U.S. patent application number 16/947021 was filed with the patent office on 2021-03-04 for stable igg4 antibodies.
This patent application is currently assigned to GENMAB A/S. The applicant listed for this patent is GENMAB A/S. Invention is credited to Rob AALBERSE, Paul PARREN, Janine SCHUURMAN, Jan VAN DE WINKEL, Marijn VAN DER NEUT KOLFSCHOTEN, Tom VINK.
Application Number | 20210061919 16/947021 |
Document ID | / |
Family ID | 1000005222084 |
Filed Date | 2021-03-04 |
![](/patent/app/20210061919/US20210061919A1-20210304-D00001.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00002.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00003.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00004.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00005.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00006.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00007.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00008.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00009.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00010.png)
![](/patent/app/20210061919/US20210061919A1-20210304-D00011.png)
View All Diagrams
United States Patent
Application |
20210061919 |
Kind Code |
A1 |
VAN DE WINKEL; Jan ; et
al. |
March 4, 2021 |
STABLE IgG4 ANTIBODIES
Abstract
The present invention relates to novel stabilized IgG4
antibodies, to methods of producing such antibodies and to uses of
such antibodies as a medicament. In a main aspect, the invention
relates to a stabilized IgG4 antibody, comprising a heavy chain and
a light chain, wherein said heavy chain comprises a human IgG4
constant region having a substitution of the Arg residue at
position (409), the Phe residue at position (405) or the Lys
residue at position (370).
Inventors: |
VAN DE WINKEL; Jan; (Zeist,
NL) ; VINK; Tom; (Alphen aan den Rijn, NL) ;
SCHUURMAN; Janine; (Diemen, NL) ; PARREN; Paul;
(Odijk, NL) ; AALBERSE; Rob; (Duivendrecht,
NL) ; VAN DER NEUT KOLFSCHOTEN; Marijn; (Amsterdam,
NL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
GENMAB A/S |
Copenhagen V |
|
DK |
|
|
Assignee: |
GENMAB A/S
Copenhagen V
DK
|
Family ID: |
1000005222084 |
Appl. No.: |
16/947021 |
Filed: |
July 15, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15197496 |
Jun 29, 2016 |
10752695 |
|
|
16947021 |
|
|
|
|
13912581 |
Jun 7, 2013 |
|
|
|
15197496 |
|
|
|
|
12602439 |
Jul 1, 2010 |
|
|
|
PCT/DK2008/050129 |
May 30, 2008 |
|
|
|
13912581 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 47/6849 20170801;
C07K 2317/53 20130101; A61K 51/1021 20130101; C07K 16/18 20130101;
C07K 2317/94 20130101; A61K 51/1006 20130101; A61K 47/6845
20170801; A61K 51/1027 20130101; A61K 47/6835 20170801; C07K 16/28
20130101; A61K 47/6803 20170801; C07K 2317/24 20130101; C07K
2317/55 20130101; C07K 2317/21 20130101; C07K 16/2863 20130101;
A61K 51/103 20130101; A61K 51/10 20130101; C07K 16/00 20130101;
A61K 47/6813 20170801; C07K 16/16 20130101; A61K 47/6839 20170801;
C07K 2317/526 20130101; A61K 51/1039 20130101; A61K 2039/505
20130101; C07K 2317/31 20130101; C07K 16/2887 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 51/10 20060101 A61K051/10; C07K 16/00 20060101
C07K016/00; A61K 47/68 20060101 A61K047/68; C07K 16/16 20060101
C07K016/16; C07K 16/18 20060101 C07K016/18 |
Foreign Application Data
Date |
Code |
Application Number |
May 31, 2007 |
DK |
PA 2007 00792 |
May 31, 2007 |
DK |
PA 2007 00793 |
Jul 6, 2007 |
DK |
PA2007 01002 |
Claims
1-75. (canceled)
76. A stabilized IgG4 antibody, comprising a heavy chain and a
light chain, wherein each of the heavy chain and the light chain
comprises a variable region and a constant region, wherein the
heavy chain constant region is a human IgG4 constant region
comprising a substitution of the Arg residue at EU index position
409 selected from the group consisting of: a Lys, Thr, Met or Leu
residue, and wherein the antibody does not comprise a
Cys-Pro-Pro-Cys sequence in the hinge region, wherein optionally
the heavy chain constant region further comprises: a) a
substitution of the Lys residue at EU index position 370 with a Thr
residue; b) a substitution of the Phe residue at EU index position
405 with an Ala or Leu residue; c) a substitution of the Phe
residue at EU index position 234 with an Ala residue; d) a
substitution of the Gly residue at EU index position 236 with an
Ala residue; e) a substitution of the Gly residue at EU index
position 237 with an Ala residue; f) a substitution of the Asn
residue at EU index position 297 with an Ala residue; g) a
substitution of the Glu residue at EU index position 318 with an
Ala or Val residue; h) a substitution of the Lys residue at EU
index position 320 with an Ala residue; and/or i) a substitution of
the Lys residue at EU index position 322 with an Ala or Gln
residue, wherein the antibody has reduced ability to induce Fab-arm
exchange in vivo.
77. The stabilized IgG4 antibody of claim 76, wherein the antibody
has a Cys-Pro-Ser-Cys sequence (SEQ ID NO: 51) in the hinge region
at EU index positions 226-229.
78. The stabilized IgG4 antibody of claim 76, wherein the Arg
residue at EU index position 409 is substituted with a Lys.
79. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Lys residue at EU index position
370 and a substitution of the Phe residue at EU index position
405.
80. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Lys residue at EU index position
370 with a Thr residue and a substitution of the Phe residue at EU
index position 405 with an Ala or Leu residue.
81. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Phe residue at EU index position
234 with an Ala residue.
82. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Gly residue at EU index position
236 with an Ala residue.
83. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Gly residue at EU index position
237 with an Ala residue.
84. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Asn residue at EU index position
297 with an Ala residue.
85. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Glu residue at EU index position
318 with an Ala or Val residue.
86. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Lys residue at EU index position
320 with an Ala residue.
87. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a substitution of the Lys residue at EU index position
322 with an Ala or Gln residue.
88. The stabilized IgG4 antibody of claim 76, wherein the antibody
has reduced effector functions.
89. The stabilized IgG4 antibody of claim 88, wherein the heavy
chain constant region comprises a) a substitution of the Phe
residue at EU index position 234 with an Ala residue; b) a
substitution of the Gly residue at EU index position 236 with an
Ala residue; c) a substitution of the Gly residue at EU index
position 237 with an Ala residue; d) a substitution of the Asn
residue at EU index position 297 with an Ala residue; e) a
substitution of the Glu residue at EU index position 318 with an
Ala or Val residue; f) a substitution of the Lys residue at EU
index position 320 with an Ala residue; and g) a substitution of
the Lys residue at EU index position 322 with an Ala or Gln
residue.
90. The stabilized IgG4 antibody of claim 76, wherein the antibody
is selected from the group consisting of: a human antibody, a
humanized antibody, and a chimeric antibody.
91. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a human kappa light chain.
92. The stabilized IgG4 antibody of claim 76, wherein the antibody
comprises a human lambda light chain.
93. The stabilized IgG4 antibody of claim 76, wherein the antibody
is a full-length antibody.
94. The stabilized IgG4 antibody of claim 76, wherein the antibody
is linked to a cytotoxic agent; a radioisotope; a prodrug; or a
drug.
95. The stabilized IgG4 antibody of claim 76, wherein the antibody
binds erythropoietin, beta amyloid, thrombopoietin,
interferon-alpha (2a and 2b), interferon-beta (1b), interferon
gamma, TNFR I (CD120a), TNFR II (CD120b), IL-1 R type 1 (CD121a),
IL-1 R type 2 (CD121b), IL-2, IL2R (CD25), IL-2R-beta (CD123),
IL-3, IL-4, IL-3R (CD123), IL-4R (CD124), IL-5R (CD125),
IL-6R-alpha (CD126), IL-6R-beta (CD130), IL-8, IL-10, IL-11, IL-15,
IL-15BP, IL-15R, IL-20, IL-21, TCR variable chain, RANK, RANK-L,
CTLA4, CXCR4R, CCR5R, TGF-beta1, TGF-beta2, TGF-beta3, G-CSF,
GM-CSF, MIF-R (CD74), M-CSF-R (CD115), GM-CSFR (CD116), soluble
FcRI, sFcRII, sFcRIII, FcRn, Factor VII, Factor VIII, Factor IX,
VEGF, VEGFxxxb, alpha-4 integrin, Cd11a, CD18, CD20, CD38, CD25,
CD74, FcalphaRI, FcepsilonRI, acetyl choline receptor, fas, fasL,
TRAIL, hepatitis virus, hepatitis C virus, envelope E2 of hepatitis
C virus, tissue factor, a complex of tissue factor and Factor VII,
EGFr, CD4, CD28, VLA-1, VLA-2, VLA-3, VLA-4, LFA-1, MAC-1,
I-selectin, PSGL-1, ICAM-I, P-selectin, periostin, CD33 (Siglec 3),
Siglec 8, TNF, CCL1, CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL17,
CCL18, CCL20, CCL22, CCL26, CCL27, CX3CL1, LIGHT, EGF, TGFalpha,
HGF, PDGF, NGF, complement, C1q, C4, C2, C3, C5, C6, C7, C8, C9,
MBL, factor B, a Matrix Metallo Protease, any of MMP1 to MMP28,
CD32b, CD200, CD200R, Killer Immunoglobulin-Like Receptors (KIRs),
NKG2D, leukocyte-associated immunoglobulin-like receptors (LAIRs),
1y49, PD-L2, CD26, BST-2, ML-IAP (melanoma inhibitor of apoptosis
protein), cathepsin D, CD40, CD40R, CD86, a B cell receptor, CD79,
PD-1, or a T cell receptor.
96. A pharmaceutical composition comprising the stabilized IgG4
antibody of claim 76.
Description
[0001] All patents, patent applications and other publications
cited herein are hereby incorporated by reference in their
entirety.
RELATED APPLICATIONS
[0002] This is a continuation of U.S. application Ser. No.
13/912,581 filed Jun. 7, 2013, which is a Division of U.S.
application Ser. No. 12/602,439 filed Jul. 1, 2010, which is a
National Stage Entry of PCT/DK2008/050129 filed May 30, 2008, and
claims the benefit of priority of Denmark Patent Application No. PA
2007 00792 filed May 31, 2007, Denmark Patent Application No. PA
2007 00793 filed May 31, 2007, and Denmark Patent Application No.
PA 2007 01002 filed Jul. 6, 2007, all of which are incorporated
herein by reference in their entirety.
FIELD OF THE INVENTION
[0003] The present invention relates to novel stabilized IgG4
antibodies, to methods of producing such antibodies and to uses of
such antibodies as a medicament.
BACKGROUND OF THE INVENTION
[0004] Antibodies are being used as therapeutic agents for a number
of diseases and disorders, including cancer and autoimmune
diseases. Antibodies are immunoglobulins that recognize specific
antigens and mediate their effects via several mechanisms,
including inhibition of ligand-receptor interactions, inhibition of
receptor activation, mediation of receptor internalization and
activation of effector functions, such as complement-dependent
cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity
(ADCC). There are five classes of immunoglobulins: IgG, IgA, IgM,
IgD and IgE. The IgG class is further divided into subclasses IgG1,
IgG2, IgG3 and IgG4.
[0005] Human IgG4 molecules are heterogeneous and exist in various
molecular forms, which differ by the absence or presence of
inter-heavy chain disulphide bonds located in the hinge region.
Thus, IgG4 molecules exist in forms in which either both or none of
the inter-heavy chain disulphide bonds have been formed, a process
which is in equilibrium (Schuurman et al. (2001) Mol Immunol 38:1;
Bloom et al (1997) Protein Sci 6:407.). The form lacking
inter-heavy chain disulphide bonds consists of one heavy chain and
one light chain, and is termed "half-molecule" or "Fab arm" herein.
The heterogeneity of IgG4s is believed to be related to the core
sequence of the IgG4 hinge region which, instead of Cys-Pro-Pro-Cys
(SEQ ID NO:50), as in IgG1 and IgG2, consists of Cys-Pro-Ser-Cys
(SEQ ID NO:51), which is believed to be a more flexible structure.
Data that support the role of the core hinge sequence in this
heterogeneity of IgG4 have been reported by Angal et al. (1993) Mol
Immunol 30:105. In this study, it was shown that by replacement of
a Ser residue in the hinge region to a Pro residue, thus changing
the core hinge sequence to Cys-Pro-Pro-Cys (SEQ ID NO:50) (which is
identical to that of IgG1 and IgG2), the presence of IgG4 half
molecules was abolished.
[0006] It has been known for several years that IgG4 antibodies,
unlike other IgG subclasses, behave as monovalent molecules in
interactions with antigen. It was found that serum-derived human
IgG4 cannot precipitate purified antigen, because it cannot
crosslink. While such serum-derived IgG4 is functionally monovalent
(Aalberse et al. (1983) J Immunol 130:722; van der Zee et al.
(1986) J Immunol 137:3566), recombinantly produced, isolated IgG4,
in contrast, is behaving bivalently in interactions with antigens
(Schuurman et al (1999) Immunology 97:693). Furthermore, IgG4
antibodies with bispecific reactivity were shown to exist in sera
from allergic patients expressing large amounts of IgG4 antibodies
against two different antigens (Schuurman et al (1999) Immunology
97:693; Aalberse and Schuurman (2002) Immunology 105:9; Aalberse et
al (1999) Int Arch Allergy Immunol 118:187). On basis of these
observations, it was hypothesized that IgG4 antibodies can exchange
`half-molecules`, an activity termed Fab arm exchange herein.
[0007] Several different allotypes of human IgG4 have been found to
exist. One of these allotypes contains a Leu residue at position
309 and a Lys residue at position 409, which in other allotypes is
an Arg residue (Brusco et al (1998) Eur 3 Immunogen 25:349). In
WO2006/033386, it has been shown that an IgG4 antibody could be
rendered more stable at low pH by introduction of an Arg to Lys
mutation at position 409 into an antibody context that also
contained mutations of the hinge region, including the above
mentioned mutation of the core sequence to Cys-Pro-Pro-Cys (SEQ ID
NO:50).
[0008] IgG4 antibodies have a poor ability to induce complement and
cell activation because of a low affinity for C1q and Fc-receptors.
This makes IgG4 the preferred isotype for development of
immunotherapies in which recruitment of host effector functions is
not desired.
[0009] However, for any therapeutic use of an antibody, a high
degree of in vivo stability of the antibody is desired.
SUMMARY OF THE INVENTION
[0010] It is demonstrated in the present patent application that
administration of two recombinant monoclonal IgG4 antibodies having
different antigen-binding specificities to a mouse leads to in vivo
formation of bispecific antibodies. The phenomenon can be
reproduced in vitro by incubating IgG4 antibodies with cells or
under reducing conditions. It was shown that IgG4 antibodies having
different antigen-binding specificities engage in Fab arm exchange
which is stochastic and in which all IgG4 molecules seem to
participate.
[0011] Thus IgG4 antibodies form bispecific antibodies without
concomitant formation of aggregates.
[0012] IgG4 antibodies therefore have unusual properties which are
undesirable in vivo: IgG4 antibodies are unstable, dynamic,
molecules which engage in Fab arm exchange. An administered
therapeutic IgG4 antibody may exchange with endogenous IgG4
antibodies with undesired specificities. The random nature of this
process introduces unpredictability which is highly undesirable for
human immunotherapy.
[0013] The present invention relates to stabilized forms of IgG4
antibodies that have a reduced ability to undergo Fab-arm exchange.
It has surprisingly been found that substitution of the Arg residue
at position 409 or the Phe residue at position 405 in human IgG4
can prevent Fab arm exchange, and thus stabilize IgG4, even in the
absence of a mutation of the core hinge region sequence to
Cys-Pro-Pro-Cys (SEQ ID NO:50). This was unexpected, because it was
believed that elimination of the flexibility of the hinge region
via a change of the core hinge sequence to Cys-Pro-Pro-Cys (SEQ ID
NO:50) was a requirement for prevention of half-molecule
exchange.
[0014] Accordingly, in a main aspect, the invention relates to a
stabilized IgG4 antibody for use as a medicament, comprising a
heavy chain and a light chain, wherein said heavy chain comprises a
human IgG4 constant region having a substitution of the Arg residue
at position 409, the Phe residue at position 405 or the Lys residue
at position 370, wherein said antibody optionally comprises one or
more further substitutions, deletions and/or insertions, with the
proviso that if the antibody has a residue selected from the group
consisting of: Lys, Ala, Thr, Met and Leu at the position
corresponding to 409, then the antibody does not comprise a
Cys-Pro-Pro-Cys sequence (SEQ ID NO:50) in the hinge region.
[0015] The substitutions at positions 409, 405 and 370 can be
present individually or in any combination.
[0016] In a main embodiment, the invention relates to an isolated
stabilized IgG4 antibody for use as a medicament, comprising a
heavy chain and a light chain, wherein said heavy chain comprises a
human IgG4 constant region having a residue selected from the group
consisting of: Lys, Ala, Thr, Met and Leu at the position
corresponding to 409 and/or a residue selected from the group
consisting of: Ala, Val, Gly, Ile and Leu at the position
corresponding to 405, and wherein said antibody optionally
comprises one or more further substitutions, deletions and/or
insertions, but does not comprise a Cys-Pro-Pro-Cys sequence (SEQ
ID NO:50) in the hinge region.
[0017] In several embodiments, the antibodies used in the invention
have the advantage that they contain a minimal number of sequence
changes in the constant region as compared to naturally occurring
IgG4. This reduces the risk of immunogenicity when the antibody is
used for human therapy.
[0018] In one particular embodiment, the constant region of the
stabilized IgG4 antibody of the invention is even identical to that
of the above mentioned Lys409 allotype described by Brusco et al.
(1998) Eur J Immunogen 25:349. Thus, in that particular embodiment,
the constant region of the antibody is identical to antibodies
found naturally in humans.
BRIEF DESCRIPTION OF THE FIGURES
[0019] FIG. 1. SDS-Page analysis of purified recombinant IgG1 and
IgG4. After purification, the Betv1 and Feld1, IgG1 and IgG4
antibodies were analyzed on non-reducing SDS-PAGE.
[0020] FIG. 2. Bispecific IgG levels in nu/nu Balb/c mice at
different time points. The amount of bispecific IgG as determined
in the heterologous cross-linking assay was plotted versus the
amount of Bet v 1 specific IgG as determined in the Bet v 1 binding
test. Data from IgG1 and IgG4 containing plasma samples are
represented by open symbols and closed symbols, respectively. The
dashed line represents the calculated amount of bispecific IgG, if
the exchange of IgG half molecules is random and complete.
[0021] FIGS. 3A and 3B. Bispecific human IgG4 molecules are
generated in vivo. FIG. 3A: Groups (n=5) of SCID mice were injected
with chimeric antibody mixtures: 100 .mu.g IgG1-Betv1/100 .mu.g
IgG1-Feld1 (squares), 100 .mu.g IgG4-Betv1/100 .mu.g IgG4-Feld1
(circles), or 100 pg IgG4-Betv1/100 .mu.g IgG4-Feld1+2,000 .mu.g
irrelevant recombinant IgG4 (IgG4-EGFR; triangles). Generation of
bispecific antibodies was followed in time by assessing the
bispecific activity to Bet v 1 and Fel d 1 in plasma. The fraction
of bispecific IgG relative to the total IgG-Bet v 1 concentration
was expressed as percentage. The arrow with asterisk indicates the
bispecific reactivity level expected in mice receiving
IgG4-Betv1/IgG4-Feld1 in the presence of excess irrelevant IgG4
(4%), the arrow without asterisk that in mice receiving
IgG4-Betv1/IgG4-Feld1 mixture (50%). Error bars represent SEM. FIG.
3B: Monospecific cross-linking activity was tested by assessing
cross-linking of radiolabeled Fel d 1 to Fel d 1-coupled Sepharose
in mouse plasma. Monospecific reactivity was expressed as the ratio
between the amount of radiolabeled Fel d 1 bound by cross-linking
and total IgG-Feld1 in order to correct for the clearance of IgG.
Error bars represent SEM.
[0022] FIG. 4. SEC analysis of bispecific activity in murine
plasma
[0023] Plasma (10 p1) drawn at t=24 h from a mouse dosed with an
IgG4 mix was fractionated on a Superdex200 column. The mouse was
dosed with a mix containing 300 .mu.g of Bet v 1 binding IgG4 and
300 .mu.g of Fel d 1 binding IgG4. In the fractions, the
concentration of Fel d 1 specific IgG (.box-solid.) was measured in
the antigen binding test and the concentration of bispecific IgG
Bet v 1-Fel d 1 (.circle-solid.) was determined in the Bet v 1-Fel
d 1 cross-linking assay. Calibration of this column using IVIg has
revealed that monomeric, dimeric and aggregated IgG elute at 12.9,
11.0 and 8.4 ml, respectively (data not shown).
[0024] FIGS. 5A-C. Fab arm exchange of IgG in whole blood
components
[0025] Exchange of IgG4 and IgG1 was evaluated by incubating
chimeric IgG mixtures in whole blood, blood cells, plasma and serum
for 24 h at 37.degree. C., after which bispecific activity in the
heterologous cross-linking assay (Fel d 1-Bet v 1) was measured.
Blood was obtained from two donors: donor A (black bars) and donor
B (grey bars). Bispecific activities were determined in mixtures
supplemented with chimeric IgG4 (FIG. 5A), chimeric IgG1 (FIG. 5B)
or without the addition of IgG (FIG. 5C). All presented data were
measured after 24 h of incubation at 37.degree. C.
[0026] FIG. 6. Fab arm exchange of IgG by human blood cells
[0027] Fab arm exchange of IgG4 (black bars) and IgG1 (grey bars)
was evaluated by incubating chimeric IgG mixtures with mononuclear
cells (MNC), thrombocytes (Thr) and erythrocytes (Ery) for 48 h at
37.degree. C., after which bispecific activity in the heterologous
cross-linking assay (Fel d 1-Bet v 1) was measured. As a control,
the antibody mixtures were also incubated in serum free culture
medium (SFC). Bispecificity is expressed as percentage
.sup.1251-Bet v 1 bound relative to amount added.
[0028] FIG. 7. Fab arm exchange of IgG4 by HEK and murine cell
lines
[0029] Fab arm exchange of IgG4 half molecules was evaluated by
incubating a chimeric IgG4 mixture with HEK cells, murine B cells
(J558) or hybridoma cells at 37.degree. C. Bispecific activity in
the heterologous cross-linking assay (Fel d 1-Bet v 1) was measured
in samples of 1 .mu.l drawn at t=0 h (gray bars) and at t=24 h
(black bars). Bispecificity is expressed as percentage
.sup.1251-Bet v 1 bound relative to amount added.
[0030] FIG. 8. Erythrocyte-mediated Fab arm exchange of IgG4
[0031] Incubation of IgG4-Betv1/IgG4-Feld1 mixtures with freshly
purified erythrocytes (ery, closed symbols) resulted in the
generation of bispecific antibodies, whereas no bispecificity was
observed for the mixture of the IgG1 isotypes. As control, antibody
mixtures were incubated in PBS without erythrocytes (open symbols).
The arrow indicates the maximal expected percentage of bispecific
IgG (50%). Error bars represent range of duplicate
measurements.
[0032] FIGS. 9A and 9B. Absence of Fab arm exchange of IgG4 in
PBS
[0033] Fab arm exchange in PBS of IgG1 (white bars), IgG4 (grey
bars) and IgG4 in the presence of excess irrelevant IgG4 (black
bars) was evaluated by measuring bispecific activity, bivalency and
antigen binding. FIG. 9A: The exchange of IgG Fab arms was
calculated from the concentration of bispecific IgG (as determined
in the heterologous cross-linking assay) and the maximal expected
concentration of bispecific IgG if the exchange of IgG half
molecules is random and complete. The Fab arm exchange is expressed
as percentage of the maximal exchange, being 100%. FIG. 9B: Fel d 1
bivalency in time is depicted, which was measured in the homologous
cross-linking assay. The concentration of bivalent IgG was
normalized by setting the concentration of bivalent IgG at t=0 at
100%.
[0034] FIG. 10. Fab arm exchange of IgG4 by erythrocyte lysate
[0035] Fab arm exchange of IgG4 was evaluated by incubating a
chimeric IgG4 mixture in lysate from erythrocytes at 37.degree. C.
IgG4 was incubated with increasing dilutions of lysate. Bispecific
activity in the heterologous cross-linking assay (Bet v 1-Fel d 1)
was measured in samples drawn at indicated time points.
Bispecificity is expressed as percentage .sup.125I-Bet v 1 bound
relative to amount added.
[0036] FIG. 11. SEC analysis of bispecific activity induced by
erythrocyte lysate
[0037] IgG4 was incubated with freshly prepared erythrocyte lysate
at 37.degree. C. for 24 h and subsequently fractionated on a
Superdex200 column, which was run at 0.5 ml/min on an AKTA HPLC
unit (Amersham Biosciences, Uppsala, Sweden). In the fractions the
concentration of Bet v 1 specific IgG (.box-solid.) was measured in
the antigen binding test and the concentration of bispecific IgG
Fel d 1-Bet v 1 (.circle-solid.) was determined in the Bet v 1-Fel
d 1 cross-linking assay. Calibration of this column has revealed
that monomeric, dimeric and aggregated IgG elute at 12.1, 10.3 and
8.3 ml, respectively (data not shown).
[0038] FIG. 12. GSH mediated Fab arm exchange of IgG4
[0039] GSH mediated exchange of IgG4 Fab arms was evaluated by
incubating IgG4 in the presence of increasing concentrations of GSH
in PBS/Azide. At indicated time points samples were drawn in which
antigen binding and bispecific activity was measured. The exchange
of IgG4 Fab arms was calculated from the measured concentration of
bispecific IgG (as determined in the heterologous cross-linking
assay) and the maximal expected concentration of bispecific IgG4 if
the exchange of IgG4 Fab arms is random and complete. The exchange
was expressed as percentage of the maximal exchange, set at
100%.
[0040] FIG. 13. SEC of GSH mediated Fab arm exchange of IgG4 half
molecules
[0041] IgG4 was incubated with GSH (0.5 mM) and subsequently
fractionated on a Superdex200 column, which was run at 0.5 ml/min
on an AKTA HPLC unit (Amersham Biosciences, Uppsala, Sweden). In
the fractions the concentration of Bet v 1 specific IgG
(.box-solid.) was measured in the antigen binding test and the
concentration of bispecific IgG Fel d 1-Bet v 1 (.circle-solid.)
was determined in the Bet v 1-Fel d 1 cross-linking assay.
Calibration of this column has revealed that monomeric, dimeric and
aggregated IgG elute at 12.1, 10.3 and 8.3 ml, respectively (data
not shown).
[0042] FIG. 14. Temperature dependence of GSH mediated Fab arm
exchange of IgG4. IgG4-Betv1 and IgG4-Feld1 mixtures were incubated
in PBS with GSH at indicated temperatures. At t=0 h (gray bars) and
t=24 h (black bars) concentrations of bispecific IgG4 were
assessed. From these data the fraction of bispecific IgG relative
to the IgG4 Betv1 concentration was calculated and expressed as
percentage. Error bars represent range of duplicate
measurements.
[0043] FIG. 15. IgG4 Fab arm exchange mediated by a panel of
reducing agents. IgG4-Betv1 and IgG4-Feld1 in PBS were incubated in
the presence of different agents (all reducing, except GSSG) for 24
h at 37.degree. C. The concentration of Bet v 1 specific IgG was
measured in the Bet v 1 binding assay and the concentration of
bispecific IgG was measured in the heterologous cross-linking assay
(Fel d 1-Bet v 1). The percentage of bispecific IgG relative to the
IgG-Betv1 concentration was calculated. Standard error bars
represent SEM calculated from three measurements.
[0044] FIGS. 16A-F. Fab arm exchange of fully human IgG4 antibodies
using GSH
[0045] FIG. 16A: IgG4-CD20/IgG4-EGFr or IgG1-CD20/IgG1-EGFr
mixtures were incubated at 37.degree. C. with or without 0.5 mM
GSH. Samples were taken at indicated time points. The formation of
bispecific antibodies was measured in a sandwich ELISA. Y-axis
indicates the optical density at 405 nm as a measurement of the
formation of bispecific CD20/EGFR antibodies.
[0046] FIG. 16B: GSH-dose dependent Fab arm exchange of IgG4. A
mixture of IgG4-CD20 and IgG4-EGFr was incubated for 24 h at
37.degree. C. with concentrations of GSH as indicated. The
formation of bispecific antibodies was measured in a sandwich
ELISA. The optical density at 405 nm is plotted on the Y-axis as a
measurement of the formation of bispecific CD20/EGFR
antibodies.
[0047] FIG. 16C: GSH-mediated exchange of IgG4 Fab arms is
influenced by the components used in the reaction, and occurs in
culture medium (Freestyle 293) at lower GSH concentrations.
[0048] FIG. 16D: GSH-mediated Fab arm exchange of IgG4 is higher at
0.5 mM GSH than at 5 mM GSH.
[0049] FIGS. 16E-F: Detection of Fab arm exchange between IgG4-EGFR
and IgG4-CD20 by ESI-TOF mass spectrometry. An IgG4 mixture was
incubated for 24 hours in the absence (FIG. 16E) or presence (FIG.
16F) of 0.5 mM GSH, after which the antibodies were deglycosylated
with PNGase F and the molecular weights of the resulting antibodies
were determined by ESI-TOF mass spectrometry. Shown are the
deconvoluted ESI-TOF spectra. Data are representative of 2
experiments.
[0050] FIG. 17. Rhesus monkey IVIg participates in Fab arm exchange
of recombinant human IgG4 antibodies. Mixtures of two recombinant
human IgG4 antibodies (IgG4-CD20 and IgG4-EGFr) were incubated with
GSH for 24 h at 37.degree. C., in the presence or absence of rhesus
monkey or human IVIg. The formation of bispecific antibodies
through Fab arm exchange was measured in a sandwich ELISA.
[0051] FIG. 18. GSH mediated Fab arm exchange of IgG1 mutants
[0052] The effect of GSH concentration on the Fab arm exchange from
different IgG1 mutants was tested using 0, 0.1, 1 and 10 mM GSH.
All references to CPSC in FIG. 18 refer to SEQ ID NO:51. Fab arm
exchange was tested using the following mixtures: [0053] IgG4
anti-feld1 wt with IgG4 anti-betv1 wt (indicated as IgG4 wt in FIG.
18) [0054] IgG1 anti-feld1 wt with IgG4 anti-betv1 wt (indicated as
IgG1 wt) [0055] IgG1 anti-feld1 CPSC with IgG1 anti-betv1 CPSC
(indicated as IgG1-CPSC) [0056] IgG1 anti-feld1 CH3(IgG4) with IgG1
anti-betv1 CH3(IgG4) (indicated as IgG1-CH3 (IgG4)) [0057] IgG1
anti-feld1 CPSC/CH3(IgG4) with anti-betv1 IgG1 CPSC/CH3(IgG4)
(indicated as IgG1-CPSC-CH3 (IgG4))
[0058] FIG. 19. Schematic representation of constructs for IgG1 and
IgG4 containing mutations in the core hinge and/or CH3 domain.
[0059] FIG. 20. Fab arm exchange of IgG1 and IgG4 hinge region or
CH3 domain mutants.
[0060] FIG. 21. Binding of hingeless IgG4 antibody 2F8-HG and CH3
mutants 2F8-HG-F405L, 2F8-HG-F405A, 2F8-HG-R409A and 2F8-HG-R409K
to EGFr. Binding was tested in an EGFR ELISA in the presence and
absence of polyclonal human IgG (IVIG).
[0061] FIG. 22. Sequence alignment of anti-EGFr antibody 2F8 in a
IgG1, IgG4 and (partial) IgG3 backbone. Amino acid numbering
according to Kabat and according to the EU-index are depicted (both
described in Kabat et al., Sequences of Proteins of Immunological
Interest, 5th Ed. Public Health Service, National Institutes of
Health, Bethesda, Md. (1991)).
[0062] FIG. 23. Fab arm exchange of CH3 domain mutants of human
IgG4 antibodies. Mixtures of two recombinant human IgG4 antibodies
(IgG4-CD20 and IgG4-EGFr) and CH3 domain mutants thereof were
incubated with 0.5 mM GSH for 24 h at 37.degree. C. The formation
of bispecific antibodies through Fab arm exchange was measured in a
sandwich ELISA.
[0063] FIG. 24. Shows the location of primers used for the
preparation of DNA constructs.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0064] The term "immunoglobulin" refers to a class of structurally
related glycoproteins consisting of two pairs of polypeptide
chains, one pair of light (L) low molecular weight chains and one
pair of heavy (H) chains, all four inter-connected by disulfide
bonds. The structure of immunoglobulins has been well
characterized. See for instance Fundamental Immunology Ch. 7 (Paul,
W., ed., 2nd ed. Raven Press, N.Y. (1989)). Briefly, each heavy
chain typically is comprised of a heavy chain variable region
(abbreviated herein as VH or VH) and a heavy chain constant region.
The heavy chain constant region typically is comprised of three
domains, C.sub.H1, C.sub.H2, and C.sub.H3. Each light chain
typically is comprised of a light chain variable region
(abbreviated herein as V.sub.L or VL) and a light chain constant
region. The light chain constant region typically is comprised of
one domain, C.sub.L. The V.sub.H and V.sub.L regions may be further
subdivided into regions of hypervariability (or hypervariable
regions which may be hypervariable in sequence and/or form of
structurally defined loops), also termed complementarity
determining regions (CDRs), interspersed with regions that are more
conserved, termed framework regions (FRs). Each V.sub.H and V.sub.L
is typically composed of three CDRs and four FRs, arranged from
amino-terminus to carboxy-terminus in the following order: FR1,
CDR1, FR2, CDR2, FR3, CDR3, FR4 (see also Chothia and Lesk J. Mol.
Biol. 196, 901-917 (1987)).
[0065] Often, the numbering of amino acid residues is performed by
the method described in Kabat et al., Sequences of Proteins of
Immunological Interest, 5th Ed. Public Health Service, National
Institutes of Health, Bethesda, Md. (1991). Using this numbering
system, the actual linear amino acid sequence of a peptide may
contain fewer or additional amino acids corresponding to a
shortening of, or insertion into, a FR or CDR of the variable
domain. For example, a heavy chain variable domain may include a
single amino acid insert (residue 52a according to Kabat) after
residue 52 of V.sub.H CDR2 and inserted residues (for instance
residues 82a, 82b, and 82c, etc. according to Kabat) after heavy
chain FR residue 82. The Kabat numbering of residues may be
determined for a given antibody by alignment at regions of homology
of the sequence of the antibody with a "standard" Kabat numbered
sequence.
[0066] Alternatively, the numbering of amino acid residues is
performed by the EU-index also described in Kabat et al., Sequences
of Proteins of Immunological Interest, 5th Ed. Public Health
Service, National Institutes of Health, Bethesda, Md. (1991). This
numbering is often used in literature dealing with the Fc part of
human immunoglobulin G molecules and is also used throughout this
application.
[0067] FIG. 22 gives an overview of both numbering methods and
shows an alignment of different antibody isotypes based on
anti-EGFR antibody 2F8.
[0068] The term "antibody" (Ab) in the context of the present
invention refers to an immunoglobulin molecule, a fragment of an
immunoglobulin molecule, or a derivative of either thereof, which
has the ability to specifically bind to an antigen under typical
physiological conditions with a half life of significant periods of
time, such as at least about 30 minutes, at least about 45 minutes,
at least about one hour, at least about two hours, at least about
four hours, at least about 8 hours, at least about 12 hours, about
24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or
more days, etc., or any other relevant functionally-defined period
(such as a time sufficient to induce, promote, enhance, and/or
modulate a physiological response associated with antibody binding
to the antigen and/or time sufficient for the antibody to recruit
an Fc-mediated effector activity). The variable regions of the
heavy and light chains of the immunoglobulin molecule contain a
binding domain that interacts with an antigen. The constant regions
of the antibodies (Abs) may mediate the binding of the
immunoglobulin to host tissues or factors, including various cells
of the immune system (such as effector cells) and components of the
complement system such as C1q, the first component in the classical
pathway of complement activation. As indicated above, the term
antibody herein, unless otherwise stated or clearly contradicted by
context, includes fragments of an antibody that comprise a mutated
or wildtype core hinge region and retain the ability to
specifically bind to the antigen.
[0069] It has been shown that the antigen-binding function of an
antibody may be performed by fragments of a full-length antibody.
Although such fragments are generally included within the meaning
of antibody, they collectively and each independently are unique
features of the present invention, exhibiting different biological
properties and utility. It also should be understood that the term
antibody, unless specified otherwise, also includes polyclonal
antibodies, monoclonal antibodies (mAbs), antibody-like
polypeptides, such as chimeric antibodies and humanized antibodies,
and antibody fragments retaining the ability to specifically bind
to the antigen (antigen-binding fragments) provided by any known
technique, such as enzymatic cleavage, peptide synthesis, and
recombinant techniques.
[0070] The term "human antibody", as used herein, is intended to
include antibodies having variable and constant regions derived
from human germline immunoglobulin sequences. The human antibodies
of the invention may include amino acid residues not encoded by
human germline immunoglobulin sequences (e.g., mutations introduced
by random or site-specific mutagenesis in vitro or by somatic
mutation in vivo). However, the term "human antibody", as used
herein, is not intended to include antibodies in which CDR
sequences derived from the germline of another mammalian species,
such as a mouse, have been grafted onto human framework
sequences.
[0071] The term "chimeric antibody" refers to an antibody that
contains one or more regions from one antibody and one or more
regions from one or more other antibodies. The term "chimeric
antibody" includes divalent and polyvalent antibodies. Chimeric
antibodies are produced by recombinant processes well known in the
art (see for instance Cabilly et al., PNAS USA 81, 3273-3277
(1984), Morrison et al., PNAS USA 81, 6851-6855 (1984), Boulianne
et al., Nature 312, 643-646 (1984), EP125023, Neuberger et al.,
Nature 314, 268-270 (1985), EP171496, EP173494, WO86/01533,
EP184187, Sahagan et al., 3. Immunol. 137, 1066-1074 (1986),
WO87/02671, Liu et al., PNAS USA 84, 3439-3443 (1987), Sun et al.,
PNAS USA 84, 214-218 (1987), Better et al., Science 240, 1041-1043
(1988) and Harlow et al., Antibodies: A Laboratory Manual, Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.,
(1988)).
[0072] A "humanized antibody" is an antibody that is derived from a
non-human species, in which certain amino acids in the framework
and constant domains of the heavy and light chains have been
mutated so as to avoid or abrogate an immune response in humans.
Humanized forms of non-human (for instance murine) antibodies are
chimeric antibodies which contain minimal sequence derived from
non-human immunoglobulin. For the most part, humanized antibodies
are human immunoglobulins (recipient antibody) in which residues
from a hypervariable region of the recipient are replaced by
residues from a hypervariable region of a non-human species (donor
antibody) such as mouse, rat, rabbit or nonhuman primate having the
desired specificity, affinity, and capacity. In some instances, Fv
framework region (FR) residues of the human immunoglobulin are
replaced by corresponding non-human residues. Furthermore,
humanized antibodies may comprise residues which are not found in
the recipient antibody or in the donor antibody. These
modifications are made to further refine antibody performance. In
general, a humanized antibody will comprise substantially all of at
least one, and typically two, variable domains, in which all or
substantially all of the hypervariable loops correspond to those of
a non-human immunoglobulin and all or substantially all of the FR
regions are those of a human immunoglobulin sequence. A humanized
antibody typically also will comprise at least a portion of an
immunoglobulin constant region (Fc), typically that of a human
immunoglobulin. For further details, see Jones et al., Nature 321,
522-525 (1986), Riechmann et al., Nature 332, 323-329 (1988) and
Presta, Curr. Op. Struct. Biol. 2, 593-596 (1992).
[0073] An "isolated antibody" as used herein, is intended to refer
to an antibody which is substantially free of other antibodies
having different antigenic specificities. An isolated antibody that
specifically binds to an epitope, isoform or variant of a
particular human target antigen may, however, have cross-reactivity
to other related antigens, for instance from other species (such as
species homologs). Moreover, an isolated antibody may be
substantially free of other cellular material and/or chemicals.
[0074] The terms "monoclonal antibody" or "monoclonal antibody
composition" as used herein refer to a preparation of antibody
molecules of single molecular composition. A monoclonal antibody
composition displays a single binding specificity and affinity for
a particular epitope. Accordingly, the term "human monoclonal
antibody" refers to antibodies displaying a single binding
specificity which have variable and constant regions derived from
human germline immunoglobulin sequences. The human monoclonal
antibodies may be generated by a hybridoma which includes a B cell
obtained from a transgenic or transchromosomal nonhuman animal,
such as a transgenic mouse, having a genome comprising a human
heavy chain transgene and a light chain transgene, fused to an
immortalized cell.
[0075] As used herein, the term "binding" in the context of the
binding of an antibody to a predetermined antigen typically is a
binding with an affinity corresponding to a K.sub.D of about
10.sup.-7 M or less, such as about 10.sup.-8 M or less, such as
about 10.sup.-9 M or less, about 10.sup.-10 M or less, or about
10.sup.-11 M or even less when determined by for instance surface
plasmon resonance (SPR) technology in a BIAcore 3000 instrument
using the antigen as the ligand and the antibody as the analyte,
and binds to the predetermined antigen with an affinity
corresponding to a K.sub.D that is at least ten-fold lower, such as
at least 100 fold lower, for instance at least 1000 fold lower,
such as at least 10,000 fold lower, for instance at least 100,000
fold lower than its affinity for binding to a non-specific antigen
(e.g., BSA, casein) other than the predetermined antigen or a
closely-related antigen. The amount with which the affinity is
lower is dependent on the K.sub.D of the antibody, so that when the
K.sub.D of the antibody is very low (that is, the antibody is
highly specific), then the amount with which the affinity for the
antigen is lower than the affinity for a non-specific antigen may
be at least 10,000 fold.
[0076] The term "k.sub.d" (sec.sup.-1), as used herein, refers to
the dissociation rate constant of a particular antibody-antigen
interaction. Said value is also referred to as the k.sub.off
value.
[0077] The term "k.sub.a" (M.sup.-1.times.sec.sup.-1), as used
herein, refers to the association rate constant of a particular
antibody-antigen interaction.
[0078] The term "K.sub.D" (M), as used herein, refers to the
dissociation equilibrium constant of a particular antibody-antigen
interaction.
[0079] The term "K.sub.A" (M.sup.-1), as used herein, refers to the
association equilibrium constant of a particular antibody-antigen
interaction and is obtained by dividing the k.sub.a by the
k.sub.d.
[0080] As used herein, "isotype" refers to the immunoglobulin
(sub)class, for instance IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or
IgM, that is encoded by heavy chain constant region genes.
[0081] As used herein, a human antibody is "derived from" a
particular germline sequence if the antibody is obtained from a
system using human immunoglobulin sequences, for instance by
immunizing a transgenic mouse carrying human immunoglobulin genes
or by screening a human immunoglobulin gene library, and wherein
the selected human antibody is at least 90%, such as at least 95%,
for instance at least 96%, such as at least 97%, for instance at
least 98%, or such as at least 99% identical in amino acid sequence
to the amino acid sequence encoded by the germline immunoglobulin
gene. Typically, outside the heavy chain CDR3, a human antibody
derived from a particular human germline sequence will display no
more than 20 amino acid differences, e.g. no more than 10 amino
acid differences, such as no more than 5, for instance no more than
4, 3, 2, or 1 amino acid difference from the amino acid sequence
encoded by the germline immunoglobulin gene.
[0082] The term "bispecific antibody" is intended to include any
antibody, which has two different binding specificities, i.e. the
antibody binds two different epitopes, which may be located on the
same target antigen or, more commonly, on different target
antigens.
[0083] As used herein, the term "effector cell" refers to an immune
cell which is involved in the effector phase of an immune response,
as opposed to the cognitive and activation phases of an immune
response. Exemplary immune cells include a cell of a myeloid or
lymphoid origin, for instance lymphocytes (such as B cells and T
cells including cytolytic T cells (CTLs)), killer cells, natural
killer cells, macrophages, monocytes, eosinophils,
polymorphonuclear cells, such as neutrophils, granulocytes, mast
cells, and basophils. Some effector cells express specific Fc
receptors and carry out specific immune functions. In some
embodiments, an effector cell is capable of inducing
antibody-dependent cellular cytotoxicity (ADCC), such as a natural
killer cell, capable of inducing ADCC. For example, monocytes,
macrophages, which express FcR are involved in specific killing of
target cells and presenting antigens to other components of the
immune system, or binding to cells that present antigens. In some
embodiments, an effector cell may phagocytose a target antigen or
target cell. The expression of a particular FcR on an effector cell
may be regulated by humoral factors such as cytokines. For example,
expression of FcyRI has been found to be up-regulated by interferon
.gamma. (IFN-.gamma.) and/or G-CSF. This enhanced expression
increases the cytotoxic activity of Fc.gamma.RI-bearing cells
against targets. An effector cell can phagocytose or lyse a target
antigen or a target cell.
[0084] "Treatment" refers to the administration of an effective
amount of a therapeutically active compound of the present
invention with the purpose of easing, ameliorating, arresting or
eradicating (curing) symptoms or disease states.
[0085] An "effective amount" refers to an amount effective, at
dosages and for periods of time necessary, to achieve a desired
therapeutic result. A therapeutically effective amount of an
antibody may vary according to factors such as the disease state,
age, sex, and weight of the individual, and the ability of the
antibody to elicit a desired response in the individual. A
therapeutically effective amount is also one in which any toxic or
detrimental effects of the antibody or antibody portion are
outweighed by the therapeutically beneficial effects.
[0086] The terms "half-molecule exchange" and "Fab arm exchange"
are used interchangeably herein and refer to a type of protein
modification for human IgG4, in which an IgG4 heavy chain and
attached light chain (half-molecule) is swapped for a heavy-light
chain pair from another IgG4 molecule. Thus, IgG4 molecules may
acquire two distinct Fab arms recognizing two distinct antigens
(resulting in bispecific molecules) while their Fc domain structure
remains unchanged. As shown herein, Fab arm exchange occurs
naturally in vivo and can be induced in vitro by purified blood
cells or reducing agents such as reduced glutathione.
Further Aspects and Embodiments of the Invention
[0087] As described above, in a first main aspect, the invention
relates to a stabilized IgG4 antibody for use as a medicament,
comprising a heavy chain and a light chain, wherein said heavy
chain comprises a human IgG4 constant region having a substitution
of the Arg residue at position 409, the Phe residue at position 405
or the Lys residue at position 370, wherein said antibody
optionally comprises one or more further substitutions, deletions
and/or insertions, with the proviso that if the antibody has a
residue selected from the group consisting of: Lys, Ala, Thr, Met
and Leu at the position corresponding to 409, then the antibody
does not comprise a Cys-Pro-Pro-Cys sequence (SEQ ID NO:50) in the
hinge region.
[0088] In one embodiment, the antibody, comprises a heavy chain and
a light chain, wherein said heavy chain comprises a human IgG4
constant region having a residue selected from the group consisting
of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409
and/or a residue selected from the group consisting of: Ala, Val,
Gly, Ile and Leu at the position corresponding to 405, and wherein
said antibody optionally comprises one or more further
substitutions, deletions and/or insertions, but does not comprise a
Cys-Pro-Pro-Cys sequence (SEQ ID NO:50) in the hinge region.
[0089] The numbers 405 and 409 refer to the Phe and Lys residues at
positions 405 and 409, respectively, using the numbering according
to the EU index, see also Example 38 and FIG. 22.
[0090] In a further main aspect, the invention relates to an
isolated stabilized IgG4 antibody, comprising a heavy chain and a
light chain, wherein said heavy chain comprises a human IgG4
constant region having a residue selected from the group consisting
of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409
and/or a residue selected from the group consisting of: Ala, Val,
Gly, Ile and Leu at the position corresponding to 405, and wherein
said antibody optionally comprises further substitutions, deletions
and/or insertions, but does not comprise a Cys-Pro-Pro-Cys sequence
(SEQ ID NO:50) in the hinge region and does not comprise both a Lys
at position 409 and a Leu at position 309.
[0091] In one embodiment, said antibody comprises a Lys, Ala, Thr,
Met or Leu residue at the position corresponding to 409.
[0092] In another embodiment, said antibody comprises a Lys, Thr,
Met or Leu residue at the position corresponding to 409.
[0093] In a further embodiment, said antibody comprises a Lys, Met
or Leu residue at the position corresponding to 409.
[0094] In a yet other embodiment, the CH3 region of the antibody
has been replaced by the CH3 region of human IgG1, of human IgG2 or
of human IgG3.
[0095] In a further embodiment of the stabilized IgG4 antibody of
the invention, the antibody has a residue which is has a lower mass
(in Da) than Phe at the position corresponding to 405.
[0096] In a further embodiment, said antibody comprises an Ala,
Val, Gly, Ile or Leu residue at the position corresponding to
405.
[0097] In an even further embodiment, said antibody comprises an
Ala or Leu residue at the position corresponding to 405.
[0098] In a further embodiment of the stabilized IgG4 antibody of
the invention, the antibody has a Thr residue at the position
corresponding to 370.
[0099] In an even further embodiment, the stabilized IgG4 antibody
of the invention does not comprise a substitution of the Leu
residue at the position corresponding to 235 by a Glu.
[0100] However, in another embodiment, said antibody does comprise
a substitution of the Leu residue at the position corresponding to
235 by a Glu.
[0101] In a further embodiment, the antibody of the invention may
have been further modified to even further reduce effector
functions.
[0102] Accordingly, in one embodiment, the antibody of the
invention comprises one or more of the following substitutions: an
Ala at position 234, an Ala at position 236, an Ala at position
237, an Ala at position 297, an Ala or Val at position 318, an Ala
at position 320, an Ala or Gln at position 322.
[0103] In another embodiment, the stabilized IgG4 antibody of the
invention does not comprise a Cys-Pro-Pro-Cys sequence (SEQ ID
NO:50) in the hinge region.
[0104] In one embodiment, the stabilized IgG4 antibody of the
invention comprises a CXPC or CPXC sequence in the hinge region,
wherein X can be any amino acid except for proline.
[0105] In a further embodiment, the antibody of the invention does
not comprise a CPRC sequence in the core hinge region and/or does
not comprise an extended IgG3-like hinge region, such as the
extended hinge region as set forth in FIG. 22 (between positions
228 and 229 in IgG3).
[0106] In one embodiment, the stabilized IgG4 antibody of the
invention comprises a CPSC sequence (SEQ ID NO:51) in the hinge
region.
[0107] As explained above, the antibody of the invention may
contain further modifications. In one embodiment, the stabilized
IgG4 antibody of the invention comprises a constant heavy chain
region comprising an amino acid sequence selected from the group
consisting of: SEQ ID NO:39, 40 and 41 or a variant of said amino
acid sequence having less than 25, such as less than 10, e.g. less
than 9, 8, 7, 6, 5, 4, 3, or 2 substitutions, deletions and/or
insertions compared to said amino acid sequence.
[0108] Typically, the stabilized IgG4 antibody of the invention has
a lower ability to activate effector functions as compared to IgG1
and IgG3, Thus, in one embodiment, said antibody is less efficient
in mediating CDC and/or ADCC than a corresponding IgG1 or IgG3
antibody having the same variable regions. Assays for measuring CDC
or ADCC activity are well known in the art.
[0109] In one embodiment, the stabilized IgG4 antibody of the
invention comprises a constant heavy chain region comprising the
amino acid sequence set forth in SEQ ID NO:40.
[0110] In one embodiment of the invention, the stabilized IgG4
antibody is selected from the group consisting of: a human
antibody, a humanized antibody and a chimeric antibody.
[0111] In one further embodiment, the antibody of the invention
comprises a human kappa light chain. In another embodiment, said
antibody comprises a human lambda light chain.
[0112] Typically, the stabilized IgG4 antibody of the invention is
a bivalent antibody, for example an antibody which is bivalent even
in the presence of excess of irrelevant antibodies, as explained in
Example 38. Furthermore, the stabilized IgG4 antibody of the
invention is preferably a full-length antibody, i.e. not a
fragment.
[0113] Methods for the production of antibodies are well-known in
the art. In a preferred embodiment, antibodies of the invention are
monoclonal antibodies. Monoclonal antibodies may e.g. be produced
by the hybridoma method first described by Kohler et al., Nature
256, 495 (1975), or may be produced by recombinant DNA methods.
Monoclonal antibodies may also be isolated from phage antibody
libraries using the techniques described in, for example, Clackson
et al., Nature 352, 624-628 (1991) and Marks et al., J. Mol. Biol.
222, 581-597 (1991). Monoclonal antibodies may be obtained from any
suitable source. Thus, for example, monoclonal antibodies may be
obtained from hybridomas prepared from murine splenic B cells
obtained from mice immunized with an antigen of interest, for
instance in form of cells expressing the antigen on the surface, or
a nucleic acid encoding an antigen of interest. Monoclonal
antibodies may also be obtained from hybridomas derived from
antibody-expressing cells of immunized humans or non-human mammals
such as rats, dogs, primates, etc.
[0114] Further modifications, such as amino acid substitutions,
deletions or insertion as described above, may be performed using
standard recombinant DNA techniques well-known in the art.
[0115] In one embodiment, the antibody of the invention is a human
antibody. Human monoclonal antibodies directed may be generated
using transgenic or transchromosomal mice carrying parts of the
human immune system rather than the mouse system. Such transgenic
and transchromosomic mice include mice referred to herein as HuMAb
mice and KM mice, respectively, and are collectively referred to
herein as "transgenic mice".
[0116] The HuMAb mouse contains a human immunoglobulin gene
miniloci that encodes unrearranged human heavy (.mu. and .gamma.)
and .kappa. light chain immunoglobulin sequences, together with
targeted mutations that inactivate the endogenous .mu. and .kappa.
chain loci (Lonberg, N. et al., Nature 368, 856-859 (1994)).
Accordingly, the mice exhibit reduced expression of mouse IgM or
.kappa. and in response to immunization, the introduced human heavy
and light chain transgenes, undergo class switching and somatic
mutation to generate high affinity human IgG,.kappa. monoclonal
antibodies (Lonberg, N. et al. (1994), supra; reviewed in Lonberg,
N. Handbook of Experimental Pharmacology 113, 49-101 (1994),
Lonberg, N. and Huszar, D., Intern. Rev. Immunol. Vol. 13 65-93
(1995) and Harding, F. and Lonberg, N. Ann. N.Y. Acad. Sci 764
536-546 (1995)). The preparation of HuMAb mice is described in
detail in Taylor, L. et al., Nucleic Acids Research 20, 6287-6295
(1992), Chen, 3. et al., International Immunology 5, 647-656
(1993), Tuaillon et al., J. Immunol. 152, 2912-2920 (1994), Taylor,
L. et al., International Immunology 6, 579-591 (1994), Fishwild, D.
et al., Nature Biotechnology 14, 845-851 (1996). See also U.S. Pat.
Nos. 5,545,806, 5,569,825, 5,625,126, 5,633,425, 5,789,650,
5,877,397, 5,661,016, 5,814,318, 5,874,299, 5,770,429, 5,545,807,
WO 98/24884, WO 94/25585, WO 93/1227, WO 92/22645, WO 92/03918 and
WO 01/09187.
[0117] The HCo7 mice have a JKD disruption in their endogenous
light chain (kappa) genes (as described in Chen et al., EMBO 3. 12,
821-830 (1993)), a CMD disruption in their endogenous heavy chain
genes (as described in Example 1 of WO 01/14424), a KCo5 human
kappa light chain transgene (as described in Fishwild et al.,
Nature Biotechnology 14, 845-851 (1996)), and a HCo7 human heavy
chain transgene (as described in U.S. Pat. No. 5,770,429).
[0118] The HCo12 mice have a JKD disruption in their endogenous
light chain (kappa) genes (as described in Chen et al., EMBO J. 12,
821-830 (1993)), a CMD disruption in their endogenous heavy chain
genes (as described in Example 1 of WO 01/14424), a KCo5 human
kappa light chain transgene (as described in Fishwild et al.,
Nature Biotechnology 14, 845-851 (1996)), and a HCo12 human heavy
chain transgene (as described in Example 2 of WO 01/14424).
[0119] In the KM mouse strain, the endogenous mouse kappa light
chain gene has been homozygously disrupted as described in Chen et
al., EMBO 3. 12, 811-820 (1993) and the endogenous mouse heavy
chain gene has been homozygously disrupted as described in Example
1 of WO 01/09187. This mouse strain carries a human kappa light
chain transgene, KCo5, as described in Fishwild et al., Nature
Biotechnology 14, 845-851 (1996). This mouse strain also carries a
human heavy chain transchromosome composed of chromosome 14
fragment hCF (SC20) as described in WO 02/43478.
[0120] Splenocytes from these transgenic mice may be used to
generate hybridomas that secrete human monoclonal antibodies
according to well known techniques. Such transgenic non-human
animals, non-human animals comprising an operable nucleic acid
sequence coding for expression of antibody used in the invention,
non-human animals stably transfected with one or more
target-encoding nucleic acid sequences, and the like, are
additional features of the present invention.
[0121] Human monoclonal or polyclonal antibodies to be used in the
present invention, or antibodies used in the present invention
originating from other species may also be generated transgenically
through the generation of another non-human mammal or plant that is
transgenic for the immunoglobulin heavy and light chain sequences
of interest and production of the antibody in a recoverable form
therefrom. In connection with the transgenic production in mammals,
antibodies may be produced in, and recovered from, the milk of
goats, cows, or other mammals. See for instance U.S. Pat. Nos.
5,827,690, 5,756,687, 5,750,172 and 5,741,957.
[0122] Further, human or other antibodies to be used in the present
invention may be generated through display-type technologies,
including, without limitation, phage display, retroviral display,
ribosomal display, and other techniques, using techniques well
known in the art and the resulting molecules may be subjected to
additional maturation, such as affinity maturation, as such
techniques are well known in the art (see for instance Hoogenboom
et al., J. Mol. Biol. 227, 381 (1991) (phage display), Vaughan et
al., Nature Biotech 14, 309 (1996) (phage display), Hanes and
Pluckthun, PNAS USA 94, 4937-4942 (1997) (ribosomal display),
Parmley and Smith, Gene 73, 305-318 (1988) (phage display), Scott
TIBS 17, 241-245 (1992), Cwirla et al., PNAS USA 87, 6378-6382
(1990), Russel et al., Nucl. Acids Research 21, 1081-1085 (1993),
Hoogenboom et al., Immunol. Reviews 130, 43-68 (1992), Chiswell and
McCafferty TIBTECH 10, 80-84 (1992), and U.S. Pat. No. 5,733,743).
If display technologies are utilized to produce antibodies that are
not human, such antibodies may be humanized.
[0123] In a further main aspect, the invention relates to a method
for producing a stabilized IgG4 antibody of the invention, said
method comprising expressing a nucleic acid construct encoding said
antibody in a host cell and optionally purifying said antibody. In
one embodiment of this method, said stabilized IgG4 antibody does
not comprise both a Lys at position 409 and a Leu at position
309.
[0124] In one embodiment, the antibody of the invention is linked
to a compound selected from the group consisting of: a cytotoxic
agent; a radioisotope; a prodrug or drug, such as a taxane; a
cytokine; and a chemokine. Methods for linking (conjugating) such
compounds to an antibody are well-known in the art. References to
suitable methods have been given in WO 2004/056847 (Genmab).
[0125] In a further main aspect, the invention relates to a
pharmaceutical composition comprising a stabilized IgG4 antibody as
defined herein above. The pharmaceutical compositions may be
formulated with pharmaceutically acceptable carriers or diluents as
well as any other known adjuvants and excipients in accordance with
conventional techniques, such as those disclosed in Remington: The
Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack
Publishing Co., Easton, Pa., 1995.
[0126] The pharmaceutically acceptable carriers or diluents as well
as any other known adjuvants and excipients should be suitable for
the chosen compound of the present invention and the chosen mode of
administration. Suitability for carriers and other components of
pharmaceutical compositions is determined based on the lack of
significant negative impact on the desired biological properties of
the chosen compound or pharmaceutical composition of the present
invention (e.g., less than a substantial impact (10% or less
relative inhibition, 5% or less relative inhibition, etc.) on
antigen binding.
[0127] A pharmaceutical composition of the present invention may
also include diluents, fillers, salts, buffers, detergents (e. g.,
a nonionic detergent, such as Tween-80), stabilizers, stabilizers
(e. g., sugars or protein-free amino acids), preservatives, tissue
fixatives, solubilizers, and/or other materials suitable for
inclusion in a pharmaceutical composition.
[0128] Actual dosage levels of the active ingredients in the
pharmaceutical compositions of the present invention may be varied
so as to obtain an amount of the active ingredient which is
effective to achieve the desired therapeutic response for a
particular patient, composition, and mode of administration,
without being toxic to the patient. The selected dosage level will
depend upon a variety of pharmacokinetic factors including the
activity of the particular compositions of the present invention
employed, or the ester, salt or amide thereof, the route of
administration, the time of administration, the rate of excretion
of the particular compound being employed, the duration of the
treatment, other drugs, compounds and/or materials used in
combination with the particular compositions employed, the age,
sex, weight, condition, general health and prior medical history of
the patient being treated, and like factors well known in the
medical arts.
[0129] A physician or veterinarian having ordinary skill in the art
can readily determine and prescribe the effective amount of the
pharmaceutical composition required. For example, the physician or
veterinarian could start doses of the compounds of the invention
employed in the pharmaceutical composition at levels lower than
that required in order to achieve the desired therapeutic effect
and gradually increase the dosage until the desired effect is
achieved. In general, a suitable daily dose of a composition of the
invention will be that amount of the compound which is the lowest
dose effective to produce a therapeutic effect. Such an effective
dose will generally depend upon the factors described above. It is
preferred that administration be intravenous, intramuscular,
intraperitoneal, by inhalation or subcutaneous. If desired, the
effective daily dose of a therapeutic composition may be
administered as two, three, four, five, six or more sub-doses
administered separately at appropriate intervals throughout the
day, optionally, in unit dosage forms.
[0130] In one embodiment, a pharmaceutical composition of the
present invention is administered parenterally. The phrases
"parenteral administration" and "administered parenterally" as used
herein means modes of administration other than enteral and topical
administration, usually by injection, and include epidermal,
intravenous, intramuscular, intraarterial, intrathecal,
intracapsular, intraorbital, intracardiac, intradermal,
intraperitoneal, intratendinous, transtracheal, subcutaneous,
subcuticular, intraarticular, subcapsular, subarachnoid,
intraspinal, intracranial, intrathoracic, epidural and intrasternal
injection and infusion.
[0131] Stabilized IgG4 antibodies of the invention can be used in
the treatment and/or prevention of a number of diseases, and be
directed to an antigen selected from a broad variety of suitable
target molecules. In one embodiment of the invention, the antibody
binds an antigen selected from the group consisting of:
erythropoietin, beta-amyloid, thrombopoietin, interferon-alpha (2a
and 2b), interferon-beta (ib), interferon-gamma, TNFR I (CD120a),
TNFR II (CD120b), IL-1R type 1 (CD121a), IL-1R type 2 (CD121b),
IL-2, IL2R (CD25), IL-2R-beta (CD123), IL-3, IL-4, IL-3R (CD123),
IL-4R (CD124), IL-5R (CD125), IL-6R-alpha (CD126), -beta (CD130),
IL-8, IL-10, IL-11, IL-15, IL-15BP, IL-15R, IL-20, IL-21, TCR
variable chain, RANK, RANK-L, CTLA4, CXCR4R, CCR5R, TGF-beta1,
-beta2, -beta3, G-CSF, GM-CSF, MIF-R (CD74), M-CSF-R (CD115),
GM-CSFR (CD116), soluble FcRI, sFcRII, sFcRIII, FcRn, Factor VII,
Factor VIII, Factor IX, VEGF, VEGFxxxb, alpha-4 integrin, Cd11a,
CD18, CD20, CD38, CD25, CD74, FcalphaRI, FcepsilonRI, acetyl
choline receptor, fas, fasL, TRAIL, hepatitis virus, hepatitis C
virus, envelope E2 of hepatitis C virus, tissue factor, a complex
of tissue factor and Factor VII, EGFr, CD4, CD28, VLA-1, 2, 3, or
4, LFA-1, MAC-1, l-selectin, PSGL-1, ICAM-I, P-selectin, periostin,
CD33 (Siglec 3), Siglec 8, TNF, CCL1, CCL2, CCL3, CCL4, CCL5,
CCL11, CCL13, CCL17, CCL18, CCL20, CCL22, CCL26, CCL27, CX3CL1,
LIGHT, EGF, VEGF, TGFalpha, HGF, PDGF, NGF, complement or a related
components such as: C1q, C4, C2, C3, C5, C6, C7, C8, C9, MBL,
factor B, a Matrix Metallo Protease such as any of MMP1 to MMP28,
CD32b, CD200, CD200R, Killer Immunoglobulin-Like Receptors (KIRs),
NKG2D and related molecules, leukocyte-associated
immunoglobulin-like receptors (LAIRs), ly49, PD-L2, CD26, BST-2,
ML-IAP (melanoma inhibitor of apoptosis protein), cathepsin D,
CD40, CD4OR, CD86, a B cell receptor, CD79, PD-1, and a T cell
receptor.
[0132] In one embodiment of the invention, the antibody binds an
alpha-4 integrin and is for use in the treatment of inflammatory
and autoimmune diseases, such as rheumatoid arthritis, multiple
sclerosis, inflammatory bowel disease, asthma and sepsis.
[0133] In another embodiment of the invention, the antibody binds
VLA-1, 2, 3, or 4 and is for use in the treatment of inflammatory
and autoimmune diseases, such as rheumatoid arthritis, multiple
sclerosis, inflammatory bowel disease, asthma, type-1 diabetes,
SLE, psoriasis, atopic dermatitis, COPD and sepsis.
[0134] In another embodiment of the invention, the antibody binds a
molecule selected from the group consisting of: LFA-1, MAC-1,
1-selectin and PSGL-1 and is for use in the treatment of
inflammatory and autoimmune diseases, such as rheumatoid arthritis,
multiple sclerosis, inflammatory bowel disease, asthma, type-1
diabetes, SLE, psoriasis, atopic dermatitis, and COPD.
[0135] In another embodiment of the invention, the antibody binds a
molecule selected from the group consisting of: LFA-1, MAC-1,
1-selectin and PSGL-1 and is for use in the treatment of a disease
selected from the group consisting of ischemia-reperfusion injury,
cytic fibrosis, osteomyelitis, glomerulonepritis, gout and
sepsis.
[0136] In another embodiment of the invention, the antibody binds
CD18 and is for use in the treatment of inflammatory and autoimmune
diseases, such as rheumatoid arthritis, multiple sclerosis,
inflammatory bowel disease, asthma, type-1 diabetes, SLE,
psoriasis, atopic dermatitis and COPD.
[0137] In another embodiment of the invention, the antibody binds
Cd11a and is for use in the treatment of inflammatory and
autoimmune diseases, such as rheumatoid arthritis, multiple
sclerosis, inflammatory bowel disease, asthma, type-1 diabetes,
SLE, psoriasis, atopic dermatitis and COPD.
[0138] In another embodiment of the invention, the antibody binds
ICAM-1 and is for use in the treatment of inflammatory and
autoimmune diseases, such as rheumatoid arthritis, multiple
sclerosis, inflammatory bowel disease, asthma, type-1 diabetes,
SLE, psoriasis, atopic dermatitis and COPD.
[0139] In another embodiment of the invention, the antibody binds
P-selectin and is for use in the treatment of cardiovascular
diseases, post-thrombotic vein wall fibrosis, ischemia reperfusion
injury, inflammatory diseases or sepsis.
[0140] In another embodiment of the invention, the antibody binds
periostin and is for use in the treatment of malignant diseases
and/or metastising diseases, such as ovary cancer, endometrial
cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer,
OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer,
thymoma, lung cancer, skin cancer, larynx cancer, liver cancer,
parotid tumors, gastric cancer, esophagus cancer, prostate cancer,
bladder cancer and cancer of the testis.
[0141] In another embodiment of the invention, the antibody binds
CD33 (Siglec 3), is optionally coupled to a toxin, cytotoxic or
cytostatic drug, and is for use in the treatment of tumors
expressing CD33 or acute myeloid leukemia.
[0142] In another embodiment of the invention, the antibody binds
Siglec 8 and is for use in the treatment of: asthma, inflammatory
or autoimmune diseases, such as rheumatoid arthritis, multiple
sclerosis, inflammatory bowel disease, asthma, type-1 diabetes,
SLE, psoriasis, atopic dermatitis and COPD.
[0143] In another embodiment of the invention, the antibody binds
nucleolin and is for use in the treatment of malignant diseases
and/or metastising diseases, such as ovary cancer, cervical cancer,
endometrial cancer, NSCLC, glioblastoma, brain-related tumors,
breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney
cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver
cancer, parotid tumors, gastric cancer, oesophagus cancer, prostate
cancer, bladder cancer, cancer of the testis and lymphomas.
[0144] In another embodiment of the invention, the antibody binds
TNF and is for use in the treatment of: inflammatory and autoimmune
diseases, such as rheumatoid arthritis, multiple sclerosis,
inflammatory bowel disease, asthma, type-1 diabetes, SLE,
psoriasis, atopic dermatitis, COPD and sepsis.
[0145] In another embodiment of the invention, the antibody binds
CCL1, CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL17, CCL18, CCL20,
CCL22, CCL26, CCL27 or CX3CL1 and is for use in the treatment of::
atopic dermatitis, inflammatory and autoimmune diseases, such as
rheumatoid arthritis, multiple sclerosis, inflammatory bowel
disease, asthma, type-1 diabetes, SLE, psoriasis, COPD and
sepsis.
[0146] In another embodiment of the invention, the antibody binds
PD-1 and is for use in restoring T cell function in HIV-1 infection
and therapy of AIDS.
[0147] In another embodiment of the invention, the antibody binds
LIGHT and is for use in the treatment of a disease selected from
the group consisting of: hepatitis, inflammatory bowel disease,
graft-versus-host disease (GVHD) and inflammation.
[0148] In another embodiment of the invention, the antibody binds
EGF, VEGF, TGFalpha or HGF and is for use in the treatment of:
malignant diseases, such as solid cancers.
[0149] In another embodiment of the invention, the antibody binds
PDGF and is for use in the treatment of: diseases in which abnormal
cell proliferation cell migration and/or angiogenesis occurs, such
as atherosclerosis, fibrosis, and malignant diseases.
[0150] In another embodiment of the invention, the antibody binds
NGF and is for use in the treatment of: neurological diseases,
neurodegenerative diseases, such as Alzheimer's disease and
Parkinson's disease, or cancer, such as prostate cancer.
[0151] In another embodiment of the invention, the antibody binds
complement or a related components such as: C1q, C4, C2, C3, C5,
C6, C7, C8, C9, MBL, or factor B and is for use in: diseases in
which complement and related components play a detrimental role,
such as organ transplant rejection, multiple sclerosis,
Guillain-Barre syndrome, hemolytic anemia, Paroxysmal Nocturnal
Hemoglobinuria, stroke, heart attacks, burn injuries, age-related
macular degeneration, asthma, lupus, arthritis, myasthenia gravis,
anti-phospholipid syndrome, sepsis and ischemia reperfusion
injury.
[0152] In another embodiment of the invention, the antibody binds a
Matrix Metallo Protease such as any of MMP1 to MMP28 and is for use
in the treatment of: inflammatory and autoimmune diseases, cancer,
including metastatic cancer; arthritis, inflammation,
cardiovascular diseases, cerebrovascular diseases such as stroke or
cerebral aneurysms, pulmonary diseases such as asthma, ocular
diseases such as corneal wound healing or degenerative genetic eye
diseases, gastrointestinal diseases such as inflammatory bowel
disease or ulcers, oral diseases such as dental caries, oral cancer
or periodontitis, ischemia reperfusion injury or sepsis.
[0153] In another embodiment of the invention, the antibody binds
CD32b and is for use in enhancement of T-cell responses to tumor
antigens and ADCC/phagocytosis by macrophages, in combination with
another therapeutic antibody; vaccination, immunotherapy of B-cell
lymphoma's, asthma or allergy.
[0154] In another embodiment of the invention, the antibody binds
CD200 or CD200R and is for use in the treatment of: asthma,
rheumatoid arthritis, GVHD, other autoimmune diseases, or cancer,
such as solid tumors or lymphomas.
[0155] In another embodiment of the invention, the antibody binds
Killer Immunoglobulin-Like Receptors (KIRs), NKG2D or related
molecules, leukocyte-associated immunoglobulin-like receptors
(LAIRs), or 1y49 and is for use in the treatment of: cancer, such
as solid tumors or lymphomas; asthma, rheumatoid arthritis, GVHD or
other autoimmune diseases.
[0156] In another embodiment of the invention, the antibody binds
PD-L2 and is for use in the treatment of: cancer, asthma, or for
use in vaccine enhancement.
[0157] In another embodiment of the invention, the antibody binds
CD26 and is for use in the treatment of: atherosclerosis, GVHD, or
auto-immune diseases.
[0158] In another embodiment of the invention, the antibody binds
BST-2 and is for use in the treatment of: asthma, atherosclerosis,
rheumatoid arthritis, psoriasis, Crohn's disease, ulcerative
cholitis, atopic dermatitis, sepsis or inflammation.
[0159] In another embodiment of the invention, the antibody binds
ML-IAP (melanoma inhibitor of apoptosis protein) and is for use in
the treatment of melanoma.
[0160] In another embodiment of the invention, the antibody binds
cathepsin D and is for use in the treatment of: malignant diseases
such as breast cancer, ovarian cancer, glioma, NSCLC, bladder
cancer, endometrial cancer, liver cancer, sarcoma, gastric cancer,
SCCHN, prostate cancer or colorectal cancer.
[0161] In another embodiment of the invention, the antibody binds
CD40 or CD4OR and is for use in the treatment of: cancer, in
particular B-cell lymphomas, B-cell-related or -mediated diseases,
autoimmune diseases such as psoriatic arthritis, rheumatoid
arthritis, multiple sclerosis, psoriasis, Crohn's disease or
ulcerative cholitis.
[0162] In another embodiment of the invention, the antibody binds
CD86 and is for use in conjunction with organ transplantation.
[0163] In another embodiment of the invention, the antibody binds a
B cell receptor and is for use in the treatment of: B-cell-related
or -mediated diseases, such as B cell lymphoma's, leukemia,
autoimmune diseases, inflammation or allergy.
[0164] In another embodiment of the invention, the antibody binds
CD79 and is for use in the treatment of B-cell-related or -mediated
diseases, such as B-cell lymphomas, leukemia, autoimmune diseases,
inflammation or allergy.
[0165] In another embodiment of the invention, the antibody binds a
T cell receptor and is for use in the treatment of T-cell-related
or -mediated diseases, such as T-cell lymphomas, leukemia,
autoimmune diseases, inflammation or allergy.
[0166] In another embodiment of the invention, the antibody binds
FcalphaRl and is for use in the treatment of a disease or disorder
selected from: allergic asthma or other allergic diseases such as
allergic rhinitis, seasonal/perennial allergies, hay fever, nasal
allergies, atopic dermatitis, eczema, hives, urticaria, contact
allergies, allergic conjunctivitis, ocular allergies, food and drug
allergies, latex allergies, or insect allergies, or IgA
nephropathy, such as IgA pemphigus.
[0167] In another embodiment of the invention, the antibody binds
CD25 and is for use in the treatment of a disease or disorder
selected from the group consisting of: transplant rejection,
graft-versus-host disease, inflammatory, immune or autoimmune
diseases, inflammatory or hyperproliferative skin disorders,
lymphoid neoplasms, malignancies, hematological disorders, skin
disorders, hepato-gastrointestinal disorders, cardiac disorders,
vascular disorders, renal disorders, pulmonary disorders,
neurological disorders, connective tissue disorders,
endocrinological disorders, viral infections.
[0168] In another embodiment of the invention, the antibody binds
IL-15 or the IL15 receptor and is for use in the treatment of a
disease or disorder selected from the group consisting of:
arthritides, gout, connective disorders, neurological disorders,
gastrointestinal disorders, hepatic disorders, allergic disorders,
hematological disorders, skin disorders, pulmonary disorders,
malignant disorders, endocrinological disorders, vascular
disorders, infectious disorders, kidney disorders, cardiac
disorders, circulatory disorders, metabolic disorders, bone,
disorders and muscle disorders.
[0169] In another embodiment of the invention, the antibody binds
IL-8 and is for use in the treatment of a disease or disorder
selected from the group consisting of: palmoplantar pustulosis
(PPP), psoriasis, or other skin diseases, inflammatory, autoimmune
and immune disorders, alcoholic hepatitis and acute pancreatitis,
diseases involving IL-8 mediated angiogenesis.
[0170] In another embodiment of the invention, the antibody binds
CD20 and is for use in the treatment of a disease or disorder
selected from the group consisting of: rheumatoid arthritis,
(auto)immune and inflammatory disorders, non-Hodgkin's lymphoma,
B-CLL, lymphoid neoplasms, malignancies and hematological
disorders, infectious diseases and connective disorders,
neurological disorders, gastrointestinal disorders, hepatic
disorders, allergic disorders, hematological disorders, skin
disorders, pulmonary disorders, malignant disorders,
endocrinological disorders, vascular disorders, infectious
disorders, kidney disorders, cardiac disorders, circulatory
disorders, metabolic disorders, bone and muscle disorders, and
immune mediated cytopenia.
[0171] In another embodiment of the invention, the antibody binds
CD38 and is for use in the treatment of a disease or disorder
selected from the group consisting of: tumorigenic disorders,
immune disorders in which CD38 expressing B cells, plasma cells,
monocytes and T cells are involved, acute respiratory distress
syndrome and choreoretinitis, rheumatoid arthritis, inflammatory,
immune and/or autoimmune disorders in which autoantibodies and/or
excessive B and T lymphocyte activity are prominent, skin
disorders, immune-mediated cytopenias, connective tissue disorders,
arthritides, hematological disorders, endocrinopathies,
hepato-gastrointestinal disorders, nephropathies, neurological
disorders, cardiac and pulmonary disorders, allergic disorders,
ophthalmologic disorders, infectious diseases,
gynecological-obstetrical disorders, male reproductive disorders,
transplantation-derived disorders,
[0172] In another embodiment of the invention, the antibody binds
EGFr and is for use in the treatment of a disease or disorder
selected from the group consisting of: cancers (over)expressing
EGFr and other EGFr related diseases, such as autoimmune diseases,
psoriasis, inflammatory arthritis.
[0173] In another embodiment of the invention, the antibody binds
CD4 and is for use in the treatment of a disease or disorder
selected from the group consisting of: rheumatoid arthritis,
(auto)immune and inflammatory disorders, cutaneous T cell
lymphomas, non-cutaneous T cell lymphomas, lymphoid neoplasms,
malignancies and hematological disorders, infectious diseases, and
connective disorders, neurological disorders, gastrointestinal
disorders, hepatic disorders, allergic disorders, hematologic
disorders, skin disorders, pulmonary disorders, malignant
disorders, endocrinological disorders, vascular disorders,
infectious disorders, kidney disorders, cardiac disorders,
circulatory disorders, metabolic disorders, bone disorders, muscle
disorders, immune mediated cytopenia, and HIV infection/AIDS.
[0174] In another embodiment of the invention, the antibody binds
CD28 and is for use in the treatment of a disease or disorder
selected from the group consisting of: an inflammatory disease,
autoimmune disease and immune disorder.
[0175] In another embodiment of the invention, the antibody binds
tissue factor, or a complex of Factor VII and tissue factor and is
for use in the treatment of a disease or disorder selected from the
group consisting of: vascular diseases, such as myocardial vascular
disease, cerebral vascular disease, retinopathy and macular
degeneration, and inflammatory disorders.
[0176] In a further aspect, the invention relates to the use of a
stabilized IgG4 antibody that binds any of the antigen mentioned
herein above for the preparation of a medicament for the treatment
of a disease or disorder as mentioned herein above in connection
with said target antigen.
[0177] The present invention is further illustrated by the
following examples which should not be construed as further
limiting.
EXAMPLES
Example 1
Oligonucleotide Primers and PCR Amplification
[0178] Oligonucleotide primers were synthesized and quantified by
Isogen Bioscience (Maarssen, The Netherlands). Primers were
dissolved in H.sub.2O to 100 pmol/.mu.l and stored at -20.degree.
C. A summary of all PCR and sequencing primers is given below. For
PCR, PfuTurbo.RTM. Hotstart DNA polymerase (Stratagene, Amsterdam,
The Netherlands) was used according to the manufacturer's
instructions. Each reaction mix contained 200 .mu.M mixed dNTPs
(Roche Diagnostics, Almere, The Netherlands), 6.7 pmol of both the
forward and reverse primer, 100 ng of genomic DNA or 1 ng of
plasmid DNA and 1 unit of PfuTurbo.RTM. Hotstart DNA polymerase in
PCR reaction buffer (supplied with polymerase) in a total volume of
20 .mu.l. PCR reactions were carried out with a TGradient
Thermocycler 96 (Whatman Biometra, Goettingen, Germany) using a
32-cycle program: denaturing at 95.degree. C. for 2 min; 30 cycles
of 95.degree. C. for 30 sec, a 60-70.degree. C. gradient (or
another specific annealing temperature) for 30 sec, and 72.degree.
C. for 3 min; final extension at 72.degree. C. for 10 min. If
appropriate, the PCR mixtures were stored at 4.degree. C. until
further analysis or processing.
Example 2
Agarose Gel Electrophoresis
[0179] Agarose gel electrophoresis was performed according to
Sambrook (Sambrook, Russell et al. 2000 Molecular cloning. A
laboratory manual (third edition), Cold Spring Harbor Laboratory
Press) using gels of 50 ml, in 1.times. Tris Acetate EDTA buffer.
DNA was visualized by the inclusion of ethidium bromide in the gel
and observation under UV light. Gel images were recorded by a CCD
camera and an image analysis system (GeneGnome; Syngene, via
Westburg B.V., Leusden, The Netherlands).
Example 3
Analysis and Purification of PCR Products and Enzymatic
Digestion
[0180] Purification of desired PCR fragments was carried out using
a MinElute PCR Purification Kit (Qiagen, via Westburg, Leusden, The
Netherlands; product #28006), according to the manufacturer's
instructions. Isolated DNA was quantified by UV spectroscopy and
the quality was assessed by agarose gel electrophoresis.
[0181] Alternatively, PCR or digestion products were separated by
agarose gel electrophoresis (e.g. when multiple fragments were
present) using a 1% Tris Acetate EDTA agarose gel. The desired
fragment was excised from the gel and recovered using the QIAEX II
Gel Extraction Kit (Qiagen; product #20051), according to the
manufacturer's instructions.
Example 4
Quantification of DNA by UV Spectroscopy
[0182] Optical density of nucleic acids was determined using a
NanoDrop ND-1000 Spectrophotometer (Isogen Life Science, Maarssen,
The Netherlands) according to the manufacturer's instructions. The
DNA concentration was measured by analysis of the optical density
(OD) at 260 nm (one OD.sub.260nm unit=50 .mu.g/ml). For all
samples, the buffer in which the nucleic acids were dissolved was
used as a reference.
Example 5
Restriction Enzyme Digestions
[0183] Restriction enzymes and supplements were obtained from New
England Biolabs (Beverly, Mass., USA) or Fermetas (Vilnius,
Lithuania) and used according to the manufacturer's
instructions.
[0184] DNA (100 ng) was digested with 5 units of enzyme(s) in the
appropriate buffer in a final volume of 10 .mu.l (reaction volumes
were scaled up as appropriate). Digestions were incubated at the
recommended temperature for a minimum of 60 min. For fragments
requiring double digestions with restriction enzymes which involve
incompatible buffers or temperature requirements, digestions were
performed sequentially. If necessary digestion products were
purified by agarose gel electrophoresis and gel extraction.
Example 6
Ligation of DNA Fragments
[0185] Ligations of DNA fragments were performed with the Quick
Ligation Kit (New England Biolabs) according to the manufacturer's
instructions. For each ligation, vector DNA was mixed with
approximately three-fold molar excess of insert DNA.
Example 7
Transformation of E. coli
[0186] Plasmid DNA (1-5 .mu.l of DNA solution, typically 2 .mu.l of
DNA ligation mix) was transformed into One Shot DH5.alpha.-T1.sup.R
or MACH-1 T1.sup.R competent E. coli cells (Invitrogen, Breda, The
Netherlands; product #12297-016) using the heat-shock method,
according to the manufacturer's instructions. Next, cells were
plated on Luria-Bertani (LB) agar plates containing 50 .mu.g/ml
ampicillin. Plates were incubated for 16-18 h at 37.degree. C.
until bacterial colonies became evident.
Example 8
Screening of Bacterial Colonies by PCR
[0187] Bacterial colonies were screened for the presence of vectors
containing the desired sequences via colony PCR using the
HotStarTaq Master Mix Kit (Qiagen; product #203445) and the
appropriate forward and reverse primers. Selected colonies were
lightly touched with a 20 .mu.l pipette tip and touched briefly in
2 ml LB for small scale culture, and then resuspended in the PCR
mix. PCR was performed with a TGradient Thermocycler 96 using a
35-cycle program: denaturation at 95.degree. C. for 15 min; 35
cycles of 94.degree. C. for 30 sec, 55.degree. C. for 30 sec and
72.degree. C. for 2 min; followed by a final extension step of 10
min at 72.degree. C. If appropriate, the PCR mixtures were stored
at 4.degree. C. until analysis by agarose gel electrophoresis.
Example 9
Plasmid DNA Isolation from E. coli Culture
[0188] Plasmid DNA was isolated from E. coli cultures using the
following kits from Qiagen (via Westburg, Leusden, The
Netherlands), according to the manufacturer's instructions. For
bulk plasmid preparation (50-150 ml culture), either a HiSpeed
Plasmid Maxi Kit (product #12663) or a HiSpeed Plasmid Midi Kit
(product #12643) was used. For small scale plasmid preparation
(.+-.2 ml culture) a Qiaprep Spin Miniprep Kit (product #27106) was
used and DNA was eluted in 50 .mu.l elution buffer (supplied with
kit).
Example 10
DNA Sequencing
[0189] Plasmid DNA was sequenced using standard procedures known in
the art. Sequences were analyzed using Vector NTI software
(Informax, Oxford, UK).
Example 11
Transient Expression in HEK-293F Cells
[0190] Freestyle.TM. 293-F (a HEK-293 subclone adapted to
suspension growth and chemically defined Freestyle medium, e. g.
HEK-293F) cells were obtained from Invitrogen and transfected
according to the manufacturer's protocol using 293fectin
(Invitrogen).
Example 12
Construction of pTomG4; A Vector for the Expression of Variable
Heavy Chain Regions with the Constant Region of Human IgG4
[0191] Genomic DNA was isolated from a blood sample of a volunteer
and used as a template in a PCR with primers IGG4gene2f and
IGG4gene2r (see table below), amplifying the complete genomic
constant region of the heavy chain of IgG4 and introducing suitable
restriction sites for cloning into the mammalian expression vector
pEE6.4 (Lonza Biologics). The PCR fragment was purified and cloned
into pEE6.4. For this the PCR product was digested with HindIII and
EcoRI, followed by heat inactivation of the restriction enzymes.
The pEE6.4 vector was digested HindIII and EcoRI, followed by heat
inactivation of the restriction enzymes and dephosphorylation of
the vector fragment with shrimp alkaline phosphatase, followed by
heat inactivation of the phosphatase. The IgG4 fragment and the
pEE6.4HindIII/EcoRI dephosphorylated vector were ligated and
transformed into competent MACH1-T1.sup.R cells (Invitrogen). Three
clones were grown in LB and plasmid DNA was isolated from a small
culture (1.5 mL). Restriction digestion revealed a pattern
consistent with the cloning of the IgG4 fragment in the pEE6.4
vector. Plasmid DNA from two clones was transformed in DH5a-T1R E.
coli and plasmid DNA was isolated and the constructs were checked
by sequence analysis of the insert and one clone was found to be
identical to a genomic IgG4 clone from the Genbank database, apart
from some minor differences in introns. These differences are
presumably either polymorphisms or sequence faults in the Genbank
sequence. The plasmid was named pTomG4.
TABLE-US-00001 TABLE 1 primer sequences Name Oligonucleotide
Sequence VLexbetv1rev AGCCACCGTACGTTTGATTTCCAGCTTGGTGCCTCC (SEQ ID
NO: 1) VLex betv1for GATGCAAGCTTGCCGCCACCATGGAGTCACAGATTCAGGCATTT
(SEQ ID NO: 2) VHexbetv1rev
CGATGGGCCCTTGGTGCTGGCTGAGGAGACGGTGACTGAGGT (SEQ ID NO: 3)
VHexbetv1for GATGCAAGCTTGCCGCCACCATGAAATGCAGCTGGGTTATCTTC (SEQ ID
NO: 4) VLexfeld1rev AGCCACCGTACGTTTTATTTCCAACTTTGTCCCCGA (SEQ ID
NO: 5) VLex feld1for GATGCAAGCTTGCCGCCACCATGGAATCACAGACTCAGGTCCTC
(SEQ ID NO: 6) VHexfeld1rev
CGATGGGCCCTTGGTGCTGGCTGCAGAGAAAGTGACCAGAGT (SEQ ID NO: 7)
VHexfeld1for GATGCAAGCTTGCCGCCACCATGGGATGGAGCTATATCATCCTC (SEQ ID
NO: 8) IGG4gene2r TGAGAATTCGGTGGGTGCTTTATTTCCATGCT (SEQ ID NO: 9)
IGG4gene2f GTAGAAGCTTACCATCGCGGATAGACAAGAACC (SEQ ID NO: 10)
RACEKmm1 TGTTAACTGCTCACTGGATGGTGGGA (SEQ ID NO: 11) RACEG1mm1
TCCCTGGGCACAATTTTCTTGTCCACC (SEQ ID NO: 12) ShortUPMH3
TGAAAGCTTCTAATACGACTCACTATAGGGC (SEQ ID NO: 13) LongUPMH3
TGAAAGCTTCTAATACGACTCACTATAGGGCAAGCAGTGGTATCAACG CAGAGT (SEQ ID NO:
14)
Example 13
Cloning of the Variable Regions of the Mouse Anti-Betv1 and
Anti-Feld1 Antibodies
[0192] Total RNA was prepared from 0.3.times.10.sup.5 (Betv1) or
0.9.times.10.sup.5 (Feld1) mouse hybridoma cells
[0193] (For Betv1: clone 2H8 from Akkerdaas, van Ree et al. 1995
Allergy 50(3), 215-220 and for Feld1: clone 4F7 from de Groot et
al. 1988 3. Allergy Clin. Immunol. 82, 778) with the RNeasy kit
(Qiagen, Westburg, Leusden, Netherlands) according to the
manufacturer's protocol.
[0194] 5'-RACE-Complementary DNA (cDNA) of RNA was prepared from
approximately 100 ng total RNA, using the SMART RACE cDNA
Amplification kit (BD Biosciences Clontech, Mountain View, Calif.,
USA), following the manufacturer's protocol. The VL and VH regions
of the Betv1 and Feld1 antibody were amplified by PCR. For this
PfuTurbo.RTM. Hotstart DNA polymerase (Stratagene) was used
according to the manufacturer's instructions. Each reaction mix
contained 200 .mu.M mixed dNTPs (Roche Diagnostics), 12 pmol of the
reverse primer (RACEG1mm1 for the VH region and RACEKmm1 for the VL
region), 7.2 pmol UPM-Mix (UPM-Mix: 2 .mu.M ShortUPMH3 and 0.4
.mu.M LongUPMH3 oligonucleotide), 0.6 .mu.l of the 5'RACE cDNA
template as described above, and 1.5 unit of PfuTurbo.RTM. Hotstart
DNA polymerase in PCR reaction buffer (supplied with polymerase) in
a total volume of 30 .mu.l.
[0195] PCR reactions were carried out with a TGradient Thermocycler
96 (Whatman Biometra) using a 35-cycle program: denaturing at
95.degree. C. for 2 min; 35 cycles of 95.degree. C. for 30 sec, a
55.degree. C. for 30 sec, and 72.degree. C. for 1.5 min; final
extension at 72.degree. C. for 10 min. The reaction products were
separated by agarose gel electrophoresis on a 1% TAE agarose gel
and stained with ethidium bromide. Bands of the correct size were
cut from the gels and the DNA was isolated from the agarose using
the Qiaexll gel extraction kit (Qiagen).
[0196] Gel isolated PCR fragments were A tailed by a 10 min
72.degree. C. incubation with 200 .mu.M dATP and 2.5 units Amplitaq
(Perkin Elmer) and purified using minielute columns (Qiagen).
A-tailed PCR fragments were cloned into the pGEMTeasy vector
(Promega) using the pGEMT easy vector system II kit (Promega),
following the manufacturer's protocol. 2 .mu.l of the ligation
mixture was transformed into OneShot DH5.alpha.T1R competent E.
coli (Invitrogen) and plated on LB/Amp/IPTG/Xgal plates. Four,
insert containing, white colonies each for the VH and VL sequences
were picked and the inserts were sequenced. The deduced amino acid
sequences of the VH and VL of Betv1 are given in SEQ ID NO:15 and
16 and the deduced amino acid sequences of Feld1 are depicted in
SEQ ID NO:17 and 18.
TABLE-US-00002 VH sequence Betv1 (SEQ ID NO: 15):
mkcswvifflmavvtgvnsevqlqqsgaelvkpgasvklsctasgfnik
dtyihwvkqrpeqglewvgridpatgntrydpkfqgkatitadtssnta
ylqlssltsedtavyycasfrpgyaldywgqgtsvtvss VL sequence Betv1 (SEQ ID
NO: 16): mesqiqafvfvflwlsgydgdivmtqshkfmstsvgdrvsftckasqdv
ftavawyqqkpgqspklliywastrrtgvpdrftgsgsgtdytltissv
qaedlalyycqqhfstpptfgggtkleik VH sequence Feld1 (SEQ ID NO: 17):
mgwsyiilflvatatdvhsqvqlqqpgaelvkpgasvklsckasgysft
sywmhwlkqrpgqglewigeinpnngrtyynekfktkatltvdksssta
ymqlnsltsedsavyycarrltmvesfaywgqgtlvtfsa VL sequence Feld1 (SEQ ID
NO: 18): mesqtqvlmsllfwvsgtcgdivmtqspssltvtagekvtmsckssqsl
lnsgnqknyltwyqqkpgqppklliywastresgvpdrftgsgsgtdfs
ltissvqaedlaiyycqndysypftfgsgtkleik
Example 14
Construction of pConG1fBetV1: A Vector for the Production of the
Heavy Chain of Betv1-IgG1
[0197] The V.sub.H coding region of mouse anti-BetV1 antibody was
amplified by PCR from a plasmid containing this region (example 13)
using the primers VHexbetvlfor and VHexbetvlrev, introducing
suitable restriction sites for cloning into pConG1f0.4 and an ideal
Kozak sequence. The VH fragment was gel purified and cloned into
pConG1f0.4. For this the PCR product and the pConKappa0.4 vector
were digested with HindIII and Apal and purified. The V.sub.H
fragment and the pConG1f0.4HindIII-ApaI digested vector were
ligated and transformed into competent DH5.alpha.-T1.sup.R cells. A
clone was selected containing the correct insert size and the
correct sequence was confirmed. This plasmid was named
pConG1fBetv1.
Example 15
Construction of pConKBetv1: A Vector for the Production of the
Light Chain of Betv1
[0198] The V.sub.L coding region mouse anti-BetV1 antibody was
amplified from a plasmid containing this region (example 13) using
the primers VLexbetv1for and VLexbetv1rev, introducing suitable
restriction sites for cloning into pConK0.4 and an ideal Kozak
sequence. The PCR product and the pConKappa0.4 vector were digested
with HindIII and BsiWI and purified. The V.sub.L fragment and the
pConKappa0.4HindIII-BsiWI digested vector were ligated and
transformed into competent DH5.alpha. T1.sup.R E. coli. A clone was
selected containing the correct insert size and the sequence was
confirmed. This plasmid was named pConKBetv1.
Example 16
Construction of pTomG4Betv1: A Vector for the Production of the
Heavy Chain of Betv1-IgG4
[0199] To construct a vector for expression of Betv1-IgG4, the VH
region of BetV1 was cloned in pTomG4. For this, pTomG4 and
pConG1fBetv1 were digested with HindIII and ApaI and the relevant
fragments were isolated. The Betv1 V.sub.H fragment and the
pTomG4HindIII-ApaI digested vector were ligated and transformed
into competent DH5.alpha.-T1.sup.R cells. A clone was selected
containing the correct insert size and the sequence was confirmed.
This plasmid was named pTomG4Betv1.
Example 17
Construction of pConG1fFeld1: A Vector for the Production of the
Heavy Chain of Feld1-IgG1
[0200] The V.sub.H coding region of mouse anti-Feld1 antibody was
amplified by PCR from a plasmid containing this region (example 13)
using the primers VHexfeld1for and VHexfeld1rev, introducing
suitable restriction sites for cloning into pConG1f0.4 and an ideal
Kozak sequence. The VH fragment was gel purified and cloned into
pConG1f0.4. For this the PCR product and the pConKappa0.4 vector
were digested with HindIII and ApaI and purified. The V.sub.H
fragment and the pConG1f0.4HindIII-ApaI digested vector were
ligated and transformed into competent DH5.alpha.-T1.sup.R cells. A
clone was selected containing the correct insert size and the
correct sequence was confirmed. This plasmid was named
pConG1fFeld1.
Example 18
Construction of pConKFeld1: A Vector for the Production of the
Light Chain of Feld1
[0201] The V.sub.L coding region mouse anti-'Feld1 antibody was
amplified from a plasmid containing this region (example 13) using
the primers VLexfeld1for and VLexfeld1rev, introducing suitable
restriction sites for cloning into pConK0.4 and an ideal Kozak
sequence. The PCR product and the pConKappa0.4 vector were digested
with HindIII and BsiWI and purified. The V.sub.L fragment and the
pConKappa0.4HindIII-BsiWI digested vector were ligated and
transformed into competent DH5.alpha. T1.sup.R E. coli. A clone was
selected containing the correct insert size and the sequence was
confirmed. This plasmid was named pConKFeld 1.
Example 19
Construction of pTomG4Feld1: A Vector for the Production of the
Heavy Chain of Feld1-IgG4
[0202] To construct a vector for expression of Feld1-IgG4, the VH
region of Feld1 was cloned in pTomG4. For this, pTomG4 and pConGlf
Feld1 were digested with HindIII and Apal and the relevant
fragments were isolated. The Feld1 VH fragment and the
pTomG4HindIII-Apal digested vector were ligated and transformed
into competent DH5.alpha.-T1.sup.R cells. A clone was selected
containing the correct insert size and the sequence was confirmed.
This plasmid was named pTomG4Feld1.
Example 20
Construction of Antibody Expression Vectors for the Expression of
2F8-IgG4 and 7D8-IgG4
[0203] Expression vectors for the expression of HuMab 2F8
(IgG1-EGFR) and HuMab 7D8 (IgG1-CD20) were constructed. The VH and
VL coding regions of HuMab 2F8 (WO 02/100348) and HuMab 7D8 (WO
04/035607) were cloned in the expression vector pConG1f (Lonza
Biologics) for the production of the IgG1 heavy chain and pConKappa
for the production of the kappa light chain, yielding the vectors
pConG1f2F8, pConG1f7D8, pConKappa2F8 and pConKappa7D8. The VH
regions of pConG1f2F8 and pConG1f7D8 were removed from these
vectors by a HindIII/ApaI digestion and inserted into a
HindIII/ApaI digested pTomG4 vector, resulting in pTomG42F8 and
pTomG47D8 respectively.
Example 21
Production of Betv1-IgG1, Betv1-IgG4, Feld1-IgG1 and Feld1-IgG4 by
transient expression in HEK-293F cells
[0204] Antibodies were produced from all constructs by
cotransfecting the relevant heavy and light chain vectors in
HEK-293F cells using 293fectin according to the manufacturer's
instructions. For Betv1-IgG1, pConG1Betv1 and pConKBetv1 were
coexpressed. For Betv1-IgG4, pTomG4Betv1 and pConKBetv1 were
coexpressed. For Feld1-IgG1, pConG1Feld1 and pConKFeld1 were
coexpressed. For Feld1-IgG4, pTomG4Feld1 and pConKFeld1 were
coexpressed. For IgG1-EGFr, pConG1f2F8 and pConKappa2F8 were
coexpressed. For IgG4-EGFr, pTomG42F8 and pConKappa2F8 were
coexpressed. For IgG1-CD20, pConG1f7D8 and pConKappa7D8 were
coexpressed. For IgG4-CD20, pTomG47D8 and pConkappa7D8 were
coexpressed.
Example 22
Purification of IgG1 and IgG4 Antibodies
[0205] IgG1 and IgG4 antibodies were purified by protein A affinity
chromatography. The cell culture supernatants were filtered over a
0.20 .mu.M dead-end filter, followed by loading on a 5 ml Protein A
column (rProtein A FF, GE Healthvcare) and elution of the IgG with
0.1 M citric acid-NaOH, pH 3. The eluate was immediately
neutralized with 2 M Tris-HCl, pH 9 and dialyzed overnight to 12.6
mM sodium phosphate, 140 mM NaCl, pH 7.4 (B. Braun, Oss, The
Netherlands). After dialysis, samples were sterile filtered over a
0.20 .mu.M dead-end filter. Concentration of the purified IgGs was
determined by nephelometry and absorbance at 280 nm. Purified
proteins were analyzed by SDS-PAGE, IEF, Mass spectrometry and
Glycoanalysis.
Example 23
SDS-PAGE Analysis of Purified IgGs
[0206] After purification, the Betv1 and Feld1, IgG1 and IgG4
antibodies were analyzed on non-reducing SDS-PAGE. The Bis-Tris
electrophoresis method used is a modification of the Laemmli method
(Laemmli 1970 Nature 227(5259): 680-5), where the samples were run
at neutral pH. The SDS-PAGE gels were stained with Coomassie and
digitally imaged using the GeneGenius (Synoptics, Cambridge,
UK).
[0207] As can be seen in FIG. 1, Betv1 and Feld1 IgG1 showed 1
major band representing the full length tetrameric (2 heavy and two
light chains) Feld1 and Betv1 IgG1 molecules. Betv1 and Feld1 IgG4
showed to have, besides the major band representing the tetrameric
IgG4 molecule, substantial amounts of half-molecules (i.e. one
heavy band one light chain).
Example 24
Evaluation of IgG4 Fab Arm Exchange in Mice
[0208] Five nu/nu Balb/c mice 6-8 weeks of age were used to follow
the exchange of IgG4 half molecules. The mice were housed in a
barrier unit of the Central Laboratory Animal Facility (Utrecht,
The Netherlands) and kept in filter-top cages with water and food
provided ad libitum. All experiments were approved by the Utrecht
University animal ethics committee.
[0209] Chimeric antibodies were administered intraperitoneally.
Blood samples (75-100 .mu.l) were drawn at 4.25 hours, 24 hours, 48
hours and 72 hours after administration. Blood was collected in
heparin-containing vials and centrifuged for 5 minutes at 10.000g
to separate plasma from cells. Plasma was stored at -20.degree. C.
for determination of antigen specific antibody and bispecific
antibody levels.
[0210] In this experiment the exchange of chimeric IgG4 half
molecules (n=2) was compared with the exchange of IgG1 half
molecules (n=3). Mixtures of Bet v 1 and Fel d 1 specific
antibodies (IgG1 or IgG4) were administered to the mice at a dose
of 600 .mu.g (300 .mu.g of each antigen specific antibody) in 200
.mu.l per mouse.
[0211] Plasma concentrations of Bet v 1 or Fel d 1 binding
antibodies were measured in the antigen binding test. To this end,
plasma samples were incubated with 0.75 mg of protein G Sepharose
(Amersham Biosciences, Uppsala, Sweden) in 750 .mu.l PBS-IAT (PBS
supplemented with 1 .mu.g/ml IVIg, 0.3% bovine serum albumin, 0.1%
Tween-20 and 0.05% (w/v) NaN.sub.3) in the presence of
.sup.125I-labeled Bet v 1 or .sup.125I-labeled Fel d 1 for 24 h.
Next, the Sepharose was washed with PBS-T (PBS supplemented with
0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) and the amount of
radioactivity bound relative to the amount of radioactivity added
was measured. The concentration of Bet v 1 or Fel d 1 specific IgG
was calculated using purified Bet v 1 specific antibodies or Fel d
1 specific antibodies as a standard (range 0-200 ng per test as
determined by nephelometer). The concentration of bispecific IgG
was measured in two variants of the heterologous cross-linking
assay. In the first assay, plasma was incubated for 24 h with
Sepharose-coupled Bet v 1 (0.5 mg) in a total volume of 300 .mu.l
in PBS-IAT. Subsequently, the Sepharose was washed with PBS-T and
incubated for 24 h with .sup.125I-labeled Fel d 1, after which the
Sepharose was washed with PBS-T and the amount of radioactivity
bound relative to the amount of radioactivity added was measured.
The concentration of bispecific IgG (Bet v 1-Fel d 1) was
calculated using the calibration curve of the Fel d 1 binding test,
which was obtained from purified Fel d 1 binding rIgG. In the
second assay Fel d 1-Bet v 1 cross-linking activity was measured in
a similar procedure using Sepharose-coupled rFel d 1 (0.5 mg) and
.sup.125I-labeled Bet v 1. The concentration of bispecific IgG (Fel
d 1-Bet v 1) was calculated using purified Bet v 1 specific rIgG as
a standard (same curve as in Bet v 1 binding test).
[0212] In FIG. 2 the concentration of bispecific IgG (Fel d 1-Bet v
1) is plotted versus the concentration of Bet v 1 binding IgG at
different time points. No bispecific IgG was observed in the mice
dosed with IgG1 mixes in contrast to the mice dosed with IgG4.
After 24 h the generation of bispecific IgG4 was maximal and
corresponded to an exchange of 100%.
[0213] In FIG. 3A the formation of bispecific IgG4 is followed in
time. Bispecific antibodies appeared in time in the plasma of mice
injected with mixtures of IgG4, but not IgG1, with bispecific
reactivity achieving a maximum of almost 50% after 1-2 days
incubation (note: if equal amounts of IgG4-Betv1 and IgG4-Feld1 are
exchanged, maximal 50% of the IgG4-Betv1 half-antibodies will be
incorporated in the bispecific fraction after random and complete
exchange of half-antibodies). A random Fab arm exchange between
equal amounts of IgG4-Betv1 and IgG4-Feld1, would be consistent
with approximately half of the IgG4 molecules acquiring
bispecificity. As a control, a 20-fold-excess of an additional IgG4
directed against an irrelevant antigen (IgG4 generated from
anti-EGFr antibody 2F8) was injected in mice together with
IgG4-Betv1 and IgG4-Feldl.The excess irrelevant IgG4 competed with
the generation of Betv1-Feld1-bispecific IgG4.
[0214] In another experiment (FIG. 3B) the same murine plasma
samples were tested for their ability to cross-link radio-labeled
soluble Fel d 1 to Sepharose-immobilized Fel d 1. It was found that
the monospecific cross-linking activity was decreased in mice dosed
with an equal mixture of IgG4s but not IgG1s, indicating a loss of
monospecific cross-linking activity. A maximal reduction of
.about.50% was reached after about one day. In mice dosed with the
additional excess of irrelevant IgG4, monospecific cross-linking
activity almost completely disappeared with similar kinetics.
[0215] Size-exclusion chromatography was performed to exclude the
possibility that bispecific activity observed in the mice dosed
with IgG4 was the result of IgG aggregation (FIG. 4). For this
purpose, a plasma sample (drawn at t=24h) was fractionated on a
Superdex200 column, after which Fel d 1 binding IgG and Bet v 1-Fel
d 1 cross-linking IgG were measured in the fractions. Fel d 1
binding antibodies eluted in one peak with a retention volume of
.about.12.9 ml, which corresponds to the retention volume of
monomeric IgG. The heterologous Bet v 1-Fel d 1 cross-linking
activity was detected in the same fractions indicating that
bispecific activity was associated with monomeric IgG. In the rIgG1
containing plasma no Bet v 1-Fel d 1 cross-linking activity was
present before fractionation. Also in the eluted fractions no
heterologous cross-linking activity was measured (data not
shown).
Example 25
Evaluation of Fab Arm Exchange Activity by Whole Blood
(Components)
[0216] Chimeric antibodies were mixed and subsequently incubated
with whole blood, blood cells, plasma or serum to investigate the
exchange activity of whole blood (components).
[0217] In this experiment the exchange of IgG4 half molecules was
evaluated in whole blood from two healthy blood donors, A and B, in
which the endogenous plasma level of IgG4 was determined by
nephelometry (being 346 and 554 .mu.g/ml, respectively). Whole
blood was obtained in vacutainers supplemented with TFPI (Tissue
Factor Pathway Inhibitor from Chiron Corporation, Emeryville,
Calif.) in a final concentration of 40 .mu.g/ml. Blood cells and
plasma were obtained by centrifugation of whole blood. The cellular
fraction was washed 3 times with Optimem (Invitrogen, Breda, The
Netherlands) and subsequently resuspended in Optimem. Serum was
obtained by incubating whole blood in a glass vacutainer with clot
activator for 30 min at 37.degree. C., after which the clotted
blood was spinned down. The exchange of IgG4 half molecules was
evaluated and compared to the exchange of IgG1 half molecules. As a
control the blood samples were also incubated in the absence of
chimeric antibodies. The following antibodies mixtures were
prepared in PBS: [0218] 1. Bet v 1 specific IgG4 (10 .mu.g) and Fel
d 1 specific IgG4 (10 .mu.g) [0219] 2. Bet v 1 specific IgG1 (10
.mu.g) and Fel d 1 specific IgG1 (10 .mu.g)
[0220] These antibody mixtures were incubated with blood, blood
cells, plasma or serum in a total volume of 100 .mu.l (final
concentration for each antibody was 0.1 .mu.g/ml) on a horizontal
orbital shaker (125 rpm) at 37.degree. C. Final hematocrit in the
incubation mixtures with whole blood and blood cells was around
.about.40%. After 24 h the incubation mixtures were centrifuged for
1 min at 2800 rpm in an Eppendorf centrifuge, after which a sample
of 10 .mu.l was drawn in 500 .mu.l PBS-AT (PBS supplemented with
0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v)
NaN.sub.3). Samples were stored, if necessary, at 4.degree. C.
[0221] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking
activity) was measured in the heterologous cross-linking assay. In
this assay, a sample was incubated for 24 h with 0.5 mg
Sepharose-coupled recombinant Fel d 1 in a total volume of 300
.mu.l in PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg).
Subsequently, the Sepharose was washed with PBS-T and incubated for
24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was
washed with PBS-T and the amount of radioactivity bound relative to
the amount of radioactivity added was measured.
[0222] In FIGS. 5A-C bispecific activity is represented as
percentage bound .sup.125I-labeled Bet v 1, which was determined in
the heterologous cross-linking assay. Bispecific activity is a
measure for the exchange of IgG4 half molecules, which was
primarily observed in whole blood and the cellular fraction of
whole blood (FIG. 5a). Bispecific levels in the cellular fraction
were even higher than in whole blood. This is most likely explained
by the fact that in the cellular fraction endogenous IgG4, which
can also be exchanged with the added chimeric IgG4 antibodies, is
no longer present. Some bispecific activity was also observed in
plasma and serum, but this activity was much lower than observed in
whole blood and only slightly higher than background level, being
1.7%, which was obtained by incubating the IgG4 mixture in Optimem.
No bispecific activity was observed in any of the incubations
containing IgG1 (FIG. 5B). Also in the control incubations without
chimeric antibodies no bispecific activity was observed (FIG. 5C).
Size-exclusion chromatography was performed to exclude the
possibility that bispecific activity observed in the IgG4 mix was
the result of IgG aggregation. For this purpose, a sample (drawn at
t=24 h) was fractionated on a Superdex200 column, after which Fel d
1 binding IgG and Bet v 1-Fel d 1 cross-linking IgG were measured
in the fractions. Fel d 1 binding antibodies eluted in one peak
with a retention volume of .about.12.9 ml, which corresponds to the
retention volume of monomeric IgG. The heterologous Bet v 1-Fel d 1
cross-linking activity was detected in the same fractions
indicating that bispecific activity was associated with monomeric
IgG (data not shown).
Example 26
Evaluation of Blood Cell Mediated IgG4 Fab Arm Exchange
Activity
[0223] Chimeric antibodies were mixed and subsequently incubated
with three different types of human blood cells (i.e. mononuclear
cells (MNC), erythrocytes and platelets) to investigate IgG4
exchange activity.
[0224] Whole blood from an anonymous donor was drawn in a heparin
containing vacutainer and subsequently centrifuged in Percoll
(Pharmacia Fine Chemicals, Uppsala, Sweden) to isolate MNCs. The
isolated MNCs were resuspended in Optimem serum free culture medium
(Invitrogen, Breda, The Netherlands) before use. Freshly purified
erythrocytes and platelets (provided by the Blood Cell Research
Department of Sanquin) were obtained from two different anonymous
donors. These cells were also resuspended in Optimem after being
washed 3 times. In addition, platelets were supplemented with 10 mM
glucose.
[0225] The exchange of IgG4 half molecules was evaluated and
compared to the exchange of IgG1 half molecules. The following
antibodies mixtures were prepared in PBS: [0226] -Bet v 1 specific
IgG4 (10 .mu.g) and Fel d 1 specific IgG4 (10 .mu.g) [0227] -Bet v
1 specific IgG1 (10 .mu.g) and Fel d 1 specific IgG1 (10 .mu.g)
[0228] These antibody mixtures were incubated with
1.8.times.10.sup.4 MNCs, 4.0.times.10.sup.8 erythrocytes or
3.5.times.10.sup.4 platelets in a total volume of 100 .mu.l (final
concentration for each antibody was 0.1 .mu.g/ml) on a horizontal
orbital shaker (125 rpm) at 37.degree. C. After 48 h the incubation
mixtures were centrifuged for 1 min at 2800 rpm in an Eppendorf
centrifuge, after which a sample of 10 .mu.l was drawn in 500 .mu.l
PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1%
Tween-20 and 0.05% (w/v) NaN.sub.3). Samples were stored, if
necessary, at 4.degree. C.
[0229] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking
activity) was measured in the heterologous cross-linking assay. In
this assay, a sample was incubated for 24 h with 0.5 mg
Sepharose-coupled recombinant Fel d 1 in a total volume of 300
.mu.l in PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg).
Subsequently, the Sepharose was washed with PBS-T and incubated for
24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was
washed with PBS-T and the amount of radioactivity bound relative to
the amount of radioactivity added was measured.
[0230] In FIG. 6 bispecific activity is shown as percentage bound
.sup.125I-labeled Bet v 1, which was determined in the heterologous
cross-linking assay. All three cell types were able to induce
bispecific activity. Some bispecific activity was also observed in
Optimem serum free medium, but this activity was much lower than
observed in the presence of blood cells. None of the tested cells
was able to exchange IgG1 half molecules.
Example 27
Evaluation of IgG4 Fab Arm Exchange by Human and Murine Cell
Lines
[0231] Chimeric IgG4 antibodies were mixed and subsequently
incubated with three different cell lines (i.e. Human Embryo Kidney
(HEK) cells, murine B cells or hybridomas) to investigate IgG4
exchange activity.
[0232] Cell line J558 (provided by the Antigen Presentation
Research Group of Sanquin) was chosen as a source of murine B
cells. Hybridomas, which produce an anti-C1 esterase inhibitor,
were obtained from the Autoimmune Research Group of Sanquin.
Suspension HEK (293F) cells were from Invitrogen, Breda, The
Netherlands. All cells were washed three times with PBS, after
which the cells were resuspended in PBS.
[0233] The exchange of IgG4 half molecules was evaluated by
incubating an IgG4 antibody mixture consisting of Bet v 1 specific
IgG4 (2 .mu.g) and Fel d 1 specific IgG4 (2 .mu.g) with the
aforementioned cells. The antibody mixture was incubated with
24.times.10.sup.5 HEK cells, 25.times.10.sup.5 murine B cells or
21.times.10.sup.5 hybridomas in a total volume of 50 .mu.l (final
concentration for each antibody was 80 .mu.g/ml) on a horizontal
orbital shaker (125 rpm) at 37.degree. C. After Oh and 24 h the
incubation mixtures were centrifuged for 1 min at 2800 rpm in an
Eppendorf centrifuge, after which a sample was drawn in PBS-AT (PBS
supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and
0.05% (w/v) NaN.sub.3). Samples were stored, if necessary, at
4.degree. C.
[0234] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking
activity) was measured in the heterologous cross-linking assay. In
this assay, sample dilutions were incubated for 24 h with 0.5 mg
Sepharose-coupled recombinant Fel d 1 in a total volume of 300
.mu.l in PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg).
Subsequently, the Sepharose was washed with PBS-T and incubated for
24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was
washed with PBS-T and the amount of radioactivity bound relative to
the amount of radioactivity added was measured.
[0235] In FIG. 7 bispecific activity is shown as percentage bound
.sup.125I-labeled Bet v 1, which was determined in the heterologous
cross-linking assay. All three cell types were able to exchange
IgG4 half molecules.
Example 28
Evaluation of IgG4 Fab Arm Exchange By Erythrocytes
[0236] Chimeric antibodies were mixed and subsequently incubated
with human erythrocytes to investigate the exchange of IgG4 half
molecules. Erythrocytes were purified from a single donor and
stored at 4.degree. C. in SAGM (Saline Adenine Glucose Mannitol)
buffer. Before use the cells were washed three times with PBS.
[0237] In this experiment the exchange of IgG4 half molecules was
compared with the exchange of IgG1. Also, the exchange of IgG4 in
the presence of excess irrelevant IgG4 was evaluated. The following
antibodies mixtures were prepared in PBS: [0238] Bet v 1 specific
IgG4 (4 .mu.g) and Fel d 1 specific IgG4 (4 .mu.g) [0239] Bet v 1
specific IgG1 (4 .mu.g) and Fel d 1 specific IgG1 (4 .mu.g) [0240]
Bet v 1 specific IgG4 (4 .mu.g), Fel d 1 specific IgG4 (4 .mu.g)
and irrelevant IgG4 specific for antigen X (80 .mu.g)
[0241] These mixtures were incubated with erythrocytes in PBS
supplemented with 0.05% (w/v) NaN.sub.3 in a total volume of 100
.mu.l (final hematocrit was around .about.40%) and subsequently
incubated on a horizontal orbital shaker (125 rpm) at 37.degree. C.
At indicated time points the erythrocytes were centrifuged for 1
min at 2800 rpm in an Eppendorf centrifuge, after which a sample of
10 .mu.l was drawn in 500 .mu.l PBS-AT (PBS supplemented with 0.3%
bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3).
Samples were stored at 4.degree. C. before measuring bispecific
activity, bivalency and antigen binding. As a control the same
mixtures were also incubated in PBS without erythrocytes.
[0242] Levels of Bet v 1 binding antibodies were measured in the
antigen binding test. To this end, samples were incubated with 0.75
mg of protein G Sepharose (Amersham Biosciences, Uppsala, Sweden)
in 750 .mu.l PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg) in
the presence of .sup.125I-labeled Bet v 1 for 24 h. Next, the
Sepharose was washed with PBS-T (PBS supplemented with 0.1%
Tween-20 and 0.05% (w/v) NaN.sub.3) and the amount of radioactivity
bound relative to the amount of radioactivity added was measured.
The concentration of Bet v 1 specific IgG was calculated using
purified Bet v 1 specific antibodies as a standard (range 0-200 ng
per test as determined by nephelometer). Bispecific activity in
experiments using Fel d 1 and Bet v 1 specific antibodies was
measured in the Feld1-Betv1 cross-linking assay. In this assay, IgG
containing sample was incubated for 24 h with Sepharose-coupled cat
extract (0.5 mg) in a total volume of 300 .mu.l in PBS-AT.
Subsequently, the Sepharose was washed with PBS-T and incubated for
24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was
washed with PBS-T and the amount of radioactivity bound relative to
the amount of radioactivity added was measured. The concentration
of bispecific IgG (Feld1-Betv1) was calculated using purified
IgG1-Betv1 as a standard (obtained in Bet v 1 binding test using
Prot G sepharose).
[0243] In FIG. 8 data obtained from the erythrocyte-mediated
exchange are presented. No exchange of IgG1 half molecules was
observed in the presence of erythocytes, whereas about maximum
exchange of IgG4 half molecules was observed after 72 h (panel A)
(note: if equal amounts of IgG4-Betv1 and IgG4-Feld1 are exchanged,
at most 50% of the IgG4-Betv1 half-antibodies will be incorporated
in the bispecific fraction after random and complete exchange of
half molecules). In the presence of excess irrelevant IgG4 almost
no exchange of IgG4 half molecules was measured, which is in line
with the expected exchange of Bet v 1 and Fel d 1 specific IgG4
with irrelevant IgG4. Size-exclusion chromatography was performed
to exclude the possibility that bispecific activity observed in the
IgG4 mix was the result of IgG aggregation. For this purpose, a
sample (drawn at t=72h) was fractionated on a Superdex200 column,
after which Fel d 1 binding IgG and Bet v 1-Fel d 1 cross-linking
IgG were measured in the fractions. Fel d 1 binding antibodies
eluted in one peak with a retention volume of .about.12.9 ml, which
corresponds to the retention volume of monomeric IgG. The
heterologous Bet v 1-Fel d 1 cross-linking activity was detected in
the same fractions indicating that bispecific activity was
associated with monomeric IgG (data not shown).
[0244] In theory, the exchange of IgG4 half molecules is also
associated with a decrease in bivalency. To test this, bivalency in
the incubation mixtures was measured. Almost no reduction of Fel d
1 bivalency was observed in the IgG1 mix, whereas a reduction of
.about.50% was observed in the IgG4 mix. This reduction is in
agreement with the maximal exchange of two different IgG4 molecules
mixed in a 1 to 1 ratio. As expected, the reduction of bivalency in
the IgG4 mix with excess irrelevant IgG4 was higher (.about.80%),
which is due to the low probability of rehybridisation of two
homologous half molecules (Bet v 1 or Fel d1 specific) in the
presence of excess irrelevant IgG4 half molecules. The strong
reduction in bivalency was not the result of loss of antigen
binding during the incubation, because the antigen binding was only
slightly (.about.10%) decreased after 72 h of incubation (data not
shown).
[0245] The exchange of IgG in PBS (supplemented with 0.05% (w/v)
NaN.sub.3) was also evaluated to investigate whether IgG4 half
molecules can be exchanged spontaneously. The set-up of this
experiment was similar to the exchange in the presence of
erythrocytes with the exception that no erythrocytes were added. No
spontaneous exchange of IgG1 or IgG4 half molecules was observed
during the incubation in PBS at 37.degree. C. as is demonstrated
FIG. 9A. However, some background was observed in the IgG4 mix,
which was also present during the incubation with erythrocytes. No
decrease of bivalency was observed during the incubation in PBS
(FIG. 9B).
Example 29
Evaluation of IgG4 Fab Arm Exchange by Erythrocyte Lysate
[0246] Chimeric IgG4 antibodies were mixed and subsequently
incubated with increasing dilutions of erythrocyte lysate.
Erythrocytes were isolated from a healthy donor and stored at
4.degree. C. in SAGM (Saline Adenine Glucose Mannitol) buffer with
a hematocrit of 60.7%. To obtain lysate the cells were washed three
times with PBS-Azide (PBS supplemented with 0.05% (w/v) NaN.sub.3)
and resuspended in water with a volume that was two fold higher
than the volume of the storage buffer. As a result, undiluted
erythrocyte lysate was equivalent to a hematocrit of 30%.
[0247] The exchange of IgG4 half molecules was evaluated by
incubating an IgG4 antibody mixture consisting of Bet v 1 specific
IgG4 (1 .mu.g) and Fel d 1 specific IgG4 (1 .mu.g) with 50 .mu.l of
freshly prepared lysate (supplemented with PBS/Azide to a total
volume of 100 .mu.l) at 37.degree. C. Final concentration of each
antibody was 10 .mu.g/ml. At indicated time points a sample was
drawn from the incubation mix in PBS-AT (PBS supplemented with 0.3%
bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) to
measure bispecific activity. Samples were stored, if necessary, at
4.degree. C.
[0248] Bispecific activity (i.e. Bet v 1-Fel d 1 cross-linking
activity) was measured in the heterologous cross-linking assay. In
this assay, sample dilutions were incubated for 24 h with 0.5 mg
Sepharose-coupled birch extract in a total volume of 300 .mu.l in
PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg). Subsequently,
the Sepharose was washed with PBS-T and incubated for 24 h with
.sup.125I-labeled Fel d 1, after which the Sepharose was washed
with PBS-T and the amount of radioactivity bound relative to the
amount of radioactivity added was measured. The concentration of
bispecific IgG (Bet v 1-Fel d 1) was calculated using the
calibration curve of the Fel d 1 binding test, which was obtained
from purified Fel d 1 binding rIgG.
[0249] In FIG. 10 generation of bispecific activity in time is
shown as percentage bound .sup.125I-labeled Fel d 1, which was
determined in the heterologous cross-linking assay. From these data
it is evident that lysate of erythrocytes contains exchange
activity. Highest exchange rate was observed in undiluted lysate,
whereas higher dilutions resulted in lower exchange rates.
Practically no bispecific activity was observed in the control
incubation in PBS.
[0250] Size-exclusion chromatography was performed to exclude the
possibility that bispecific activity induced by erythrocyte lysate
was the result of IgG aggregation (FIG. 11). For this purpose, an
incubation mixture was prepared consisting of 10 .mu.g Bet v 1
binding IgG4, 10 .mu.g Fel d 1 binding IgG4 and 50 .mu.l
erythrocyte lysate, which was supplemented with PBS/Azide to final
volume of 100 .mu.l. This mixture was incubated at 37.degree. C.
for 24 h, after which 70 .mu.l was fractionated on a Superdex200
column. In the fractions Bet v 1 binding IgG and Fel d 1-Bet v 1
cross-linking IgG were measured. Levels of Bet v 1 binding
antibodies were measured in the antigen binding test. Samples were
incubated with 0.75 mg of protein G Sepharose (Amersham
Biosciences, Uppsala, Sweden) in 750 .mu.l PBS-IAT (PBS
supplemented with 1 .mu.g/ml IVIg, 0.3% bovine serum albumin, 0.1%
Tween-20 and 0.05% (w/v) NaN.sub.3) in the presence of
.sup.125I-labeled Bet v 1 for 24 h. Next, the Sepharose was washed
with PBS-T (PBS supplemented with 0.1% Tween-20 and 0.05% (w/v)
NaN.sub.3) and the amount of radioactivity bound relative to the
amount of radioactivity added was measured. The concentration of
Bet v 1 specific IgG was calculated using purified Bet v 1 specific
antibodies as a standard (range 0-200 ng per test as determined by
nephelometer). The concentration of bispecific IgG (i.e. Fel d
1-Bet v 1 cross-linking activity) was measured in the heterologous
cross-linking assay. In this assay, a sample was incubated for 24 h
with 0.5 mg Sepharose-coupled cat extract, in which Fel d 1 antigen
is present, in a total volume of 300 .mu.l in PBS-IAT.
Subsequently, the Sepharose was washed with PBS-T and incubated for
24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was
washed with PBS-T and the amount of radioactivity bound relative to
the amount of radioactivity added was measured. The concentration
of bispecific IgG (Fel d 1-Bet v 1) was calculated using the same
calibration curve as used in the Bet v 1 binding test, which was
obtained from purified Bet v 1 binding rIgG.
[0251] Bet v 1 binding antibodies eluted in one peak with a
retention volume of .about.12.6 ml, which corresponds to the
retention volume of monomeric IgG (FIG. 11). The heterologous Fel d
1-Bet v 1 cross-linking activity was detected in the same fractions
indicating that bispecific activity was associated with monomeric
IgG.
Example 30
Evaluation of IgG4 Fab Arm Exchange Activity in Dialyzed
Erythrocyte Lysate
[0252] Erythrocytes were isolated from a healthy donor and stored
at 4.degree. C. in SAGM (Saline Adenine Glucose Mannitol) buffer
with a hematocrit of 60.7%. To obtain lysate the cells were washed
three times with PBS-Azide (PBS supplemented with 0.05% (w/v)
NaN.sub.3) and resuspended in water with a volume that was two-fold
higher than the volume of the storage buffer. Therefore, undiluted
erythrocyte lysate was equivalent to a hematocrit of 30%. Part of
the lysate was dialyzed against PBS-Azide using a dialysis membrane
cassette from Pierce (3.5 kD cut-off). Ultrafiltrate was obtained
by centrifugation of non-dialyzed lysate in an Amicon filter (3.5
kD cut-off).
[0253] The exchange of IgG4 half molecules was evaluated by
incubating an IgG4 antibody mixture (Bet v 1 specific IgG4 (0.5
.mu.g) and Fel d 1 specific IgG4 (0.5 .mu.g) with freshly prepared
erythrocyte lysate (25 .mu.l) or dialyzed lysate (25 .mu.l) at
37.degree. C. Total volume of each incubation was 50 .mu.l
resulting in a final concentration of 10 .mu.g/ml for each
antibody. The following supplements were used: reduced glutathione
(GSH) from Sigma, Glucose-6-phospate (G-6-P) and NADPH (both from
Roche). These compounds were dissolved in water before use. After
24 h of incubation a sample was drawn from the incubation mix in
PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1%
Tween-20 and 0.05% (w/v) NaN.sub.3) to measure bispecific activity.
Samples were stored, if necessary, at 4.degree. C.
[0254] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking
activity) was measured in the heterologous cross-linking assay. In
this assay, sample dilutions were incubated for 24 h with 0.5 mg
Sepharose-coupled cat extract in a total volume of 300 .mu.l in
PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg). Subsequently,
the Sepharose was washed with PBS-T and incubated for 24 h with
.sup.125I-labeled Bet v 1, after which the Sepharose was washed
with PBS-T and the amount of radioactivity bound relative to the
amount of radioactivity added was measured.
[0255] The exchange levels were compared with the bispecific
activity generated by freshly prepared lysate (Table 2).
TABLE-US-00003 TABLE 2 Overview of factors that restore bispecific
activity in dialyzed erythrocyte lists. Exchange activity of
dialyzed erythrocyte lysate was compared with freshly prepared
lysate. Dialyzed lysate was supplemented with 5 .quadrature.l of
ultrafiltrate. Final concentrations of G-6-P, NADPH and GSH were 5
mM, 0.1 mM and 0.5 mM, respectively. Exchange source Supplement
Exchange activity Lysate - ++ Dialyzed lysate - - Dialyzed lysate
Ultrafiltrate + Dialyzed lysate G-6-P, NADPH, GSH ++ Dialyzed
lysate G-6-P - Dialyzed lysate NADPH - Dialyzed lysate GSH ++
[0256] From these data it is evident that the activity of
erythrocyte lysate was lost after dialysis. Addition of
ultrafiltrate restored the exchange for a large part. This result
suggested that during dialysis a component (<3.5 kD) was lost,
which is essential for the exchange reaction. Such a component is
likely to be involved in the redox cycle, because disulfide bridge
reduction and oxidation is required for the exchange of IgG4 half
molecules. Therefore, three "co-factors" (G-6-P, NADPH and GSH) of
the redox cycle were added to dialyzed lysate to investigate
whether these compounds could restore the exchange activity. The
exchange activity could be restored if G-6-P, NADPH and GSH were
supplemented together. Incubation of dialyzed lysate in the
presence of separate factors revealed that the exchange activity
was restored by GSH, but not by G-6-P or NADPH.
Example 31
Evaluation of IgG4 Half Molecule Exchange by Reduced
Glutathione
[0257] Chimeric antibodies were mixed and subsequently incubated
with reduced glutathione (GSH) to investigate the exchange of IgG4
half molecules. GSH (Sigma-Aldrich, St. Louis, Mo.) was solved in
water before use.
[0258] In this experiment the exchange of IgG4 half molecules was
evaluated by incubating an IgG4 antibody mixture consisting of Bet
v 1 specific IgG4 (1 .mu.g) and Fel d 1 specific IgG4 (1 .mu.g) in
PBS/Azide containing GSH at 37.degree. C. Total incubation volume
was 100 .mu.l resulting in a final concentration of 10 .mu.g/ml for
each antibody. At indicated time points a sample was drawn from the
incubation mixture in PBS-AT (PBS supplemented with 0.3% bovine
serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). Samples
were stored at 4.degree. C. for measuring of antigen binding and
bispecific activity
[0259] Levels of Bet v 1 binding antibodies were measured in the
antigen binding test. Samples were incubated with 0.75 mg of
protein G Sepharose (Amersham Biosciences, Uppsala, Sweden) in 750
.mu.l PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg) in the
presence of .sup.125I-labeled Bet v 1 for 24 h. Next, the Sepharose
was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and
0.05% (w/v) NaN.sub.3) and the amount of radioactivity bound
relative to the amount of radioactivity added was measured. The
concentration of Bet v 1 specific IgG was calculated using purified
Bet v 1 specific antibodies as a standard (range 0-200 ng per test
as determined by nephelometer). The concentration of bispecific IgG
(i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the
heterologous cross-linking assay. In this assay, a sample was
incubated for 24 h with 0.5 mg Sepharose-coupled cat extract, in
which Fel d 1 antigen is present, in a total volume of 300 .mu.l in
PBS-IAT. Subsequently, the Sepharose was washed with PBS-T and
incubated for 24 h with .sup.125I-labeled Bet v 1, after which the
Sepharose was washed with PBS-T and the amount of radioactivity
bound relative to the amount of radioactivity added was measured.
The concentration of bispecific IgG (Fel d 1-Bet v 1) was
calculated using the same calibration curve as used in the Bet v 1
binding test, which was obtained from purified Bet v 1 binding
IgG.
[0260] In FIG. 12 time courses of GSH mediated exchange of IgG4
half molecules are presented. From these data it is clear that IgG4
half molecules are exchanged in the presence of GSH. In this
experiment optimal exchange was observed between 0.1 and 1 mM GSH
and highest exchange (.about.90%) was reached after 24 h using 0.5
mM GSH.
[0261] Size-exclusion chromatography was performed to exclude the
possibility that bispecific activity observed after GSH mediated
exchange of IgG4 was the result of IgG aggregation (FIG. 13). For
this purpose, a mixture of Bet v 1 binding IgG4 and Fel d 1 binding
IgG4 (10 .mu.g of each antibody) was incubated with 0.5 mM GSH in
PBS/Azide. This mixture (final volume 100 .mu.l) was incubated at
37.degree. C. for 24 h, after which 70 .mu.l was fractionated on a
Superdex200 column. In the fractions Bet v 1 binding IgG and Fel d
1-Bet v 1 cross-linking IgG were measured. Bet v 1 binding
antibodies eluted in one peak with a retention volume of
.about.12.6 ml, which corresponds to the retention volume of
monomeric IgG. The heterologous Fel d 1-Bet v 1 cross-linking
activity was detected in the same fractions indicating that
bispecific activity was associated with monomeric IgG. The
generation of bispecific IgG4 molecules in the presence of GSH was
found to be temperature dependent, as exchange occurred more
efficiently at 37.degree. C. than at 4.degree. C. (FIG. 14).
Example 32
Generation of Bispecific IgG in the Presence of other Agents
[0262] IgG1-Betv1 and IgG1-Feld1 or IgG4-Betv1 and IgG4-Feld1 were
mixed at a final concentration of 10 .mu.g/ml for antibody and
incubated with reducing agents in a total volume of 50 .mu.l. Apart
from GSH the following agents were tested (final concentration in
incubation mixture): L-cysteine was from Sigma (100 .mu.M),
dithiothreitol (DTT) was from Biorad (50 .mu.M),
.beta.-mercapto-ethanol (BME) was from Biorad (100 .mu.M) and
oxidized glutathione (GSSG, note that of the panel of agents this
agent is not reducing, while all others are) was from Sigma (100
.mu.M). The mixtures were incubated at 37.degree. C. for 24 h and
samples were drawn in PBS/AT, in which the (bi)specific IgG
concentrations were measured. FIG. 15 shows that the addition of
GSH or other reducing agents (but not of GSSG) to a mixture of
purified IgG4-Betv1 and IgG4-Feld1 was sufficient to induce Fab arm
exchange and the generation of bispecific IgG4. In contrast, no
bispecific reactivity was induced in the control IgG1 mixture.
Example 33
Exchange of Fully Human IgG4 Antibodies using GSH
[0263] IgG1-CD20, IgG4-CD20, IgG1-EGFr and IgG4-EGFr were mixed and
incubated with GSH in a total volume of 1 ml. Final concentration
of each antibody was 50 .mu.g/ml; the final concentration of GSH
was 0.5 mM. The mixtures were incubated at 37.degree. C. for 24 h
and samples were drawn in PBS-AT, in which the (bi)specific IgG
concentrations were measured.
[0264] Bispecific activity was determined using a sandwich ELISA.
For this assay an ELISA plate (Greiner bio-one, Frickenhausen,
Germany) was coated overnight with 1 .mu.g/ml (100 .mu.l/well) of
recombinant extracellular domain of EGFR in PBS at 4.degree. C. The
plate was washed 3 times with PBS/0.05 Tween 20 (PBT). Samples were
diluted in PBT/0.2 BSA (PBTB) and transferred to the ELISA plate
(100 .mu.l/well). After incubation on a plate shaker (300 rpm) for
90 minutes at room temperature (RT), samples were discarded and the
plate was washed 3 times with PBT. Next, 100 .mu.l of the mouse
anti-idiotypic monoclonal antibody 2F2 SAB1.1 (directed against the
anti-CD20 antibody 7D8; Genmab) at 2 .mu.g/ml in PBTB was added and
incubated at RT for 90 minutes at a plate shaker (300 rpm). The
anti-idiotypic antibody was discarded and the plate was washed 3
times with PBT, followed by the addition of 100 .mu.l/well of a HRP
conjugated goat anti-mouse IgG (Jackson ImmunoResearch
Laboratories, Westgrove, Pa., USA) at a 1000.times. dilution in
PBTB and incubation at RT for 90 minutes at a plate shaker (300
rpm). The detection antibody was discarded and the plate was washed
3 times with PBT. A 50 mg ABTS tablet (Roche Diagnostics GmbH,
Mannheim, Germany) was dissolved in ABTS buffer (Roche) and added
to the ELISA plate (100 .mu.l/well). The ELISA plate was incubated
for 30 min (or longer if desired) at RT on a plate shaker (300 rpm)
covered with aluminum foil and the reaction was stopped with 100
.mu.l oxalic acid (Riedel de Haen Seelze, Germany) per well. The
ELISA plate was left at RT for 10 minutes before reading absorbance
at 405 nm in an ELISA plate reader.
[0265] FIG. 16A shows that bispecific anti-EGFR/CD20 antibodies
formed in time upon incubation of the mixture of IgG4-EGFr and
IgG4-CD20 in the presence, but not in the absence, of GSH. Fab arm
exchange did not occur in a mixture of IgG1 antibodies, neither in
the presence or absence of GSH.
[0266] To explore the dynamic range of GSH mediated exchange of
IgG4 half molecules, a full concentration curve of GSH (0.5-1,000
.mu.M) was used to analyze exchange. IgG4-CD20 and IgG4-EGFr were
mixed and incubated with GSH in a total volume of 1 ml. Final
concentration of each antibody was 50 .mu.g/ml; the final
concentration of GSH were as indicated in FIG. 16B. The mixtures
were incubated at 37.degree. C. for 24 h and samples were drawn in
PBS-AT, in which the (bi)specific IgG concentrations were
measured.
[0267] FIG. 16B shows a clear GSH-dose dependence of IgG4 half
molecule exchange. To explore how reaction components influence the
GSH-mediated IgG4 half molecule exchange, exchange was tested in
PBS and serum- and protein free, chemically defined medium
(FreeStyle 293 expression medium, GIBCO/Invitrogen Corporation). It
was found that in this tissue culture medium, GSH-mediated exchange
occurs at lower GSH-concentrations (FIG. 16C). It was also found
that there is an optimum in GSH-mediated IgG4 half molecule
exchange, as incubation with 5 mM GSH clearly resulted in lower
exchange that with 0.5 mM (FIG. 16D).
[0268] A mixture of IgG4-EGFr and IgG4-CD20 was incubated for 24 h
in the absence or presence of GSH and evaluated by mass
spectrometry (ESI-TOF MS). Fifty pl samples containing 200 .mu.g/ml
of each antibody were deglycosylated overnight with 1 .mu.l
N-glycosidase F (Roche Diagnostics NL BV, Almere, The Netherlands).
Samples were desalted on an Acquity UPLC.TM. (Waters, Milford, USA)
with a BEH C8, 1.7 .mu.m, 2.1.times.50 mm column at 60.degree. C.
Five .mu.l was injected and eluted with a gradient from 5% to 95%
eluent B. Eluent A was MilliQ water (Millipore Synthesis A10
apparatus) and eluent B was LC-MS grade acetonitrile (Biosolve,
Valkenswaard, The Netherlands). Both eluents contained 0.05% formic
acid as organic modifier (Fluka Riedel-de Haen, Buchs, Germany).
Time-of-flight electrospray ionization mass spectra were recorded
on-line on a micrOTOF.TM. mass spectrometer (Bruker, Bremen,
Germany) operating in the positive ion mode. In each analysis, a
500-5000 m/z scale was internally calibrated with ES tuning mix
(Agilent Technologies, Santa Clara, USA). Mass spectra were
deconvoluted by using the Maximum Entropy algorithm, which is
provided with DataAnalysis.TM. software v. 3.3 (Bruker).
[0269] FIG. 16E shows that the molecular weights of IgG4-CD20
(145.5 kD) and IgG4-EGFR (145.9 kD) remained unchanged in the
absence of GSH. In the presence of GSH (FIG. 16F), however, a new
peak with a mass corresponding to a Fab arm exchanged molecule
appeared (145.7 kD). The novel mass corresponded to the expected
mass of the bispecific anti-EGFR/CD20 antibody. Moreover, from the
peak heights of the MS spectra it could be estimated that the
bispecific antibody represented 50% of the total antibody mass in
the mixture indicating a random exchange which reached equilibrium
within 24 hours.
Example 34
Rhesus Monkey IVIg Participates in Fab Arm Exchange of Recombinant
Human IgG4 Antibodies
[0270] Mixtures of two recombinant human IgG4 antibodies (IgG4-CD20
and IgG4-EGFr, as described above) were incubated with GSH for 24 h
at 37.degree. C., in the presence or absence of rhesus monkey or
human IVIg. The formation of bispecific antibodies through Fab arm
exchange was measured in a sandwich ELISA as described above.
[0271] FIG. 17 shows that monkey polyclonal IVIg compares to human
polyclonal IVIg in its ability to inhibit the exchange of Fab arms
of the recombinant antibodies in vitro in the presence of reduced
glutathione. This means that a component of rhesus IVIg, rhesus
immunoglobulin, participates in Fab arm exchange. Rhesus
immunoglobulin, presumably rhesus IgG4, can exchange Fab arm with
recombinant human IgG4.
Example 35
Fab Arm Exchange of Hinge Region or CH3 Domain Mutants
[0272] Three IgG1 mutants were made: an IgG1 with an IgG4
core-hinge (IgG1-CPSC) and two CH3 domain swap mutants
(IgG1-CH3(IgG4) and IgG1-CPSC-CH3(IgG4).
[0273] All references to CPSC in Example 35 refer to SEQ ID
NO:51.
[0274] Site directed mutagenesis was used to introduce a P228S
mutation in the hinge of IgG1 using pEE-G1-wt a Bet v 1 as a
template. Mutagenic primers, forward and reverse, were designed
with Vector NTI Advance 10:
TABLE-US-00004 P228S Mut primer-F: SEQ ID NO: 19: cttgtgacaa
aactcacacc tgcccatcgt gcccaggtaa gccag P228S Mut primer-R: SEQ ID
NO: 20: ctggcttacc tgggcacgat gggcaggtgt gagttttgtc acaag
[0275] Quickchange site-directed mutagenesis kit (Stratagene) was
used to create the pEE-G1-CPSC mutant. The polymerase chain
reaction (PCR) mix consisted of 5 .mu.l pEE-G1 a Betv1 DNA template
(.about.35 ng), 1.5 .mu.l mutagenic primer-forward (.about.150 ng),
1.5 .mu.l mutagenic primer-reverse (.about.150 ng), 1 .mu.l dNTP
mix, 5 .mu.l reaction buffer (10.times.), 36 .mu.l H2O and finally
1 .mu.l Pfu Turbo DNA polymerase. Then the mix was applied to the
PCR: 30'' 95.degree. C., 30'' 95.degree. C. (denaturating), 1'
55.degree. C. (annealing) and 17 minutes 68.degree. C.
(elongating). This cycle was repeated 20 times.
[0276] DNA digesting and ligation was used to create CH3 domain
swap mutant constructs IgG1-CH3(IgG4) and IgG1-CPSC-CH3(IgG4).
Digestion reactions to obtain CH3 domains and vectors without CH3
domains were as follows: .about.1500 ng DNA (pEE-G1-betv1,
pEE-B1-CPSC and pEE-G4-betv1), 2 .mu.l BSA, 2 .mu.l Neb3 buffer, 1
.mu.l SalI and H.sub.2O added to a volume of 20 pl. Incubation at
37.degree. C. for 30'. DNA was purified and eluted with 30 .mu.l
H.sub.2O before 1 .mu.l SanDI and 3 .mu.l universal buffer was
added and incubated at 37.degree. C. for 30'. Fragments were
subjected to gel electrophoresis on 1% agarose gels with ethidium
bromide. Fragments were cut from the gel under ultraviolet light
and dissolved using a DNA purification kit (Amersham). The
pEE-G4-wt SalI/SanDI (which contained IgG4 CH3 domain) fragment was
ligated into pEE-G1-wt and pEE-G1-CPSC using following procedure: 1
.mu.l template DNA (SalI/SanDI digested pEE-G1-wt and pEE-G1-CPSC),
5 .mu.l SalI/SanDI insert, 4 .mu.l Ligate-it buffer, 9 .mu.l H2O
and 1 .mu.l ligase in a total volume of 20 .mu.l. Ligation was
stopped after 5'.
[0277] DNA digestion (using ApaI and HindIII) and ligation was used
to replace the VH domain of the bet v 1 mutant antibodies with that
of pEE-G4-a-feld1wt, following a similar procedure as above.
[0278] Also, one IgG4 mutant was made: IgG4-S228Pnew. In this
mutant, the hinge is stabilized by replacing serine at position 228
for a proline (IgG1 core hinge). Site-directed mutagenesis was
performed using the QuickChange II XL Site-Directed Mutagenesis Kit
(Stratagene, Amsterdam, The Netherlands) according to the
manufacturer's instructions. This method included the introduction
of a silent extra XmaI site to screen for successful mutagenesis.
Briefly, 5 .mu.l 10.times. reaction buffer, 1 .mu.l oligonucleotide
S228Pfcorrect (100 pmol/.mu.l), 1 .mu.l oligonucleotide
S228Prcorrect (100 pmol/.mu.l), 1 .mu.l dNTP mix, 3 .mu.l
Quicksolution, 1 .mu.l plasmid pTomG42F8HG (50 ng/.mu.l) (described
in PCT application entitled "Recombinant monovalent antibodies and
methods for production thereof", filed on 28 Nov. 2006 (RO/DK
(Genmab)) and 1 .mu.l PfuUltra HF DNA polymerase were mixed in a
total volume of 50 .mu.l and amplified with a TGradient
Thermocycler 96 (Whatman Biometra, Goettingen, Germany; product
#050-801) using an 18-cycle program: denaturing at 95.degree. C.
for 1 min; 18 cycles of 95.degree. C. for 50 sec, 60.degree. C. for
50 sec, and 68.degree. C. for 10 min. PCR mixtures were stored at
4.degree. C. until further processing. Next, PCR mixtures were
incubated with 1 .mu.l DpnI for 60 min at 37.degree. C. to digest
the pTomG42F8HG vector and stored at 4.degree. C. until further
processing. The reaction mixture was precipitated with 5 .mu.l 3 M
NaAc and 125 .mu.l Ethanol, incubated for 20 minutes at -20.degree.
C. and spun down for 20 minutes at 4.degree. C. at 14000.times.g.
The DNA pellet was washed with 70% ethanol, dried and dissolved in
4 .mu.l water. The total 4 .mu.l reaction volume was transformed in
One Shot DNH5.alpha. T1.sup.R competent E. coli cells (Invitrogen,
Breda, The Netherlands) according to the manufacturer's
instructions (Invitrogen). Next, cells were plated on Luria-Bertani
(LB) agar plates containing 50 .mu.g/ml ampicillin. Plates were
incubated for 16-18 hours at 37.degree. C. until bacterial colonies
became evident.
[0279] After screening by colony PCR and XmaI (mutagenesis will
result in the loss of a XmaI site) digestion, plasmid was isolated
from the bacteria and the mutation was confirmed by DNA sequencing.
To check if no unwanted extra mutations were introduced the whole
HC coding region was sequenced and did not contain any additional
mutations. The final construct was named pTomG42F8S228PNew.
TABLE-US-00005 Name Oligonucleotide Sequence S228Pfcorrect
CCCCCATGCCCACCATGCCCAGGTAAGCCAACCC (SEQ ID NO: 21) AGGCCTCGC
S228Prcorrect GCGAGGCCTGGGTTGGCTTACCTGGGCATGGTGG (SEQ ID NO: 22)
GCATGGGGG
[0280] Recombinant antibodies from these constructs were
transiently expressed in HEK 293 cells in 3 ml, 6-wells plates
(NUNC) or in 125 ml erlenmeyers (Corning) with 293 Fectin
(Invitrogen) as transfection reagent.
[0281] The following mixtures of unpurified antibodies (FreeStyle
293 expression medium, GIBCO/Invitrogen Corporation) were incubated
with 0.1 mM GSH at 37.degree. C. for 24 h and samples were drawn in
PBS-AT, in which the (bi)specific IgG concentrations were measured
as described in previous examples: [0282] IgG4 anti-feld1wt with
IgG4 anti-betv1 wt [0283] IgG1 anti-feld1wt with IgG4 anti-betv1 wt
[0284] IgG1 anti-feld1CPSC with IgG1 anti-betv1 CPSC (indicated as
IgG1 CPSC-IgG1 CPSC below) [0285] IgG1 anti-feld1CPSC with IgG1
anti-betv1 CH3(IgG4) (IgG1 CPSC-IgG1 CH3(IgG4)) [0286] IgG1
anti-feld1CPSC with IgG1 anti-betv1 CPSC/CH3(IgG4) (IgG1 CPSC-IgG1
CPSC/CH3(IgG4)) [0287] IgG1 anti-feld1CH3(IgG4) with IgG1
anti-betv1 CH3(IgG4) (IgG1 CH3(IgG4)-IgG1 CH3(IgG4)) [0288] IgG1
anti-feld1CH3(IgG4) with IgG1 anti-betv1 CPSC/CH3(IgG4) (IgG1
CH3(IgG4)-IgG1 CPSC/CH3(IgG4)) [0289] IgG1 anti-feld1CPSC/CH3(IgG4)
with anti-betv1 IgG1 CPSC/CH3(IgG4) (IgG1 CPSC/CH3(IgG4)-IgG1
CPSC/CH3(IgG4)) [0290] IgG1 anti-feld1CPSC/CH3(IgG4) with IgG4
a-ntibetv1 wt (IgG1 CPSC/CH3(IgG4)-IgG4 wt) [0291] IgG4 anti-bet1
S228Pnew with IgG4 wt
[0292] The results showed that under these in vitro conditions (0.1
mM GSH), half molecule exchange occurs when one of the antibodies
contains the CPSC hinge (SEQ ID NO:51) and both antibodies contain
an IgG4-like CH3. Also, half molecule exchange occurs between
an
[0293] IgG4 molecule containing an IgG1 hinge and IgG4 wt
molecules:
TABLE-US-00006 IgG1 IgG1 IgG1 CPSC/ IgG1 wt IgG4 wt CH3(IgG4) CPSC
CH3(IgG4) IgG1 wt - - IgG4 wt - + + - + IgG1 CH3(IgG4) + - - .+-.
IgG1 CPSC - - - - IgG1 + .+-. - + CPSC/CH3(IgG4) IgG4 S228Pnew - +
- = no exchange + = exchange occurs .+-. = limited exchange (~5%)
Blank square = not tested
[0294] The effect of GSH concentration on the half molecule
exchange from the different mutants was tested using 0, 0.1, 1 and
10 mM GSH. Exchange was tested using the following mixtures: [0295]
IgG4 a-feld1wt with IgG4 a-betv1 wt [0296] IgG1 a-feld1wt with IgG4
a-betv1 wt [0297] IgG1 a-feld1CPSC with IgG1 a-betv1 CPSC [0298]
IgG1 a-feld1CH3(IgG4) with IgG1 a-betv1 CH3(IgG4) [0299] IgG1
a-feld1CPSC/CH3(IgG4) with a-betv1 IgG1 CPSC/CH3(IgG4))
[0300] For GSH concentrations up to 1 mM, the results (FIG. 18)
confirmed those described above. At 10 mM GSH, half molecule
exchange was also seen in the reaction containing IgG1
a-feld1CH3(IgG4) and IgG1 a-betv1 CH3(IgG4).
[0301] Size-exclusion chromatography was performed to exclude the
possibility that bispecific activity observed after GSH mediated
exchange of the appropriate IgG1 mutants was the result of IgG
aggregation as described in previous examples. The heterologous Fel
d 1-Bet v 1 cross-linking activity was detected in the fractions
corresponding to the retention volume of monomeric IgG.
Example 36
Generation of IgG1 and IgG4 Antibodies with Hinge Region and/or CH3
Domain Mutations
[0302] Five IgG1 mutants were made: an IgG1 with an IgG4 core-hinge
(IgG1-P228S), two CH3 domain swap mutants (IgG1-CH3(.gamma.4) and
IgG1-P228S-CH3(.gamma.4)), one CH3 point mutant in which lysine
present at position 409 of IgG1 (within the CH3 domain) is replaced
for arginine (IgG1-K409R), and one IgG1 with an IgG4 core hinge and
K409R mutation (IgG1-P228S-K409R) (FIG. 19). These mutants were
made with either Bet v 1 or Fel d 1 specificity.
[0303] Two IgG4 mutants were made: one CH3 point mutant in which
arginine present at position 409 of IgG4 (within the CH3 domain) is
replaced for lysine (IgG4-R409K), and one CH3 swap mutant
(IgG4-CH3(.gamma.1)) (FIG. 19). These mutants were also made with
either Bet v 1 or Fel d 1 specificity.
[0304] All references to CPSC in Example 36 refer to SEQ ID
NO:51.
[0305] Site directed mutagenesis was used to introduce a P228S
mutation in the hinge of IgG1 using pEE-G1-wt a Bet v 1 as a
template. Mutagenic primers, forward and reverse, were designed
with Vector NTI Advance 10:
TABLE-US-00007 P228S Mut primer-F: SEQ ID NO: 23: cttgtgacaa
aactcacacc tgcccatcgt gcccaggtaa gccag P228S Mut primer-R: SEQ ID
NO: 24: ctggcttacc tgggcacgat gggcaggtgt gagttttgtc acaag
[0306] Quickchange site-directed mutagenesis kit (Stratagene) was
used to create the pEE-G1-CPSC mutant. The polymerase chain
reaction (PCR) mix consisted of 5 .mu.l pEE-G1 a Betv1 DNA template
(.about.35 ng), 1.5 .mu.l mutagenic primer-forward (.about.150 ng),
1.5 .mu.l mutagenic primer-reverse (.about.150 ng), 1 .mu.l dNTP
mix, 5 .mu.l reaction buffer (10.times.), 36 .mu.l H2O and finally
1 .mu.l Pfu Turbo DNA polymerase. Then the mix was applied to the
PCR: 30'' 95.degree. C., 30'' 95.degree. C. (denaturating), 1'
55.degree. C. (annealing) and 17 minutes 68.degree. C.
(elongating). This cycle was repeated 20 times.
[0307] DNA digesting and ligation was used to create CH3 domain
swap mutant constructs IgG1-CH3(.gamma.4) and
IgG1-P228S-CH3(.gamma.4). Digestion reactions to obtain CH3 domains
and vectors without CH3 domains were as follows: .about.1500 ng DNA
(pEE-G1-betv1, pEE-G1-CPSC and pEE-G4-betv1), 2 .mu.l BSA, 2 .mu.l
Neb3 buffer, 1 .mu.l SalI and H.sub.2O added to a volume of 20
.mu.l. Incubation at 37.degree. C. for 30'. DNA was purified and
eluted with 30 .mu.l H.sub.2O before 1 .mu.l SanDI and 3 .mu.l
universal buffer was added and incubated at 37.degree. C. for 30'.
Fragments were subjected to gel electrophoresis on 1% agarose gels
with ethidium bromide. Fragments were cut from the gel under
ultraviolet light and dissolved using a DNA purification kit
(Amersham). The pEE-G4-wt SalI/SanDI (which contained IgG4 CH3
domain) fragment was ligated into pEE-G1-wt and pEE-G1-CPSC using
following procedure: 1 .mu.l template DNA (SalI/SanDI digested
pEE-G1-wt and pEE-G1-CPSC), 5 .mu.l SalI/SanDI insert, 4 .mu.l
Ligate-it buffer, 9 .mu.l H2O and 1 .mu.l ligase in a total volume
of 20 .mu.l. Ligation was stopped after 5'.
[0308] DNA digestion (using Apal and HindIII) and ligation was used
to replace the VH domain of the bet v 1 mutant antibodies with that
of pEE-G4-a-feld1wt, following a similar procedure as above.
[0309] Site-directed mutagenesis was used to introduce point
mutations (K409R or R409K) into the pEE-.gamma.4 wt, pEE-.gamma.1
and PEE-.gamma.1-P228S constructs. Mutagenic primers, forward and
reverse, were designed with Vector NTI Advance 10: [0310] G1-K409R
Mut-F: SEQ ID NO: 25 [0311] G1-K409R Mut-R: SEQ ID NO: 26 [0312]
G4-R409K Mut-F: SEQ ID NO: 27 [0313] G4-R409K Mut-R: SEQ ID NO:
28
TABLE-US-00008 [0313] Mutagenic Restric- Primer Sequence 5'-3'
Mutation tion site G1-K409R Mut-F
CCTTCTTCCTCTATAGCAGGCTCACCGTAGACAAGAGCAGGTG Lys > Arg AccI GC
G1-K409R Mut-R GCCACCTGCTCTTGTCTACGGTGAGCCTGCTATAGAGGAAGAA Lys >
Arg AccI GG G4-R409K Mut-F
GGCTCCTTCTTCCTCTACAGCAAGCTAACCGTAGACAAGAGCA Arg > Lys AccI GG
G4-R409K Mut-R CCTGCTCTTGTCTACGGTTAGcTTGcTGTAGAGGAAGAAGGAG Arg >
Lys AccI CC
[0314] Site-directed mutagenesis was performed using the
QuickChange II XL Site-Directed Mutagenesis Kit (Stratagene,
Amsterdam, The Netherlands) according to the manufacturer's
instructions, with changes as indicated below to increase mutagenic
efficiency. This method included the introduction of a silent extra
Accl site to screen for successful mutagenesis. First, a prePCR mix
was used containing 3 .mu.l 10.times. pfu reaction buffer, 1 .mu.l
dNTP mix (10 mM), 275 ng forward or reverse primer, 50 ng template
DNA and 0.75 .mu.l Pfu turbo hotstart polymerase. A prePCR was run
using a GeneAmp PCR system 9700 (Applied Biosystems): initial
denaturation at 94.degree. C. for 5 min; 4 cycles of 94.degree. C.
for 30 sec, 50.degree. C. for 1 min and 68.degree. C. for 14 min.
25 .mu.l of forward primer containing prePCR mix was added to 25
.mu.l of reverse primer containing prePCR mix. 0.5 .mu.l Pfu turbo
hotstart was added and amplification was performed: denaturing at
94.degree. C. for 1 min; 14 cycles of 94.degree. C. for 1 min,
50.degree. C. for 1 min and 68.degree. C. for 8 min; 12 cycles of
94.degree. C. for 30 sec, 55.degree. C. for 1 min and 68.degree. C.
for 8 min.
[0315] PCR mixtures were stored at 4.degree. C. until further
processing. Next, PCR mixtures were incubated with 1 .mu.l DpnI for
60 min at 37.degree. C. and stored at 4.degree. C. until further
processing. 2 .mu.l of the digested PCR products was transformed in
One Shot DNH5.alpha. T1.sup.R competent E. coli cells (Invitrogen,
Breda, The Netherlands) according to the manufacturer's
instructions (Invitrogen). Next, cells were plated on Luria-Bertani
(LB) agar plates containing 50 .mu.g/ml ampicillin. Plates were
incubated for 16-18 hours at 37.degree. C. until bacterial colonies
became evident.
[0316] After screening by colony PCR and Accl digestion to check
for successful mutagenesis, plasmid was isolated from the bacteria
and the mutation was confirmed by DNA sequencing. To check if no
unwanted extra mutations were introduced the whole HC coding region
was sequenced and did not contain any additional mutations.
TABLE-US-00009 Sequence Primer sequence (5'-3') CH1-Betv1-F:
TCTCCTCAGCCAGCACCAAG SEQ ID NO: 29 CH1-Feld1-F:
GTTTGTCTGCAGCCAGCACCAAG SEQ ID NO: 30 CH2-F: SEQ ID NO: 31
CATCTCCAAAGCCAAAGGTGGGACC CH2-R: SEQ ID NO: 32
GGTCCCACCTTTGGCTTTGGAGATG CH3-F: SEQ ID NO: 33
CGACGGCTCCTTCTTCCTCTACAG CH3-R: SEQ ID NO: 34
CTGTAGAGGAAGAAGGAGCCGTCG Intron2-F: CAAGAGCCATATCCGGGAGGACC SEQ ID
NO: 35 Intron2-R: GGTCCTCCCGGATATGGCTCTTG SEQ ID NO: 36 pEE-F: SEQ
ID NO: 37 GTCAGAGGTAACTCCCGTTG pEE-R: SEQ ID NO: 38
GTTGTGGTTTGTCCAAACTC
[0317] Recombinant antibodies from these constructs were
transiently expressed in HEK 293 cells in 3 ml, 6-wells plates
(NUNC) or in 125 or 250 erlenmeyers (Corning) with 293 Fectin
(Invitrogen) as transfection reagent.
Example 37
Fab Arm Exchange of IgG1 and IgG4 Hinge Region or CH3 Domain
Mutants
[0318] Antibodies were mixed and subsequently incubated with
reduced glutathione (GSH) to investigate the exchange of half
molecules. GSH (Sigma-Aldrich, St. Louis, Mo.) was dissolved in
water before use.
[0319] The exchange of half molecules was evaluated by incubating
an antibody mixture consisting of Bet v 1 specific antibody (200
ng) and Fel d 1 specific antibody (200 ng) in PBS/Azide containing
GSH (1 or 10 mM) at 37.degree. C. Total incubation volume was 50
.mu.l. After 24 hours samples were drawn from the incubation
mixture in PBS-AT (PBS supplemented with 0.3% bovine serum albumin,
0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). For samples containing 10
mM GSH an equimolar amount of iodine-acetamide, a strongly
alkylating agent that inhibits the GSH activity, was added. Samples
were stored at 4.degree. C. for measuring of antigen binding and
bispecific activity
[0320] Levels of Bet v 1 binding antibodies were measured in the
antigen binding test. Samples were incubated with 0.75 mg of
protein G Sepharose (Amersham Biosciences, Uppsala, Sweden) in 750
.mu.l PBS-IAT (PBS-AT supplemented with 1 .mu.g/ml IVIg) in the
presence of .sup.125I-labeled Bet v 1 for 24 h. Next, the Sepharose
was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and
0.05% (w/v) NaN.sub.3) and the amount of radioactivity bound
relative to the amount of radioactivity added was measured. The
concentration of Bet v 1 specific IgG was calculated using purified
Bet v 1 specific antibodies as a standard (range 0-200 ng per test
as determined by nephelometer).
[0321] The concentration of bispecific IgG (i.e. Fel d 1-Bet v 1
cross-linking activity) was measured in the heterologous
cross-linking assay. In this assay, a sample was incubated for 24 h
with 0.5 mg Sepharose-coupled cat extract, in which Fel d 1 antigen
is present, in a total volume of 300 .mu.l in PBS-IAT.
Subsequently, the Sepharose was washed with PBS-T and incubated for
24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was
washed with PBS-T and the amount of radioactivity bound relative to
the amount of radioactivity added was measured. The concentration
of bispecific IgG (Fel d 1-Bet v 1) was calculated using the same
calibration curve as used in the Bet v 1 binding test, which was
obtained from purified Bet v 1 binding IgG. Tests were performed
using antibody-containing supernatants in FreeStyle 293 expression
medium, GIBCO/Invitrogen Corporation.
[0322] The following antibody mixtures were used: [0323] Betv1-IgG1
wt with Feld1-IgG1 wt (indicated as IgG1 wt in FIG. 20) [0324]
Betv1-IgG1 P228S with Feld1-IgG1-P228S (IgG1-P228S in FIG. 20)
[0325] Betv1-IgG4-CH3(.gamma.1) with Feld1-IgG4-CH3(.gamma.1)
(IgG4-CH3(.gamma.1) in FIG. 20) [0326] Betv1-IgG4-R409K with
Feld1-IgG4-R409K (IgG4-R409K in FIG. 20) [0327]
Betv1-IgG1-CH3(.gamma.4) with Feld1-IgG1-CH3(.gamma.4)
(IgG1-CH3(.gamma.4) in FIG. 20) [0328] Betv1-IgG1-K409R with
Feld1-IgG1-K409R (IgG1-K409R in FIG. 20) [0329] Betv1-IgG4 wt with
Feld1-IgG4 wt (IgG4 wt in FIG. 20) [0330]
Betv1-IgG1-P228S-CH3(.gamma.4) with Feld1-IgG1-P228S-CH3(.gamma.4)
(IgG1-P228S-CH3(.gamma.4) in FIG. 20) [0331] Betv1-IgG1-P228S-K409R
with Feld1-IgG1-P228S-K409R (IgG1-P228S-K409R in FIG. 20)
[0332] The results (FIG. 20) showed that at 1 mM GSH, half molecule
exchange occurs between IgG4 wt, IgG1-P228S-K409R or
IgG1-P228S-CH3(.gamma.4) antibodies. Under these conditions, IgG1
wt, IgG1-P228S, IgG4-CH3(.gamma.1), IgG4-R409K, IgG1-CH3(.gamma.4)
or IgG1-K409R antibodies showed no or only minimal exchange of half
molecules. At 10 mM GSH, half molecule exchange was also seen in
the reactions containing IgG1-CH3(.gamma.4) or IgG1-K409R
antibodies.
Example 38
Additional CH3 Mutations to Stabilize Dimerization of Hingeless
IgG4 Antibody Molecules in the Absence of IVIG
[0333] Hingeless IgG4 antibody (HG) molecules form dimers by low
affinity non-covalent interactions. WO/2007/059782 describes that
this dimerization process can be inhibited by using HG IgG4
molecules in the presence of an excess of irrelevant antibodies.
WO/2007/059782 describes a hingeless IgG4 anti-EGFR antibody
2F8-HG.
[0334] Construction of pHG-2F8: A vector for the expression of the
heavy chain of 2F8-HG: The heavy chain cDNA encoding region of
2F8-HG was codon optimized and cloned in the pEE6.4 vector (Lonza
Biologics, Slough, UK). The resulting vector was named pHG-2F8.
[0335] Construction of pKappa2F8: A vector for the production of
the light chain of 2F8 antibodies: The VL region encoding antibody
2F8 was codon optimized and cloned in the pKappa2F2 vector (a
vector encoding the codon optimized cDNA region of antibody 2F2
(described in WO2004035607) in vector pEE12.4 (Lonza)), replacing
the 2F2 VL region with the 2F8 VL region. The resulting vector was
named pKappa-2F8.
[0336] Hingeless IgG4 anti-EGFR antibody 2F8-HG has been described
in WO/2007/059782. The additional mutations given in the Table
below were introduced into the CH3 region of hingeless IgG4
antibody 2F8-HG by site-directed mutagenesis.
[0337] KABAT indicates amino acid numbering according to Kabat
(Kabat et al., Sequences of Proteins of Immunological Interest, 5th
Ed. Public Health Service, National Institutes of Health, Bethesda,
Md.. (1991) [0338] EU index indicates amino acid numbering
according to EU index as outlined in Kabat et al., Sequences of
Proteins of Immunological Interest, 5th Ed. Public Health Service,
National Institutes of Health, Bethesda, Md. (1991)) [0339] SEQ ID
NO:39, 40, 41 indicates amino acid numbering as indicated in SEQ ID
NO:39, 40 and 41 of this document. [0340] See also FIG. 22 for
comparison of numbering methods.
TABLE-US-00010 [0340] Numbering of CH3 mutations KABAT EU index G4
SEQ ID NO: 39, 40, 41 436 F405A F285A 436 F405L F285L 440 R409A
R289A 440 R409K R289K
[0341] To make the constructs for the expression of the CH3
mutants, the mutations were introduced into pHG2F8 using
site-directed mutagenesis, using the following primers:
TABLE-US-00011 Name nt Sequence HGF417Af 48
CCAGTGCTGGACAGCGACGGAAGCTTCGCCCTGTACAGCAGGCTGACC (SEQ ID NO: 42)
HGF417Ar 48 GGTCAGCCTGCTGTACAGGGCGAAGCTTCCGTCGCTGTCCAGCACTGG (SEQ
ID NO: 43) HGF417Lf 51
CCAGTGCTGGACAGCGACGGATCCTTCTTACTGTACAGCAGGCTGACCGTG (SEQ ID NO: 44)
HGF417Lr 51 CACGGTCAGCCTGCTGTACAGTAAGAAGGATCCGTCGCTGTCCAGCACTGG
(SEQ ID NO: 45) HGR421Af 46
GCTCCTTCTTCCTGTACAGCGCGTTAACCGTGGACAAGTCCAGGTG (SEQ ID NO: 46)
HGR421Ar 46 CACCTGGACTTGTCCACGGTTAACGCGCTGTACAGGAAGAAGGAGC (SEQ ID
NO: 47) HGR421Kf 45 CTCCTTCTTCCTGTACAGCAAGCTTACCGTGGACAAGTCCAGGTG
(SEQ ID NO: 48) HGR421Kr 45
CACCTGGACTTGTCCACGGTAAGCTTGCTGTACAGGAAGAAGGAG (SEQ ID NO: 49)
[0342] The constructs were expressed transiently in HEK-293F cells
by cotransfecting the heavy-chain- and light-chain-encoding
plasmids and binding to purified EGFr was determined in the absence
and presence of 200 .mu.g/ml polyclonal human IgG (Intravenous
Immunoglobulin, IVIG, Sanquin Netherlands).
[0343] Binding affinities were determined using an ELISA in which
purified EGFr (Sigma, St Louis, Mo.) was coated to 96-well Microlon
ELISA plates (Greiner, Germany), 50 ng/well. Plates were blocked
with PBS supplemented with 0.05% Tween 20 and 2% chicken serum.
Subsequently, samples, serially diluted in a buffer containing 100
.mu.g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG,
Sanquin Netherlands) were added and incubated for 1 h at room
temperature (RT). Plates were subsequently incubated with
peroxidase-conjugated rabbit-anti-human kappa light chain (DAKO,
Glostrup, Denmark) as detecting antibody and developed with
2,2'-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) (ABTS;
Roche, Mannheim, Germany). Absorbance was measured in a microplate
reader (Biotek, Winooski, Vt.) at 405 nm.
[0344] FIG. 21 shows that the binding curve of 2F8-HG in the
presence of IVIG (thick dotted line with closed boxes) clearly
right-shifts with respect to the binding curve of 2F8-HG without
IVIG (thick closed line with open boxes). This difference in
avidity for the EGFr coat is consistent with the idea that, in the
presence of IVIG, 2F8-HG binds monovalently. The binding curves of
the tested mutations, 2F8-HG-F405L, 2F8-HG-F405A, 2F8-HG-R409A and
2F8-HG-R409KA, become insensitive to the addition of IVIG and were
super-imposable on the bivalent binding curve of 2F8-HG in the
absence of IVIG. These differences in avidity for the EGFr coat are
consistent with the idea that the 2F8-HG-F405L, 2F8-HG-F405A,
2F8-HG-R409A and 2F8-HG-R409K mutations stabilize dimerization of
the HG molecules.
Example 39
Additional CH3 Domain Mutations to Stabilize Dimerization of Human
IgG4 Antibodies
[0345] Mutations as given in the Table below were introduced into
the CH3 domains of IgG4-CD20 and IgG4-EGFr by site-directed
mutagenesis. KABAT indicates amino acid numbering according to
Kabat (Kabat et al., Sequences of Proteins of Immunological
Interest, 5th Ed. Public Health Service, National Institutes of
Health, Bethesda, Md. (1991) [0346] EU index indicates amino acid
numbering according to EU index as outlined in Kabat et al.,
Sequences of Proteins of Immunological Interest, 5th Ed. Public
Health Service, National Institutes of Health, Bethesda, Md.
(1991)) [0347] SEQ ID NO:39, 40, 41 indicates amino acid numbering
as indicated in SEQ ID NO:39, 40 and 41 of this document. [0348]
See also FIG. 22 for comparison of numbering methods.
TABLE-US-00012 [0348] Numbering of CH3 mutations KABAT EU index G4
SEQ ID NO: 39, 40, 41 376 Q355R Q235R 393 K370T K250T 436 F405A
F285A 436 F405L F285L 440 R409A R289A 440 R409K R289K 440 R409L
R289L 440 R409M R289M 440 R409T R289T 450 E419Q E299Q 476 L445P
L325P
[0349] IgG1-CD20 and IgG1-EGFr, IgG4-CD20 and IgG4-EGFr, or
IgG4-CH3mutant-CD20 and IgG4-CH3mutant-EGFr were mixed and
incubated with 0.5 mM GSH as described above. Bispecific activity
was determined as described in Example 33.
[0350] FIG. 23 shows that bispecific anti-EGFr/CD20 antibodies were
formed in mixtures of IgG4 antibodies as well as in mixtures of CH3
domain mutants Q355R, E419Q, L445P and R409A. No bispecific
activity was measured in mixtures of CH3 domain mutants R409K,
R409M, R409L and K370T, indicating that these mutations stabilized
dimerization of human IgG4 antibodies. CH3 domain mutant R409T,
F405A and F405L partially stabilized dimerization of human IgG4
antibodies.
TABLE-US-00013 SEQUENCE LISTING SEQ ID NO: 39: Amino acid sequence
of the wildtype C.sub.H region of human IgG4 1 ASTKGPSVFP
LAPCSRSTSE STAALGCLVK DYFPEPVTVS WNSGALTSGV 51 HTFPAVLQSS
GLYSLSSVVT VPSSSLGTKT YTCNVDHKPS NTKVDKRVES 101 KYGPPCPSCP
APEFLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSQED 151 PEVQFNWYVD
GVEVHNAKTK PREEQFNSTY RVVSVLTVLH QDWLNGKEYK 201 CKVSNKGLPS
SIEKTISKAK GQPREPQVYT LPPSQEEMTK NQVSLTCLVK 251 GFYPSDIAVE
WESNGQPENN YKTTPPVLDS DGSFFLYSRL TVDKSRWQEG 301 NVFSCSVMHE
ALHNHYTQKS LSLSLGK SEQ ID NO: 40: Amino acid sequence of the
wildtype C.sub.H region of human IgG4 1 ASTKGPSVFP LAPCSRSTSE
STAALGCLVK DYFPEPVTVS WNSGALTSGV 51 HTFPAVLQSS GLYSLSSVVT
VPSSSLGTKT YTCNVDHKPS NTKVDKRVES 101 KYGPPCPSCP APEFLGGPSV
FLFPPKPKDT LMISRTPEVT CVVVDVSQED 151 PEVQFNWYVD GVEVHNAKTK
PREEQFNSTY RVVSVLTVLH QDWLNGKEYK 201 CKVSNKGLPS SIEKTISKAK
GQPREPQVYT LPPSQEEMTK NQVSLTCLVK 251 GFYPSDIAVE WESNGQPENN
YKTTPPVLDS DGSFFLYSKL TVDKSRWQEG 301 NVFSCSVMHE ALHNHYTQKS LSLSLGK
SEQ ID NO: 41: Amino acid sequence of the wildtype C.sub.H region
of human IgG4 1 ASTKGPSVFP LAPCSRSTSE STAALGCLVK DYFPEPVTVS
WNSGALTSGV 51 HTFPAVLQSS GLYSLSSVVT VPSSSLGTKT YTCNVDHKPS
NTKVDKRVES 101 KYGPPCPSCP APEFLGGPSV FLFPPKPKDT LMISRTPEVT
CVVVDVSQED 151 PEVQFNWYVD GVEVHNAKTK PREEQFNSTY RVVSVLTVVH
QDWLNGKEYK 201 CKVSNKGLPS SIEKTISKAK GQPREPQVYT LPPSQEEMTK
NQVSLTCLVK 251 GFYPSDIAVE WESNGQPENN YKTTPPVLDS DGSFFLYSRL
TVDKSRWQEG 301 NVFSCSVMHE ALHNHYTQKS LSLSLGK
Sequence CWU 1
1
52136DNAartificialprimer 1agccaccgta cgtttgattt ccagcttggt gcctcc
36244DNAartificialprimer 2gatgcaagct tgccgccacc atggagtcac
agattcaggc attt 44342DNAartificialprimer 3cgatgggccc ttggtgctgg
ctgaggagac ggtgactgag gt 42444DNAartificialprimer 4gatgcaagct
tgccgccacc atgaaatgca gctgggttat cttc 44536DNAartificialprimer
5agccaccgta cgttttattt ccaactttgt ccccga 36644DNAartificialprimer
6gatgcaagct tgccgccacc atggaatcac agactcaggt cctc
44742DNAartificialprimer 7cgatgggccc ttggtgctgg ctgcagagaa
agtgaccaga gt 42844DNAartificialprimer 8gatgcaagct tgccgccacc
atgggatgga gctatatcat cctc 44932DNAartificialprimer 9tgagaattcg
gtgggtgctt tatttccatg ct 321033DNAartificialprimer 10gtagaagctt
accatcgcgg atagacaaga acc 331126DNAartificialprimer 11tgttaactgc
tcactggatg gtggga 261227DNAartificialprimer 12tccctgggca caattttctt
gtccacc 271331DNAartificialprimer 13tgaaagcttc taatacgact
cactataggg c 311454DNAartificialprimer 14tgaaagcttc taatacgact
cactataggg caagcagtgg tatcaacgca gagt 5415137PRTartificialvariable
region sequence of antibody 15Met Lys Cys Ser Trp Val Ile Phe Phe
Leu Met Ala Val Val Thr Gly1 5 10 15Val Asn Ser Glu Val Gln Leu Gln
Gln Ser Gly Ala Glu Leu Val Lys 20 25 30Pro Gly Ala Ser Val Lys Leu
Ser Cys Thr Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His
Trp Val Lys Gln Arg Pro Glu Gln Gly Leu 50 55 60Glu Trp Val Gly Arg
Ile Asp Pro Ala Thr Gly Asn Thr Arg Tyr Asp65 70 75 80Pro Lys Phe
Gln Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn 85 90 95Thr Ala
Tyr Leu Gln Leu Ser Ser Leu Thr Ser Glu Asp Thr Ala Val 100 105
110Tyr Tyr Cys Ala Ser Phe Arg Pro Gly Tyr Ala Leu Asp Tyr Trp Gly
115 120 125Gln Gly Thr Ser Val Thr Val Ser Ser 130
13516127PRTartificialvariable region sequence of antibody 16Met Glu
Ser Gln Ile Gln Ala Phe Val Phe Val Phe Leu Trp Leu Ser1 5 10 15Gly
Val Asp Gly Asp Ile Val Met Thr Gln Ser His Lys Phe Met Ser 20 25
30Thr Ser Val Gly Asp Arg Val Ser Phe Thr Cys Lys Ala Ser Gln Asp
35 40 45Val Phe Thr Ala Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser
Pro 50 55 60Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Arg Thr Gly Val
Pro Asp65 70 75 80Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Tyr Thr
Leu Thr Ile Ser 85 90 95Ser Val Gln Ala Glu Asp Leu Ala Leu Tyr Tyr
Cys Gln Gln His Phe 100 105 110Ser Thr Pro Pro Thr Phe Gly Gly Gly
Thr Lys Leu Glu Ile Lys 115 120 12517138PRTartificialvariable
region sequence of antibody 17Met Gly Trp Ser Tyr Ile Ile Leu Phe
Leu Val Ala Thr Ala Thr Asp1 5 10 15Val His Ser Gln Val Gln Leu Gln
Gln Pro Gly Ala Glu Leu Val Lys 20 25 30Pro Gly Ala Ser Val Lys Leu
Ser Cys Lys Ala Ser Gly Tyr Ser Phe 35 40 45Thr Ser Tyr Trp Met His
Trp Leu Lys Gln Arg Pro Gly Gln Gly Leu 50 55 60Glu Trp Ile Gly Glu
Ile Asn Pro Asn Asn Gly Arg Thr Tyr Tyr Asn65 70 75 80Glu Lys Phe
Lys Thr Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser 85 90 95Thr Ala
Tyr Met Gln Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val 100 105
110Tyr Tyr Cys Ala Arg Arg Leu Thr Met Val Glu Ser Phe Ala Tyr Trp
115 120 125Gly Gln Gly Thr Leu Val Thr Phe Ser Ala 130
13518133PRTartificialvariable region sequence of antibody 18Met Glu
Ser Gln Thr Gln Val Leu Met Ser Leu Leu Phe Trp Val Ser1 5 10 15Gly
Thr Cys Gly Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Thr 20 25
30Val Thr Ala Gly Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser
35 40 45Leu Leu Asn Ser Gly Asn Gln Lys Asn Tyr Leu Thr Trp Tyr Gln
Gln 50 55 60Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser
Thr Arg65 70 75 80Glu Ser Gly Val Pro Asp Arg Phe Thr Gly Ser Gly
Ser Gly Thr Asp 85 90 95Phe Ser Leu Thr Ile Ser Ser Val Gln Ala Glu
Asp Leu Ala Ile Tyr 100 105 110Tyr Cys Gln Asn Asp Tyr Ser Tyr Pro
Phe Thr Phe Gly Ser Gly Thr 115 120 125Lys Leu Glu Ile Lys
1301945DNAartificialprimer 19cttgtgacaa aactcacacc tgcccatcgt
gcccaggtaa gccag 452045DNAartificialprimer 20ctggcttacc tgggcacgat
gggcaggtgt gagttttgtc acaag 452143DNAartificialprimer 21cccccatgcc
caccatgccc aggtaagcca acccaggcct cgc 432243DNAartificialprimer
22gcgaggcctg ggttggctta cctgggcatg gtgggcatgg ggg
432345DNAartificialprimer 23cttgtgacaa aactcacacc tgcccatcgt
gcccaggtaa gccag 452445DNAartificialprimer 24ctggcttacc tgggcacgat
gggcaggtgt gagttttgtc acaag 452545DNAartificialprimer 25ccttcttcct
ctatagcagg ctcaccgtag acaagagcag gtggc 452645DNAartificialprimer
26gccacctgct cttgtctacg gtgagcctgc tatagaggaa gaagg
452745DNAartificialprimer 27ggctccttct tcctctacag caagctaacc
gtagacaaga gcagg 452845DNAartificialprimer 28cctgctcttg tctacggtta
gcttgctgta gaggaagaag gagcc 452920DNAartificialprimer 29tctcctcagc
cagcaccaag 203023DNAartificialprimer 30gtttgtctgc agccagcacc aag
233125DNAartificialprimer 31catctccaaa gccaaaggtg ggacc
253225DNAartificialprimer 32ggtcccacct ttggctttgg agatg
253324DNAartificialprimer 33cgacggctcc ttcttcctct acag
243424DNAartificialprimer 34ctgtagagga agaaggagcc gtcg
243523DNAartificialprimer 35caagagccat atccgggagg acc
233623DNAartificialprimer 36ggtcctcccg gatatggctc ttg
233720DNAartificialprimer 37gtcagaggta actcccgttg
203820DNAartificialprimer 38gttgtggttt gtccaaactc 2039327PRThomo
sapiens 39Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys
Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys
Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Ser Lys Tyr Gly
Pro Pro Cys Pro Ser Cys Pro Ala Pro 100 105 110Glu Phe Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 115 120 125Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 130 135 140Asp
Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp145 150
155 160Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Phe 165 170 175Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp 180 185 190Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Gly Leu 195 200 205Pro Ser Ser Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg 210 215 220Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Gln Glu Glu Met Thr Lys225 230 235 240Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 245 250 255Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 260 265
270Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
275 280 285Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val
Phe Ser 290 295 300Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser305 310 315 320Leu Ser Leu Ser Leu Gly Lys
32540327PRThomo sapiens 40Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr
Val Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr Cys Asn
Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu
Ser Lys Tyr Gly Pro Pro Cys Pro Ser Cys Pro Ala Pro 100 105 110Glu
Phe Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 115 120
125Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
130 135 140Asp Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr
Val Asp145 150 155 160Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Phe 165 170 175Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp 180 185 190Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Gly Leu 195 200 205Pro Ser Ser Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 210 215 220Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys225 230 235
240Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
245 250 255Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys 260 265 270Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser 275 280 285Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Glu Gly Asn Val Phe Ser 290 295 300Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser305 310 315 320Leu Ser Leu Ser Leu
Gly Lys 32541327PRThomo sapiens 41Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr
Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro Ser Cys Pro Ala Pro 100 105
110Glu Phe Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
115 120 125Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val 130 135 140Asp Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp145 150 155 160Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu Gln Phe 165 170 175Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Val His Gln Asp 180 185 190Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu 195 200 205Pro Ser Ser
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 210 215 220Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys225 230
235 240Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser
Asp 245 250 255Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys 260 265 270Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser 275 280 285Arg Leu Thr Val Asp Lys Ser Arg Trp
Gln Glu Gly Asn Val Phe Ser 290 295 300Cys Ser Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser305 310 315 320Leu Ser Leu Ser
Leu Gly Lys 3254248DNAartificialprimer 42ccagtgctgg acagcgacgg
aagcttcgcc ctgtacagca ggctgacc 484348DNAartificialprimer
43ggtcagcctg ctgtacaggg cgaagcttcc gtcgctgtcc agcactgg
484451DNAartificialprimer 44ccagtgctgg acagcgacgg atccttctta
ctgtacagca ggctgaccgt g 514551DNAartificialprimer 45cacggtcagc
ctgctgtaca gtaagaagga tccgtcgctg tccagcactg g
514646DNAartificialprimer 46gctccttctt cctgtacagc gcgttaaccg
tggacaagtc caggtg 464746DNAartificialprimer 47cacctggact tgtccacggt
taacgcgctg tacaggaaga aggagc 464845DNAartificialprimer 48ctccttcttc
ctgtacagca agcttaccgt ggacaagtcc aggtg 454945DNAartificialprimer
49cacctggact tgtccacggt aagcttgctg tacaggaaga aggag 45504PRThomo
sapiens 50Cys Pro Pro Cys1514PRThomo sapiens 51Cys Pro Ser
Cys1524PRThomo sapiens 52Cys Pro Arg Cys1
* * * * *