FEATURE(9)..(9)X at
position 9 can be any amino acid, but preferably I, Q, S, E,
g-glutamate, A, T, G, D, isoD, N, K, or RMISC_FEATURE(10)..(10)X at
position 10 can be any amino acid, but preferably E, g-glutamate,
Q, S, A, T, G, D, isoD, N, K, or RMISC_FEATURE(11)..(11)X at
position 11 can be any amino acid, but preferably Q, S, E,
g-glutamate, A, T, G, D, isoD, N, K, or RMISC_FEATURE(12)..(12)X at
position 12 can be L or MMISC_FEATURE(13)..(13)X at position 13 can
be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or RMISC_FEATURE(14)..(14)X at position 14
can be any amino acid, but preferably Q, A, S, T, G, D, isoD, E,
g-glutamate, N, K, or RMISC_FEATURE(17)..(17)X at position 17 can
be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or RMISC_FEATURE(18)..(18)X at position 18
can be any amino acid, but preferably Q, A, S, T, G, D, isoD, E,
g-glutamate, N, K, or RMISC_FEATURE(21)..(21)X at position 21 can
be any amino acid, but preferably K, A, S, T, G, D, isoD, E,
g-glutamate, Q, N, or RMISC_FEATURE(22)..(22)X at position 22 can
be any amino acid, but preferably S, A,T, G, D, isoD, E,
g-glutamate, Q, N, K, or RMISC_FEATURE(25)..(25)X at position 25
can be any amino acid, but preferably S, A, T, G, D, isoD, E,
g-glutamate, Q, N, K, or RMISC_FEATURE(26)..(26)X at position 26
can be any amino acid, but preferably P, S, A, T, G, D, isoD, E,
g-glutamate, Q, N, K, or RMISC_FEATURE(27)..(27)X at position 27
can be any amino acid, but preferably Q, S, A, T, G, D, isoD, E,
g-glutamate, N, K, or R 18Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Leu Leu1 5 10 15Xaa Xaa Leu Leu Xaa Xaa Leu Leu Xaa
Xaa Xaa 20 251923PRTArtificialsynthetic peptide 19Ser Gln Gly Ile
Ser Glu Lys Gln Val Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala
Leu Leu Gln Pro 202023PRTArtificialsynthetic peptide 20Ser Gln Gly
Ile Ser Glu Lys Gln Phe Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln
Ala Leu Leu Gln Pro 202127PRTArtificialP17/18
consensusMISC_FEATURE(1)..(1)X at position 1 can be any amino acid,
but preferably Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(2)..(2)X at position 2 can be any amino acid, but
preferably Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(3)..(3)X at position 3 can be any amino acid, but
preferably P, Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(4)..(4)X at position 4 can be any amino acid, but
preferably I, Q, S, E, g-glutamate, A, T, G, D, N, isoD, K, or
RMISC_FEATURE(5)..(5)X at position 5 can be any amino acid, but
preferably D, isoD, S, E, g-glutamate, A, T, G, N, Q, K, or
RMISC_FEATURE(6)..(6)X at position 6 can be any amino acid, but
preferably R, Q, S, E, g-glutamate, A, T, G, D, isoD, N, or
KMISC_FEATURE(7)..(7)X of position 7 can be any amino acid, but
preferably Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(8)..(8)X at position 8 can be any amino acid, but
preferably T, Q, S, E, g-glutamate, A, G, D, isoD, N, K, or
RMISC_FEATURE(9)..(9)X at position 9 can be any amino acid, but
preferably I, Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(10)..(10)X at position 10 can be any amino acid, but
preferably E, g-glutamate, Q, S, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(11)..(11)X at position 11 can be any amino acid, but
preferably Q, S, E, g-glutamate, A, T, G, D, isoD, N, K, or
RMISC_FEATURE(12)..(12)X at position 12 can be L or
MMISC_FEATURE(13)..(13)X at position 13 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(14)..(14)X at position 14 can be any amino acid, but
preferably Q, A, S, T, G, D, isoD, E, g-glutamate, N, K, or
RMISC_FEATURE(17)..(17)X at position 17 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(18)..(18)X at position 18 can be any amino acid, but
preferably Q, A, S, T, G, D, isoD, E, g-glutamate, N, K, or
RMISC_FEATURE(21)..(21)X at position 21 can be any amino acid, but
preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or
RMISC_FEATURE(22)..(22)X at position 22 can be any amino acid, but
preferably S, A,T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(25)..(25)X at position 25 can be any amino acid, but
preferably S, A, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(26)..(26)X at position 26 can be any amino acid, but
preferably P, S, A, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(27)..(27)X at position 27 can be any amino acid, but
preferably Q, S, A, T, G, D, isoD, E, g-glutamate, N, K, or R 21Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Leu Leu1 5 10
15Xaa Xaa Leu Leu Xaa Xaa Leu Leu Xaa Xaa Xaa 20
252223PRTArtificialsynthetic peptide 22Ser Gln Gly Ile Ser Glu Lys
Gln Leu Asp Gln Ile Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Leu Gln
Pro 202323PRTArtificialsynthetic peptide 23Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Phe Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 202423PRTArtificialsynthetic peptide 24Ser Gln Gly Ile Ser
Glu Lys Gln Leu Asp Gln Leu Ile Ser Gln Leu1 5 10 15Ile Gln Ala Leu
Leu Gln Pro 202513PRTArtificialP17/18 min
consensusMISC_FEATURE(1)..(1)X at position 1 can be L or
MMISC_FEATURE(2)..(2)X at position 2 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(3)..(3)X at position 3 can be any amino acid, but
preferably Q, A, S, T, G, D, isoD, E, g-glutamate, N, K, or
RMISC_FEATURE(6)..(6)X at position 6 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(7)..(7)X at position 7 can be any amino acid, but
preferably Q, A, S, T, G, D, isoD, E, g-glutamate, N, K, or
RMISC_FEATURE(10)..(10)X at position 10 can be any amino acid, but
preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or
RMISC_FEATURE(11)..(11)X at position 11 can be any amino acid, but
preferably S, A,T, G, D, isoD, E, g-glutamate, Q, N, K, or R 25Xaa
Xaa Xaa Leu Leu Xaa Xaa Leu Leu Xaa Xaa Leu Leu1 5
102613PRTArtificialP19 consensusMISC_FEATURE(1)..(1)X at position 1
is optional and can be L, I, V, F, or MMISC_FEATURE(3)..(3)X at
position 3 can be any amino acid, but preferably K, A, S, T, G, D,
isoD, E, g-glutamate, Q, N, or RMISC_FEATURE(4)..(4)X at position 4
can be any amino acid, but preferably A, S, T, G, D, isoD, E,
g-glutamate, Q, N, K, or RMISC_FEATURE(5)..(5)X at position 5 can
be L or MMISC_FEATURE(7)..(7)X at position 7 can be any amino acid,
but preferably K, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or
RMISC_FEATURE(10)..(10)X at position 10 can be any amino acid, but
preferably A, S, T, G, D, isoD, E, g-glutamate, Q, N, K, or
RMISC_FEATURE(11)..(11)X at position 11 can be any amino acid, but
preferably R, A, S, T, G, D, isoD, E, g-glutamate, Q, N, or
KMISC_FEATURE(12)..(12)X at position 12 can be L, I, V, F, or
MMISC_FEATURE(13)..(13)X at position 13 can be L, I, V, F, or M
26Xaa Leu Xaa Xaa Xaa Leu Xaa Leu Ile Xaa Xaa Xaa Xaa1 5
102723PRTArtificialsynthetic peptide 27Ser Gln Gly Ile Ser Glu Lys
Gln Leu Asp Gln Leu Leu Ser Ala Leu1 5 10 15Ile Gln Ala Leu Leu Gln
Pro 202823PRTArtificialsynthetic peptide 28Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Ser Lys Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 202923PRTArtificialsynthetic peptide 29Ser Gln Gly Ile Ser
Glu Lys Gln Leu Asp Gln Leu Leu Ser Ser Leu1 5 10 15Ile Gln Ala Leu
Leu Gln Pro 203023PRTArtificialsynthetic peptide 30Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Ile Leu1 5 10 15Ile Gln Ala
Leu Leu Gln Pro 203120PRTArtificialsynthetic peptide 31Ser Glu Glu
Glu Glu Glu Leu Asp Gln Leu Leu Ser Gln Leu Ile Gln1 5 10 15Ala Leu
Leu Gln 203223PRTArtificialsynthetic peptide 32Ser Gln Gly Ile Ser
Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Ile1 5 10 15Ile Gln Ala Leu
Leu Gln Pro 203319PRTArtificialsynthetic peptide 33Ser Glu Glu Glu
Glu Glu Leu Asp Gln Leu Leu Ser Gln Leu Ile Gln1 5 10 15Ala Leu
Leu3423PRTArtificialsynthetic peptide 34Ser Gln Gly Ile Ser Glu Lys
Gln Leu Asp Gln Leu Leu Ser Gln Phe1 5 10 15Ile Gln Ala Leu Leu Gln
Pro 203522PRTArtificialsynthetic peptide 35Arg Arg Arg Arg Arg Gly
Gly Leu Asp Gln Leu Leu Ser Gln Leu Ile1 5 10 15Gln Ala Leu Leu Gln
Pro 203622PRTArtificialsynthetic peptide 36Leu Asp Gln Leu Leu Ser
Gln Leu Ile Gln Ala Leu Leu Gln Pro Gly1 5 10 15Gly Arg Arg Arg Arg
Arg 203723PRTArtificialsynthetic peptide 37Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Ile Leu
Gln Pro 203822PRTArtificialsynthetic peptide 38Lys Lys Lys Lys Lys
Gly Gly Leu Asp Gln Leu Leu Ser Gln Leu Ile1 5 10 15Gln Ala Leu Leu
Gln Pro 203922PRTArtificialsynthetic peptide 39Leu Asp Gln Leu Leu
Ser Gln Leu Ile Gln Ala Leu Leu Gln Pro Gly1 5 10 15Gly Lys Lys Lys
Lys Lys 204023PRTArtificialsynthetic peptide 40Ser Gln Gly Ile Ser
Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu
Phe Gln Pro 204123PRTArtificialsynthetic peptide 41Asn Glu Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile Met Ala
Leu Leu Gln Gln 204223PRTArtificialsynthetic peptide 42Asn Gln Gly
Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile Thr
Ala Leu Leu Gln Gln 204323PRTArtificialsynthetic peptide 43Asn Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile
Glu Ala Leu Leu Gln Gln 204423PRTArtificialsynthetic peptide 44Asn
Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10
15Ile Ala Ala Leu Leu Gln Gln 204523PRTArtificialsynthetic peptide
45Asn Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1
5 10 15Ile Lys Ala Leu Leu Gln Gln 204623PRTArtificialsynthetic
peptide 46Asn Glu Gly Ile Ser Glu Lys Glu Leu Asp Glu Leu Leu Thr
Glu Leu1 5 10 15Ile Glu Ala Leu Leu Gln Gln
204722PRTArtificialP15b/P20 consensusMISC_FEATURE(3)..(3)X at
position 3 is N, D, or isoDMISC_FEATURE(6)..(6)X at position 6 is
Q, E, g-glutamate, G, A, or SMISC_FEATURE(8)..(8)X at position 8 is
N, D, or isoDMISC_FEATURE(15)..(15)X at position 15 is optional and
can be any amino acidMISC_FEATURE(18)..(18)X at position 18 is M,
E, g-glutamate, G, A, S, T, or KMISC_FEATURE(22)..(22)X at position
22 is optional and can be Q, E, g-glutamate, G, A, or S 47Lys Pro
Xaa Asp Ser Xaa Ser Xaa Ile Ala Lys Leu Ile Ser Xaa Leu1 5 10 15Ile
Xaa Ser Leu Leu Xaa 204845PRTArtificialsynthetic peptide 48Gln Lys
Asp Val Asn Phe Gly Thr Pro Asp Ser Thr Val Gln Asn Pro1 5 10 15Gln
Asp Ala Ser Lys Pro Asn Asp Ser Gln Ser Asn Ile Ala Lys Leu 20 25
30Ile Ser Ala Leu Ile Met Ser Leu Leu Gln Met Leu Thr 35 40
454922PRTArtificialsynthetic peptide 49Lys Pro Asn Asp Ser Gln Ser
Asn Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Met Ser Leu Leu Gln
205022PRTArtificialsynthetic peptide 50Lys Pro Asn Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Gln
205122PRTArtificialsynthetic peptide 51Lys Pro Asn Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Ala Ser Leu Leu Gln
205222PRTArtificialsynthetic peptide 52Lys Pro Asn Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Ser Ser Leu Leu Gln
205322PRTArtificialsynthetic peptide 53Lys Pro Asn Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Thr Ser Leu Leu Gln
205422PRTArtificialsynthetic peptide 54Lys Pro Asn Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Lys Ser Leu Leu Gln
205522PRTArtificialsynthetic peptide 55Lys Pro Asn Asp Ser Glu Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Gln
205622PRTArtificialsynthetic peptide 56Lys Pro Asp Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Met Ser Leu Leu Gln
205722PRTArtificialsynthetic peptide 57Lys Pro Asp Asp Ser Glu Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Met Ser Leu Leu Gln
205822PRTArtificialsynthetic peptide 58Lys Pro Asp Asp Ser Gln Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Gln
205922PRTArtificialsynthetic peptide 59Lys Pro Asp Asp Ser Glu Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Gln
206022PRTArtificialsynthetic peptide 60Lys Pro Asp Asp Ser Glu Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Glu
206122PRTArtificialsynthetic peptide 61Lys Pro Asn Asp Ser Glu Ser
Asp Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Glu
206222PRTArtificialsynthetic peptide 62Lys Pro Asp Asp Ser Glu Ser
Asn Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu Glu
206339PRTArtificialsynthetic peptide 63Asn Phe Gly Thr Pro Asp Ser
Thr Val Gln Asn Pro Gln Asp Ala Ser1 5 10 15Lys Pro Asn Asp Ser Gln
Ser Asn Ile Ala Lys Leu Ile Ser Ala Leu 20 25 30Ile Met Ser Leu Leu
Gln Met 356423PRTArtificialsynthetic peptide 64Lys Pro Asn Asp Ser
Gln Ser Asn Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Met Ser Leu
Leu Gln Met 206534PRTArtificialsynthetic peptide 65Gly Thr Pro Asp
Ser Thr Val Gln Asn Pro Gln Asp Ala Ser Lys Pro1 5 10 15Asn Asp Ser
Gln Ser Asn Ile Ala Lys Leu Ile Ser Leu Ile Met Ser 20 25 30Leu
Leu6620PRTArtificialP6/6a consensusMISC_FEATURE(4)..(4)X at
position 4 is F or YMISC_FEATURE(6)..(6)X at position 6 is Q, E,
g-glutamate, G, A, or SMISC_FEATURE(7)..(7)X at position 7 is
optional and can be M, E, g-glutamate, G, A, S, T, or K or
LMISC_FEATURE(9)..(9)X at position 9 is M, E, g-glutamate, G, A, S,
T, or KMISC_FEATURE(10)..(10)X at position 10 is H or
NMISC_FEATURE(14)..(14)X at position 14 is E, g-glutamate, D, or
isoDMISC_FEATURE(17)..(17)X at position 17 is Q, E, g-glutamate, G,
A, or SMISC_FEATURE(19)..(19)X at position 19 is Q, E, g-glutamate,
G, A, or S 66Pro Ser Pro Xaa Thr Xaa Xaa Leu Xaa Xaa Ile Val Gly
Xaa Ile Leu1 5 10 15Xaa Ala Xaa Asn 206720PRTArtificialsynthetic
peptide 67Pro Ser Pro Phe Thr Gln Met Leu Met His Ile Val Gly Glu
Ile Leu1 5 10 15Gln Ala Gln Asn 206819PRTArtificialsynthetic
peptide 68Pro Ser Pro Phe Thr Gln Leu Met His Ile Val Gly Glu Ile
Leu Gln1 5 10 15Ala Gln Asn6920PRTArtificialsynthetic peptide 69Pro
Ser Pro Phe Thr Gln Ala Leu Met His Ile Val Gly Glu Ile Leu1 5 10
15Gln Ala Gln Asn 207020PRTArtificialsynthetic peptide 70Pro Ser
Pro Phe Thr Gln Met Leu Met Asn Ile Val Gly Glu Ile Leu1 5 10 15Gln
Ala Gln Asn 207120PRTArtificialsynthetic peptide 71Pro Ser Pro Tyr
Thr Gln Met Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala Gln
Asn 207220PRTArtificialsynthetic peptide 72Pro Ser Pro Phe Thr Gln
Met Leu Met His Ile Val Gly Asp Ile Leu1 5 10 15Gln Ala Gln Asn
207320PRTArtificialsynthetic peptide 73Pro Ser Pro Phe Thr Gln Ala
Leu Ala His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala Gln Asn
207420PRTArtificialsynthetic peptide 74Pro Ser Pro Phe Thr Glu Ala
Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala Gln Asn
207520PRTArtificialsynthetic peptide 75Pro Ser Pro Phe Thr Glu Ala
Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Glu Ala Gln Asn
207620PRTArtificialsynthetic peptide 76Pro Ser Pro Phe Thr Glu Ala
Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Glu Ala Glu Asn
207720PRTArtificialsynthetic peptide 77Pro Ser Pro Tyr Thr Glu Ala
Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Glu Ala Glu Asn
207820PRTArtificialsynthetic peptide 78Pro Ser Pro Phe Thr Glu Ala
Leu Met Asn Ile Val Gly Glu Ile Leu1 5 10 15Glu Ala Glu Asn
207920PRTArtificialsynthetic peptide 79Pro Ser Pro Phe Thr Glu Ala
Leu Met His Ile Val Gly Asp Ile Leu1 5 10 15Glu Ala Glu Asn
208020PRTArtificialsynthetic peptide 80Pro Ser Pro Tyr Thr Glu Ala
Leu Met Asn Ile Val Gly Asp Ile Leu1 5 10 15Glu Ala Glu Asn
208150PRTArtificialsynthetic peptide 81Thr Ser Ser Ser Pro Gly Leu
Phe Gln Ser Gly Gly Asp Asn Gly Leu1 5 10 15Gly Gly His Asn Ala Asn
Ser Ala Leu Gly Gln Gln Pro Ile Asp Arg 20 25 30Gln Thr Ile Glu Gln
Met Ala Gln Leu Leu Ala Gln Leu Leu Lys Ser 35 40 45Leu Leu
508250PRTArtificialsynthetic peptide 82Thr Ser Ser Ser Pro Gly Leu
Phe Gln Ser Gly Gly Asp Asn Gly Leu1 5 10 15Gly Gly His Asn Ala Asn
Ser Ala Leu Gly Gln Gln Pro Ile Asp Arg 20 25 30Gln Thr Ile Glu Gln
Leu Ala Gln Leu Leu Ala Gln Leu Leu Lys Ser 35 40 45Leu Leu
508327PRTArtificialsynthetic peptide 83Gln Gln Pro Ile Asp Arg Gln
Thr Ile Glu Gln Met Ala Gln Leu Leu1 5 10 15Ala Gln Leu Leu Lys Ser
Leu Leu Ser Pro Gln 20 258427PRTArtificialsynthetic peptide 84Gln
Gln Pro Ile Asp Arg Gln Thr Ile Glu Gln Leu Ala Gln Leu Leu1 5 10
15Ala Gln Leu Leu Lys Ser Leu Leu Ser Pro Gln 20
258516PRTArtificialsynthetic peptide 85Ile Glu Gln Met Ala Gln Leu
Leu Ala Gln Leu Leu Lys Ser Leu Leu1 5 10
158616PRTArtificialsynthetic peptide 86Ile Glu Gln Leu Ala Gln Leu
Leu Ala Gln Leu Leu Lys Ser Leu Leu1 5 10
158720PRTArtificialsynthetic peptide 87Asp Arg Gln Thr Ile Glu Gln
Met Ala Gln Leu Leu Ala Gln Leu Leu1 5 10 15Lys Ser Leu Leu
208820PRTArtificialsynthetic peptide 88Asp Arg Gln Thr Ile Glu Gln
Leu Ala Gln Leu Leu Ala Gln Leu Leu1 5 10 15Lys Ser Leu Leu
208925PRTArtificialsynthetic peptide of amino acids 116 to 140 of
the full length Erwinia amylovora HrpW (P19) 89Ile Thr Pro Asp Gly
Gln Gly Gly Gly Gln Ile Gly Asp Asn Pro Leu1 5 10 15Leu Lys Ala Met
Leu Lys Leu Ile Ala 20 259025PRTArtificialsynthetic peptide 90Ile
Thr Pro Asp Gly Gln Gly Gly Gly Gln Ile Gly Asp Asn Pro Leu1 5 10
15Leu Lys Ala Leu Leu Lys Leu Ile Ala 20
259130PRTArtificialsynthetic peptide 91Ile Thr Pro Asp Gly Gln Gly
Gly Gly Gln Ile Gly Asp Asn Pro Leu1 5 10 15Leu Lys Ala Met Leu Lys
Leu Ile Ala Arg Met Met Asp Gly 20 25 309230PRTArtificialsynthetic
peptide 92Ile Thr Pro Asp Gly Gln Gly Gly Gly Gln Ile Gly Asp Asn
Pro Leu1 5 10 15Leu Lys Ala Leu Leu Lys Leu Ile Ala Arg Leu Leu Asp
Gly 20 25 309313PRTArtificialHR Box Peptide
ConsensusMISC_FEATURE(1)..(1)X at position 1 is L, I, V, or
FMISC_FEATURE(2)..(2)X at position 2 is optional and, when present,
is any amino acidMISC_FEATURE(3)..(3)X at position 3 is any amino
acidMISC_FEATURE(4)..(4)X at position 4 is L, I, V, or
FMISC_FEATURE(5)..(5)X at position 5 is L or IMISC_FEATURE(6)..(6)X
at position 6 is optional and, when present, is any amino
acidMISC_FEATURE(7)..(7)X at position 7 is any amino
acidMISC_FEATURE(8)..(8)X at position 8 is L, I, V, or
FMISC_FEATURE(9)..(9)X at position 9 is L, I, V, or
AMISC_FEATURE(10)..(10)X at position 10 is optional and, when
present, is any amino acidMISC_FEATURE(11)..(11)X at position 11 is
any amino acidMISC_FEATURE(12)..(12)X at position 12 is L or
IMISC_FEATURE(13)..(13)X at position 13 is L, I, V, or F 93Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5
109417PRTArtificialsynthetic peptide 94Lys Gln Leu Asp Gln Leu Leu
Ser Gln Leu Ile Gln Ala Leu Leu Gln1 5 10
15Pro9518PRTArtificialsynthetic peptide 95Glu Lys Gln Leu Asp Gln
Leu Leu Ser Gln Leu Ile Gln Ala Leu Leu1 5 10 15Gln
Pro9619PRTArtificialsynthetic peptide 96Ser Glu Lys Gln Leu Asp Gln
Leu Leu Ser Gln Leu Ile Gln Ala Leu1
5 10 15Leu Gln Pro9721PRTArtificialsynthetic peptide 97Gly Ile Ser
Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu Ile Gln1 5 10 15Ala Leu
Leu Gln Pro 209823PRTArtificialsynthetic peptide 98Ser Gln Glu Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala
Leu Leu Gln Pro 209923PRTArtificialsynthetic peptide 99Ser Gln Gly
Leu Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln
Ala Leu Leu Gln Pro 2010023PRTArtificialsynthetic peptide 100Ser
Gln Gly Ala Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10
15Ile Gln Ala Leu Leu Gln Pro 2010123PRTArtificialsynthetic peptide
101Ser Gln Gly Asp Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1
5 10 15Ile Gln Ala Leu Leu Gln Pro 2010223PRTArtificialsynthetic
peptide 102Ser Gln Gly Ile Val Glu Lys Gln Leu Asp Gln Leu Leu Ser
Gln Leu1 5 10 15Ile Gln Ala Leu Leu Gln Pro
2010323PRTArtificialsynthetic peptide 103Ser Gln Gly Ile Ser Arg
Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 2010423PRTArtificialsynthetic peptide 104Ser Gln Gly Ile
Ser Val Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala
Leu Leu Gln Pro 2010523PRTArtificialsynthetic peptide 105Ser Gln
Gly Ile Ser Glu Asp Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile
Gln Ala Leu Leu Gln Pro 2010623PRTArtificialsynthetic peptide
106Ser Gln Gly Ile Ser Glu Val Gln Leu Asp Gln Leu Leu Ser Gln Leu1
5 10 15Ile Gln Ala Leu Leu Gln Pro 2010723PRTArtificialsynthetic
peptide 107Ser Gln Gly Ile Ser Glu Lys Val Leu Asp Gln Leu Leu Ser
Gln Leu1 5 10 15Ile Gln Ala Leu Leu Gln Pro
2010823PRTArtificialsynthetic peptide 108Ser Gln Gly Ile Ser Glu
Lys Ser Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 2010923PRTArtificialsynthetic peptide 109Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile Met Ala
Leu Leu Gln Gln 2011023PRTArtificialsynthetic peptide 110Asn Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile
Met Ala Leu Leu Gln Gln 2011123PRTArtificialsynthetic peptide
111Ser Gln Gly Ile Ser Glu Lys Gln Leu Val Gln Leu Leu Ser Gln Leu1
5 10 15Ile Gln Ala Leu Leu Gln Pro 2011223PRTArtificialsynthetic
peptide 112Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Val Leu Leu Ser
Gln Leu1 5 10 15Ile Gln Ala Leu Leu Gln Pro
2011323PRTArtificialsynthetic peptide 113Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Val Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 2011423PRTArtificialsynthetic peptide 114Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Ser Leu Ser Gln Leu1 5 10 15Ile Gln Ala
Leu Leu Gln Pro 2011523PRTArtificialsynthetic peptide 115Asn Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile
Gln Ala Leu Leu Gln Gln 2011623PRTArtificialsynthetic peptide
116Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Val Gln Leu1
5 10 15Ile Gln Ala Leu Leu Gln Pro 2011723PRTArtificialsynthetic
peptide 117Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser
Val Leu1 5 10 15Ile Gln Ala Leu Leu Gln Pro
2011823PRTArtificialsynthetic peptide 118Asn Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Thr Gln Leu1 5 10 15Ile Met Ala Leu Leu
Gln Pro 2011923PRTArtificialsynthetic peptide 119Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Leu Gln Ala
Leu Leu Gln Pro 2012023PRTArtificialsynthetic peptide 120Ser Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ala
Gln Ala Leu Leu Gln Pro 2012123PRTArtificialsynthetic peptide
121Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1
5 10 15Val Gln Ala Leu Leu Gln Pro 2012223PRTArtificialsynthetic
peptide 122Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser
Gln Leu1 5 10 15Ile Val Ala Leu Leu Gln Pro
2012323PRTArtificialsynthetic peptide 123Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Val Leu Leu
Gln Pro 2012423PRTArtificialsynthetic peptide 124Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Asp
Leu Leu Gln Pro 2012523PRTArtificialsynthetic peptide 125Ser Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile
Gln Ser Leu Leu Gln Pro 2012621PRTArtificialsynthetic peptide
126Ser Glu Glu Glu Glu Glu Leu Asp Gln Leu Leu Thr Gln Leu Ile Glu1
5 10 15Ala Leu Leu Gln Gln 2012723PRTArtificialsynthetic peptide
127Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1
5 10 15Ile Gln Ala Leu Ser Gln Pro 2012823PRTArtificialsynthetic
peptide 128Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser
Gln Leu1 5 10 15Ile Gln Ala Leu Ile Gln Pro
2012923PRTArtificialsynthetic peptide 129Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Val
Gln Pro 2013023PRTArtificialsynthetic peptide 130Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala
Leu Leu Val Pro 2013121PRTArtificialsynthetic peptide 131Ser Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile
Gln Ala Leu Leu 2013222PRTArtificialsynthetic peptide 132Ser Gln
Gly Ile Ser Glu Lys Gln Leu Gln Leu Leu Ser Gln Leu Ile1 5 10 15Gln
Ala Leu Leu Gln Pro 2013322PRTArtificialsynthetic peptide 133Ser
Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Gln Leu Ile1 5 10
15Gln Ala Leu Leu Gln Pro 2013420PRTArtificialsynthetic peptide
134Ser Glu Glu Glu Glu Glu Leu Asp Gln Leu Leu Thr Gln Leu Ile Glu1
5 10 15Ala Leu Leu Gln 2013513PRTArtificialP6/6a min
consensusMISC_FEATURE(1)..(1)X at position 1 is F or
YMISC_FEATURE(3)..(3)X at position 3 is Q, E, g-glutamate, G, A, or
SMISC_FEATURE(4)..(4)X at position 4 is optional and can be M, E,
g-glutamate, G, A, S, T, or K, or LMISC_FEATURE(6)..(6)X at
position 6 is M, E, g-glutamate, G, A, S, T, or
KMISC_FEATURE(7)..(7)X at position 7 is H or
NMISC_FEATURE(11)..(11)X at position 11 is E, g-glutamate, D, or
isoD 135Xaa Thr Xaa Xaa Leu Xaa Xaa Ile Val Gly Xaa Ile Leu1 5
1013623PRTArtificialsynthetic peptide 136Ser Gln Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Ala Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro 2013723PRTArtificialsynthetic peptide 137Ser Gln Gly Ile
Ser Glu Lys Gln Leu Asp Gln Leu Leu Asp Gln Leu1 5 10 15Ile Gln Ala
Leu Leu Gln Pro 2013823PRTArtificialsynthetic peptide 138Ser Gln
Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Lys Gln Leu1 5 10 15Ile
Gln Ala Leu Leu Gln Pro 2013923PRTArtificialsynthetic peptide
139Ser Gln Gly Ile Ser Glu Lys Gln Leu Asp Gln Leu Leu Gln Gln Leu1
5 10 15Ile Gln Ala Leu Leu Gln Pro 2014024PRTArtificialsynthetic
peptide 140Ser Gln Gly Ile Ser Glu Lys Gln Ala Leu Asp Gln Leu Leu
Ser Gln1 5 10 15Leu Ile Gln Ala Leu Leu Gln Pro
2014119PRTArtificialsynthetic peptide 141Ser Glu Glu Glu Glu Glu
Leu Asp Gln Leu Leu Thr Gln Leu Ile Glu1 5 10 15Ala Leu
Leu14239PRTArtificialsynthetic peptide 142Asn Phe Gly Thr Pro Asp
Ser Thr Val Gln Asn Pro Gln Asp Ala Ser1 5 10 15Lys Pro Asn Asp Ser
Gln Ser Asn Ile Ala Lys Leu Ile Ser Ala Leu 20 25 30Ile Gln Ser Leu
Leu Gln Pro 3514339PRTArtificialsynthetic peptide 143Asn Phe Gly
Thr Pro Asp Ser Thr Val Gln Asn Pro Gln Asp Ala Ser1 5 10 15Lys Pro
Asn Asp Ser Gln Ser Asn Ile Ala Lys Leu Ile Ser Ala Leu 20 25 30Ile
Met Ser Leu Leu Gln Pro 3514439PRTArtificialsynthetic peptide
144Asn Phe Gly Thr Pro Asp Ser Thr Val Gln Asn Pro Gln Asp Ala Ser1
5 10 15Lys Pro Asn Asp Ser Gln Ser Asn Ile Ala Lys Leu Ile Ser Ala
Leu 20 25 30Ile Gln Ser Leu Leu Gln Met
3514569DNAArtificialsynthetic fragment 145tctcaaggaa tttctgaaaa
gcaacttgat caacttcttt ctcaacttat tcaagctctt 60cttcaacct
6914669DNAArtificialsynthetic fragment 146agccagggta ttagcgaaaa
acagctggat cagctgctga gccagctgat tcaggcactg 60ctgcagccg
6914769DNAArtificialsynthetic fragment 147aatgaaggaa tttctgaaaa
ggaacttgat gaacttctta ctgaacttat tgaagctctt 60cttcaacaa
6914869DNAArtificialsynthetic fragment 148aatgaaggta ttagcgaaaa
agaactggat gaactgctga ccgaactgat tgaagcactg 60ctgcagcag
6914922PRTArtificialsynthetic peptide 149Ser Glu Glu Glu Glu Glu
Gly Gly Ile Ala Lys Leu Ile Ser Ala Leu1 5 10 15Ile Glu Ser Leu Leu
Glu 2015020PRTArtificialsynthetic peptide 150Ser Glu Glu Glu Glu
Glu Ile Ala Lys Leu Ile Ser Ala Leu Ile Glu1 5 10 15Ser Leu Leu Glu
2015120PRTArtificialsynthetic peptide 151Lys Pro Asn Asp Ser Gln
Ser Asn Ile Ala Lys Leu Ile Ser Leu Ile1 5 10 15Met Ser Leu Leu
2015220PRTArtificialsynthetic peptide 152Lys Pro Asn Asp Ser Gln
Ser Asn Ile Ala Lys Leu Ile Ser Leu Ile1 5 10 15Glu Ser Leu Leu
2015321PRTArtificialsynthetic peptide of amino acids 85-103 of
full-length harpin of Xanthomonas oryzae pv. Oryzae 153Pro Ser Pro
Phe Thr Gln Met Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala
Gln Asn Gly 2015414PRTArtificialMotif 2
consensusMISC_FEATURE(1)..(1)X at position 1 can be P, A, or
VMISC_FEATURE(3)..(3)X at position 3 can be P, Q, or
AMISC_FEATURE(4)..(4)X at position 4 can be F, L, or
YMISC_FEATURE(7)..(7)X at position 7 can be M or
AMISC_FEATURE(10)..(10)X at position 10 can be H, N, or
QMISC_FEATURE(13)..(13)X at position 13 can be G or
MMISC_FEATURE(14)..(14)X at position 14 can be E, D, or Q 154Xaa
Ser Xaa Xaa Thr Gln Xaa Leu Met Xaa Ile Val Xaa Xaa1 5
1015517PRTArtificialP6b 155Phe Thr Gln Met Leu Met His Ile Val Gly
Glu Ile Leu Gln Ala Gln1 5 10 15Asn15616PRTArtificialsynthetic
peptide 156Pro Ser Pro Phe Thr Gln Met Leu Met His Ile Val Gly Glu
Ile Leu1 5 10 1515720PRTArtificialsynthetic peptide 157Pro Ser Pro
Phe Thr Gln Leu Leu Met His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala
Gln Asn 2015820PRTArtificialsynthetic peptide 158Pro Ser Pro Phe
Thr Gln Met Leu Glu His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala Gln
Asn 2015920PRTArtificialsynthetic peptide 159Pro Ser Pro Phe Thr
Gln Leu Leu Glu His Ile Val Gly Glu Ile Leu1 5 10 15Gln Ala Gln Asn
2016019PRTArtificialsynthetic peptide 160Ser Glu Glu Glu Glu Glu
Phe Thr Gln Met Leu Met His Ile Val Gly1 5 10 15Glu Ile
Leu16119PRTArtificialsynthetic peptide 161Ser Glu Glu Glu Glu Glu
Phe Thr Gln Leu Leu Glu His Ile Val Gly1 5 10 15Glu Ile
Leu16250PRTArtificialsynthetic peptide of amino acids 10 to 59 of
the full length Erwinia amylovora HrpW 162Thr Ser Ser Ser Pro Gly
Leu Phe Gln Ser Gly Gly Asp Asn Gly Leu1 5 10 15Gly Gly His Asn Ala
Asn Ser Ala Leu Gly Gln Gln Pro Ile Asp Arg 20 25 30Gln Thr Ile Glu
Gln Met Ala Gln Leu Leu Ala Glu Leu Leu Lys Ser 35 40 45Leu Leu
5016324PRTArtificialsynthetic peptide 163Gln Gln Pro Ile Asp Arg
Gln Thr Ile Glu Gln Met Ala Gln Leu Leu1 5 10 15Ala Gln Leu Leu Lys
Ser Leu Leu 2016422PRTArtificialsynthetic peptide 164Asp Arg Gln
Thr Ile Glu Gln Leu Ala Gln Leu Leu Ala Gln Leu Leu1 5 10 15Lys Ser
Leu Leu Ser Pro 2016520PRTArtificialsynthetic peptide 165Gln Thr
Ile Glu Gln Leu Ala Gln Leu Leu Ala Gln Leu Leu Lys Ser1 5 10 15Leu
Leu Ser Pro 2016622PRTArtificialsynthetic peptide 166Ser Glu Glu
Glu Glu Glu Ile Glu Gln Leu Ala Gln Leu Leu Ala Gln1 5 10 15Leu Leu
Lys Ser Leu Leu 2016719PRTArtificialsynthetic peptide 167Ser Glu
Glu Glu Glu Glu Leu Ala Gln Leu Leu Ala Gln Leu Leu Lys1 5 10 15Ser
Leu Leu16826PRTArtificialsynthetic peptide 168Ser Glu Glu Glu Glu
Glu Ile Gly Asp Asn Pro Leu Leu Lys Ala Leu1 5 10 15Leu Lys Leu Ile
Ala Arg Leu Leu Asp Gly 20 2516926PRTArtificialsynthetic peptide
169Ser Glu Glu Glu Glu Glu Ile Gly Asp Asp Glu Leu Leu Lys Ala Leu1
5 10 15Leu Lys Leu Ile Ala Arg Leu Leu Asp Gly 20
2517021PRTArtificialsynthetic peptide 170Ser Glu Glu Glu Glu Glu
Leu Leu Lys Ala Leu Leu Lys Leu Ile Ala1 5 10 15Arg Leu Leu Asp Gly
2017124PRTArtificialsynthetic peptide 171Ser Glu Glu Glu Glu Glu
Ile Gly Asp Asn Pro Leu Leu Lys Ala Leu1 5 10 15Leu Lys Leu Ile Ala
Arg Leu Leu 2017219PRTArtificialsynthetic peptide 172Ser Glu Glu
Glu Glu Glu Leu Leu Lys Ala Leu Leu Lys Leu Ile Ala1 5 10 15Arg Leu
Leu17318PRTArtificialsynthetic peptide 173Ser Glu Glu Glu Glu Glu
Leu Lys Ala Leu Leu Lys Leu Ile Ala Arg1 5 10 15Leu
Leu17434PRTArtificialsynthetic peptide of amino acids 92 to 125 of
the Ralstonia solanacearum PopA 174Gln Ala Pro Gln Ser Ala Asn Lys
Thr Gly Asn Val Asp Asp Ala Asn1 5 10 15Asn Gln Asp Pro Met Gln Ala
Leu Met Gln Leu Leu Glu Asp Leu Val 20 25 30Lys
Leu17519PRTArtificialsynthetic peptide 175Gln Asp Pro Met Gln Ala
Leu Met Gln Leu Leu Glu Asp Leu Val Lys1 5 10 15Leu Leu
Lys17619PRTArtificialsynthetic peptide 176Gln Asp Pro Ala Gln Ala
Leu Leu Gln Leu Leu Glu Asp Leu Val Lys1 5 10
15Leu Leu Lys17719PRTArtificialsynthetic peptide 177Gln Asp Pro Ala
Gln Ala Leu Glu Gln Leu Leu Glu Asp Leu Val Lys1 5 10 15Leu Leu
Lys17820PRTArtificialsynthetic peptide 178Ser Glu Glu Glu Glu Glu
Ala Leu Glu Gln Leu Leu Glu Asp Leu Val1 5 10 15Lys Leu Leu Lys
2017955PRTArtificialsynthetic peptide of amino acids 206 to 260 of
the Ralstonia solanacearum PopA 179Asn Gly Ala Asp Gly Gly Asn Gly
Val Asn Gly Asn Gln Ala Asn Gly1 5 10 15Pro Gln Asn Ala Gly Asp Val
Asn Gly Ala Asn Gly Ala Asp Asp Gly 20 25 30Ser Glu Asp Gln Gly Gly
Leu Thr Gly Val Leu Gln Lys Leu Met Lys 35 40 45Ile Leu Asn Ala Leu
Val Gln 50 5518032PRTArtificialsynthetic peptide 180Ala Asn Gly Ala
Asp Asp Gly Ser Glu Asp Gln Gly Gly Leu Thr Leu1 5 10 15Thr Gly Val
Leu Gln Lys Leu Met Lys Ile Leu Asn Ala Leu Val Gln 20 25
3018124PRTArtificialsynthetic peptide 181Glu Asp Gln Gly Gly Leu
Thr Leu Thr Gly Val Leu Gln Lys Leu Met1 5 10 15Lys Ile Leu Asn Ala
Leu Val Gln 2018219PRTArtificialsynthetic peptide 182Gly Gly Leu
Thr Leu Thr Gly Val Leu Gln Lys Leu Met Lys Ile Leu1 5 10 15Asn Ala
Leu18322PRTArtificialsynthetic peptide 183Glu Asp Gln Gly Gly Leu
Thr Leu Thr Gly Val Leu Gln Lys Leu Met1 5 10 15Lys Ile Leu Asn Ala
Leu 2018422PRTArtificialsynthetic peptide 184Glu Asp Gln Gly Gly
Leu Thr Leu Thr Gly Val Leu Gln Lys Leu Leu1 5 10 15Lys Ile Leu Asn
Ala Leu 2018522PRTArtificialsynthetic peptide 185Glu Asp Gln Gly
Gly Leu Thr Leu Thr Gly Val Leu Gln Glu Leu Met1 5 10 15Glu Ile Leu
Asn Ala Leu 2018624PRTArtificialsynthetic peptide 186Glu Asp Gln
Gly Gly Leu Thr Leu Thr Gly Val Leu Gln Lys Leu Leu1 5 10 15Lys Ile
Leu Glu Ala Leu Val Gln 2018722PRTArtificialsynthetic peptide
187Ser Glu Glu Glu Glu Leu Thr Leu Thr Gly Val Leu Gln Lys Leu Leu1
5 10 15Lys Ile Leu Glu Ala Leu 2018821PRTArtificialsynthetic
peptide 188Ser Glu Glu Glu Glu Glu Leu Thr Gly Val Leu Gln Lys Leu
Leu Lys1 5 10 15Ile Leu Glu Ala Leu 2018916PRTArtificialsynthetic
peptide 189Ser Glu Glu Leu Glu Glu Leu Leu Glu Glu Leu Ile Glu Glu
Leu Leu1 5 10 1519015PRTArtificialsynthetic peptide 190Leu Glu Glu
Leu Leu Glu Glu Leu Ile Glu Glu Leu Leu Glu Glu1 5 10
1519123PRTArtificialsynthetic peptide 191Ser Glu Gly Ile Ser Glu
Lys Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Glu Ala Leu Leu
Gln Pro 2019218PRTArtificialsynthetic peptide 192Leu Asp Gln Leu
Leu Ser Gln Leu Ile Gln Ala Leu Leu Glu Glu Glu1 5 10 15Glu
Glu19318PRTArtificialsynthetic peptide 193Ser Glu Glu Leu Asp Gln
Leu Leu Ser Gln Leu Ile Gln Ala Leu Leu1 5 10 15Glu
Glu19424PRTArtificialsynthetic peptide 194Ser Gln Gly Ile Ser Glu
Glu Gln Leu Asp Gln Leu Leu Ser Gln Leu1 5 10 15Ile Gln Ala Leu Leu
Gln Pro Arg 2019523PRTArtificialsynthetic peptide 195Asn Glu Gly
Ile Ser Glu Lys Glu Leu Asp Glu Leu Leu Thr Glu Leu1 5 10 15Ala Glu
Ala Leu Leu Gln Gln 2019623PRTArtificialsynthetic peptide 196Ser
Gln Gly Ile Ser Glu Lys Gln Ile Asp Gln Leu Leu Ser Gln Leu1 5 10
15Ile Gln Ala Leu Leu Gln Pro 2019720PRTArtificialsynthetic peptide
197Ser Glu Glu Phe Thr Gln Met Leu Met His Ile Val Gly Glu Ile Leu1
5 10 15Gln Ala Gln Asn 2019820PRTArtificialsynthetic peptide 198Ser
Glu Glu Glu Pro Ser Pro Phe Thr Gln Met Leu Met His Ile Val1 5 10
15Gly Glu Ile Leu 2019937PRTArtificialsynthetic peptide 199Gln Ala
Gly Pro Gln Ser Ala Asn Lys Thr Gly Asn Val Asp Asp Ala1 5 10 15Asn
Asn Gln Asp Pro Met Gln Ala Leu Met Gln Leu Leu Glu Asp Leu 20 25
30Val Lys Leu Leu Lys 3520022PRTArtificialsynthetic peptide 200Ser
Glu Glu Glu Glu Glu Leu Thr Leu Thr Gly Val Leu Gln Lys Leu1 5 10
15Leu Lys Ile Leu Glu Ala 2020119PRTArtificialsynthetic peptide
201Ser Glu Glu Glu Glu Glu Val Leu Gln Lys Leu Leu Lys Ile Leu Glu1
5 10 15Ala Leu Val20219PRTArtificialsynthetic peptide 202Ser Glu
Glu Glu Glu Glu Leu Gln Lys Leu Leu Lys Ile Leu Glu Ala1 5 10 15Leu
Val Gln20344PRTArtificialsynthetic peptide of amino acids 137 to
180 of Erwinia amylovora HrpN 203Ser Thr Ser Gln Asn Asp Asp Ser
Thr Ser Gly Thr Asp Ser Thr Ser1 5 10 15Asp Ser Ser Asp Pro Met Gln
Gln Leu Leu Lys Met Phe Ser Glu Ile 20 25 30Met Gln Ser Leu Phe Gly
Asp Gly Gln Asp Gly Thr 35 4020441PRTArtificialsynthetic peptide
204Gln Asn Asp Asp Ser Thr Ser Gly Thr Asp Ser Thr Ser Asp Ser Ser1
5 10 15Asp Pro Met Gln Gln Leu Leu Lys Met Phe Ser Glu Ile Met Gln
Ser 20 25 30Leu Phe Gly Asp Gly Gln Asp Gly Thr 35
4020519PRTArtificialsynthetic peptide 205Ser Asp Pro Met Gln Gln
Leu Leu Lys Met Phe Ser Glu Ile Met Gln1 5 10 15Ser Leu
Phe20620PRTArtificialsynthetic peptide 206Ser Glu Glu Glu Leu Gln
Gln Leu Leu Lys Leu Phe Ser Glu Ile Leu1 5 10 15Gln Ser Leu Phe
2020721PRTArtificialsynthetic peptide 207Ser Glu Glu Glu Glu Glu
Leu Gln Gln Leu Leu Lys Leu Phe Ser Glu1 5 10 15Ile Leu Gln Ser Leu
2020820PRTArtificialsynthetic peptide 208Ser Glu Glu Glu Glu Glu
Leu Gln Gln Leu Leu Lys Leu Phe Ser Glu1 5 10 15Ile Leu Gln Ser
2020920PRTArtificialsynthetic peptide 209Leu Gln Gln Leu Leu Lys
Leu Phe Ser Glu Ile Leu Gln Ser Leu Phe1 5 10 15Glu Glu Glu Glu
2021013PRTArtificialsynthetic peptide 210Leu Glu Glu Leu Leu Glu
Glu Leu Ile Glu Glu Leu Leu1 5 1021116PRTArtificialsynthetic
peptide 211Arg Leu Arg Arg Leu Leu Arg Arg Leu Ile Arg Arg Leu Leu
Arg Pro1 5 10 1521215PRTArtificialsynthetic peptide 212Leu Asp Asp
Leu Leu Asp Asp Leu Ile Asp Asp Leu Leu Asp Asp1 5 10
1521315PRTArtificialsynthetic peptide 213Leu Glu Glu Leu Leu Glu
Glu Leu Leu Glu Glu Leu Leu Glu Glu1 5 10
1521415PRTArtificialsynthetic peptide 214Leu Glu Gln Leu Leu Glu
Asp Leu Val Lys Leu Leu Lys Glu Glu1 5 10
1521515PRTArtificialsynthetic peptide 215Leu Glu Gln Leu Leu Glu
Asp Leu Val Glu Leu Leu Glu Glu Glu1 5 10
1521615PRTArtificialsynthetic peptide 216Leu Glu Glu Leu Leu Glu
Asp Leu Val Glu Leu Leu Glu Glu Glu1 5 10
1521715PRTArtificialsynthetic peptide 217Leu Glu Glu Leu Leu Glu
Glu Leu Val Glu Leu Leu Glu Glu Glu1 5 10
1521818PRTArtificialsynthetic peptide 218Leu Glu Glu Leu Leu Glu
Leu Phe Glu Glu Ile Leu Glu Glu Leu Phe1 5 10 15Glu
Glu21918PRTArtificialsynthetic peptide 219Leu Glu Glu Leu Leu Lys
Leu Phe Glu Glu Ile Leu Glu Glu Leu Phe1 5 10 15Glu
Glu22014PRTArtificialsynthetic peptide 220Ile Glu Glu Leu Ile Glu
Leu Ile Glu Glu Leu Leu Glu Glu1 5 1022115PRTArtificialsynthetic
peptide 221Ile Glu Glu Leu Ile Glu Glu Leu Ile Glu Glu Leu Leu Glu
Glu1 5 10 1522214PRTArtificialsynthetic peptide 222Leu Glu Glu Leu
Leu Lys Leu Ile Glu Arg Leu Leu Glu Glu1 5
1022314PRTArtificialsynthetic peptide 223Leu Glu Glu Leu Leu Glu
Leu Ile Glu Arg Leu Leu Glu Glu1 5 1022414PRTArtificialsynthetic
peptide 224Leu Glu Glu Leu Leu Lys Leu Ile Glu Glu Leu Leu Glu Glu1
5 1022514PRTArtificialsynthetic peptide 225Leu Glu Glu Leu Leu Glu
Leu Ile Glu Glu Leu Leu Glu Glu1 5 1022625PRTArtificialsynthetic
peptide 226Gln Gly Gly Gly Gln Ile Gly Asp Asn Pro Leu Leu Lys Ala
Met Leu1 5 10 15Lys Leu Ile Ala Arg Met Met Asp Gly 20
2522718PRTArtificialsynthetic peptide 227Ser Gln Ser Asn Ile Ala
Lys Leu Ile Ser Ala Leu Ile Met Ser Leu1 5 10 15Leu
Gln22826PRTArtificialsynthetic peptide 228Gln Gln Pro Ile Asp Arg
Gln Thr Ile Glu Gln Leu Ala Gln Leu Leu1 5 10 15Ala Gln Leu Leu Lys
Ser Leu Leu Ser Pro 20 2522924PRTArtificialsynthetic peptide 229Gln
Gln Pro Ile Asp Arg Gln Thr Ile Glu Gln Leu Ala Gln Leu Leu1 5 10
15Ala Gln Leu Leu Lys Ser Leu Leu 2023044PRTArtificialsynthetic
peptide of amino acids 137 to 180 of Erwinia amylovora HrpN 230Ser
Thr Ser Gln Asn Asp Asp Ser Thr Ser Gly Thr Asp Ser Thr Ser1 5 10
15Asp Ser Ser Asp Pro Met Gln Gln Leu Leu Lys Met Phe Ser Glu Ile
20 25 30Met Gln Ser Leu Phe Gly Asp Gly Gln Asp Gly Thr 35
4023119PRTArtificialsynthetic peptide 231Ser Glu Glu Glu Glu Glu
Leu Ala Glu Leu Leu Ala Glu Leu Leu Lys1 5 10 15Ser Leu
Leu23221PRTArtificialsynthetic peptide 232Ser Glu Glu Glu Glu Glu
Leu Asp Gln Leu Leu Ser Gln Leu Ile Gln1 5 10 15Ala Leu Leu Gln Pro
20
* * * * *