U.S. patent application number 17/020325 was filed with the patent office on 2021-04-08 for methods to determine the presence of an antibody that binds modified human thymic stromal lymphopoietin (tslp).
The applicant listed for this patent is AMGEN INC.. Invention is credited to Stewart D. Lyman, Raymond Paxton, Kirk P. Van Ness.
Application Number | 20210102955 17/020325 |
Document ID | / |
Family ID | 1000005277916 |
Filed Date | 2021-04-08 |
![](/patent/app/20210102955/US20210102955A1-20210408-C00001.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00002.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00003.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00004.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00005.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00006.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00007.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00008.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00009.png)
![](/patent/app/20210102955/US20210102955A1-20210408-C00010.png)
United States Patent
Application |
20210102955 |
Kind Code |
A1 |
Lyman; Stewart D. ; et
al. |
April 8, 2021 |
Methods to Determine the Presence of an Antibody that Binds
Modified Human Thymic Stromal Lymphopoietin (TSLP)
Abstract
Modified, furin resistant human TSLP polypeptides and
polynucleotides encoding the modified human TSLP polypeptides are
provided. Pharmaceutical compositions, B and T cell activation
agents, assays and methods of use are also described.
Inventors: |
Lyman; Stewart D.; (Seattle,
WA) ; Van Ness; Kirk P.; (Seattle, WA) ;
Paxton; Raymond; (Bellevue, WA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AMGEN INC. |
Thousand Oaks |
CA |
US |
|
|
Family ID: |
1000005277916 |
Appl. No.: |
17/020325 |
Filed: |
September 14, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15259931 |
Sep 8, 2016 |
|
|
|
17020325 |
|
|
|
|
14717334 |
May 20, 2015 |
|
|
|
15259931 |
|
|
|
|
14095524 |
Dec 3, 2013 |
9045558 |
|
|
14717334 |
|
|
|
|
13608808 |
Sep 10, 2012 |
8598318 |
|
|
14095524 |
|
|
|
|
13151126 |
Jun 1, 2011 |
|
|
|
13608808 |
|
|
|
|
12723499 |
Mar 12, 2010 |
7973151 |
|
|
13151126 |
|
|
|
|
11981423 |
Oct 30, 2007 |
7709217 |
|
|
12723499 |
|
|
|
|
10202699 |
Jul 23, 2002 |
7288633 |
|
|
11981423 |
|
|
|
|
60307345 |
Jul 23, 2001 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
G01N 2333/52 20130101;
C07K 14/52 20130101; G01N 33/6854 20130101; C07K 16/28 20130101;
C07K 14/5418 20130101; C07K 2319/20 20130101; A61K 38/00 20130101;
G01N 2333/47 20130101; C07K 2319/31 20130101 |
International
Class: |
G01N 33/68 20060101
G01N033/68; C07K 14/54 20060101 C07K014/54; C07K 14/52 20060101
C07K014/52; C07K 16/28 20060101 C07K016/28 |
Claims
1. An isolated nucleic acid encoding a polypeptide comprising at
least 90% amino acid sequence identity to amino acids 29-159 of SEQ
ID NO: 10, wherein the polypeptide comprises one or more amino acid
substitutions or deletions to inactivate the furin cleavage site
RRKRK (SEQ ID NO:6) at position 127-131 of SEQ ID NO:4.
2. The nucleic acid of claim 1 encoding a polypeptide comprising at
least 90% amino acid sequence identity to SEQ ID NO: 12, wherein
the polypeptide comprises one or more amino acid substitutions or
deletions to inactivate the furin cleavage site RRKRK (SEQ ID NO:6)
at position 127-131 of SEQ ID NO:4.
3. The nucleic acid of claim 1 encoding a polypeptide comprising at
least 90% amino acid sequence identity to SEQ ID NO: 14, wherein
the polypeptide comprises one or more amino acid substitutions or
deletions to inactivate the furin cleavage site RRKRK (SEQ ID NO:6)
at position 127-131 of SEQ ID NO:4.
4. The nucleic acid of claim 1 encoding a polypeptide comprising at
least 90% amino acid sequence identity to SEQ ID NO: 16, wherein
the polypeptide comprises one or more amino acid substitutions or
deletions to inactivate the furin cleavage site RRKRK (SEQ ID NO:6)
at position 127-131 of SEQ ID NO:4.
5. The nucleic acid of claim 1 encoding a polypeptide comprising at
least 90% amino acid sequence identity to SEQ ID NO: 17, wherein
the polypeptide comprises an amino acid substitution or deletion to
inactivate the furin cleavage site RRKRK (SEQ ID NO:6) at position
127-131 of SEQ ID NO:4.
6. The nucleic acid of claim 1 encoding a polypeptide comprising at
least 90% amino acid sequence identity to SEQ ID NO: 18, wherein
the polypeptide comprises one or more amino acid substitutions or
deletions to inactivate the furin cleavage site RRKRK (SEQ ID NO:6)
at position 127-131 of SEQ ID NO:4.
7. The nucleic acid molecule of claim 1, wherein the nucleic acid
comprises a polynucleotide sequence selected from the group
consisting of SEQ ID NOs: 9, 11, 13 and 15.
8. The nucleic acid molecule of claim 1, further comprising a
nucleotide sequence encoding a heterologous protein in frame with
the polynucleotide of claim 1.
9. The nucleic acid molecule of claim 8, wherein the heterologous
protein is a cell targeting moiety.
10. The nucleic acid molecule of claim 9, wherein the cell
targeting moiety is an antibody that binds a cell surface
antigen.
11. The nucleic acid molecule of claim 9, wherein the cell
targeting moiety is a ligand that binds a cell surface
receptor.
12. The nucleic acid molecule of claim 8, wherein the heterologous
protein is a peptide tag.
13. The nucleic acid molecule of claim 8, wherein the heterologous
protein is an Fc polypeptide.
14. The nucleic acid molecule of claim 1, operably linked to a
transcriptional or translational regulatory sequence.
15. The nucleic acid molecule of claim 14, wherein said
transcriptional or translational regulatory sequence comprise a
transcriptional promoter or enhancer.
16. An isolated vector comprising the nucleic acid molecule of
claim 1.
17. An isolated host cell comprising the nucleic acid molecule of
claim 1.
18. The isolated host cell of claim 17, wherein the host cell is a
mammalian cell.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 12/723,499, filed Mar. 12, 2010, now allowed,
which is a divisional of U.S. patent application Ser. No.
11/981,423, filed Oct. 30, 2007, now U.S. Pat. No. 7,709,217, which
is a continuation of U.S. patent application Ser. No. 10/202,699,
filed Jul. 23, 2002, now U.S. Pat. No. 7,288,633, which claims the
benefit of U.S. provisional application Ser. No. 60/307,345, filed
Jul. 23, 2001, the entire disclosure of which is relied upon and
incorporated by reference.
REFERENCE TO THE SEQUENCE LISTING
[0002] The present application is being filed along with a Sequence
Listing in electronic format. The Sequence Listing is provided as a
file entitled 3255-US-CNT2_ST25.txt, created May 31, 2011, which is
32 KB in size. The information in the electronic format of the
Sequence Listing is incorporated herein by reference in its
entirety.
FIELD OF THE INVENTION
[0003] The invention generally relates to recombinant protein
expression. More specifically, the invention relates to modified
human thymic stromal lymphopoietin (TSLP) polypeptides that are
resistant to degradation in mammalian cell culture, polynucleotides
sequences encoding modified TSLP polypeptides, and processes for
the production and use of modified TSLP.
BACKGROUND OF THE INVENTION
[0004] Thymic stromal lymphopoietin (TSLP) is a growth factor
integral to both B and T cell development and maturation. In
particular, murine TSLP supports B lymphopoieses and is required
for B cell proliferation. Murine TSLP is also critical in
controlling the rearrangement of the T cell receptor-gamma
(TCR.gamma.) locus, and has a substantial stimulatory effect on
thymocytes and mature T cells. See, for example, Friend et al.,
1994, Exp. Hematol., 22:321-328; Ray et al., 1996, Eur. J.
Immunol., 26:10-16; Candeias et al., 1997, Immunology Letters,
57:9-14.
[0005] TSLP possess cytokine activity similar to IL-7. For example,
TSLP can replace IL-7 in stimulating B cell proliferation responses
(Friend et al., supra). TSLP and IL-7 appear to mediate their
lymphopoietic effects via distinct mechanisms. For example, IL-7
activates Janus family tyrosine kinases, including JAK1 and JAK3,
and modulates the activity of the signal transducer and activator
of transcription 5 (STAT5) protein. While TSLP modulates the
activity of STAT5, it fails to activate any Janus family tyrosine
kinase members (Levin et. al., 1999, J. Immunol. 162:677-683).
Although TSLP and IL-7 mediate similar effects on target cells,
they also appear to have distinct signaling pathways and likely
some variation in their biologic response.
[0006] The known activities of TSLP in modulating the immune
system, particularly in stimulating B and T cell proliferation,
development, and maturation, makes this molecule an attractive
therapeutic tool. The ability to produce large quantities of the
active polypeptide is essential to commercial production of human
TSLP. Production of recombinant polypeptides in a mammalian cell
expression system is most commonly used for commercial human
therapeutic applications.
[0007] Recombinant huTSLP polypeptide has been expressed in a
number of different expression systems, including mammalian cell
lines, as described in WO 00/29581. However, production of useful
quantities of active huTSLP protein in mammalian cells has been
difficult. In particular, huTSLP expression in mammalian cells
often yields a degraded product. Alternative polynucleotide
molecules and methods to achieve production of useful quantities of
active huTSLP polypeptide are needed.
SUMMARY OF THE INVENTION
[0008] The amino acid sequence of human TSLP was found to contain a
unique sequence of amino acids containing a furin cleavage site.
Modifications of the polypeptide to inactivate the furin cleavage
site, according to the present invention, provides modified
protease resistant huTSLP polypeptides which are more stable when
expressed in mammalian cell systems as compared with the unmodified
TSLP polypeptides.
[0009] Modified, protease resistant human TSLP polypeptides of the
invention include those having one or more amino acid sequence
modifications that alters and inactivates the furin cleavage site
RRKRK, as shown in Table 1 below, positioned at approximately amino
acid residues 127-131 of SEQ ID NO: 4. Suitable modifications
include amino acid substitutions, deletions, additions, or
combinations of these, that alter the amino acid sequence RRKRK to
disrupt the furin cleavage site pattern RXXR, in particular those
that disrupt the pattern RX(R/K)R. Also included are polypeptides
which are substantially similar in amino acid sequence to the
modified huTSLP polypeptides, and fragments thereof, that retain at
least one activity of native TSLP and are protease resistant. In
one embodiment, the sequences RKRK or RKRKV have been deleted from
the amino acid sequence of the huTSLP polypeptides.
[0010] The invention also provides polynucleotide molecules
encoding the modified protease resistant huTSLP polypeptides
discussed above. Polynucleotide molecules of the invention include
those having an in-frame nucleic acid sequence modification that
disrupts or otherwise deactivates the codons that encode the furin
cleavage site RRKRK [SEQ ID NO: 6] positioned at amino acid
residues 127-131 of SEQ ID NO: 4. Suitable modifications of the
cleavage site includes in-frame nucleic acid substitutions,
deletions, additions, or combinations of these, that alter the
nucleic acid sequence that encodes RRKRK to disrupt the encoded
furin cleavage site pattern RXXR, particularly RX(R/K)R.
Embodiments include, for example, deletion mutants in which the
nucleotide sequence AGG AGA AAA AGG AAA [SEQ ID NO: 5] encoding
RRKRK, or the nucleotide sequence AGA AAA AGG AAA GTC [SEQ ID NO:
7] encoding an amino acid sequence RKRKV [SEQ ID NO: 8] have been
deleted. Also included are polynucleotide molecules having
sequences which are substantially similar to polynucleotide
molecules encoding the modified TSLP polypeptides, and fragments
thereof that retain at least one activity of native TSLP and are
protease resistant.
[0011] The invention also provides additional forms of modified
huTSLP polypeptides, including soluble forms and fusion proteins.
For example, the fusion proteins of the invention include modified
huTSLP polypeptides fused to heterologous proteins or peptides that
confer a desired function, such as to facilitate purification,
oligomerization, stability, secretion or identification of the
polypeptide. A fusion protein of the invention can be produced, for
example, from an expression construct containing a polynucleotide
molecule encoding modified protease resistant huTSLP polypeptide in
frame with a polynucleotide molecule encoding the heterologous
protein.
[0012] The invention also provides vectors, plasmids, expression
systems, host cells, and the like, containing a modified protease
resistant huTSLP polynucleotide molecule. Genetic engineering
methods for the production of modified huTSLP polypeptides of the
invention include expression of the polynucleotide molecules in
cell free systems, cellular hosts, in tissues, and in animal
models, according to known methods.
[0013] The invention further includes compositions containing a
substantially purified modified huTSLP polypeptide of the invention
and an acceptable carrier. Preferred are pharmaceutical
compositions adapted for administration to cells, tissues, or
patients, that are useful to induce the activities of B cells and T
cells in therapeutic treatment, for example, of immune deficiency
disorders, viral infections, and bacterial infections.
[0014] These and various other features and advantages of the
invention will be apparent from a reading of the following detailed
description and a review of the appended claims.
BRIEF DESCRIPTION OF THE SEQUENCES
[0015] SEQ ID NO: 1 is a polynucleotide sequence encoding a murine
TSLP (GenBank AF232937)
[0016] SEQ ID NO: 2 is the amino acid sequence of murine TSLP
encoded by SEQ ID NO:1.
[0017] SEQ ID NO: 3 is a polynucleotide sequence encoding a human
TSLP (GenBank AY037115)
[0018] SEQ ID NO: 4 is the amino acid sequence of a human TSLP
encoded by SEQ ID NO:3.
[0019] SEQ ID NO: 5 is a polynucleotide sequence AGG AGA AAA AGG
AAA, encoding a furin cleavage site RRKRK.
[0020] SEQ ID NO: 6 is the amino acid sequence RRKRK encoded by SEQ
ID NO: 5.
[0021] SEQ ID NO: 7 is a polynucleotide sequence AGA AAA AGG AAA
GTC, encoding an amino acid sequence RKRKV present in human TSLP
but not murine TSLP.
[0022] SEQ ID NO: 8 is the amino acid sequence RKRKV encoded by SEQ
ID NO: 7.
[0023] SEQ ID NO: 9 is a polynucleotide sequence encoding a
modified human TSLP having one or more in-frame modifications to
the sequence AGG AGA AAA AGG AAA that encodes the furin cleavage
site RRKRK, resulting in deactivation of the encoded furin cleavage
site.
[0024] SEQ ID NO: 10 is the amino acid sequence of the modified
TSLP encoded by SEQ ID NO: 9.
[0025] SEQ ID NO: 11 is a polynucleotide sequence encoding a
modified TSLP polypeptide having codons AGA AAA AGG AAA encoding
amino acids RKRK deleted.
[0026] SEQ ID NO: 12 is the amino acid sequence of the modified
TSLP polypeptide encoded by SEQ ID NO: 11.
[0027] SEQ ID NO: 13 is a polynucleotide sequence encoding a
modified TSLP polypeptide having codons AGG AGA AAA AGG AAA
encoding amino acids RRKRK deleted.
[0028] SEQ ID NO: 14 is the amino acid sequence of the modified
TSLP polypeptide encoded by SEQ ID NO: 13.
[0029] SEQ ID NO: 15 is a polynucleotide sequence encoding a
modified TSLP polypeptide having codons AGA AAA AGG AAA GTC
encoding amino acids RKRKV deleted.
[0030] SEQ ID NO: 16 is the amino acid sequence of the modified
TSLP polypeptide encoded by SEQ ID NO: 15.
[0031] SEQ ID NO: 17 is a modified human TSLP polypeptide.
[0032] SEQ ID NO: 18 is a modified human TSLP polypeptide.
[0033] SEQ ID NO: 19 is a PCR forward primer.
[0034] SEQ ID NO: 20 is a PCR forward primer.
[0035] SEQ ID NO: 21 is a PCR reverse primer.
[0036] SEQ ID NO: 22 is a PCR reverse primer.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0037] The following definitions are provided to facilitate
understanding of certain terms used frequently herein and are not
meant to limit the scope of the present disclosure.
[0038] "Amino acid" refers to any of the twenty standard
.alpha.-amino acids as well as any naturally occurring and
synthetic derivatives. Modifications to amino acids or amino acid
sequences can occur during natural processes such as
post-translational processing, or can include known chemical
modifications. Modifications include, but are not limited to:
phosphorylation, ubiquitination, acetylation, amidation,
glycosylation, covalent attachment of flavin, ADP-ribosylation,
cross linking, iodination, methylation, and the like.
[0039] As used herein the term "antibody" refers to intact
antibodies including polyclonal antibodies (see, for example
Antibodies: A Laboratory Manual, Harlow and Lane (eds), Cold Spring
Harbor Press, (1988)), and monoclonal antibodies (see, for example,
U.S. Pat. Nos. RE 32,011, 4,902,614, 4,543,439, and 4,411,993, and
Monoclonal Antibodies: A New Dimension in Biological Analysis,
Plenum Press, Kennett, McKearn and Bechtol (eds.) (1980)). The term
"antibody" also refers to a fragment of an antibody such as F(ab),
F(ab'), F(ab').sub.2, Fv, Fc, and single chain antibodies which are
produced by recombinant DNA techniques or by enzymatic or chemical
cleavage of intact antibodies. The term "antibody" also refers to
bispecific or bifunctional antibodies, which are an artificial
hybrid antibody having two different heavy/light chain pairs and
two different binding sites. Bispecific antibodies can be produced
by a variety of methods including fusion of hybridomas or linking
of Fab' fragments. (See Songsivilai et al, Clin. Exp. Immunol.
79:315-321 (1990), Kostelny et al., J. Immunol. 148:1547-1553
(1992)). As used herein the term "antibody" also refers to chimeric
antibodies, that is, antibodies having a human constant antibody
immunoglobin domain is coupled to one or more non-human variable
antibody immunoglobin domain, or fragments thereof (see, for
example, U.S. Pat. Nos. 5,595,898 and 5,693,493). Antibodies also
refers to "humanized" antibodies (see, for example, U.S. Pat. No.
4,816,567 and WO 94/10332), minibodies (WO 94/09817), and
antibodies produced by transgenic animals, in which a transgenic
animal containing a proportion of the human antibody producing
genes but deficient in the production of endogenous antibodies are
capable of producing human antibodies (see, for example, Mendez et
al., Nature Genetics 15:146-156 (1997), and U.S. Pat. No.
6,300,129). The term "antibodies" also includes multimeric
antibodies, or a higher order complex of proteins such as
heterdimeric antibodies. "Antibodies" also includes anti-idiotypic
antibodies including anti-idiotypic antibodies against an antibody
targeted to the tumor antigen gp72; an antibody against the
ganglioside GD3; or an antibody against the ganglioside GD2.
[0040] "Fc" or "Fc polypeptide" refers to polypeptides containing
the Fc domain of an antibody. The "Fc domain" refers to the portion
of the antibody that is responsible for binding to antibody
receptors on cells. An Fc domain can contain one, two or all of the
following: the constant heavy 1 domain (C.sub.H1), the constant
heavy 2 domain (C.sub.H2), the constant heavy 3 domain (C.sub.H3),
and the hinge region. The Fc domain of the human IgG1, for example,
contains the C.sub.H2 domain, and the C.sub.H3 domain and hinge
region, but not the CHI domain. Truncated forms of such
polypeptides containing the hinge region that promotes dimerization
are also included. See, for example, C. A. Hasemann and J. Donald
Capra, Immunoglobins: Structure and Function, in William E. Paul,
ed.
[0041] "Antisense" refers to polynucleotide sequences that are
complementary to target "sense" polynucleotide sequence.
[0042] "Cell targeting moiety" refers to any signal on a
polypeptide, either naturally occurring or genetically engineered,
used to target a polypeptide to a cell, polypeptide,
polynucleotide, or innate material.
[0043] "Complementary" or "complementarity" refers to the ability
of a polynucleotide in a polynucleotide molecule to form a base
pair with another polynucleotide in a second polynucleotide
molecule. For example, the sequence A-G-T is complementary to the
sequence T-C-A. Complementarity can be partial, in which only some
of the polynucleotides match according to base pairing, or
complete, where all the polynucleotides match according to base
pairing.
[0044] As used herein, the term "derivative" refers to a modified
resistant TSLP polypeptides attached to at least one additional
chemical moiety, or to at least one additional polypeptide to form
covalent or aggregate conjugate such as glycosyl groups, lipids,
phosphate, acetyl groups, or C-terminal or N-terminal fusion
proteins and the like.
[0045] "Expression" refers to transcription and translation
occurring within a host cell. The level of expression of a DNA
molecule in a host cell can be determined on the basis of either
the amount of corresponding mRNA that is present within the cell or
the amount of DNA molecule encoded protein produced by the host
cell (Sambrook et al., 1989, Molecular cloning: A Laboratory
Manual, 18.1-18.88).
[0046] As used herein, the term "furin cleavage site" refers to an
amino acid sequence recognized and cleaved by furin. In human TSLP,
for example, a furin cleavage site has been identified within the
sequence RRKRK. In general, the minimal cleavage site for furin is
RXXR and more preferably, RX(R/K)R. (Nakayama 1997, Biochem J
327:625-35). The term "furin" refers to a calcium dependent serine
protease is involved in the processing of a variety of proteins.
Furin is known to cleave various proproteins, such as growth factor
precursors, into biologically active proteins. Furin mRNA has been
detected in all tissues and cell lines examined, suggesting that
its activity is ubiquitous and not focused on any particular target
group of proteins. Examples of preproteins cleaved by furin include
various growth factors, growth factor receptors, plasma proteins
involved in blood-clotting and complement cascades, matrix
metalloproteinases, viral-envelope glycoproteins, and bacterial
exotoxins.
[0047] As used herein, the term "modified TSLP polypeptides" or
"modified huTSLP polypeptides" is used interchangeably with "furin
resistant TSLP" or "protease resistant TSLP" and refers to any
huTSLP polypeptide that has been modified to inactivate the furin
cleavage site RXXR, and that also retains a TSLP activity, such as
stimulation of B or T cell proliferation or development, or binding
to TSLP receptors, as described, for example, in WO 00/29581, or in
the Examples below. The term "modified TSLP polypeptides" also
includes variants and fragments such as the extracellular domain,
as well as derivatives such as fusion proteins.
[0048] "Fusion protein" refers to a protein having a heterologous
polypeptide attached via recombinant DNA techniques. The fused
heterologous polypeptide can provide a specific function, for
example, to determine the location of the fusion protein in a cell,
enhance the stability of the fusion protein, facilitate
purification of the fusion protein, or target the protein to a
desired antigen or cell. Examples of such fusion proteins include
polypeptides fused to a portion of an immunoglobulin molecule, for
example, an Fc fragment, polypeptides fused to a histidine tag, a
growth factor, and the like, as described, in WO 00/29581.
[0049] "Genetically engineered" refers to any recombinant method
used to create a eukaryotic host cell that expresses a protein of
interest. Methods and vectors for genetically engineering host
cells are well known; for example, various techniques are
illustrated in Current Protocols in Molecular Biology, Ausubel et
al., eds. (Wiley & Sons, New York, 1988, and quarterly
updates). Genetic engineering techniques include, but are not
limited to, expression vectors, targeted homologous recombination
and gene activation (see, for example, U.S. Pat. No. 5,272,071 to
Chappel) and transactivation by engineered transcription factors
(see, for example, Segal et al., 1999, Proc Natl Acad Sci USA
96(6):2758-63).
[0050] "Homology" refers to a degree of complementarity between
polynucleotides, where the degree of complementarity between
polynucleotide molecules has significant effects on the efficiency
and strength of hybridization between the polynucleotide
molecules.
[0051] "Host cell" or "host cells" refers to cells established in
ex vivo culture. It is a characteristic of host cells discussed in
the present disclosure that they be capable of expressing furin
resistant TSLP, as defined herein. Examples of suitable host cells
useful for aspects of the present invention include, but are not
limited to, mammalian cell lines. Specific examples of such cell
lines include human embryonic kidney cells (293 cells), Chinese
hamster ovary (CHO) cells (Puck et al., 1958, Proc. Natl. Acad.
Sci. USA 60, 1275-1281), human cervical carcinoma cells (HELA)
(ATCC CCL 2), human liver cells (Hep G2) (ATCC HB8065), human
breast cancer cells (MCF-7) (ATCC HTB22), human colon carcinoma
cells (DLD-1) (ATCC CCL 221), Daudi cells (ATCC CRL-213), COS
cells, and CV-1 cells.
[0052] "Hybridization" refers to the pairing of complementary
polynucleotides during an annealing period. The strength of
hybridization between two polynucleotide molecules is impacted by
the homology between the two molecules, stringency of the
conditions involved, the melting temperature of the formed hybrid,
and the G:C ratio within the polynucleotides.
[0053] "Inactivated" refers an activity that has been rendered
nonfunctional. For example, a furin cleavage site in a polypeptide
can be inactivated by modifying the amino acid sequence. Cleavage
of the modified polypeptide in the presence of furin is reduced,
and preferably is eliminated, as compared with the wild type
polypeptide. Reduced or eliminated cleavage is demonstrated, for
example, by a change in the cleavage products as compared to the
cleavage products of the wild type.
[0054] "Isolated" refers to a polynucleotide or polypeptide that
has been separated from at least one contaminant (polynucleotide or
polypeptide) with which it is normally associated. For example, an
isolated polynucleotide is in a context or in a form that is
different from that in which it is found in nature.
[0055] As used herein, the term "huTSLP polypeptide" refers to a
human TSLP polypeptide having the amino acid sequence set forth in
SEQ ID NO: 4, or a variant or fragment of that polypeptide that
retains at least one activity of a TSLP having SEQ ID NO: 4. A
variant is a polypeptide which has an amino acid sequence that is
substantially similar to the amino acid sequence of the unaltered
protein, or a fragment thereof. For the purposes of the present
invention, "substantially similar" to is at least about 80%
identical to, preferably at least about 90% identical to, more
preferably at least about 95%, more preferably at least about 98%,
most preferably at least about 99% identical to the amino acid
sequence of the unaltered protein, and which retains the activity
of the unaltered polypeptide. Amino acid substitutions which are
conservative substitutions unlikely to affect biological activity
are considered identical for the purposes of this invention and
include the following: Ala for Ser, Val for Ile, Asp for Glu, Thr
for Ser, Ala for Gly, Ala for Thr, Ser for Asn, Ala for Val, Ser
for Gly, Tyr for Phe, Ala for Pro, Lys for Arg, Asp for Asn, Leu
for Ile, Leu for Val, Ala for Glu, Asp for Gly, and the reverse.
(See, for example, Neurath et al., The Proteins, Academic Press,
New York (1979)).
[0056] The percent identity may be determined by visual inspection
and mathematical calculation, or by a comparison of two sequences
using various computer programs used by those of skill in the art.
For example, the percent identity of two sequences can be
determined using the GAP computer program, based on the algorithm
of Smith and Waterman, Adv. Appl. Math. 2:482-489 (1981),
(available from the University of Wisconsin Genetics Computer Group
(UWGCG), University Research Park, Madison, Wis.). The preferred
default parameters for the GAP program include: (1) a scoring
matrix, blosum62, as described by Henikoff and Henikoff Proc. Natl.
Acad. Sci USA 89:10915 (1992)); a gap weight of 12; (3) a gap
length weight of 4; and (4) no penalty for end gaps. Other programs
used by those skilled in the art of sequence comparison may also be
used.
[0057] "Polynucleotide" refers to a sequence of nucleotides. The
nucleotides are either a sequence of polyribonucleotides or
polydeoxyribonucleotides, or a mixture of both. Examples of
polynucleotides in the context of the present invention include
single and double stranded DNA, single and double stranded RNA, and
hybrid molecules that have both mixtures of single and double
stranded DNA and RNA. Further, the polynucleotides of the present
invention can include one or more modified nucleotide.
[0058] As used herein the term "protein" and "polypeptide" are used
interchangeably and is considered to be any chain of at least ten
amino acids linked by peptide bonds. Purification of a protein from
contaminating proteins can be accomplished through any number of
known techniques, including, ammonium sulfate or ethanol
precipitation, anion or cation exchange chromatography,
phosphocellulose chromatography, hydrophobic interaction
chromatography, affinity chromatography, hydroxylapatite
chromatography, and lectin chromatography. Various protein
purification techniques are illustrated in Current Protocols in
Molecular Biology, Ausubel et al., eds. (Wiley & Sons, New
York, 1988, and quarterly updates).
[0059] "STAT5" refers to a member of the signal transducers and
activators of transcription (STAT) family of transcription factors
known to be activated by one or more JAK kinase, translocate to the
nucleus, and participate in transcriptional regulation by binding
to specific DNA sites. Techniques for determining STAT5 activity
include DNA binding assays, STAT5 dependent reporter assays,
.sup.32P-labeling of STAT5, and the like, as illustrated in Current
Protocols in Molecular Biology, Ausubel et al., eds. (Wiley &
Sons, New York, 1988, and quarterly updates).
[0060] "Thymic stromal lymphopoietin" (TSLP) refers to a growth
factor that stimulates the process of hematolymphoid development,
as described, for example, in WO 00/29581, and Sims et al., 2000,
J. Exp. Med. 192:671-680.
[0061] "Vector," "extra-chromosomal vector", or "expression vector"
refers to a first polynucleotide molecule, usually double-stranded,
which can have inserted into it a second polynucleotide molecule,
for example a heterologous polynucleotide, such as a polynucleotide
encoding furin resistant human TSLP. A heterologous polynucleotide
may or may not be naturally found in the host cell, and can be one
or more additional copy of a nucleic acid sequence naturally
present in the host genome. The vector transports the foreign
polynucleotide into a suitable host cell. Once in the host cell,
the vector can be capable of integrating into the host cell
chromosomes. The vector can also contain the necessary elements to
select cells containing the integrated polynucleotide, as well as
elements to promote transcription of mRNA from the transfected
polynucleotide. Examples of vectors within the scope of the present
invention include, but are not limited to, plasmids,
bacteriophages, cosmids, retroviruses, and artificial
chromosomes.
[0062] Unless otherwise stated, the techniques utilized can be
found in any of several well-known references, such as: Molecular
Cloning: A Laboratory Manual (Sambrook et al. (1989) Molecular
cloning: A Laboratory Manual), Gene Expression Technology (Methods
in Enzymology, Vol. 185, edited by D. Goeddel (1991) Academic
Press, San Diego, Calif.), "Guide to Protein Purification" in
Methods in Enzymology (M. P. Deutshcer, 3d., (1990) Academic Press,
Inc.), PCR Protocols: A Guide to Methods and Applications (Innis et
al. (1990) Academic Press, San Diego, Calif.), Culture of Animal
Cells: A Manual of Basic Technique, 2.sup.nd ed. (R. I. Freshney
(1987) Liss, Inc., New York, N.Y.), and Gene Transfer and
Expression Protocols, pp 109-128, ed. E. J. Murray, The Humana
Press Inc., Clifton, N.J.).
TSLP Polypeptides
[0063] Thymic stromal lymphopoietin (TSLP) is a growth factor, a
member of the cytokine family of lymphopoietic signaling factors
that is integral to both B and T cell development and maturation.
TSLP promotes B cell lymphopoiesis to the B220.sup.+/IgM.sup.+
immature B cell stage and induces the proliferation of the
factor-dependent cell line NAG8/7. TSLP is involved in controlling
the rearrangement of the T cell receptor-gamma (TCR.gamma.) locus,
and has a substantial stimulatory effect on thymocytes and mature T
cells.
[0064] The biological activities of TSLP on B and T cells partially
overlap with the activities of the cytokine, IL-7. For example,
both TSLP and IL-7 co-stimulate thymocytes and mature T cells,
sustain the NAG8/7 cell line, and support B lymphopoiesis in fetal
liver cells. These overlapping functions likely result from the
common use by the TSLP and IL-7 receptor complexes of the IL-7R
alpha-chain. (Park et al., 2000, J. Experimental Medicine,
192(5):659-669; Levin et al., 1999, J. Immunol., 162(2): 677-83;
Isaksen et al., 1999, J. Immunol, 163(11):5971-7). Blockage of the
IL-7 receptor will likely block the activities of both IL-7 and
TSLP.
[0065] IL-7, together with IL-15, is important for the development
and function of immune cells, B and T cells. IL-7 aids the
development of CD4 and CD8 T cells as well as for the proliferation
and survival of naive and memory CD4 T cells. IL-15 is important
for the development of natural killer (NK) cells, and is involved
in the development of memory CD8 cells but not memory CD4
cells.
[0066] Using an IL-15 knockout mouse model and an antibody directed
against the IL-7 receptor alpha chain, it was determined that IL-7
but not IL-15 is required for the proliferation of naive CD8 T
cells, including OTI TgT cells and polyclonal CD 44 lo. Acute
homeostasis driven proliferation (HDP) of memory CD8 T cells (OTI
or polyclonal CD44 hi) is delayed in IL-15 KO mice and by treatment
of wild type mice with anti-IL-7 receptor monoclonal antibody. In
the absence of IL-15 and inhibition of IL-7 receptor function,
memory T cell proliferation is almost completely inhibited. Basal
homeostatic proliferation of CD8 memory T cells is blocked in IL-15
KO mice. Treatment with anti-IL-7 receptor monoclonal antibody
delayed proliferation in wild type mice. In the absence of IL-15
and under inhibition of IL-7 receptor function, survival of the T
cells is affected. These results indicate that IL-7 and IL-15 are
essential for the proliferation and survival of CD8 memory T cells.
Because TSLP and IL-7 share overlapping functional activities on T
cells via the IL-7 receptor, it is anticipated that TSLP also
functions to promote the proliferation and survival of CD8 memory T
cells. The memory T cell data indicates that TSLP is useful for
obtaining long term immunity, and thus can be used as a vaccine
adjuvant.
[0067] More particularly, TSLP supports the proliferation and
differentiation of committed B220.sup.+ B cell progenitors in vitro
(Ray, et al., 1996, Eur. J. Immunol. 1996, 26:10-16). Cells
incubated in the presence of either IL-7 or TSLP express cell
surface markers characteristic of the pro-B cell stage of B cell
differentiation. TSLP can replace IL-7 during the first 4-6 days of
in vitro culture to support the progression of B cell progenitors
from uncommitted bipotential precursors. TSLP can also substitute
for IL-7 in supporting the sustained proliferative response
exhibited by B cell progenitors from CBA/N mice. TSLP supports the
expansion of B220.sup.+ pre-B cells from either fetal liver or bone
marrow for several days in vitro. TSLP also facilitates
proliferation and differentiation of pre-B cells isolated from bone
marrow up until the stage of becoming mitogen responsive in the
presence of the stromal cell line S17.
[0068] TSLP facilitates the expansion and differentiation of B cell
progenitors in vitro, and can replace IL-7 in supporting the
development of B cells from B220.sup.+ precursors as well as
uncommitted bipotential progenitors in vitro. Techniques for
stimulating B lineage and T lineage cell proliferation are well
known (Ray et al., 1996 supra; Namikawa et al., 1996, Blood
87(5):1881-1890), as are techniques for expanding hematopoietic
cells from sources such as umbilical cord blood and bone marrow (W.
Piacibello, et al., 1997, Blood, 89(8):2644-2653). TSLP, alone or
in combination with other cytokines, such as IL-7, can be used to
control and amplify pluripotent stem cell renewal and expansion for
cord blood or bone marrow transplantation.
[0069] Recombinant IL-7 has been used to reconstitute a patient's
immune system following autologous bone marrow transplantation
(Abdul-Hai et al., 1996, Experimental Hematology 24:1416-1422).
IL-7 induces proliferation and differentiation of pre-B cells and
immature thymocytes. TSLP induces similar proliferative effects on
pre-B cells. Therefore, TSLP, alone or in combination with other
cytokines or growth factors such as IL-7, can be used to stimulate
hematopoietic cell proliferation and differentiation.
[0070] TSLP induces tyrosine phosphorylation of both isoforms of
STAT5 (STAT5a and STAT5b), resulting in STAT5-DNA complex formation
and transcription of the STAT5-responsive gene CIS, a feedback
modulator of STAT5 (Levin et al., supra; Isaksen et al., supra).
STAT5 has been extensively studied in STAT5-deficient mice. One or
both forms of STAT5 plays a role in modulating the immune system,
hematopoiesis, sexually dimorphic growth, mammary development, hair
growth, deposition of adipose tissue, and pregnancy (Davey, et al.,
1999, Am. J. Hum. Genet. 65:959-965). Many cases of freshly
isolated human lymphoid leukemic cells have been shown to exhibit
constitutive activation of STAT5 (Nosaka, et al. 1999, The EMBO
Journal 18(17):4754-4765).
[0071] As one example of a STAT5 regulated activity, STAT5a and
STAT5b are required for normal mammary gland growth and
differentiation (Richer et al., 1998, J. Biol. Chem.
273(47):31317-31326). STAT5a-deficient mice lack proliferative
mammary lobulo-alveolar outgrowth, and the females are unable to
lactate. STAT5b-deficient female mice have impaired mammary gland
development.
[0072] TSLP appears to be a central actor in B and T cell
development. TSLP proteins are useful in therapies and treatments
targeted at stimulating the proliferation and maturation of B
and/or T cells, for example in the treatment immune disorders, such
as AIDS. Inhibition of TSLP expression, for example by an anti-TSLP
antibody, or engagement of the TSLP receptor with a non-active TSLP
fragment or inhibitory analog of TSLP, can inhibit B and T cell
development and proliferation, and therapeutically useful, for
example, in the treatment of autoimmune disease or in preventing
rejection of organ transplant.
[0073] Human TSLP polypeptides are described in WO 00/29581. The
amino acid sequence of one preferred embodiment of the full length
human TSLP is given in SEQ ID NO: 4. Computer analysis predicts
that the mature polypeptide sequence corresponds to amino acids 29
to 159 of SEQ ID NO: 4, while the signal peptide is thought to
correspond to amino acids 1 through 28 of SEQ ID NO: 4, or
alternatively amino acids 1 through 34 or 1 through 116. The huTSLP
polypeptides may be membrane bound or soluble, secreted
polypeptides. In one embodiment, the soluble polypeptide may
include all or part of the extracellular domain, but lack the
transmembrane region, which would cause retention of the
polypeptide on a cell membrane. Human TSLP polypeptides include
variants of the polypeptide encoded by SEQ ID NO:4 having at least
80% identity in amino acid sequence to SEQ ID NO:4 and retaining at
least one TSLP function, as well as fragments thereof retaining a
TSLP function.
Protease Resistance
[0074] The nucleic acid sequences encoding murine TSLP (GenBank
accession number AF232937) and human TSLP (GenBank accession number
AY037115) were disclosed in PCT application WO 00/29581. As
described more fully in the Examples below, expression of human
TSLP cDNA in mammalian cells often yields a degraded product.
[0075] In contrast to human TSLP, murine TSLP was not degraded when
expressed in mammalian cells. The nucleic acid and amino acid
sequences of human and murine TSLP were compared, and significant
differences were found. In particular, the human nucleic acid
sequence encodes a unique stretch of amino acids, 127-RRKRV-132,
not present in the murine protein. Further analysis suggested that
this unique stretch of amino acids contained a furin cleavage site,
127-RRKRK-131.
[0076] As more fully described in the Examples below, human TSLP
protein overexpressed and isolated from mammalian cell cultures,
when analyzed, for example, by electrophoresis, contains a number
of polypeptides, shown as numerous bands on a gel. A prominent band
in the mixture of proteins has a molecular weight of approximately
6 kD. The amino acid sequence of the 6 kD fragment corresponded to
the C-terminal end of TSLP, suggesting a cleavage point at the
furin cleavage site, RRKRK. This data provides direct evidence that
degradation of human TSLP expressed in mammalian cells resulted
from cleavage at the furin cleavage site.
[0077] The furin cleavage site is located about 8 residues before
the start of a fourth helix of a four-helix bundle in the amino
acid sequence of huTSLP thought to be required for activity.
Truncation of huTSLP at this furin cleavage site produces a
three-helix bundle cytokine, and also removes the last of the
conserved cysteine residues shared between mouse and huTSLP that is
thought to be involved in intramolecular disulfide bond formation.
Accordingly, cleavage of huTSLP at the furin cleavage site is
thought to remove a portion of the molecule that is required for
biological activity.
[0078] In the present invention, a furin cleavage site in huTSLP
has been identified, and modified to prevent furin cleavage of
huTSLP. According to the invention, one or more of the codons
encoding the furin cleavage site, RRKRK, is altered, for example,
by site-directed mutagenesis, to prevent recognition of the
cleavage site by furin. Preferably, one or more codons are altered
to disrupt the cleavage site. Since the minimal furin recognition
site is RXXR, any modification that disrupts the RXXR pattern in
huTSLP is within the scope of the present invention.
Modified Human TSLP Polypeptides
[0079] Modified human TSLP polypeptides of the present invention
includes polypeptides having the human TSLP amino acid sequence set
forth in SEQ ID NO: 4, modified to deactivate the furin cleavage
site RRKRK [SEQ ID NO: 6], as well as variants having an amino acid
sequence that is substantially similar to the amino acid sequence
of SEQ ID NO: 4, or fragments thereof, that are both resistant to
furin cleavage and retain a functional activity of human TSLP.
[0080] For the purposes of the present invention, the term
"substantially similar" refers to least about 80% identical to,
preferably at least about 90% identical to, more preferably at
least about 95% identical to, more preferably at least about 98%
identical to, most preferably at least about 99% identical to the
amino acid sequence of the unaltered protein, and which retain at
least some degree of at least one activity of the unaltered
polypeptide. Amino acid substitutions which are conservative
substitutions unlikely to affect biological activity are considered
identical for the purposes of this invention and include the
following: Ala for Ser, Val for Ile, Asp for Glu, Thr for Ser, Ala
for Gly, Ala for Thr, Ser for Asn, Ala for Val, Ser for Gly, Tyr
for Phe, Ala for Pro, Lys for Arg, Asp for Asn, Leu for Ile, Leu
for Val, Ala for Glu, Asp for Gly, and the reverse. (See, for
example, Neurath et al., The Proteins, Academic Press, New York
(1979)). Further information regarding phenotypically silent amino
acid exchanges can be found in Bowie et al., 1999, Science
247:1306-1310).
[0081] Modifications suitable for inactivating the furin cleavage
site includes amino acid substitutions, deletions, additions, or
combinations of these, that alter the amino acid sequence RRKRK to
disrupt the furin cleavage site pattern RXXR, particularly
disrupting the pattern RX(R/K)R, (wherein R refers to arginine, K
refers to lysine, and X refers to any amino acid). In one
embodiment the sequence RKRK or RKRKV has been deleted in the
modified TSLP polypeptides of the present invention.
[0082] Preferably, at least two amino acids within the furin
cleavage site are altered to remove dibasic amino acids arginine or
lysine that can be recognized by furin. For example, the
modification can result in substitution of one or more dibasic
amino acids with one or more neutral amino acid. The dibasic amino
acids can also be deleted, or an insertion can be made within the
127-131 amino acid region of SEQ ID NO: 4 to disrupt the cleavage
site.
[0083] In one embodiment, the modified TSLP polypeptides of the
invention include deletions of one or more, preferably two or more
of the amino acid residues 127-RRKRK-131 of SEQ ID NO: 4 to disrupt
the RXXR furin cleavage pattern. For example, deletion of one
arginine (R) results in the disrupted sequence RKRK or RRKK;
deletion of two arginines results in the disrupted sequence KRK or
RKK; deletion of three arginines results in the disrupted sequence
KK. Modified TSLP polypeptides also include deletions of four or
all five basic amino acids, for example, deleting RKRK, RRKR, or
RRKRK in the amino acid positions 128-RKRK-131 or 128-RKRKV-132 of
SEQ ID NO: 4.
[0084] In an alternative embodiment, the modified human TSLP
polypeptides of the invention include amino acid substitutions in
the human TSLP amino acid sequence, wherein one or more, and
preferably two or more of the amino acid residues 127-RRKRK-131 are
substituted with a different amino acid residue, disrupting the
RXXR pattern. Preferably, one or more arginine and/or lysine is
substituted with a non-basic, more preferably a neutral amino acid.
By way of example, substitution of one arginine (R) results in the
disrupted sequence RXKRK or RRKXK; substitution of two arginines
results in the disrupted sequence XXKRK or XRKXK; substitution of
three arginines results in the disrupted sequence XXKXK. Preferred
is the substitution of all fix basic amino acids resulting in the
sequence XXXXX, wherein X is a non-basic amino acid, preferably a
neutral amino acid.
[0085] The modified huTSLP polypeptides of the invention also
include amino acid additions to the huTSLP amino acid sequence
where one or more amino acid residues are inserted into the furin
cleavage sequence 127-RRKRK-131, disrupting the RXXR pattern.
[0086] For example, two or more amino acids can be inserted, such
as in the sequence 127-RRZ.sub.nKRK-131 where Z is not R or K, and
n is not 1; one or more, and preferably two or more amino acids can
be inserted between arinines, or the sequence 127-RZ.sub.nRKRK-131,
where Z is not R or K, and n is not 2; and the like. Preferably, n
is 3, 4, or 5, and Z is a neutral amino acid.
TABLE-US-00001 Exemplary Modified Human TSLP Polypeptides FURIN
SITE RXXR Native (SEQ ID NO: 4) ##STR00001## Modified* (SEQ ID NO:
10) ##STR00002## Deletion 1 (SEQ ID NO: 12) ##STR00003## Deletion 2
(SEQ ID NO: 14) ##STR00004## Deletion 3 (SEQ ID NO: 16)
##STR00005## Substitution* (SEQ ID NO: 17) ##STR00006## Addition**
(SEQ ID NO: 18) ##STR00007##
[0087] X (*) can designate an amino acid substitution, deletion,
insertion, or combination of these that disrupts the activity of
the furin cleavage site.
[0088] In one exemplary embodiment, for example, set forth in SEQ
ID NO:10, all of the amino acids designated by X are modified to be
any amino acid, preferably a neutral amino acid, other than R or K.
In another embodiment, one or more, and preferably two or more of X
is an amino acid deletion, most preferably two or more arginine (R)
residues are deleted, and most preferably each X represents a
deleted amino acid. In another embodiment, one or more, and
preferably two or more of X is an amino acid substitution that is
not K or R and is preferably neutral amino acid. In this
embodiment, XXXXX can be, for example, XRXRX, XRXRK, RXRXX, or
RXRXK.
[0089] As set forth in SEQ ID NO: 18, Z(**) can be any amino acid
that is not R or K, and preferably is a neutral amino acid. As
discussed above, n can be any number that disrupts the RXXR
pattern, for example, n can be 1 or greater, and preferably is 3,
4, or 5. Other exemplary methods for deactivating the furan
cleavage site pattern RXXR and particularly RXR/KR will be apparent
and are encompassed in the invention.
[0090] Examples of modified huTSLP polypeptides presented above
include polypeptides having the amino acid sequences set forth in
SEQ ID NO: 10, 12, 14, 16, 17, or 18, as well as polypeptides
having an amino acid sequence which is substantially similar to
these sequences, that is, having at least 80% identity to these
amino acid sequences, and retaining resistance to furin cleavage as
well as having at least one TSLP activity. Human TSLP polypeptide
activity can be readily determined, for example, by subjecting a
variant, derivative, or fragment of a human TSLP polypeptide to the
BAF/HRT bioassay described in Example 3 below, or using the NAG8/7
cell proliferation assays as described by Friend et al., supra, or
to STAT5 activation assays as described by Levin et al., supra.
[0091] The modified huTSLP polypeptides may be membrane bound or
soluble, secreted polypeptides. In one embodiment, the soluble
modified polypeptide may include all or part of the extracellular
domain, but lack the transmembrane region, which would cause
retention of the polypeptide on a cell membrane. Human TSLP
polypeptides include variants of the polypeptide encoded by SEQ ID
NO:4 having at least 80% identity in amino acid sequence to SEQ ID
NO:4 and retaining at least one TSLP function, as well as fragments
thereof such as the soluble domain retaining a TSLP function.
[0092] Useful derivatives of the modified polypeptides of the
invention include, for example, modified human TSLP polypeptides
attached to at least one additional chemical moiety, or to at least
one additional heterologous polypeptide to form covalent or
aggregate conjugate such as glycosyl groups, lipids, phosphate,
acetyl groups, or C-terminal or N-terminal fusion proteins and the
like. Preferred heterologous polypeptides include those that
facilitate purification, stability, cellular or tissue targeting,
or secretion of the modified human TSLP, such as fusion proteins
with the Fc polypeptide.
[0093] Modifications of the amino acid sequence of human TSLP
polypeptides can be accomplished by any of a number of known
techniques. For example, mutations can be introduced at particular
locations by known procedures such as oligonucleotide-directed
mutagenesis (Walder et al., 1986, Gene, 42:133; Bauer et al., 1985,
Gene 37:73; Craik, 1985, BioTechniques, 12-19; Smith et al., 1981,
Genetic Engineering: Principles and Methods, Plenum Press; and U.S.
Pat. Nos. 4,518,584 and 4,737,462).
[0094] The modified human TSLP polypeptides of the present
invention are preferably provided in an isolated form, and
preferably are substantially purified. The polypeptides can be
recovered and purified from recombinant cell cultures by known
methods, including ammonium sulfate or ethanol precipitation, anion
or cation exchange chromatography, phosphocellulose chromatography,
hydrophobic interaction chromatography, affinity chromatography,
hydroxylapatite chromatography, and lectin chromatography. In a
preferred embodiment, high performance liquid chromatography (HPLC)
is employed for purification.
[0095] Modified human TSLP can be fused to heterologous regions
used to facilitate purification of the polypeptide. Many of the
available peptides (peptide tags) allow selective binding of the
fusion protein to a binding partner. Non-limiting examples of
peptide tags include 6-His, thioredoxin, hemaglutinin, GST, and the
OmpA signal sequence tag. A binding partner that recognizes and
binds to the peptide can be any molecule or compound including
metal ions (for example, metal affinity columns), antibodies,
antibody fragments, and any protein or peptide, which binds the
heterologous peptide to permit purification of the fusion
protein.
[0096] Fragments spanning a modified furin cleavage site, including
a fragment where the furin cleavage site has been deleted, can be
used to generate specific antibodies against modified huTSLP
polypeptides. The fragments should be short, between 5 and 20 amino
acids, and preferably between 5 and 10 amino acids. Using known
selection techniques, specific epitopes can be selected and used to
generate monoclonal or polyclonal antibodies. Such antibodies have
utility in the assaying protease resistant huTSLP activity,
specifically identifying the expression of protease resistant
huTSLP, and in the purification of the modified huTSLP from cell
culture.
Modified TSLP Polynucleotide Sequences
[0097] The invention also provides isolated nucleic acid molecules
which comprise polynucleotides encoding the modified huTSLP
polypeptides of the present invention. Polynucleotides of the
invention include those having an in-frame nucleotide sequence
modification that disrupts or otherwise deactivates the codons that
encode the furin cleavage site RRKRK [SEQ ID NO: 6] positioned at
approximately amino acid residues 127-131 of SEQ ID NO: 4, such as,
for example, the polynucleotide sequence AGG AGA AAA AGG AAA [SEQ
ID NO: 5]. Suitable modifications include in-frame nucleic acid
substitutions, deletions, additions, or combinations of these, that
alter the sequence that encodes RRKRK to disrupt the encoded furin
cleavage site pattern RXXR, particularly RX(R/K)R. For example, in
one embodiment the sequence: AGA AAA AGG AAA GTC [SEQ ID NO: 7]
encoding an amino acid sequence RKRKV [SEQ ID NO: 8] is
deleted.
TABLE-US-00002 Exemplary Human TSLP Mutant Polynucleotides FURIN
SITE ##STR00008## Native [SEQ ID NO: 3] AAG AAG AGG AGA AAA AGG AAA
GTC ACA ACC Modified* [SEQ ID NO: 9] AAG AAG xxx xxx xxx xxx xxx
GTC ACA ACC Deletion 1 [SEQ ID NO: 11] AAG AAG AGG ... ... ... ...
GTC ACA ACC Deletion 2 [SEQ ID NO: 14] AAG AAG ... ... ... ... ...
GTC ACA ACC Deletion 3 [SEQ ID NO: 16] AAG AAG ... ... ... ... ...
... ACA ACC x*can designate any in-frame nucleotide substitution,
deletion, insertion, or combination of these, that disrupts the
activity of the furan cleavage site.
[0098] In one exemplary embodiment set forth in SEQ ID NO: 9, each
xxx encodes any amino acid except for R or K, preferably a neutral
amino acid. In another embodiment, one or more, and preferably two
or more codons xxx are deleted, most preferably two or more codons
encoding arginine (R) residues are deleted, and most preferably
each xxx represents a deleted codon. In another embodiment, one or
more, and preferably two or more of x are nucleotide substitutions
that do not form codons encoding K or R, and preferably encode
neutral amino acids. In a further embodiment, one or more codons
are inserted to disrupt the amino acid sequence of the furin
cleavage site, as discussed above, for example, RRKZ.sub.nRK. Other
exemplary methods for modifying the codons to deactivate the furin
cleavage site pattern RXXR and particularly RXR/KR will be apparent
and are encompassed in the invention.
[0099] Therefore, modified huTSLP polynucleotides of the invention
include polynucleotides having in-frame deletions, substitutions,
or additions to SEQ ID NO: 3, as long as the addition, deletion, or
substitution deactivates the cleavage site and encodes a furin
resistant huTSLP polypeptide molecule which retains a TSLP
activity. In addition, the polynucleotides of the invention
encompasses polynucleotides having sequences which are
substantially similar to this modified SEQ ID NO: 3, or a fragment
of SEQ ID NO:3, and which encode modified TSLP polypeptides which
retain both at least one TSLP activity and furin resistance.
[0100] As used herein, a nucleic acid molecule is "substantially
similar to" another nucleic acid molecule if its polynucleotide
sequence is at least 80% identical, preferably 90% identical, more
preferably 95% identical, more preferably 98% identical, and most
preferably 99% identical to the sequence of the second nucleic acid
molecule, and if it encodes a modified TSLP polypeptide of the
present invention retaining both a TSLP activity and furin
resistance. Polynucleotide sequence identity is determined by known
methods, for example by aligning two sequences in a software
program such as the MACAW program created by Greg Schuler. In
addition, the percent identity may be determined by visual
inspection and mathematical calculation, or by comparing sequence
information using the GAP computer program, version 6 described by
Devereux et al. Nucl. Acids Res. 12:387 (1984), and available from
the University of Wisconsin Genetics Computer Group (UWGCG).
[0101] The modified huTSLP polynucleotides of the present invention
can be cDNA, chemically synthesized DNA, DNA amplified by PCR, RNA,
or combinations thereof. Due to the degeneracy of the genetic code,
two DNA sequences can differ and yet encode identical amino acid
sequences. The present invention thus provides a nucleic acid
molecule having a polynucleotide sequence encoding a modified
huTSLP polypeptide. The nucleic acid molecules of the present
invention having a polynucleotide sequence encoding a polypeptide
which is substantially similar to SEQ ID NO: 4 and modified to
inactivate the furin cleavage site RRKRK. As used herein,
"substantially similar" refers to a polypeptide having at least 80%
identity in amino acid sequence to the modified SEQ ID NO: 4,
wherein the polypeptide retains both resistance for furin cleavage
and a TSLP activity.
[0102] The present invention also includes polynucleotides having
SEQ ID NO: 9, 11, 13, or and polynucleotides which are
substantially similar to these polynucleotide sequences. In
addition, the present invention provides polynucleotides encoding
the polypeptides of SEQ ID NO: 10, 12, 14, 16, 17, or 18, and
polynucleotides encoding polypeptides which are substantially
similar to these polypeptides.
[0103] Useful fragments of the polynucleotides of the invention
include probes and primers. These can be used, for example, in PCR
methods to amplify and detect the presence of modified huTSLP
polynucleotides in vitro, as well as in Southern and Northern blots
for analysis of protease resistant huTSLP. Cells transiently or
stably overexpressing the protease resistant huTSLP polynucleotide
molecules of the invention can also be identified by the use of
such probes. Methods for the production and use of such primers and
probes are known.
[0104] Other useful fragments include antisense or sense
oligonucleotides comprising a single-stranded nucleic acid sequence
capable of binding to a target modified huTSLP mRNA (using a sense
strand) or DNA (using an antisense strand) sequence.
Vectors and Host Cells
[0105] The present invention provides vectors containing the
polynucleotides described above, as well as host cells transformed
with such vectors. Any of the polynucleotides molecules of the
invention can be contained in a vector, which generally includes a
selectable marker and an origin of replication, for propagation in
a host. The vectors further include suitable transcriptional or
translational regulatory sequences, such as those derived from a
mammalian, microbial, viral, or insect genes, operably linked to
the modified huTSLP polynucleotide molecule. Examples of such
regulatory sequences include transcriptional promoters, operators,
or enhancers, mRNA ribosomal binding sites, and appropriate
sequences that control transcription and translation. Nucleotide
sequences are operably linked when the regulatory sequence
functionally relates to the DNA encoding the target protein. Thus,
a promoter nucleotide sequence is operably linked to a modified
huTSLP DNA sequence if the promoter nucleotide sequence directs the
transcription of the modified TSLP sequence.
[0106] Selection of suitable vectors for the cloning of protease
resistant huTSLP polynucleotide molecules of this invention will
depend upon the host cell in which the vector will be transformed,
and, where applicable, the host cell from which the target
polypeptide is to be expressed. Suitable host cells include
prokaryotes, yeast, and higher eukaryotic cells, each of which is
discussed below. Modified huTSLP polypeptides are often expressed
in mammalian cells.
[0107] The modified huSLP polypeptides to be expressed in host
cells can also be a fusion proteins comprising the TSLP polypeptide
and at least one heterologous polypeptide. As discussed above,
heterologous polypeptides can be fused to the TSLP polypeptide to
facilitate, for example, secretion, stability, purification, and/or
targeting of the modified huTSLP polypeptide. Examples of fusions
proteins provided by the present invention includes fusions of
modified TSLP polypeptides with, for example Fc polypeptides and
leucine zipper domains to promote the oligomerization of the TSLP
polypeptides as described in WO 00/29581.
[0108] In another embodiment, a nucleotide sequence encoding an
appropriate signal peptide can be incorporated into an expression
vector. A nucleic acid sequence encoding a signal peptide
(secretory leader) can be fused in-frame to the modified huTSLP
sequence so that modified huTSLP is translated as a fusion protein
comprising the signal peptide. A signal peptide that is functional
in the intended host cell promotes extracellular secretion of the
polypeptide. Preferably, the signal sequence will be cleaved from
the modified huTSLP polypeptide upon secretion of the polypeptide
from the cell. Non-limiting examples of signal sequences that can
be used in practicing the invention include the yeast I-factor and
the honeybee melatin leader in Sf9 insect cells.
[0109] Suitable host cells for expression of target polypeptides of
the invention include prokaryotes, yeast, and higher eukaryotic
cells; most preferred are mammalian cells. Suitable prokaryotic
hosts that can be used for the expression of these polypeptides
include bacteria of the genera Escherichia, Bacillus, and
Salmonella, as well as members of the genera Pseudomonas,
Streptomyces, and Staphylococcus. For expression in prokaryotic
cells, for example E. coli, the polynucleotide molecule encoding
the modified huTSLP polypeptide preferably includes an N-terminal
methionine residue to facilitate expression of the recombinant
polypeptide. The N-terminal Met can optionally be cleaved from the
expressed polypeptide.
[0110] Expression vectors for use in prokaryotic hosts generally
comprise one or more phenotypic selectable marker gene. Such gene
generally encodes, for example, a protein that confers antibiotic
resistance or that supplies an auxotrophic requirement. A wide
variety of such vectors are readily available from commercial
sources. Examples include pSPORT vectors, pGEM vectors (Promega),
pPROEX vectors (LTI, Bethesda, Md.), Bluescript vectors
(Stratagene), and pQE vectors (Qiagen).
[0111] Modified huTSLP can also be expressed in yeast host cells
from genera including Saccharomyces, Pichia, and Kluveromyces.
Preferred yeast hosts are S. cerevisiae, and P. pastoris. Yeast
vectors will often contain an origin of replication sequence from a
2T yeast plasmid, an autonomously replicating sequence (ARS), a
promoter region, sequences for polyadenylation, sequences for
transcription termination, and a selectable marker gene. Vectors
replicable in both yeast and E. coli (termed shuttle vectors) can
also be used. In addition to the above-mentioned features of yeast
vectors, a shuttle vector will also include sequences for
replication and selection in E. coli. Direct secretion of the
target polypeptides expressed in yeast hosts can be accomplished by
the inclusion of nucleotide sequence encoding the yeast I-factor
leader sequence at the 5' end of the modified huTSLP encoding
nucleotide sequence.
[0112] Insect host cell culture systems can also be used for the
expression of the modified huTSLP polypeptides. The target
polypeptides of the invention are preferably expressed using a
baculovirus expression system, as described, in a review by Luckow
and Summers, 1988, Bio/Technology 6:47.
[0113] In the preferred embodiment, the modified huTSLP
polypeptides of the invention are expressed in mammalian host
cells. Non-limiting examples of suitable mammalian cell lines
include the COS-7 line of monkey kidney cells (Gluzman et al.,
1981, Cell 23:175), Chinese hamster ovary (CHO) cells (Puck et al.,
1958, Proc. Nat. Acad. Sci. USA, 60:1275-1281; CV-1 cells (ATC
CRL-10478); 293 cells, COS cells, and human cervical carcinoma
cells (HELA) (ATCC CCL 2).
[0114] The choice of a suitable expression vector for expression of
the target polypeptides of the invention will depend upon the
specific mammalian host cell to be used. Examples of suitable
expression vectors include pDC 409 (McMahan et al., 1991, EMBO J.
10:2821), pDC 317 (Source), pcDNA3.1/Hygro (Invitrogen), pSVL
(Pharmacia Biotech) and the vectors described in WO 01/27299.
[0115] Expression vectors for use in mammalian host cells can
include transcriptional and translational control sequences derived
from viral genomes. Commonly used promoter sequences and enhancer
sequences that can be used to express the modified human TSLP
include, but are not limited to, those derived from human
cytomegalovirus (CMV), Adenovirus 2, Polyoma virus, and Simian
virus 40 (SV40). Methods for the construction of mammalian
expression vectors are disclosed, for example, in Okayama and Berg,
1983, Mol. Cell. Biol. 3:280; Cosman et al., 1986, Mol. Immunol.
23:935; Cosman et al., 1984, Nature 312:768; EP-A-0367566; and WO
91/18982.
[0116] Modification of a protease resistant huTSLP polynucleotide
molecule to facilitate insertion into a particular vector (for
example, by modifying restriction sites), ease of use in a
particular expression system or host (for example, using preferred
host codons), and the like, are known and are contemplated for use
in the invention. Genetic engineering methods for the production of
modified human TSLP polypeptides include the expression of the
polynucleotide molecules in cell free expression systems, in
cellular hosts, in tissues, and in animal models, according to
known methods.
Compositions
[0117] The invention provides compositions containing a
substantially purified modified huTSLP polypeptide of the invention
and a carrier. For therapeutic applications, the invention provides
compositions adapted for pharmaceutical use, for example,
containing a pharmaceutically acceptable carrier. Pharmaceutical
compositions of the invention are administered to cells, tissues,
or patients, for example, to induce the activity of B and T cells;
and for therapeutic treatment, for example, in stimulating immune
cell proliferation and development in immuno-suppressed patients,
for example AIDS. The pharmaceutical compositions containing a
modified huTSLP polypeptide are also useful as vaccine adjuvants,
for example, useful for obtaining long-term immunity.
[0118] The invention also provides reagents, compositions, and
methods that are useful for analysis of B and T cell activity; for
analysis of STAT5 activity; and for analysis of the
inhibitory/stimulatory effects of signal molecules involved in
innate immune system responses.
Antibodies
[0119] The polypeptides of the present invention, in whole or in
part, can be used to generate antibodies that are useful in assays
for detecting modified huTSLP polypeptide expression and for
purification of overexpressed modified human TSLP. Antibodies
against modified TSLP polypeptides can be used as an antagonist to
TSLP activity in a system. Methods for the selection of peptide
epitopes and production of antibodies are known. See, for example,
Antibodies: A Laboratory Manual, Harlow and Land (eds.), 1988 Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.;
Monoclonal Antibodies, Hybridomas: A New Dimension in Biological
Analyses, Kennet et al. (eds.), 1980, Plenum Press, New York.
[0120] In addition to the production of antibodies, all or a
portion of the modified TSLP polypeptide of the invention can be
used, for example, as a targeting moiety to target binding to cells
and tissues expressing TSLP receptors.
Assays
[0121] Human TSLP activity can be identified and measured using a
number of assays including assays involving huTSLP effects on B and
T cell proliferation and development. One such assay is described
in Example 3. BAF cells expressing human TSLP receptors (BAF/HTR)
which require active TSLP for proliferation can be used to measure
TSLP activity as described in Example 3 herein. Additional assays
for hTSLP activity include, for example, an assay measuring
induction of T cell growth from human bone marrow by TSLP is
described in WO 00/29581. Another TSLP activity is the ability to
activate STAT5 as described in the reference to Levin et al., 1999,
J. Immunol. 162:677-683, and in Example 4 herein.
[0122] These assays can be used to determine and quantitate on a
relative basis TSLP activity, for various modified TSLP
polypeptides including variants and derivates. In addition, these
assays can be used identify agents which act to modify TSLP
activity, or eliminate TSLP activity. For example, a lower modified
huTSLP activated test activity in the presence of the test agent,
compared with the absence of the test agent, indicates that the
test agent has decreased the activity of the modified huTSLP. A
higher protease resistant huTSLP activated test activity in the
presence of the test agent than in the absence of the test agent
indicates that the test agent has increased the activity of the
protease resistant huTSLP. Stimulators and inhibitors of modified
huTSLP can be used to augment, inhibit, or modify huTSLP mediated
activity, and therefore can have therapeutic uses. For example,
inhibitors of modified huTSLP can be useful to reduce B and T cell
activity, for example in autoimmune diseases or in patients
undergoing organ transplants.
Therapeutic Applications
[0123] The modified huTSLP polypeptides of the invention can be
used therapeutically in the same manner known for the therapeutic
use of the huTSLP polypeptide, as discussed in the publications
referenced above. huTSLP is effective to stimulate B and T cell
activities. For example, huTSLP, and preferably micromolar amounts
of soluble modified huTSLP induces B and T cell differentiation,
proliferation, and activation. Such administration is
therapeutically useful in the treatment of bacterial and viral
infections, as well as in the treatment of tumor cells and
autoimmune deficiencies.
[0124] Further, the polypeptides of the present invention can be
used alone or in combination with IL-7 to reconstitute a patient's
immune system following autologous bone marrow transplantation (see
for example Abdul-Hai et al., 1996, Experimental Hematology,
24:1416-1422). TSLP, due to its known effects on STAT5, can also be
used in therapies targeted to modify STAT5 effects on a patient
(see Richer et al., 1998, J. Biol. Chem., 273(47):31317-31326;
Davey et al., 1999, Am. J. Hum. Genet., 65:959-965; Nosaka et al.,
1999, EMBO J, 18(17):4754-4765).
[0125] Modified human TSLP polynucleotides and polypeptides,
including vectors expressing modified huTSLP, of the invention can
be formulated as pharmaceutical compositions and administered to a
host, preferably mammalian host, including a human patient, in a
variety of forms adapted to the chosen route of administration. The
compounds are preferably administered in combination with a
pharmaceutically acceptable carrier, and can be combined with or
conjugated to specific delivery agents, including targeting
antibodies and/or cytokines.
[0126] Modified human TSLP can be administered by known techniques,
such as orally, parentally (including subcutaneous injection,
intravenous, intramuscular, intrasternal or infusion techniques),
by inhalation spray, topically, by absorption through a mucous
membrane, or rectally, in dosage unit formulations containing
conventional non-toxic pharmaceutically acceptable carriers,
adjuvants or vehicles. Pharmaceutical compositions of the invention
can be in the form of suspensions or tablets suitable for oral
administration, nasal sprays, creams, sterile injectable
preparations, such as sterile injectable aqueous or oleagenous
suspensions or suppositories.
[0127] For oral administration as a suspension, the compositions
can be prepared according to techniques well-known in the art of
pharmaceutical formulation. The compositions can contain
microcrystalline cellulose for imparting bulk, alginic acid or
sodium alginate as a suspending agent, methylcellulose as a
viscosity enhancer, and sweeteners or flavoring agents. As
immediate release tablets, the compositions can contain
microcrystalline cellulose, starch, magnesium stearate and lactose
or other excipients, binders, extenders, disintegrants, diluents
and lubricants known in the art.
[0128] For administration by inhalation or aerosol, the
compositions can be prepared according to techniques well-known in
the art of pharmaceutical formulation. The compositions can be
prepared as solutions in saline, using benzyl alcohol or other
suitable preservatives, absorption promoters to enhance
bioavailability, fluorocarbons or other solubilizing or dispersing
agents known in the art.
[0129] For administration as injectable solutions or suspensions,
the compositions can be formulated according to techniques
well-known in the art, using suitable dispersing or wetting and
suspending agents, such as sterile oils, including synthetic mono-
or diglycerides, and fatty acids, including oleic acid.
[0130] For rectal administration as suppositories, the compositions
can be prepared by mixing with a suitable non-irritating excipient,
such as cocoa butter, synthetic glyceride esters or polyethylene
glycols, which are solid at ambient temperatures, but liquefy or
dissolve in the rectal cavity to release the drug.
[0131] Preferred administration routes include orally,
parenterally, as well as intravenous, intramuscular or subcutaneous
routes. More preferably, the compounds of the present invention are
administered parenterally, i.e., intravenously or
intraperitoneally, by infusion or injection. In one embodiment of
the invention, the compounds can be administered directly to a
tumor by tumor injection; or by systemic delivery by intravenous
injection.
[0132] Solutions or suspensions of the compounds can be prepared in
water, isotonic saline (PBS) and optionally mixed with a nontoxic
surfactant. Dispersions can also be prepared in glycerol, liquid
polyethylene, glycols, DNA, vegetable oils, triacetin and mixtures
thereof. Under ordinary conditions of storage and use, these
preparations can contain a preservative to prevent the growth of
microorganisms.
[0133] The pharmaceutical dosage form suitable for injection or
infusion use can include sterile, aqueous solutions or dispersions
or sterile powders comprising an active ingredient which are
adapted for the extemporaneous preparation of sterile injectable or
infusible solutions or dispersions. In all cases, the ultimate
dosage form should be sterile, fluid and stable under the
conditions of manufacture and storage. The liquid carrier or
vehicle can be a solvent or liquid dispersion medium comprising,
for example, water, ethanol, a polyol such as glycerol, propylene
glycol, or liquid polyethylene glycols and the like, vegetable
oils, nontoxic glyceryl esters, and suitable mixtures thereof. The
proper fluidity can be maintained, for example, by the formation of
liposomes, by the maintenance of the required particle size, in the
case of dispersion, or by the use of nontoxic surfactants. The
prevention of the action of microorganisms can be accomplished by
various antibacterial and antifungal agents, for example, parabens,
chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In
many cases, it will be desirable to include isotonic agents, for
example, sugars, buffers, or sodium chloride. Prolonged absorption
of the injectable compositions can be brought about by the
inclusion in the composition of agents delaying absorption, for
example, aluminum monosterate hydrogels and gelatin.
[0134] Sterile injectable solutions are prepared by incorporating
the compounds in the required amount in the appropriate solvent
with various other ingredients as enumerated above and, as
required, followed by filter sterilization. In the case of sterile
powders for the preparation of sterile injectable solutions, the
preferred methods of preparation are vacuum drying and
freeze-drying techniques, which yield a powder of the active
ingredient plus any additional desired ingredient present in the
previously sterile-filtered solutions.
[0135] Having generally described the invention, the same will be
more readily understood by reference to the following examples,
which are provided by way of illustration and are not intended as
limiting.
EXAMPLES
Example 1: Recognition and Modification of Furin Cleavage Site
[0136] The nucleic acid sequences encoding murine TSLP (GenBank
accession number AF232937) [SEQ ID NO: 3] and human TSLP [SEQ ID
NO: 5] were disclosed in PCT application WO 00/29581. Production of
useful quantities of human TSLP cDNA in mammalian cells is
hampered, however, as expression in mammalian cells often yields a
degraded product.
[0137] Expression of human recombinant TSLP in mammalian cells
provided substantially lower quantities of full length recombinant
protein than expected. A portion the expressed protein was in a
cleaved, fragmented form, having a major degradation product of 6
kD. In contrast to human TSLP, murine TSLP was not degraded when
expressed in mammalian cells. The nucleic acid and amino acid
sequences of the human and murine TSLP were then compared. As shown
in Table 1, comparison of the human TSLP amino acid sequence with a
murine TSLP amino acid sequence revealed a series of residues,
beginning at residue 128, found exclusively in the human TSLP
(128-RKRKV-132). Upon further investigation, it was determined that
the residues represented a furin cleavage site (127-RRKRK-131).
Importantly, the position of the furin cleavage site correlated
with release of an approximate 6 kD C-terminal fragment of human
TSLP.
[0138] The huTSLP amino acid sequence includes an N-terminal
hydrophobic region that functions as a signal peptide followed by a
series of 4 helixes forming a four-helix bundle cytokine structure.
The furin cleavage site is positioned about 8 amino acids before
the start of the fourth helix of the four-helix bundle. Truncation
of the protein at the cleavage site can result in an inactivated
human TSLP protein.
TABLE-US-00003 TABLE 1 Comparison of murine and human TSLP
polypeptides Human 1
MFPFALLYVLSVSFRKIFILQ.LVGLVLTYDFTNCDFEKIKAAYLSTISK 49 Mouse 1
MVLLRSLFILQVLVRMGLTYNFSNCNFTSITKIYCNIIFH 40 Human 50
DLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFA 99 Mouse 50
DLTGDLKGAK...FEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFA 87 Human 100
##STR00009## 148 Mouse 100
RRTREALNDHCPGYPETERNDGTQEMAQE.....VQNICLNQTSQILRLW 132 Human 150
RFNRPLLKQQ [SEQ ID NO: 4] Mouse 150 YSFMQSPE [SEQ ID NO: 2]
[0139] When TSLP protein is expressed and isolated from mammalian
cell cultures, and analyzed, for example, by electrophoresis, a
number of polypeptides result, shown as numerous bands on a gel.
The most prominent band in the mixture of proteins has a molecular
weight of approximately 6 kD. The amino acid sequence of the 6 kD
fragment corresponds to the C-terminal end of TSLP, suggesting a
cleavage point at the furin cleavage site, RRKRK. This data
provides direct evidence that degradation of human TSLP expressed
in mammalian cells results from cleavage at the furin cleavage
site.
Example 2: Mutagenesis of Furin Site in Human TSLP
[0140] Site directed mutagenesis was used to inactivate the furin
cleavage site from the human TSLP poly-His FLAG transcript, using
313-human-TSLP His-FLAG (#14095) (1 mg/ml) as the template. A
series of polymerase chain reaction (PCR) reactions was used to
delete the nucleotide sequence: AGA AAA AGG AAA GTC [SEQ ID NO: 7]
that encodes the huTSLP segment containing the furin cleavage site:
RKRKV [SEQ ID NO: 8]. In addition, a combination of primers was
designed to create a Sal-1 restriction site at the 5' end and a
Not-1 site at the 3' end. The primers were as follows:
TABLE-US-00004 [SEQ ID NO: 19] 1. Forward (Sal-1):
5'-GTCGACGCCACCATGTTCCCT-3' [SEQ ID NO: 20] 2. Forward:
5-'ATGAAGAAGAGGACAACCAATAAATGTC-3' [SEQ ID NO: 21] 3. Reverse:
5'-GACATTTATTGGTTGTCCTCTTCTTCAT-3' [SEQ ID NO: 22] 4.
Reverse(Not-1): 5'-AGCGGCCGCTCATTTGTCGTC-3'
[0141] The polynucleotide sequence of human TSLP is shown
below:
TABLE-US-00005 HUMAN TSLP (GenBank AY037115) 1 gcagccagaa
agctctggag catcagggag actccaactt aaggcaacag catgggtgaa 61
taagggcttc ctgtggactg gcaatgagag gcaaaacctg gtgcttgagc actggcccct
121 aaggcaggcc ttacagatct cttacactcg tggtgggaag agtttagtgt
gaaactgggg 181 tggaattggg tgtccacgta tgttcccttt tgccttacta
tatgttctgt cagtttcttt 241 caggaaaatc ttcatcttac aacttgtagg
gctggtgtta acttacgact tcactaactg 301 tgactttgag aagattaaag
cagcctatct cagtactatt tctaaagacc tgattacata 361 tatgagtggg
accaaaagta ccgagttcaa caacaccgtc tcttgtagca atcggccaca 421
ttgccttact gaaatccaga gcctaacctt caatcccacc gccggctgcg cgtcgctcgc
481 caaagaaatg ttcgccatga aaactaaggc tgccttagct atctggtgcc
caggctattc 541 ##STR00010## 601 caataaatgt ctggaacaag tgtcacaatt
acaaggattg tggcgtcgct tcaatcgacc 661 tttactgaaa caacagtaaa
ccatctttat tatggtcata tttcacagcc caaaataaat 721 catctttatt
aagtaaaaaa aaa [SEQ ID NO: 3]
[0142] A PCR product of 409 bases was formed using primers 1 and 3
in a first PCR reaction. Primer 1 includes a Sal-1 restriction
site, while primer 3 deletes the 15 base furin cleavage sequence. A
second PCR product of 162 bases was formed using primers 2 and 4 in
a second PCR reaction, with primer 4 includes a NOT-1 restriction
site, while primer 2 deletes the 15 base furin cleavage site.
[0143] The PCR reactions contained 10 Tl of Amplitaq 10.times.
buffer; 1 Tl Amplitaq; 2 Tl dNTPs (10 pM each); 40 pM each primer;
1 Tl template; water to a final volume of 100 Tl. The PCR was
performed on a Perkin Elmer-Gene Amp PCR Systems 2400 machine, at:
1 cycle of 94.degree. C., 2:00 minutes; 30 cycles of 94.degree. C.,
0:30 minutes, 50.degree. C., 0:15 minutes, and 72.degree. C., 1:00
minute; and one cycle of 72.degree. C., 2:00 minutes.
[0144] PCR products were purified in 1% low melt agarose gels.
Appropriate sized-bands were excised from the gel and the DNA was
purified using a High Pure PCR Product Purification Kit obtained
from Boehringer Mannheim. The gel-purified 409 and 162 base
products were combined with primers 1 and 4 to produce a 558 base
pair PCR product that contained the full length human TSLP
polyHis-FLAG sequence lacking the 15 base pair region encoding the
furin cleavage site.
[0145] The reaction solution contained: 10 Tl Amplitaq 10.times.
buffer; 1 Tl Amplitaq; 2 Tl (10 pM each) dNTP; 15.4 Tl (40 pM)
Primer 1; 16 Tl (40 pM) Primer 4; 1 Tl (41 ng) PCR Product A; 2 Tl
(119ng) PCR Product B; and water to a final volume of 100 Tl. As
above, the PCR reaction/conditions were carried out in the Perkin
Elmer-Gene Amp PCR Systems 2400 machine. At the end of the
reaction, the 558 base pair product was separated on a 1% low-melt
agarose gel and purified.
[0146] Purified modified human TSLP sequence was ligated into
vector pGEM-T (Promega), using the reagents supplied with the
vector kit: 1 Tl pGEM-T vector; 5 Tl 2.times. ligation buffer; 1 Tl
ligase; and 1 Tl 558 base pair modified human TSLP (12 ng). The
reaction solution was left at room temperature for one hour. The
ligation mixture (2 Tl) was combined with 40 Tl of
DH10I-electrocompetent E. coli, and electroporated into the
bacteria. The electroporated bacteria were then transferred to 0.9
ml of SOC solution and shaken for one hour at 37.degree. C.
[0147] A volume of 0.1 Tl of this solution was spread on
ampicillin-resistant plates and incubated at 37.degree. C.
overnight. Colonies were picked and inoculated into 4 mL of LB
broth containing ampicillin. After overnight incubation on a shake
platform at 37.degree. C., the plasmid DNA was purified and
digested with NOT-1/Sal-1 to confirm the correct size of the
insert. The pGem-T vector with the 558 base pair insert was
sequenced to confirm that the molecular manipulations had produced
the desired mutation.
[0148] pGEM-T vector was digested with Not-I and Sal-1, and the 558
base pair insert subcloned into expression vectors pDC 409 and
pDC317. Digestion and ligation reactions were performed as is well
known in the art. Expression vectors were then used to produce
either transiently transfected CV-1 cells (ATCC CRL-10478) or to
make stably expressing CHO cells. Note that for comparison, a
control expression vector encoding human TSLP having an intact
furin cleavage site was used to produce both transient and stable
transfected cells.
[0149] HuTSLP and modified huTSLP protein were each expressed in
CV-1 cells as a HIS, Flag fusion protein. The expressed protein was
purified using IMAC (immobilized metal affinity chromatography,
using the manufacturer's instructions (Qiagen)). Analysis of the
expressed protein on SDS-PAGE under reducing and non-reducing
conditions demonstrated the production of modified huTSLP.
[0150] The constructed, modified human TSLP sequence, having the
furin cleavage site removed, was expressed as full-length human
TSLP protein in mammalian culture (CV-1 cells). When compared to
the non-modified human TSLP, little or no degradation product was
produced with expression of the furin-site deleted TSLP,
demonstrating that the furin site was, in fact, the site
responsible for the fragmentation of recombinant human TSLP.
Example 3: Active Modified Human TSLP
[0151] The activity of the modified huTSLP, produced as described
for Example 2, was verified using a BAF/HRT cell bioassay. The
BAF/HTR bioassay utilizes a murine pro B lymphocyte cell line,
which has been transfected with the human TSLP receptor (cell line
obtained from Steven F. Ziegler, Virginia Mason Research Center,
Seattle, Wash.). The TSLPR DNA sequence was deposited with Genbank,
(accession number AF201963) and is described in Pandey et al.,
2000, Nat Immun 1(1), 59-64. These cells are dependent upon huTSLP
for growth, and proliferate in a dose-dependent manner in response
to active huTSLP added in test samples.
[0152] Titrations of samples and standards were performed in a
96-well microtiter format. A baseline quantity of BAF/HRT cells
were added to each well. Samples of modified huTSLP and standards
were added to the wells. Following an incubation period, cell
proliferation was measured by the addition of Alamar Blue dye I
(Biosource International Catalog #DAL1100, 10 uL/well).
Metabolically active BAF/HRT cells take up and reduce Alamar Blue,
which leads to change in the fluorescent properties of the dye. The
number of fluorescent units produced in this assay by the modified,
protease resistant huTSLP was similar to that of the reference
unmodified huTSLP, showing that the modified huTSLP was equally
active to unmodified huTSLP.
Example 4: Modified huTSLP Activates STAT5
[0153] The ability of modified huTSLP of the invention to activate
STAT5 is analyzed according to the method described in Levin et
al., 1999 supra. Briefly, NAG8/7 cells are cytokine starved for 4-5
hours, then stimulated at 10.sup.7 cells/ml with 100 ng/ml modified
human TSLP. Unmodified huTSLP is used as a control. Post
incubation, cells are harvested, washed, and lysed. Stimulated cell
lysates are analyzed by immunoblot assay, and demonstrate modified
huTSLP activity when compared with control.
[0154] The invention is described herein with reference to specific
examples. Various changes and modifications can be made to these
examples that are well within the scope of the invention. Numerous
other changes can be made that are readily suggested to those
skilled in the art and that are encompassed in the spirit of the
invention disclosed herein and as defined in the appended
claims.
[0155] All publications cited herein are hereby incorporated by
reference.
Sequence CWU 1
1
2211125DNAMus musculusCDS(18)..(440) 1cacgttcagg cgacagc atg gtt
ctt ctc agg agc ctc ttc atc ctg caa 50 Met Val Leu Leu Arg Ser Leu
Phe Ile Leu Gln 1 5 10gta cta gta cgg atg ggg cta act tac aac ttt
tct aac tgc aac ttc 98Val Leu Val Arg Met Gly Leu Thr Tyr Asn Phe
Ser Asn Cys Asn Phe 15 20 25acg tca att acg aaa ata tat tgt aac ata
att ttt cat gac ctg act 146Thr Ser Ile Thr Lys Ile Tyr Cys Asn Ile
Ile Phe His Asp Leu Thr 30 35 40gga gat ttg aaa ggg gct aag ttc gag
caa atc gag gac tgt gag agc 194Gly Asp Leu Lys Gly Ala Lys Phe Glu
Gln Ile Glu Asp Cys Glu Ser 45 50 55aag cca gct tgt ctc ctg aaa atc
gag tat tat act ctc aat cct atc 242Lys Pro Ala Cys Leu Leu Lys Ile
Glu Tyr Tyr Thr Leu Asn Pro Ile60 65 70 75cct ggc tgc cct tca ctc
ccc gac aaa aca ttt gcc cgg aga aca aga 290Pro Gly Cys Pro Ser Leu
Pro Asp Lys Thr Phe Ala Arg Arg Thr Arg 80 85 90gaa gcc ctc aat gac
cac tgc cca ggc tac cct gaa act gag aga aat 338Glu Ala Leu Asn Asp
His Cys Pro Gly Tyr Pro Glu Thr Glu Arg Asn 95 100 105gac ggt act
cag gaa atg gca caa gaa gtc caa aac atc tgt ctg aat 386Asp Gly Thr
Gln Glu Met Ala Gln Glu Val Gln Asn Ile Cys Leu Asn 110 115 120caa
acc tca caa att cta aga ttg tgg tat tcc ttc atg caa tct cca 434Gln
Thr Ser Gln Ile Leu Arg Leu Trp Tyr Ser Phe Met Gln Ser Pro 125 130
135gaa taa aattagcttt cagcttctgc tatgaaaatc tctatcttgg ttttagtgga
490Glu140cagaatacta agggtgtgac acttagagga ccactggtgt ttattcttta
attacagaag 550ggattcttaa cttatttttt ggcatatcgc ttttttcagt
ataggtgctt taaatgggaa 610atgagcaata gaccgttaat ggaaatatct
gtactgttaa tgaccagctt ctgagaagtc 670tttctcacct cccctgcaca
caccttactc tagggcaaac ctaactgtag taggaagaga 730attgaaagta
gaaaaaaaaa ttaaaaccaa tgacagcatc taaaccctgt ttaaaaggca
790aggatttttc tacctgtaat gattcttcta acattcctat gctaagattt
taccaaagaa 850gaaaatgaca gttcgggcag tcactgccat gatgaggtgg
tctgaaagaa gcttgtggaa 910tctgggagaa actgctgaga tcatattgca
aatccagctg tcaaagggtt cagacccagg 970acagtacaat tcgtgagcag
atctcaagag ccttgcacat ctacgagata tatatttaaa 1030gttgtagata
atgaatttct aatttatttt gtgagcactt ttggaaatat acatgctact
1090ttgtaatgaa tacattgctg aataaagtaa ttctc 11252140PRTMus musculus
2Met Val Leu Leu Arg Ser Leu Phe Ile Leu Gln Val Leu Val Arg Met1 5
10 15Gly Leu Thr Tyr Asn Phe Ser Asn Cys Asn Phe Thr Ser Ile Thr
Lys 20 25 30Ile Tyr Cys Asn Ile Ile Phe His Asp Leu Thr Gly Asp Leu
Lys Gly 35 40 45Ala Lys Phe Glu Gln Ile Glu Asp Cys Glu Ser Lys Pro
Ala Cys Leu 50 55 60Leu Lys Ile Glu Tyr Tyr Thr Leu Asn Pro Ile Pro
Gly Cys Pro Ser65 70 75 80Leu Pro Asp Lys Thr Phe Ala Arg Arg Thr
Arg Glu Ala Leu Asn Asp 85 90 95His Cys Pro Gly Tyr Pro Glu Thr Glu
Arg Asn Asp Gly Thr Gln Glu 100 105 110Met Ala Gln Glu Val Gln Asn
Ile Cys Leu Asn Gln Thr Ser Gln Ile 115 120 125Leu Arg Leu Trp Tyr
Ser Phe Met Gln Ser Pro Glu 130 135 1403743DNAHomo
sapiensCDS(200)..(679) 3gcagccagaa agctctggag catcagggag actccaactt
aaggcaacag catgggtgaa 60taagggcttc ctgtggactg gcaatgagag gcaaaacctg
gtgcttgagc actggcccct 120aaggcaggcc ttacagatct cttacactcg
tggtgggaag agtttagtgt gaaactgggg 180tggaattggg tgtccacgt atg ttc
cct ttt gcc tta cta tat gtt ctg tca 232 Met Phe Pro Phe Ala Leu Leu
Tyr Val Leu Ser 1 5 10gtt tct ttc agg aaa atc ttc atc tta caa ctt
gta ggg ctg gtg tta 280Val Ser Phe Arg Lys Ile Phe Ile Leu Gln Leu
Val Gly Leu Val Leu 15 20 25act tac gac ttc act aac tgt gac ttt gag
aag att aaa gca gcc tat 328Thr Tyr Asp Phe Thr Asn Cys Asp Phe Glu
Lys Ile Lys Ala Ala Tyr 30 35 40ctc agt act att tct aaa gac ctg att
aca tat atg agt ggg acc aaa 376Leu Ser Thr Ile Ser Lys Asp Leu Ile
Thr Tyr Met Ser Gly Thr Lys 45 50 55agt acc gag ttc aac aac acc gtc
tct tgt agc aat cgg cca cat tgc 424Ser Thr Glu Phe Asn Asn Thr Val
Ser Cys Ser Asn Arg Pro His Cys60 65 70 75ctt act gaa atc cag agc
cta acc ttc aat ccc acc gcc ggc tgc gcg 472Leu Thr Glu Ile Gln Ser
Leu Thr Phe Asn Pro Thr Ala Gly Cys Ala 80 85 90tcg ctc gcc aaa gaa
atg ttc gcc atg aaa act aag gct gcc tta gct 520Ser Leu Ala Lys Glu
Met Phe Ala Met Lys Thr Lys Ala Ala Leu Ala 95 100 105atc tgg tgc
cca ggc tat tcg gaa act cag ata aat gct act cag gca 568Ile Trp Cys
Pro Gly Tyr Ser Glu Thr Gln Ile Asn Ala Thr Gln Ala 110 115 120atg
aag aag agg aga aaa agg aaa gtc aca acc aat aaa tgt ctg gaa 616Met
Lys Lys Arg Arg Lys Arg Lys Val Thr Thr Asn Lys Cys Leu Glu 125 130
135caa gtg tca caa tta caa gga ttg tgg cgt cgc ttc aat cga cct tta
664Gln Val Ser Gln Leu Gln Gly Leu Trp Arg Arg Phe Asn Arg Pro
Leu140 145 150 155ctg aaa caa cag taa accatcttta ttatggtcat
atttcacagc ccaaaataaa 719Leu Lys Gln Glntcatctttat taagtaaaaa aaaa
7434159PRTHomo sapiens 4Met Phe Pro Phe Ala Leu Leu Tyr Val Leu Ser
Val Ser Phe Arg Lys1 5 10 15Ile Phe Ile Leu Gln Leu Val Gly Leu Val
Leu Thr Tyr Asp Phe Thr 20 25 30Asn Cys Asp Phe Glu Lys Ile Lys Ala
Ala Tyr Leu Ser Thr Ile Ser 35 40 45Lys Asp Leu Ile Thr Tyr Met Ser
Gly Thr Lys Ser Thr Glu Phe Asn 50 55 60Asn Thr Val Ser Cys Ser Asn
Arg Pro His Cys Leu Thr Glu Ile Gln65 70 75 80Ser Leu Thr Phe Asn
Pro Thr Ala Gly Cys Ala Ser Leu Ala Lys Glu 85 90 95Met Phe Ala Met
Lys Thr Lys Ala Ala Leu Ala Ile Trp Cys Pro Gly 100 105 110Tyr Ser
Glu Thr Gln Ile Asn Ala Thr Gln Ala Met Lys Lys Arg Arg 115 120
125Lys Arg Lys Val Thr Thr Asn Lys Cys Leu Glu Gln Val Ser Gln Leu
130 135 140Gln Gly Leu Trp Arg Arg Phe Asn Arg Pro Leu Leu Lys Gln
Gln145 150 155515DNAHomo sapiensCDS(1)..(15) 5agg aga aaa agg aaa
15Arg Arg Lys Arg Lys1 565PRTHomo sapiens 6Arg Arg Lys Arg Lys1
5715DNAHomo sapiensCDS(1)..(15) 7aga aaa agg aaa gtc 15Arg Lys Arg
Lys Val1 585PRTHomo sapiens 8Arg Lys Arg Lys Val1 59743DNAHomo
sapiensCDS(200)..(679)misc_feature(200)..(679)"nnn" is a codon
encoding any amino acid that is not Arg or
Lys.misc_feature(200)..(679)"Xaa" is not Arg or Lys; "nnn" does not
encode Arg or Lys. 9gcagccagaa agctctggag catcagggag actccaactt
aaggcaacag catgggtgaa 60taagggcttc ctgtggactg gcaatgagag gcaaaacctg
gtgcttgagc actggcccct 120aaggcaggcc ttacagatct cttacactcg
tggtgggaag agtttagtgt gaaactgggg 180tggaattggg tgtccacgt atg ttc
cct ttt gcc tta cta tat gtt ctg tca 232 Met Phe Pro Phe Ala Leu Leu
Tyr Val Leu Ser 1 5 10gtt tct ttc agg aaa atc ttc atc tta caa ctt
gta ggg ctg gtg tta 280Val Ser Phe Arg Lys Ile Phe Ile Leu Gln Leu
Val Gly Leu Val Leu 15 20 25act tac gac ttc act aac tgt gac ttt gag
aag att aaa gca gcc tat 328Thr Tyr Asp Phe Thr Asn Cys Asp Phe Glu
Lys Ile Lys Ala Ala Tyr 30 35 40ctc agt act att tct aaa gac ctg att
aca tat atg agt ggg acc aaa 376Leu Ser Thr Ile Ser Lys Asp Leu Ile
Thr Tyr Met Ser Gly Thr Lys 45 50 55agt acc gag ttc aac aac acc gtc
tct tgt agc aat cgg cca cat tgc 424Ser Thr Glu Phe Asn Asn Thr Val
Ser Cys Ser Asn Arg Pro His Cys60 65 70 75ctt act gaa atc cag agc
cta acc ttc aat ccc acc gcc ggc tgc gcg 472Leu Thr Glu Ile Gln Ser
Leu Thr Phe Asn Pro Thr Ala Gly Cys Ala 80 85 90tcg ctc gcc aaa gaa
atg ttc gcc atg aaa act aag gct gcc tta gct 520Ser Leu Ala Lys Glu
Met Phe Ala Met Lys Thr Lys Ala Ala Leu Ala 95 100 105atc tgg tgc
cca ggc tat tcg gaa act cag ata aat gct act cag gca 568Ile Trp Cys
Pro Gly Tyr Ser Glu Thr Gln Ile Asn Ala Thr Gln Ala 110 115 120atg
aag aag nnn nnn nnn nnn nnn gtc aca acc aat aaa tgt ctg gaa 616Met
Lys Lys Xaa Xaa Xaa Xaa Xaa Val Thr Thr Asn Lys Cys Leu Glu 125 130
135caa gtg tca caa tta caa gga ttg tgg cgt cgc ttc aat cga cct tta
664Gln Val Ser Gln Leu Gln Gly Leu Trp Arg Arg Phe Asn Arg Pro
Leu140 145 150 155ctg aaa caa cag taa accatcttta ttatggtcat
atttcacagc ccaaaataaa 719Leu Lys Gln Glntcatctttat taagtaaaaa aaaa
74310159PRTHomo sapiensmisc_feature(127)..(127)The 'Xaa' at
location 127 stands for Lys, Asn, Arg, Ser, Thr, Ile, Met, Glu,
Asp, Gly, Ala, Val, Gln, His, Pro, Leu, Tyr, Trp, Cys, or
Phe.misc_feature(128)..(128)The 'Xaa' at location 128 stands for
Lys, Asn, Arg, Ser, Thr, Ile, Met, Glu, Asp, Gly, Ala, Val, Gln,
His, Pro, Leu, Tyr, Trp, Cys, or Phe.misc_feature(129)..(129)The
'Xaa' at location 129 stands for Lys, Asn, Arg, Ser, Thr, Ile, Met,
Glu, Asp, Gly, Ala, Val, Gln, His, Pro, Leu, Tyr, Trp, Cys, or
Phe.misc_feature(130)..(130)The 'Xaa' at location 130 stands for
Lys, Asn, Arg, Ser, Thr, Ile, Met, Glu, Asp, Gly, Ala, Val, Gln,
His, Pro, Leu, Tyr, Trp, Cys, or Phe.misc_feature(131)..(131)The
'Xaa' at location 131 stands for Lys, Asn, Arg, Ser, Thr, Ile, Met,
Glu, Asp, Gly, Ala, Val, Gln, His, Pro, Leu, Tyr, Trp, Cys, or Phe.
10Met Phe Pro Phe Ala Leu Leu Tyr Val Leu Ser Val Ser Phe Arg Lys1
5 10 15Ile Phe Ile Leu Gln Leu Val Gly Leu Val Leu Thr Tyr Asp Phe
Thr 20 25 30Asn Cys Asp Phe Glu Lys Ile Lys Ala Ala Tyr Leu Ser Thr
Ile Ser 35 40 45Lys Asp Leu Ile Thr Tyr Met Ser Gly Thr Lys Ser Thr
Glu Phe Asn 50 55 60Asn Thr Val Ser Cys Ser Asn Arg Pro His Cys Leu
Thr Glu Ile Gln65 70 75 80Ser Leu Thr Phe Asn Pro Thr Ala Gly Cys
Ala Ser Leu Ala Lys Glu 85 90 95Met Phe Ala Met Lys Thr Lys Ala Ala
Leu Ala Ile Trp Cys Pro Gly 100 105 110Tyr Ser Glu Thr Gln Ile Asn
Ala Thr Gln Ala Met Lys Lys Xaa Xaa 115 120 125Xaa Xaa Xaa Val Thr
Thr Asn Lys Cys Leu Glu Gln Val Ser Gln Leu 130 135 140Gln Gly Leu
Trp Arg Arg Phe Asn Arg Pro Leu Leu Lys Gln Gln145 150
15511731DNAHomo sapiensCDS(200)..(667) 11gcagccagaa agctctggag
catcagggag actccaactt aaggcaacag catgggtgaa 60taagggcttc ctgtggactg
gcaatgagag gcaaaacctg gtgcttgagc actggcccct 120aaggcaggcc
ttacagatct cttacactcg tggtgggaag agtttagtgt gaaactgggg
180tggaattggg tgtccacgt atg ttc cct ttt gcc tta cta tat gtt ctg tca
232 Met Phe Pro Phe Ala Leu Leu Tyr Val Leu Ser 1 5 10gtt tct ttc
agg aaa atc ttc atc tta caa ctt gta ggg ctg gtg tta 280Val Ser Phe
Arg Lys Ile Phe Ile Leu Gln Leu Val Gly Leu Val Leu 15 20 25act tac
gac ttc act aac tgt gac ttt gag aag att aaa gca gcc tat 328Thr Tyr
Asp Phe Thr Asn Cys Asp Phe Glu Lys Ile Lys Ala Ala Tyr 30 35 40ctc
agt act att tct aaa gac ctg att aca tat atg agt ggg acc aaa 376Leu
Ser Thr Ile Ser Lys Asp Leu Ile Thr Tyr Met Ser Gly Thr Lys 45 50
55agt acc gag ttc aac aac acc gtc tct tgt agc aat cgg cca cat tgc
424Ser Thr Glu Phe Asn Asn Thr Val Ser Cys Ser Asn Arg Pro His
Cys60 65 70 75ctt act gaa atc cag agc cta acc ttc aat ccc acc gcc
ggc tgc gcg 472Leu Thr Glu Ile Gln Ser Leu Thr Phe Asn Pro Thr Ala
Gly Cys Ala 80 85 90tcg ctc gcc aaa gaa atg ttc gcc atg aaa act aag
gct gcc tta gct 520Ser Leu Ala Lys Glu Met Phe Ala Met Lys Thr Lys
Ala Ala Leu Ala 95 100 105atc tgg tgc cca ggc tat tcg gaa act cag
ata aat gct act cag gca 568Ile Trp Cys Pro Gly Tyr Ser Glu Thr Gln
Ile Asn Ala Thr Gln Ala 110 115 120atg aag aag agg gtc aca acc aat
aaa tgt ctg gaa caa gtg tca caa 616Met Lys Lys Arg Val Thr Thr Asn
Lys Cys Leu Glu Gln Val Ser Gln 125 130 135tta caa gga ttg tgg cgt
cgc ttc aat cga cct tta ctg aaa caa cag 664Leu Gln Gly Leu Trp Arg
Arg Phe Asn Arg Pro Leu Leu Lys Gln Gln140 145 150 155taa
accatcttta ttatggtcat atttcacagc ccaaaataaa tcatctttat
717taagtaaaaa aaaa 73112155PRTHomo sapiens 12Met Phe Pro Phe Ala
Leu Leu Tyr Val Leu Ser Val Ser Phe Arg Lys1 5 10 15Ile Phe Ile Leu
Gln Leu Val Gly Leu Val Leu Thr Tyr Asp Phe Thr 20 25 30Asn Cys Asp
Phe Glu Lys Ile Lys Ala Ala Tyr Leu Ser Thr Ile Ser 35 40 45Lys Asp
Leu Ile Thr Tyr Met Ser Gly Thr Lys Ser Thr Glu Phe Asn 50 55 60Asn
Thr Val Ser Cys Ser Asn Arg Pro His Cys Leu Thr Glu Ile Gln65 70 75
80Ser Leu Thr Phe Asn Pro Thr Ala Gly Cys Ala Ser Leu Ala Lys Glu
85 90 95Met Phe Ala Met Lys Thr Lys Ala Ala Leu Ala Ile Trp Cys Pro
Gly 100 105 110Tyr Ser Glu Thr Gln Ile Asn Ala Thr Gln Ala Met Lys
Lys Arg Val 115 120 125Thr Thr Asn Lys Cys Leu Glu Gln Val Ser Gln
Leu Gln Gly Leu Trp 130 135 140Arg Arg Phe Asn Arg Pro Leu Leu Lys
Gln Gln145 150 15513728DNAHomo sapiensCDS(200)..(664) 13gcagccagaa
agctctggag catcagggag actccaactt aaggcaacag catgggtgaa 60taagggcttc
ctgtggactg gcaatgagag gcaaaacctg gtgcttgagc actggcccct
120aaggcaggcc ttacagatct cttacactcg tggtgggaag agtttagtgt
gaaactgggg 180tggaattggg tgtccacgt atg ttc cct ttt gcc tta cta tat
gtt ctg tca 232 Met Phe Pro Phe Ala Leu Leu Tyr Val Leu Ser 1 5
10gtt tct ttc agg aaa atc ttc atc tta caa ctt gta ggg ctg gtg tta
280Val Ser Phe Arg Lys Ile Phe Ile Leu Gln Leu Val Gly Leu Val Leu
15 20 25act tac gac ttc act aac tgt gac ttt gag aag att aaa gca gcc
tat 328Thr Tyr Asp Phe Thr Asn Cys Asp Phe Glu Lys Ile Lys Ala Ala
Tyr 30 35 40ctc agt act att tct aaa gac ctg att aca tat atg agt ggg
acc aaa 376Leu Ser Thr Ile Ser Lys Asp Leu Ile Thr Tyr Met Ser Gly
Thr Lys 45 50 55agt acc gag ttc aac aac acc gtc tct tgt agc aat cgg
cca cat tgc 424Ser Thr Glu Phe Asn Asn Thr Val Ser Cys Ser Asn Arg
Pro His Cys60 65 70 75ctt act gaa atc cag agc cta acc ttc aat ccc
acc gcc ggc tgc gcg 472Leu Thr Glu Ile Gln Ser Leu Thr Phe Asn Pro
Thr Ala Gly Cys Ala 80 85 90tcg ctc gcc aaa gaa atg ttc gcc atg aaa
act aag gct gcc tta gct 520Ser Leu Ala Lys Glu Met Phe Ala Met Lys
Thr Lys Ala Ala Leu Ala 95 100 105atc tgg tgc cca ggc tat tcg gaa
act cag ata aat gct act cag gca 568Ile Trp Cys Pro Gly Tyr Ser Glu
Thr Gln Ile Asn Ala Thr Gln Ala 110 115 120atg aag aag gtc aca acc
aat aaa tgt ctg gaa caa gtg tca caa tta 616Met Lys Lys Val Thr Thr
Asn Lys Cys Leu Glu Gln Val Ser Gln Leu 125 130 135caa gga ttg tgg
cgt cgc ttc aat cga cct tta ctg aaa caa cag taa 664Gln Gly Leu Trp
Arg Arg Phe Asn Arg Pro Leu Leu Lys Gln Gln140 145 150accatcttta
ttatggtcat atttcacagc ccaaaataaa tcatctttat taagtaaaaa 724aaaa
72814154PRTHomo sapiens 14Met Phe Pro Phe Ala Leu Leu Tyr Val Leu
Ser Val Ser Phe Arg Lys1 5 10 15Ile Phe Ile Leu Gln Leu Val Gly Leu
Val Leu Thr Tyr Asp Phe Thr 20 25 30Asn Cys Asp Phe Glu Lys Ile Lys
Ala Ala Tyr Leu Ser Thr Ile Ser
35 40 45Lys Asp Leu Ile Thr Tyr Met Ser Gly Thr Lys Ser Thr Glu Phe
Asn 50 55 60Asn Thr Val Ser Cys Ser Asn Arg Pro His Cys Leu Thr Glu
Ile Gln65 70 75 80Ser Leu Thr Phe Asn Pro Thr Ala Gly Cys Ala Ser
Leu Ala Lys Glu 85 90 95Met Phe Ala Met Lys Thr Lys Ala Ala Leu Ala
Ile Trp Cys Pro Gly 100 105 110Tyr Ser Glu Thr Gln Ile Asn Ala Thr
Gln Ala Met Lys Lys Val Thr 115 120 125Thr Asn Lys Cys Leu Glu Gln
Val Ser Gln Leu Gln Gly Leu Trp Arg 130 135 140Arg Phe Asn Arg Pro
Leu Leu Lys Gln Gln145 15015728DNAHomo sapiensCDS(200)..(664)
15gcagccagaa agctctggag catcagggag actccaactt aaggcaacag catgggtgaa
60taagggcttc ctgtggactg gcaatgagag gcaaaacctg gtgcttgagc actggcccct
120aaggcaggcc ttacagatct cttacactcg tggtgggaag agtttagtgt
gaaactgggg 180tggaattggg tgtccacgt atg ttc cct ttt gcc tta cta tat
gtt ctg tca 232 Met Phe Pro Phe Ala Leu Leu Tyr Val Leu Ser 1 5
10gtt tct ttc agg aaa atc ttc atc tta caa ctt gta ggg ctg gtg tta
280Val Ser Phe Arg Lys Ile Phe Ile Leu Gln Leu Val Gly Leu Val Leu
15 20 25act tac gac ttc act aac tgt gac ttt gag aag att aaa gca gcc
tat 328Thr Tyr Asp Phe Thr Asn Cys Asp Phe Glu Lys Ile Lys Ala Ala
Tyr 30 35 40ctc agt act att tct aaa gac ctg att aca tat atg agt ggg
acc aaa 376Leu Ser Thr Ile Ser Lys Asp Leu Ile Thr Tyr Met Ser Gly
Thr Lys 45 50 55agt acc gag ttc aac aac acc gtc tct tgt agc aat cgg
cca cat tgc 424Ser Thr Glu Phe Asn Asn Thr Val Ser Cys Ser Asn Arg
Pro His Cys60 65 70 75ctt act gaa atc cag agc cta acc ttc aat ccc
acc gcc ggc tgc gcg 472Leu Thr Glu Ile Gln Ser Leu Thr Phe Asn Pro
Thr Ala Gly Cys Ala 80 85 90tcg ctc gcc aaa gaa atg ttc gcc atg aaa
act aag gct gcc tta gct 520Ser Leu Ala Lys Glu Met Phe Ala Met Lys
Thr Lys Ala Ala Leu Ala 95 100 105atc tgg tgc cca ggc tat tcg gaa
act cag ata aat gct act cag gca 568Ile Trp Cys Pro Gly Tyr Ser Glu
Thr Gln Ile Asn Ala Thr Gln Ala 110 115 120atg aag aag agg aca acc
aat aaa tgt ctg gaa caa gtg tca caa tta 616Met Lys Lys Arg Thr Thr
Asn Lys Cys Leu Glu Gln Val Ser Gln Leu 125 130 135caa gga ttg tgg
cgt cgc ttc aat cga cct tta ctg aaa caa cag taa 664Gln Gly Leu Trp
Arg Arg Phe Asn Arg Pro Leu Leu Lys Gln Gln140 145 150accatcttta
ttatggtcat atttcacagc ccaaaataaa tcatctttat taagtaaaaa 724aaaa
72816154PRTHomo sapiens 16Met Phe Pro Phe Ala Leu Leu Tyr Val Leu
Ser Val Ser Phe Arg Lys1 5 10 15Ile Phe Ile Leu Gln Leu Val Gly Leu
Val Leu Thr Tyr Asp Phe Thr 20 25 30Asn Cys Asp Phe Glu Lys Ile Lys
Ala Ala Tyr Leu Ser Thr Ile Ser 35 40 45Lys Asp Leu Ile Thr Tyr Met
Ser Gly Thr Lys Ser Thr Glu Phe Asn 50 55 60Asn Thr Val Ser Cys Ser
Asn Arg Pro His Cys Leu Thr Glu Ile Gln65 70 75 80Ser Leu Thr Phe
Asn Pro Thr Ala Gly Cys Ala Ser Leu Ala Lys Glu 85 90 95Met Phe Ala
Met Lys Thr Lys Ala Ala Leu Ala Ile Trp Cys Pro Gly 100 105 110Tyr
Ser Glu Thr Gln Ile Asn Ala Thr Gln Ala Met Lys Lys Arg Thr 115 120
125Thr Asn Lys Cys Leu Glu Gln Val Ser Gln Leu Gln Gly Leu Trp Arg
130 135 140Arg Phe Asn Arg Pro Leu Leu Lys Gln Gln145
15017159PRTHomo sapiensmisc_feature(127)..(129)"Xaa" is one or more
amino acids that is not Arg or Lys. 17Met Phe Pro Phe Ala Leu Leu
Tyr Val Leu Ser Val Ser Phe Arg Lys1 5 10 15Ile Phe Ile Leu Gln Leu
Val Gly Leu Val Leu Thr Tyr Asp Phe Thr 20 25 30Asn Cys Asp Phe Glu
Lys Ile Lys Ala Ala Tyr Leu Ser Thr Ile Ser 35 40 45Lys Asp Leu Ile
Thr Tyr Met Ser Gly Thr Lys Ser Thr Glu Phe Asn 50 55 60Asn Thr Val
Ser Cys Ser Asn Arg Pro His Cys Leu Thr Glu Ile Gln65 70 75 80Ser
Leu Thr Phe Asn Pro Thr Ala Gly Cys Ala Ser Leu Ala Lys Glu 85 90
95Met Phe Ala Met Lys Thr Lys Ala Ala Leu Ala Ile Trp Cys Pro Gly
100 105 110Tyr Ser Glu Thr Gln Ile Asn Ala Thr Gln Ala Met Lys Lys
Xaa Xaa 115 120 125Xaa Arg Lys Val Thr Thr Asn Lys Cys Leu Glu Gln
Val Ser Gln Leu 130 135 140Gln Gly Leu Trp Arg Arg Phe Asn Arg Pro
Leu Leu Lys Gln Gln145 150 15518160PRTHomo
sapiensmisc_feature(130)..(130)Xaa is one or more amino acids that
is not Arg or Lys. 18Met Phe Pro Phe Ala Leu Leu Tyr Val Leu Ser
Val Ser Phe Arg Lys1 5 10 15Ile Phe Ile Leu Gln Leu Val Gly Leu Val
Leu Thr Tyr Asp Phe Thr 20 25 30Asn Cys Asp Phe Glu Lys Ile Lys Ala
Ala Tyr Leu Ser Thr Ile Ser 35 40 45Lys Asp Leu Ile Thr Tyr Met Ser
Gly Thr Lys Ser Thr Glu Phe Asn 50 55 60Asn Thr Val Ser Cys Ser Asn
Arg Pro His Cys Leu Thr Glu Ile Gln65 70 75 80Ser Leu Thr Phe Asn
Pro Thr Ala Gly Cys Ala Ser Leu Ala Lys Glu 85 90 95Met Phe Ala Met
Lys Thr Lys Ala Ala Leu Ala Ile Trp Cys Pro Gly 100 105 110Tyr Ser
Glu Thr Gln Ile Asn Ala Thr Gln Ala Met Lys Lys Arg Arg 115 120
125Lys Xaa Arg Lys Val Thr Thr Asn Lys Cys Leu Glu Gln Val Ser Gln
130 135 140Leu Gln Gly Leu Trp Arg Arg Phe Asn Arg Pro Leu Leu Lys
Gln Gln145 150 155 1601921DNAHomo sapiens 19gtcgacgcca ccatgttccc t
212028DNAHomo sapiens 20atgaagaaga ggacaaccaa taaatgtc
282128DNAHomo sapiens 21gacatttatt ggttgtcctc ttcttcat
282221DNAHomo sapiens 22agcggccgct catttgtcgt c 21
* * * * *