Targeted Thrombolysis for Treatment of Microvascular Thrombosis

Abstract

The present invention provides fusion proteins for targeted delivery of plasminogen activators to platelet-VWF complexes, or alternatively to the site where these are located, in a fibrin-independent manner. The fusion protein of the invention are for use in methods for the prevention or treatment of diseases or conditions associated with such platelet-VWF complexes, which may cause microvascular thrombosis in diseases such as e.g. thrombotic thrombocytopenic purpura. Preferred targeting agents for incorporation into the fusion proteins are e.g. nanobodies against VWF or platelets. Preferred plasminogen activators for use in the fusion proteins comprise the protease domains of uPA or tPA. The invention further pertains to nucleic acid molecule encoding the fusion proteins of the invention, e.g. a gene therapy vector, and to pharmaceutical compositions comprising the fusion proteins of the invention or such gene therapy vectors.

Description

FIELD OF THE INVENTION

[0001] The present invention relates to the field of medicine and pharmacy, in particular to the field of biopharmaceuticals for use in the prevention or treatment of a disease or condition associated with microvascular thrombosis, such as e.g. thrombotic thrombocytopenic purpura. More specifically, the invention relates to fusion proteins comprising a targeting agent and a plasminogen activator, wherein the targeting agent targets the plasminogen activator to at least one of VWF, platelets and activated vascular endothelium with the aim to enzymatically degrade vascular obstructions in a fibrin-independent manner. The invention further relates to gene therapy vectors encoding such fusion proteins.

BACKGROUND ART

[0002] Microvascular thrombosis (MVT) is characterized by the formation of microvascular platelet aggregates. They are minimally composed of platelets and VWF. This becomes clear in thrombotic thrombocytopenic purpura (TTP), where platelet- and VWF-rich, but fibrin-poor microthrombi obstruct microvasculature with life-threatening consequences. Thus, fibrin, which is seen in macrovascular thrombosis, is not per se required for these microvascular obstructions. MVT is a shared feature between several disease states including thrombotic thrombocytopenic purpura, hemolytic uremic syndrome, antiphospholipid antibody syndrome and complement-mediated thrombotic microangiopathy (George et al., 2014, N Engl J Med. 371(7):654-66). In severe cases of MVT, multi-organ failure can occur with lethal consequences. Even in less severe cases, organ damage may form and reducing both the quality of life, as well as the life expectancy of the patient. Recent studies suggest that microvascular disease underlies cardiovascular disease/events in patients in the more generalized population with cardiovascular disease, and that do not show overt signs of macrovascular obstruction on radiological examination. This is ultimately thought to cause heart failure, in particular in females.

[0003] Patients with TTP experience attacks of microvascular thrombosis, when platelets form complexes with ultra-large multimers of von Willebrand Factor (VWF). This is the result of severely decreased activity of the enzyme ADAMTS13 (a disintegrin and metalloproteinase with a thrombospondin type I motif, member 13). ADAMTS13 normally regulates the thrombogenicity of VWF by enzymatically reducing its multimer size. Hereto, VWF needs to unfold from its globular form into an unrolled conformation, thereby exposing its A2 domain for proteolysis. The majority of TTP patients suffer from neutralizing autoantibodies against ADAMTS13. For a small subgroup, mutations in ADAMTS13 have been described that lead to deficiency (Upshaw-Shulman syndrome).

[0004] Current TTP therapy involves extensive plasma exchange to deplete inhibitory antibodies and restore ADAMTS13 activity at the same time. However, persistent autoantibodies impede elimination of microthrombi. This makes therapy time-consuming and very costly (Fijnheer et al., Ned Tijdsch Hematol 2016; 13 (1): 18-24).

[0005] Besides ADAMTS13, VWF can be cleaved by the enzyme plasmin (Berkowitz et al., J Clin Invest 1987 Feb; 79(2):524-31). We previously identified that systemic plasminogen activation (with streptokinase) was therapeutic in a mouse model for TTP, suggesting that plasmin can act as a functional alternative to ADAMTS13 (Tersteeg et al., 2014, Circulation, 129(12):1320-31). Although plasmin(ogen) can directly bind to unrolled VWF, natural plasminogen activators--such as tissue plasminogen activator (tPA) and urokinase plasminogen activator (uPA)--cannot. The natural targets of tPA and uPA are fibrin and the endothelial cell receptor uPAR, respectively. Furthermore, microthrombi in TTP are fibrin-poor and it is uncertain whether fibrin is a prerequisite for other types of MVT. This renders these molecules (i.e. tPA, uPA) that are generally used as thrombolytic agents in the treatment of macrovascular disease ineffective in treating MVT. Moreover, for safety reasons (i.e. low platelet counts) it is desirable to avoid systemic plasminogen activation.

[0006] It is an object of the present invention to provide for means and methods for treating MVT and associated conditions. The invention therefore provides fusion proteins for targeted delivery of plasminogen activators to platelet-VWF complexes, or alternatively to the site where these are located, in a fibrin-independent manner. The invention further provides therapeutic methods for conditions that can be prevented or treated by local delivery/stimulation of plasminogen activation to sites of microvascular occlusion.

SUMMARY OF THE INVENTION

[0007] In a first aspect, the invention relates to a fusion protein comprising a plasminogen activator and a targeting agent for targeting the plasminogen activator to a site of a thrombus comprising at least one of VWF and platelets. Preferably, the targeting agent in the fusion protein of the invention specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium. It is further preferred that the targeting agent in the fusion protein of the invention is not a targeting agent that specifically binds to only the activated form of the GPIlb/Illa receptor on platelets. More preferably, the targeting agent in the fusion protein of the invention is one or more of: a) a targeting agent that at least binds unfolded VWF, wherein preferably the targeting agent preferentially binds unfolded VWF over globular VWF; b) a targeting agent that binds the D3 domain of VWF; c) a targeting agent that binds the GP1B receptor on platelets; d) a targeting agent that binds integrin .alpha.IIb/.beta.III on platelets; e) a targeting agent that binds to a receptor that is preferentially expressed by activated endothelium, wherein preferably the receptor is selected form the group consisting of E-selectin, P-selectin, uPAR, c1q receptor, kinin B1 receptor, plasminogen receptor KT (PLGR-KT), endothelial protein C receptor, thrombomodulin, n-cadherin, ICAM-1 and VCAM-1; and, f) a targeting agent that binds to a membrane marker for activated or injured endothelium, wherein the membrane marker is one or more of anionic phospholipids, phosphatidylserine and phosphatidylethanolamine. In one embodiment, Preferably, the fusion protein of the invention comprises more than one targeting agent.

[0008] A fusion protein according to the invention preferably is a fusion protein wherein the targeting agent comprises at least one of: a) an antibody variable domain that specifically binds to at least one of VWF, platelets, and activated vascular endothelium; and, b) a binding domain from a protein that naturally binds VWF, platelets and activated or injured vascular endothelium, which binding domain specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium. Thus, in a fusion protein according to the invention, the antibody variable domain preferably is a VHH, more preferably a humanized VHH. Alternatively, in a fusion protein according to the invention, binding domain from a protein that naturally binds VWF, platelets and activated or injured vascular endothelium preferably comprises a binding domain selected from the group consisting of: i) the platelet GP1B receptor-binding Al domain from VWF; ii) a VWF-binding domain from one of ADAMTS13, Factor XII, Factor H (complement regulator), plasminogen and Factor VIII; and, iii) a membrane binding domain selected from the vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain, the C-domain from factor V and the C-domain from factor VIII.

[0009] In a fusion protein of the invention as defined above, the plasminogen activator preferably comprises the protease domain of tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), plasminogen, streptokinase or staphylokinase. It is preferred in a fusion protein of the invention that the plasminogen activator further comprises at least the cysteine-containing part of the connecting peptide that naturally occurs in the plasminogen activator immediately upstream of its protease domain. Optionally, a fusion protein of the invention comprises a linker amino acid sequence linking the targeting agent and the plasminogen activator.

[0010] Thus, a fusion protein in accordance with the invention preferably comprises in a N- to C-terminal order: a) one or more targeting agents as defined above, whereby, optionally the targeting agents are linked by linker amino acid sequences; b) optionally a linker amino acid sequence; and, c) a plasminogen activator or plasminogen-derived protease domain as defined above.

[0011] In a second aspect, the invention relates to a nucleic acid molecule comprising a nucleotide sequence encoding a fusion protein in accordance with the invention as defined above. Preferably, the nucleotide sequence encoding the fusion protein further comprises a nucleotide sequence encoding a signal peptide operably linked to the fusion protein. The nucleic acid molecule further preferably comprises regulatory elements conducive to the expression of the fusion protein, which regulatory elements are operably linked to the nucleotide sequence.

[0012] In a third aspect, the invention pertains to a gene therapy vector comprising a nucleic acid molecule according to the invention.

[0013] In a fourth aspect, the invention relates to a pharmaceutical composition comprising a fusion protein according to the invention or a gene therapy vector according to the invention and a pharmaceutically acceptable excipient.

[0014] In a fifth aspect, the invention pertains a fusion protein according to the invention, a gene therapy vector according to the invention or a pharmaceutical composition according to the invention, for use in the prevention or treatment of a disease or condition associated with thrombi comprising at least one of VWF and platelets, wherein preferably with the disease or condition associated with microvascular thrombosis. More preferably, the disease or condition associated with (micro)thrombi comprising at least one of VWF and platelets is selected from the group consisting of: acquired or hereditary thrombotic thrombocytopenic purpura (TTP) complement-mediated thrombotic microangiopathy, haemolytic uremic syndrome, antiphospholipid antibody syndrome, non-occlusive thrombus, the formation of an occlusive thrombus, arterial thrombus formation, acute coronary occlusion, peripheral arterial occlusive disease, restenosis and disorders arising from coronary by-pass graft, coronary artery valve replacement and coronary interventions such angioplasty, stenting or atherectomy, hyperplasia after angioplasty, atherectomy or arterial stenting, occlusive syndrome in a vascular system or lack of patency of diseased arteries, transient cerebral ischemic attack, unstable or stable angina pectoris, cerebral infarction, HELLP syndrome, carotid endarterectomy, carotid artery stenosis, critical limb ischemia, cardioembolism, peripheral vascular disease, restenosis, sickle cell disease and myocardial infarct.

[0015] In a sixth aspect, the invention pertains to a method for treating or reducing the risk of a disease or condition associated with thrombi comprising at least one of VWF and platelets, wherein the method comprises the step of administering to a subject in need thereof, an effective amount of fusion protein according to the invention, a gene therapy vector according to the invention or a pharmaceutical composition according to the invention, and wherein preferably with the disease or condition associated with microvascular thrombosis. More preferably, the disease or condition associated with (micro)thrombi comprising at least one of VWF and platelets is selected from the group consisting of: acquired or hereditary thrombotic thrombocytopenic purpura (TTP) complement-mediated thrombotic microangiopathy, haemolytic uremic syndrome, antiphospholipid antibody syndrome, non-occlusive thrombus, the formation of an occlusive thrombus, arterial thrombus formation, acute coronary occlusion, peripheral arterial occlusive disease, restenosis and disorders arising from coronary by-pass graft, coronary artery valve replacement and coronary interventions such angioplasty, stenting or atherectomy, hyperplasia after angioplasty, atherectomy or arterial stenting, occlusive syndrome in a vascular system or lack of patency of diseased arteries, transient cerebral ischemic attack, unstable or stable angina pectoris, cerebral infarction, HELLP syndrome, carotid endarterectomy, carotid artery stenosis, critical limb ischemia, cardioembolism, peripheral vascular disease, restenosis and myocardial infarct.

DESCRIPTION OF THE INVENTION

Definitions

[0016] The terms "homology", "sequence identity" and the like are used interchangeably herein. Sequence identity is herein defined as a relationship between two or more amino acid (polypeptide or protein) sequences or two or more nucleic acid (polynucleotide) sequences, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between amino acid or nucleic acid sequences, as the case may be, as determined by the match between strings of such sequences. "Similarity" between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide. "Identity" and "similarity" can be readily calculated by known methods.

[0017] "Sequence identity" and "sequence similarity" can be determined by alignment of two peptide or two nucleotide sequences using global or local alignment algorithms, depending on the length of the two sequences. Sequences of similar lengths are preferably aligned using a global alignment algorithms (e.g. Needleman Wunsch) which aligns the sequences optimally over the entire length, while sequences of substantially different lengths are preferably aligned using a local alignment algorithm (e.g. Smith Waterman). Sequences may then be referred to as "substantially identical" or "essentially similar" when they (when optimally aligned by for example the programs GAP or BESTFIT using default parameters) share at least a certain minimal percentage of sequence identity (as defined below). GAP uses the Needleman and Wunsch global alignment algorithm to align two sequences over their entire length (full length), maximizing the number of matches and minimizing the number of gaps. A global alignment is suitably used to determine sequence identity when the two sequences have similar lengths. Generally, the GAP default parameters are used, with a gap creation penalty=50 (nucleotides)/8 (proteins) and gap extension penalty=3 (nucleotides)/2 (proteins). For nucleotides the default scoring matrix used is nwsgapdna and for proteins the default scoring matrix is Blosum62 (Henikoff & Henikoff, 1992, PNAS 89, 915-919). Sequence alignments and scores for percentage sequence identity may be determined using computer programs, such as the GCG Wisconsin Package, Version 10.3, available from Accelrys Inc., 9685 Scranton Road, San Diego, Calif. 92121-3752 USA, or using open source software, such as the program "needle" (using the global Needleman Wunsch algorithm) or "water" (using the local Smith Waterman algorithm) in EmbossWlN version 2.10.0, using the same parameters as for GAP above, or using the default settings (both for `needle` and for `water` and both for protein and for DNA alignments, the default Gap opening penalty is 10.0 and the default gap extension penalty is 0.5; default scoring matrices are Blossum 62 for proteins and DNA Full for DNA). When sequences have a substantially different overall lengths, local alignments, such as those using the Smith Waterman algorithm, are preferred.

[0018] Alternatively percentage similarity or identity may be determined by searching against public databases, using algorithms such as FASTA, BLAST, etc. Thus, the nucleic acid and protein sequences of the present invention can further be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the BLASTn and BLASTx programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to oxidoreductase nucleic acid molecules of the invention. BLAST protein searches can be performed with the BLASTx program, score=50, wordlength=3 to obtain amino acid sequences homologous to protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17): 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., BLASTx and BLASTn) can be used. See the homepage of the National Center for Biotechnology Information at http://www.ncbi.nlm.nih.gov/.

[0019] Optionally, in determining the degree of amino acid similarity, the skilled person may also take into account so-called "conservative" amino acid substitutions, as will be clear to the skilled person. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. Examples of classes of amino acid residues for conservative substitutions are given in the Tables below.

TABLE-US-00001 Acidic Residues Asp (D) and Glu (E) Basic Residues Lys (K), Arg (R), and His (H) Hydrophilic Uncharged Residues Ser (S), Thr (T), Asn (N), and Gln (Q) Aliphatic Uncharged Residues Gly (G), Ala (A), Val (V), Leu (L), and Ile (I) Non-polar Uncharged Residues Cys (C), Met (M), and Pro (P) Aromatic Residues Phe (F), Tyr (Y), and Trp (W)

[0020] Alternative conservative amino acid residue substitution classes.

TABLE-US-00002 1 A S T 2 D E 3 N Q 4 R K 5 I L M 6 F Y W

[0021] Alternative Physical and Functional Classifications of Amino Acid Residues.

TABLE-US-00003 Alcohol group-containing residues S and T Aliphatic residues I, L, V, and M Cycloalkenyl-associated residues F, H, W, and Y Hydrophobic residues A, C, F, G, H, I, L, M, R, T, V, W, and Y Negatively charged residues D and E Polar residues C, D, E, H, K, N, Q, R, S, and T Positively charged residues H, K, and R Small residues A, C, D, G, N, P, S, T, and V Very small residues A, G, and S Residues involved in turn formation A, C, D, E, G, H, K, N, Q, R, S, P and T Flexible residues Q, T, K, S, G, P, D, E, and R

[0022] Nucleotide sequences encoding fusion proteins of the invention may also be defined by their capability to hybridize with the nucleotide sequences of encoding fusion proteins as exemplified herein, under moderate, or preferably under stringent hybridization conditions. Stringent hybridization conditions are herein defined as conditions that allow a nucleic acid sequence of at least about 25, preferably about 50 nucleotides, 75 or 100 and most preferably of about 200 or more nucleotides, to hybridize at a temperature of about 65.degree. C. in a solution comprising about 1 M salt, preferably 6.times.SSC or any other solution having a comparable ionic strength, and washing at 65.degree. C. in a solution comprising about 0.1 M salt, or less, preferably 0.2.times.SSC or any other solution having a comparable ionic strength. Preferably, the hybridization is performed overnight, i.e. at least for 10 hours and preferably washing is performed for at least one hour with at least two changes of the washing solution. These conditions will usually allow the specific hybridization of sequences having about 90% or more sequence identity.

[0023] Moderate conditions are herein defined as conditions that allow a nucleic acid sequences of at least 50 nucleotides, preferably of about 200 or more nucleotides, to hybridize at a temperature of about 45.degree. C. in a solution comprising about 1 M salt, preferably 6.times.SSC or any other solution having a comparable ionic strength, and washing at room temperature in a solution comprising about 1 M salt, preferably 6.times.SSC or any other solution having a comparable ionic strength. Preferably, the hybridization is performed overnight, i.e. at least for 10 hours, and preferably washing is performed for at least one hour with at least two changes of the washing solution. These conditions will usually allow the specific hybridization of sequences having up to 50% sequence identity. The person skilled in the art will be able to modify these hybridization conditions in order to specifically identify sequences varying in identity between 50% and 90%.

[0024] A "nucleic acid construct" or "nucleic acid vector" is herein understood to mean a man-made nucleic acid molecule resulting from the use of recombinant DNA technology. The term "nucleic acid construct" therefore does not include naturally occurring nucleic acid molecules although a nucleic acid construct may comprise (parts of) naturally occurring nucleic acid molecules. The terms "expression vector" or expression construct" refer to nucleic acid molecules that are capable of effecting expression of a nucleotide sequence or gene in host cells or host organisms compatible with such expression vectors or constructs. These expression vectors typically include regulatory sequence elements that are operably linked to the nucleotide sequence to be expressed to effect its expression. Such regulatory elements usually at least include suitable transcription regulatory sequences and optionally, 3' transcription termination signals. Additional elements necessary or helpful in effecting expression may also be present, such as expression enhancer elements. The expression vector will be introduced into a suitable host cell and be able to effect expression of the coding sequence in an in vitro cell culture of the host cell. The expression vector will be suitable for replication in the host cell or organism of the invention whereas an expression construct will usually integrate in the host cell's genome for it to be maintained. Techniques for the introduction of nucleic acid into cells are well established in the art and any suitable technique may be employed, in accordance with the particular circumstances. For eukaryotic cells, suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. adenovirus, AAV, lentivirus or vaccinia. For microbial, e.g. bacterial, cells, suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage. The introduced nucleic acid may be on an extra-chromosomal vector within the cell or the nucleic acid may be integrated into the genome of the host cell. Integration may be promoted by inclusion of sequences within the nucleic acid or vector which promote recombination with the genome, in accordance with standard techniques. The introduction may be followed by expression of the nucleic acid to produce the encoded fusion protein. In some embodiments, host cells (which may include cells actually transformed although more likely the cells will be descendants of the transformed cells) may be cultured in vitro under conditions for expression of the nucleic acid, so that the encoded fusion protein polypeptide is produced, when an inducible promoter is used, expression may require the activation of the inducible promoter.

[0025] As used herein, the term "promoter" or "transcription regulatory sequence" refers to a nucleic acid fragment that functions to control the transcription of one or more coding sequences, and is located upstream with respect to the direction of transcription of the transcription initiation site of the coding sequence, and is structurally identified by the presence of a binding site for DNA-dependent RNA polymerase, transcription initiation sites and any other DNA sequences, including, but not limited to transcription factor binding sites, repressor and activator protein binding sites, and any other sequences of nucleotides known to one of skill in the art to act directly or indirectly to regulate the amount of transcription from the promoter. A "constitutive" promoter is a promoter that is active in most tissues under most physiological and developmental conditions. An "inducible" promoter is a promoter that is physiologically or developmentally regulated, e.g. by the application of a chemical inducer.

[0026] The term "selectable marker" is a term familiar to one of ordinary skill in the art and is used herein to describe any genetic entity which, when expressed, can be used to select for a cell or cells containing the selectable marker. The term "reporter" may be used interchangeably with marker, although it is mainly used to refer to visible markers, such as green fluorescent protein (GFP). Selectable markers may be dominant or recessive or bidirectional.

[0027] As used herein, the term "operably linked" refers to a linkage of polynucleotide elements in a functional relationship. A nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For instance, a transcription regulatory sequence is operably linked to a coding sequence if it affects the transcription of the coding sequence. Operably linked means that the DNA sequences being linked are typically contiguous and, where necessary to join two protein encoding regions, contiguous and in reading frame.

[0028] The terms "protein" or "polypeptide" are used interchangeably and refer to molecules consisting of a chain of amino acids, without reference to a specific mode of action, size, 3-dimensional structure or origin.

[0029] The term "signal peptide" (sometimes referred to as signal sequence) is a short peptide (usually 16-30 amino acids long) present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway. At the end of the signal peptide there is usually a stretch of amino acids that is recognized and cleaved by signal peptidase either during or after completion of translocation (from the cytosol into the secretory pathway, i.e. ER) to generate a free signal peptide and a mature protein. Signal peptides are extremely heterogeneous and many prokaryotic and eukaryotic signal peptides are functionally interchangeable even between different species however the efficiency of protein secretion may depend on the signal peptide. Suitable signal peptides are generally known in the art e.g. from KaII et al. (2004 J. Mol. Biol. 338: 1027-1036) and von Heijne (1985, J Mol Biol. 184 (1): 99-105).

[0030] The term "gene" means a DNA fragment comprising a region (transcribed region), which is transcribed into an RNA molecule (e.g. an mRNA) in a cell, operably linked to suitable regulatory regions (e.g. a promoter). A gene will usually comprise several operably linked fragments, such as a promoter, a 5' leader sequence, a coding region and a 3' non-translated sequence (3' end) comprising a polyadenylation site. "Expression of a gene" refers to the process wherein a DNA region which is operably linked to appropriate regulatory regions, particularly a promoter, is transcribed into an RNA, which is biologically active, i.e. which is capable of being translated into a biologically active protein or peptide.

[0031] The term "homologous" when used to indicate the relation between a given (recombinant) nucleic acid or polypeptide molecule and a given host organism or host cell, is understood to mean that in nature the nucleic acid or polypeptide molecule is produced by a host cell or organisms of the same species, preferably of the same variety or strain. If homologous to a host cell, a nucleic acid sequence encoding a polypeptide will typically (but not necessarily) be operably linked to another (heterologous) promoter sequence and, if applicable, another (heterologous) secretory signal sequence and/or terminator sequence than in its natural environment. It is understood that the regulatory sequences, signal sequences, terminator sequences, etc. may also be homologous to the host cell. When used to indicate the relatedness of two nucleic acid sequences the term "homologous" means that one single-stranded nucleic acid sequence may hybridize to a complementary single-stranded nucleic acid sequence. The degree of hybridization may depend on a number of factors including the amount of identity between the sequences and the hybridization conditions such as temperature and salt concentration as discussed later.

[0032] The term "heterologous" when used with respect to a nucleic acid (DNA or RNA) or protein refers to a nucleic acid or protein that does not occur naturally as part of the organism, cell, genome or DNA or RNA sequence in which it is present, or that is found in a cell or location or locations in the genome or DNA or RNA sequence that differ from that in which it is found in nature. Heterologous nucleic acids or proteins are not endogenous to the cell into which it is introduced, but has been obtained from another cell or synthetically or recombinantly produced. Generally, though not necessarily, such nucleic acids encode proteins that are not normally produced by the cell in which the DNA is transcribed or expressed. Similarly exogenous RNA encodes for proteins not normally expressed in the cell in which the exogenous RNA is present. Heterologous nucleic acids and proteins may also be referred to as foreign nucleic acids or proteins. Any nucleic acid or protein that one of skill in the art would recognize as heterologous or foreign to the cell in which it is expressed is herein encompassed by the term heterologous nucleic acid or protein. The term heterologous also applies to non-natural combinations of nucleic acid or amino acid sequences, i.e. combinations where at least two of the combined sequences are foreign with respect to each other.

[0033] Unless indicated otherwise, the terms "immunoglobulin" and "antibody" whether it used herein to refer to a heavy chain antibody or to a conventional 4-chain antibody is used as a general term to include both the full-size antibody, the individual chains thereof, as well as all parts, domains or fragments thereof (including but not limited to antigen-binding domains or fragments such as VHH domains or V.sub.H/V.sub.L domains, respectively). In addition, the term "sequence" as used herein (for example in terms like "immunoglobulin sequence", "antibody sequence", "variable domain sequence", "VHH sequence" or "protein sequence"), should generally be understood to include both the relevant amino acid sequence as well as nucleic acid sequences or nucleotide sequences encoding the same, unless the context requires a more specific interpretation.

[0034] The "variable region" or "variable domain" of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody. The variable domain of the heavy chain may be referred to as "VH", or to "VHH" in case of a heavy chain antibody such as the camelid antibodies that consist of only heavy chains. The variable domain of the light chain may be referred to as "VL." These domains are generally the most variable parts of an antibody and contain the antigen-binding sites. The term "variable" refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies. The V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the average 110-amino acid span of the variable domains. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of extreme variability called "hypervariable regions" (HVRs) or complementarity determining regions (CDRs) that are each about 9-12 amino acids long. The variable domains of native heavy and light chains each comprise four FRs, largely adopting a .beta.-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the .beta.-sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).

[0035] The terms "VHH", "VHH domain" and "nanobody" are interchangeable herein and are used herein to refer to the variable domain of a heavy chain antibody, i.e. an antibody consisting only of heavy chains and devoid of light chains as are known e.g. from Camelids. The amino acid sequence and structure of a VHH can be considered without however being limited thereto to be comprised of four framework regions or "FR's", which are referred to in the art and herein below as "Framework region 1" or "FR1"; as "Framework region 2" or "FR2"; as "Framework region 3" or "FR3"; and as "Framework region 4" or "FR4",respectively; which framework regions are interrupted by three complementary determining regions or "CDRs", which are referred to in the art as "Complementarity Determining Region 1" or "CDR1"; as "Complementarity Determining Region 2" or "CDR2"; and as "Complementarity Determining Region 3" or "CDR3", respectively. The total number of amino acid residues in a VHH can be in the region of 110-120, is preferably 112-115, and is most preferably 113. It should however be noted that parts, fragments or analogs (as further described herein below) of a VHH are not particularly limited as to their length and/or size, as long as such parts, fragments or analogs meet the further functional requirements outlined herein below and are also preferably suitable for the purposes described herein.

[0036] The amino acid residues of a VHH (or conventional variable domain) are numbered according to the general numbering for V.sub.H domains given by Kabat et al. ("Sequence of proteins of immunological interest", US Public Health Services, NIH Bethesda, Md. , Publication No. 91), as applied to VHH domains from Camelids by Riechmann and Muyldermans (1999, J. Immunol. Methods; 231: 25-38; see for example FIG. 2 of said reference). According to this numbering, FR1 of a VHH comprises the amino acid residues at positions 1-30, CDR1 of a VHH comprises the amino acid residues at positions 31-36, FR2 of a VHH comprises the amino acids at positions 36-49, CDR2 of a VHH comprises the amino acid residues at positions 50-65, FR3 of a VHH comprises the amino acid residues at positions 66-94, CDR3 of a VHH comprises the amino acid residues at positions 95-102, and FR4 of a VHH comprises the amino acid residues at positions 103-113. In this respect, it should be noted that as is well known in the art for VH domains and for VHH domains the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering). This means that, generally, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence. Generally, however, it can be said that, according to the numbering of Kabat and irrespective of the number of amino acid residues in the CDRs, position 1 according to the Kabat numbering corresponds to the start of FR1 and visa versa, position 36 according to the Kabat numbering corresponds to the start of FR2 and visa versa, position 66 according to the Kabat numbering corresponds to the start of FR3 and visa versa, and position 103 according to the Kabat numbering corresponds to the start of FR4.

[0037] Alternative methods for numbering the amino acid residues of VH domains, which methods can also be applied in an analogous manner to VHH domains from Camelids, are the method described by Chothia et al.(1989, Nature 342, 877-883), the so-called "AbM definition" and the so-called "contact definition". However, in the present description, claims and figures, the numbering according to Kabat as applied to VHH domains by Riechmann and Muyldermans will be followed, unless indicated otherwise.

[0038] For a general description of heavy chain antibodies and the variable VHH domains thereof, reference is inter alia made to the following references, which are mentioned as general background art: WO 94/04678, WO 95/04079, WO 96/34103, WO 94/25591, WO 99/37681, WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301, EP 1134231, WO 02/48193, WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016, WO 03/055527 WO 03/050531, WO 01/90190, WO 03/025020; WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863 and WO 04/062551 and Hassanzadeh-Ghassabeh et al. (2013, Nanomedicine, 8(6)1 013-1026). For a more specific description of single domain VHH antibodies against Von Willebrand Factor or platelet receptor GP1b, reference is made to WO 2004/062551 and WO 2006/122825.

[0039] Generally, it should be noted that the term "VHH" (or nanobody) as used herein in its broadest sense is not limited to a specific biological source or to a specific method of preparation. For example, VHHs as used in the invention can be obtained (1) by isolating the VHH domain of a naturally occurring heavy chain antibody; (2) by expression of a nucleotide sequence encoding a naturally occurring VHH domain; (3) by "humanization" (as described below) of a naturally occurring VHH domain or by expression of a nucleic acid encoding a such humanized VHH domain; (4) by "camelization" of a naturally occurring VH domain from any animal species, in particular a species of mammal, such as from a human being, or by expression of a nucleic acid encoding such a camelized VH domain; (5) using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences; (6) by preparing a nucleic acid encoding a VHH using techniques for nucleic acid synthesis, followed by expression of the nucleic acid thus obtained; and/or (7) by any combination of the foregoing. Suitable methods and techniques for performing the foregoing are state of the art and therefore known to the skilled person.

[0040] One particularly preferred class of VHHs for use in the invention comprises VHHs with an amino acid sequence that corresponds to the amino acid sequence of a naturally occurring VHH domain, but that has been "humanized", i.e. by replacing one or more amino acid residues in the amino acid sequence of said naturally occurring VHH sequence by one or more of the amino acid residues that occur at the corresponding position(s) in a V.sub.H domain from a conventional 4-chain antibody from a human being. This can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the prior art on humanization including e.g. Jones et al. (Nature 321:522-525, 1986); Riechmann et al., (Nature 332:323-329, 1988); Presta (Curr. Op. Struct. Biol. 2:593-596, 1992), Vaswani and Hamilton (Ann. Allergy, Asthma and Immunol., 1:105-115 1998); Harris (Biochem. Soc. Transactions, 23:1035-1038, 1995); Hurle and Gross (Curr. Op. Biotech., 5:428-433, 1994), and specific prior art relating to humanization of VHHs such as e.g. Vincke et al. (2009, J. Biol. Chem. 284:3273-3284). Again, it should be noted that such humanized VHHs of the invention can be obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VHH domain as a starting material.

[0041] A "blocking" antibody or an "antagonist" antibody is one which inhibits or reduces biological activity of the antigen it binds. Preferred blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen. An "agonist antibody", as used herein, is an antibody which mimics at least one of the functional activities of a polypeptide of interest.

[0042] "Binding affinity" generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen or target). Unless indicated otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen/target). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.d). Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally bind antigen/target slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative embodiments are described in the following.

[0043] A "K.sub.d" or "K.sub.d value" can be measured by using an ELISA as described in the Examples herein or by using surface plasmon resonance assays using a BlAcore.TM.-2000 or a BlAcore.TM.-3000 (BlAcore, Inc., Piscataway, N.J.) at 25.degree. C. with immobilized antigen CM5 chips at .about.10-50 response units (RU). Briefly, carboxymethylated dextran biosensor chips (CM5, BlAcore Inc.) are activated with N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Antigen is diluted with 10 mM sodium acetate, pH 4.8, into 5 .mu.g/ml (.about.0.2 .mu.M) before injection at a flow rate of 5 .mu./minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of the antibody or Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25.degree. C. at a flow rate of approximately 25 .mu./min. Association rates (kon) and dissociation rates (k.sub.off) are calculated using a simple one-to-one Langmuir binding model (BlAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram. The equilibrium dissociation constant (Kd) is calculated as the ratio k.sub.off/k.sub.on. See, e.g., Chen, Y., et al., (1999) J. Mol Biol 293:865-881. If the on-rate exceeds 10.sup.6 M.sup.-1 S.sup.-1 by the surface plasmon resonance assay above, then the on-rate can be determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence emission intensity (excitation=295 nm; emission=340 nm, 16 nm band-pass) at 25.degree. C. of a 20nM anti-antigen antibody (Fab form) in PBS, pH 7.2, in the presence of increasing concentrations of antigen as measured in a spectrometer, such as a stop-flow equipped spectrophometer (Aviv Instruments) or a 8000-series SLM-Aminco spectrophotometer (ThermoSpectronic) with a stir red cuvette.

[0044] An "on-rate" or "rate of association" or "association rate" or "k.sub.on" according to this invention can also be determined with the same surface plasmon resonance technique described above using a BlAcore.TM.-2000 or a BlAcore.TM.-3000 (BlAcore, Inc., Piscataway, N.J.) as described above.

[0045] The phrases "pharmaceutical or pharmacologically acceptable" refers to molecular entities and compositions that do not produce or produce acceptable adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. Whether certain adverse effects are acceptable is determined based on the severity of the disease. The preparation of a pharmaceutical composition that contains at least one chimeric polypeptide or additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington: The Science and Practice of Pharmacy" (Ed. Allen, L. V. 22nd edition, 2012, www.pharmpress.com), incorporated herein by reference. Moreover, for animal (e.g., human) administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards.

[0046] As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington: The Science and Practice of Pharmacy" (Ed. Allen, L. V. 22nd edition, 2012, www.pharmpress.com), incorporated herein by reference). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.

[0047] Any reference to nucleotide or amino acid sequences accessible in public sequence databases herein refers to the version of the sequence entry as available on the filing date of this document.

DESCRIPTION OF EMBODIMENTS

[0048] The present inventors have surprisingly found that targeting of plasminogen activation to sites of MVT is a feasible approach for the treatment of TTP. Patients with TTP experience attacks of MVT, when platelets form complexes with ultra-large VWF. We previously reported that systemic plasminogen activation (with streptokinase) was therapeutic in a mouse model for TTP, suggesting that plasmin can act as a functional alternative to ADAMTS13 (Tersteeg et al., 2014, supra). Although plasmin(ogen) can directly bind to VWF, natural plasminogen activators (tPA, uPA) cannot. Furthermore, microthrombi are fibrin-poor and for safety reasons it is desirable to avoid systemic plasminogen activation. To increase therapeutic efficacy and safety, the present invention therefore aims to stimulate cleavage of the thrombogenic multimeric protein VWF by plasmin. More specifically, the invention relates to modified plasminogen activators that have acquired the ability to bind either VWF, platelets or activated/injured (micro)vascular endothelial cells to locally induce plasmin activity for clearance of MVT, in a fibrin-independent manner. The invention further provides therapeutic methods for conditions that can be prevented or treated by local delivery/stimulation of plasminogen activation to sites of MVT.

[0049] In a first aspect the invention therefore pertains to a fusion protein comprising a plasminogen activator and a targeting agent for targeting the plasminogen activator to a site of a thrombus comprising at least one of VWF and platelets. The thrombus-site whereto the targeting agent targets the fusion protein of the invention can in principle be any site where a thrombus is present or developing, including sites of macrovascular as well as microvascular thrombi (MVT) and sites of (yet) non-occlusive macro- or microvascular thrombi. However, the fusion proteins of the invention are (also) aimed at clearing site of MVT, which are fibrin-poor, but which do contain VWF, platelets and where the vascular endothelium can be activated or injured. Preferably therefore, the targeting agent in the fusion protein of the invention is a targeting agent that specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium.

[0050] The targeting agent can be any ligand or binding molecule that specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium. Preferably, however, the targeting agent is a proteinaceous targeting agent. More preferably, the proteinaceous targeting agent is a part of the single amino acid chain of the fusion protein, which chain also comprises the plasminogen activator.

[0051] A targeting agent "which binds" a target of interest, e.g. VWF, platelets, or activated/ injured endothelium, is an agent that binds the target with sufficient affinity such that the targeting agent is useful as a therapeutic agent in targeting a structure, e.g. an MVT, cell or tissue expressing or exposing the target, and does not significantly cross-react with other proteins or molecules. In such embodiments, the extent of binding of the targeting agent to a "non-target" molecule (e.g. protein) will be less than about 10% of the binding of the targeting agent to its particular target molecule as determined by fluorescence activated cell sorting (FACS) analysis or radioimmunoprecipitation

[0052] (RIA). With regard to the binding of an targeting agent to a target molecule, the term "specific binding" or "specifically binds to" or "binds to" or is "specific for" a particular target molecule or polypeptide, e.g. an epitope on a particular polypeptide target, means binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labelled target. In this case, specific binding is indicated if the binding of the labelled target to a probe is competitively inhibited by excess unlabeled target. The term "specific binding" or "specifically binds to" or is "specific for" a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a K.sub.d for the target (which may be determined as described above) of at least about 10.sup.-4 M, alternatively at least about 10.sup.-5 M, alternatively at least about 10.sup.-6 M, alternatively at least about 10.sup.-7 M, alternatively at least about 10.sup.-8 M, alternatively at least about 10.sup.-9 M, alternatively at least about 10.sup.-10 M, alternatively at least about 10.sup.-11 M, alternatively at least about 10.sup.-12 M, or greater. In one embodiment, the term "specific binding" refers to binding where a targeting agent binds to a particular target molecule, polypeptide or epitope on a particular polypeptide without substantially binding to any other molecule, polypeptide or epitope.

[0053] In one embodiment of the invention, the targeting agent in the fusion protein specifically binds to Von Willebrand factor (VWF), preferably to human VWF. The basic human VWF monomer is a 2050-amino acid protein. Every monomer contains a number of specific domains with a specific function including e.g. the D'/D3 domain, which binds to factor VIII, the Al domain, which inter alia binds to the platelet GPIb-receptor, the A2 domain (which must partially unfold to expose the buried cleavage site for the specific ADAMTS13 protease that inactivates VWF by making much smaller multimers), the A3 domain, which binds to collagen, the Cl domain, in which the RGD motif binds to platelet integrin .alpha.IIb.beta.3 when this is activated and the "cysteine knot" domain (at the C-terminal end of the protein). Multimers of VWF can be extremely large, >20,000 kDa and can consist of over 80 subunits of 250 kDa each. VWF's primary function is binding to other proteins, in particular factor VIII, and it is important in platelet adhesion to wound sites. VWF is not an enzyme and, thus, has no catalytic activity. VWF binds to a number of cells and molecules, including e.g. to collagen (e.g.

[0054] when is exposed in endothelial cells due to damage occurring to the blood vessel) and to the platelet GP1 B receptor. The latter binding occurs under all circumstances, but is most efficient under high shear stress (i.e. rapid blood flow in narrow blood vessels). VWF binds to other platelet receptors when they are activated, e.g., by thrombin (i.e., when coagulation has been stimulated).

[0055] A targeting agent in the fusion protein of the invention can specifically bind to any and all forms, conformation, domains and epitopes of VWF. The targeting agent can thus specifically bind to at least one of the unfolded (activated) conformation of VWF and the globular (circulating unactivated) conformation of VWF (sVWF). In one embodiment, the targeting agent that at least binds unfolded VWF, wherein, preferably the targeting agent preferentially binds unfolded VWF over globular VWF (i.e. has a higher affinity for unfolded VWF than for globular VWF), more preferably, the targeting agent binds the unfolded (activated) conformation of VWF and does not bind to circulating unactivated globular forms of VWF. More specifically, the targeting agent in the fusion protein of the invention specifically binds to at least one of the VWF Al domain, the Al domain of activated VWF, VWF A2 domain, the A2 domain of activated VWF, the VWF A3 domain and the VWF D3 domain. Suitable examples of targeting agents that bind VWF are the VHH camelid antibody fragments used in the Examples herein, as further detailed below.

[0056] In another embodiment of the invention, the targeting agent in the fusion protein specifically binds to platelets (also referred to as thrombocytes), preferably to human platelets. Together with VWF, platelets are the main component of MVT and therefore also suitable targets for the targeting agent in the fusion protein of the invention. A targeting agent in the fusion protein of the invention can specifically bind to any and all forms of platelets. The targeting agent can thus specifically bind to at least one of activated platelets and to non-activated platelets. Preferably, targeting agent (at least) binds to non-activated platelets. Unlike macrovascular thrombosis or regular thrombosis, MVT do necessarily comprise activated platelets, and especially unactivated platelets (together with VWF) are causing the problems in MVT in e.g. TTP. Therefore, the targeting agent in the fusion protein preferably is not a targeting agent that specifically binds to only activated platelets (and not to non-activated platelets). More specifically, the targeting agent preferably is not a targeting agent that specifically binds to only the activated form of the GPIIb/IIIa receptor on platelets, such as e.g. the single-chain antibody SCE5 described by Schwarz et al. (2004, FASEB J. 18:1704 1706). The targeting agent thus preferably specifically binds to the non-active form of integrin .alpha.IIb/.beta.III. In a preferred embodiment, the targeting agent in the fusion protein of the invention specifically binds to at least one of: a) the platelet GP1B receptor, and b) integrin .alpha.IIb/.beta.III on platelets. A targeting agent that specifically binds to the platelet GP1B receptor is however preferred. Suitable targeting agents that bind platelets are known in the art, as e.g. exemplified by the anti-GPlba antibody 6B4 described by Fontayne et al. (2006, Thromb Haemost. 96(5):671-84) or by the anti-GP1B the VHH antibody fragment used in the Examples herein.

[0057] In a further embodiment of the invention, the targeting agent in the fusion protein specifically binds to activated, injured and/or distressed endothelium (herein further collectively referred to as activated endothelium. The activated endothelium preferably is activated vascular endothelium, more preferably activated microvascular endothelium. The targeting agent can thus specifically bind to at least one of a receptor that is preferentially expressed by activated endothelium and a membrane marker for activated endothelium. Preferably, the receptor that is preferentially expressed by activated endothelium the receptor is selected form the group consisting of E-selectin, P-selectin, uPAR, c1q receptor, kinin B1 receptor, plasminogen receptor KT (PLGR-KT), endothelial protein C receptor, thrombomodulin, n-cadherin, ICAM-1 and VCAM-1. Preferably, the membrane marker for activated endothelium is one or more of anionic phospholipids, phosphatidylserine and phosphatidylethanolamine.

[0058] In one embodiment of a fusion protein of the invention, the targeting agent that specifically binds to one of the above-defined targets, preferably comprises at least one of: a) an antibody variable domain that specifically binds to one of said targets; and, b) a binding domain from a protein that naturally binds to one of said targets.

[0059] A preferred antibody variable domain that is present as targeting agent in a fusion protein of the invention is a VHH as defined herein above, more preferably the antibody variable domain is a humanized VHH.

[0060] In a preferred embodiment, the VHH that is present as targeting agent in a fusion protein of the invention is a VHH that specifically binds VWF. Suitable examples of VHHs that bind VWF and that are part of a fusion protein of the invention as targeting agent in are the VWF-binding VHHs that are part of the fusion protein in the Examples herein or that are described in US2013/0136736-A1, which is incorporated by reference herein.

[0061] A preferred VHH that binds soluble globular VWF and that is present as targeting agent in a fusion protein of the invention is VHH-sVWF, having the amino acid sequence of positions 55-178 of SEQ ID NO:7 or a VHH having an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with positions 55-178 of SEQ ID NO:7 and having a Kd for VWF of less than 1, 0.5, 0.2, 0.1, 0.05 or 0.0306 nM.

[0062] A preferred VHH that binds the D3 domain of VWF and that is present as targeting agent in a fusion protein of the invention is VHH-D3, having the amino acid sequence of positions 55-178 of SEQ ID NO:8 or a VHH having an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with positions 55-178 of SEQ ID NO:8 and having a Kd for VWF of less than 1, 0.5, 0.4, 0.35, or 0.33 nM.

[0063] A preferred VHH that binds the Al domain of VWF and that is present as targeting agent in a fusion protein of the invention is VHH-Al2, having the amino acid sequence of positions 55-179 of SEQ ID NO:11 or a VHH having an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with positions 55-179 of SEQ ID NO:11 and having a Kd for VWF of less than 25, 20, 18, 15 or 13 nM. Another preferred of VHH that binds the Al domain of VWF and that is present as targeting agent in a fusion protein of the invention is the VHH having the amino acid sequence of SEQ ID NO:13 or its humanized version having the amino acid sequence of SEQ ID NO:14, or a VHH having an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with the SEQ ID NO:13 or 14 and having a Kd for VWF of less than 10, 5 or 2 nM.

[0064] A preferred VHH that binds the platelet GP1B receptor and that is present as targeting agent in a fusion protein of the invention is VHH-GP1B17, having the amino acid sequence of positions 55-178 of SEQ ID NO:12 or a VHH having an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with positions 55-178 of SEQ ID NO:12 and having a Kd for the platelet GP1B receptor of less than 20, 15, 10, 5, 2, 1, 0.5, 0.2 or 0.1 nM. Other preferred VHHs that bind the platelet GP1B receptor and that are present as targeting agent in fusion proteins of the invention have an amino acid sequence selected from the group consisting of amino acid sequences of positions 55-175 of SEQ ID NO:20, positions 55-178 of SEQ ID NO:21, positions 55-172 of SEQ ID NO:22, positions 55-171 of SEQ ID NO:23, positions 55-174 of SEQ ID NO:24, positions 55-176 of SEQ ID NO:25; positions 55-178 of SEQ ID NO:26, positions 55-178 of SEQ ID NO:27, positions 55-178 of SEQ ID NO:28, positions 55-166 of SEQ ID NO:29, positions 55-180 of SEQ ID NO:30, positions 55-176 of SEQ ID NO:31, positions 55-176 of SEQ ID NO:32, positions 55-179 of SEQ ID NO:33, positions 55-179 of SEQ ID NO:34, positions 55-177 of SEQ ID NO:35, positions 55-178 of SEQ ID NO:36 and positions 55-181 of SEQ ID NO:37, or have an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with the amino acid sequence in this group and having a Kd for the platelet GP1B receptor of less than 20, 15, 10, 5, 2, 1, 0.5, 0.2 or 0.1 nM.

[0065] Another preferred VHH that binds the Al domain of VWF comprises an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with SEQ ID NO: 46. Preferably a VHH that binds the Al domain of VWF and that comprises the amino acid sequence of SEQ ID NO:46 is present as targeting agent in a fusion protein of the invention is the VHH having the amino acid sequence of SEQ ID NO:45 or its humanized version having the amino acid sequence of SEQ ID NO:44, or a VHH having an amino acid sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity with the SEQ ID NO:44 or 45 and having a Kd for VWF of less than 10, 5 or 2 nM.

[0066] In another embodiment of a fusion protein of the invention, the targeting agent that specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium comprises a binding domain from a protein that naturally binds to at least one of VWF, platelets, and activated or injured vascular endothelium. Preferably, the binding domain comprises a binding domain selected from the group consisting of: i) the A1 domain from VWF, or at least a part of the VWF A1 domain that binds the platelet GP1B receptor; ii) a VWF-binding domain from one of ADAMTS13, Factor XII, Factor H (complement regulator), plasminogen and Factor VIII, at least a part of these domains that binds VWF; and, iii) a domain that binds to membrane(s) of activated or injured vascular endothelium, which domain is selected from the vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain, the C-domain from factor V and the C-domain from factor VIII.

[0067] In one embodiment of the invention, the fusion protein comprises more than one targeting agent. The fusion protein can thus comprises e.g. two, three, four, five, six or more targeting agents. If more than one targeting agent is present in the fusion protein, there can be more than one copy of the same targeting agent present in the fusion protein. Alternatively, the fusion protein can comprises at least two different targeting agents. For example, the fusion protein can comprise at least two different targeting agents that (each) bind to at least two different domains of VWF or to at least two different receptors on platelets. Or the fusion protein can comprises at least two different targeting agents, of which at least one binds to VWF and at least one other binds to platelets. An advantage of incorporating more than one targeting agent in the fusion protein is the avidity of the multivalent binding at the site of MVT, i.e. the accumulated strength of multiple affinities of individual binding interactions by the individual targeting agents. When more than one targeting agent is present in the fusion protein, the individual targeting agents are preferably arranged in tandem, and preferably with suitable (flexible) spacer- or linker-amino acid sequences between the individual targeting agents.

[0068] Suitable flexible linker-amino acid sequences are known in the art (e.g. from Chen et al., 2013, Adv Drug Deliv Rev. 65(10): 1357-1369). Flexible linkers are usually applied when the joined domains require a certain degree of movement or interaction. They are generally composed of small, non-polar (e.g. Gly) or polar (e.g. Ser or Thr) amino acids. The small size of these amino acids provides flexibility, and allows for mobility of the connecting functional domains. The incorporation of Ser or Thr can maintain the stability of the linker in aqueous solutions by forming hydrogen bonds with the water molecules, and therefore reduces the unfavorable interaction between the linker and the protein moieties. Preferred flexible linkers have sequences consisting primarily of stretches of Gly and Ser residues ("GS" linker). An example of preferred (and widely used) flexible linker has the sequence of (Gly-Gly-Gly-Gly-Ser).sub.n. By adjusting the copy number "n", the length of this GS linker can be optimized to achieve appropriate separation of the functional domains, or to maintain necessary inter-domain interactions. Besides the GS linkers, many other flexible linkers have been designed for recombinant fusion proteins. These flexible linkers are also rich in small or polar amino acids such as Gly and Ser, but can contain additional amino acids such as Thr and Ala to maintain flexibility, as well as polar amino acids such as Lys and Glu to improve solubility, such as e.g. the flexible linkers KESGSVSSEQLAQFRSLD (SEQ ID NO:38) and EGKSSGSGSESKST (SEQ ID NO:38), that have been applied for the construction of a bioactive scFv's.

[0069] In addition to the above described one or more targeting agents for targeting to an MVT, a fusion protein of the invention further at least comprises a plasminogen activator. Plasminogen activators are serine proteases that catalyze the activation of plasmin via proteolytic cleavage of its zymogen form plasminogen. While plasmin is an important factor in fibrinolysis, in the context of the present invention plasminogen activation is relied upon for its fibrin-independent thrombolytic activity towards MVT. Therefore, a fusion protein according to the invention comprises a plasminogen activator, which plasminogen activation preferably comprises a (catalytic) protease domain from tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), plasminogen, streptokinase or staphylokinase. The catalytic protease domains of tPA, uPA, plasminogen, streptokinase and staphylokinase are well known in the art. A preferred plasminogen-activating catalytic protease domain for incorporation in a fusion protein of the invention is the catalytic protease domain of uPA, preferably of human uPA, which comprises the amino acid sequence of positions 16-268 of SEQ ID NO:1, or the catalytic protease domain of tPA, preferably of human tPA, which comprises the amino acid sequence of positions 15-266 of SEQ ID NO:19.

[0070] In one embodiment, wherein the catalytic domain protease domain for incorporation in a fusion protein of the invention is the catalytic protease domain of uPA, preferably of human uPA, the (human) uPA domain comprises a mutation in its sequence that stabilizes the (human) uPA. Stabilizing mutations have been described in U.S. Pat. No. 5,472,692 and Sun et al (J Biol Chem 1997 Sept. 19; 272 (38): 23818-23823) which incorporated herein in their entirety. In one preferred embodiment, the catalytic domain protease comprises and/or consists of SEQ ID NO: 1 wherein the Lysin (K) located at position 157 of SEQ ID NO:1 is mutated to Histidine (H). In one preferred embodiment, the catalytic domain protease comprises and/or consists of SEQ ID NO: 2 wherein the Lysin (K) located at position 158 of SEQ ID NO:2 is mutated to Histidine (H).

[0071] In one embodiment, the plasminogen activator that is incorporated in a fusion protein of the invention is comprises a variant of a catalytic protease domain with reduced susceptibility to natural inhibitors of plasminogen activators, such as plasminogen activator inhibitor-1 (PAI-1). Such variants include e.g. variants of the protease domains of uPA or tPA with one or more modifications in their exosite loops that are involved in the interaction with PAI-1, such as e.g. the 37- and 147-loops in the protease domains of uPA or analogous loops in the protease domain of tPA, e.g. the 37-, 60-, 97-, 147- and 217-loops (see Lin et al. J Biol Chem. 2011 Mar 4; 286(9): 7027-7032). Examples of such modifications are deletions of exosites that are specific to interaction with PAI-1 (tPA del 296-302) or replacement of specific amino acids that specifically mediate the interaction with PAI-1 (tPA Arg->Glu 304 or Arg ->Ser 304) (Madison et al. Nature. 1989 Jun 29;339(6227):721-4.).

[0072] In a preferred embodiment the plasminogen activator that is incorporated in a fusion protein of the invention further comprises at least the cysteine-containing part of the connecting peptide that naturally occurs in the plasminogen activator immediately upstream (N-terminally) of its protease domain. The presence of the connecting peptide including its cysteine avoids that the counterpart cysteine in the protease domain forms unwanted disulfide bridges.

[0073] A preferred connecting peptides for inclusion in the plasminogen activator that is incorporated in a fusion protein of the invention is: a) a connecting peptide from uPA that at least includes amino acids 17-27 of SEQ ID NO:16, more preferably the connecting peptide at least includes amino acids 13-27 of SEQ ID NO:16; b) a connecting peptide from tPA that at least includes amino acids 3-14 of SEQ ID NO:17, more preferably the connecting peptide at least includes amino acids 1-14 of SEQ ID NO:17; or c) a connecting peptide from plasminogen that at least includes amino acids 5-18 of SEQ ID NO:18, more preferably the connecting peptide at least includes amino acids 1-18 of SEQ ID NO:18.

[0074] In another preferred embodiment, a fusion protein of the invention preferably comprises a linker-amino acid sequence located between the one or more targeting agents on the one hand, and the plasminogen activator on the other hand. It is thereby understood that if the plasminogen activator includes a connecting peptide e.g. as described above, that the linker-amino acid sequence then is located upstream of the plasminogen activator's connecting peptide. The linker-amino acid sequence linking the targeting agents and the plasminogen activator preferably is a flexible linker-amino acid sequence as described above. A preferred linker-amino acid sequence for linking the targeting agents and the plasminogen activator has the sequence of (Gly-Gly-Gly-Gly-Ser).sub.n, whereby n is 1-4, more preferably 2 or 3 and most preferably 2. A particularly preferred linker-amino acid sequence has the amino acid sequence of SEQ ID NO:6.

[0075] Thus, a preferred fusion protein in accordance with the invention is a fusion protein that comprises in a N- to C-terminal order: a) one or more targeting agents as defined hereinabove, whereby, optionally the targeting agents are linked by linker amino acid sequences as defined hereinabove; b) optionally a linker amino acid sequence as defined hereinabove; and, c) a plasminogen activator as defined hereinabove. The fusion protein can further comprise additional functional elements, including e.g. isolation tags, such as e.g. a His-tag or a STREP isolation tag, or a cleavage site recognized only by a specific protease such as e.g. a Tobacco Etch Virus cleavage site, so to be able to cleave off undesirable amino acid sequences (e.g. the isolation tag) from the fusion protein. An example of the configuration of a preferred fusion protein in accordance with the invention is shown in FIG. 1, whereby the nucleotide sequence encoding the fusion protein also encodes a (IN signal sequence upstream of the fusion protein to direct its secretion from the cell in which the protein is produced.

[0076] In a second aspect, the invention relates to a nucleic acid molecule comprising a nucleotide sequence encoding a fusion protein of the invention as defined hereinabove. The nucleotide sequence encoding the fusion protein further preferably comprises a nucleotide sequence encoding a signal peptide operably linked to the fusion protein. A preferred signal peptide for directing secretion of the fusion proteins of the invention is the Igic signal peptide, having the amino acid sequence of SEQ ID NO: 3. A nucleic acid molecule comprising a nucleotide sequence encoding a fusion protein of the invention, further preferably comprises regulatory elements conducive to the expression of the fusion protein in an appropriate host cell, which regulatory elements are operably linked to the nucleotide sequence.

[0077] In a third aspect, the invention relates to a vector comprising a nucleic acid molecule according to the invention. Optionally, the vector according to the invention is a gene therapy vector.

[0078] Preferably, the a gene therapy vector is a viral gene therapy vector, e.g. a viral gene therapy vector selected from gene therapy vectors based on an adenovirus, an adeno-associated virus (AAV), a herpes virus, a pox virus, an oncolytic virus vector and a retrovirus. A preferred viral gene therapy vector is an AAV or Lentiviral vector.

[0079] In a fourth aspect, the invention relates to a host cell comprising a vector according to the invention, which host cell expresses a fusion protein according to invention.

[0080] The cell preferably is an isolated cell or a cultured cell. Among the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells. Prokaryotes include gram negative or gram positive organisms, for example Escherichia coli or bacilli. Higher eukaryotic cells include insect cells and established cell lines of mammalian origin. Examples of suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (Gluzman et al., 1981, Cell 23:175), L cells, HEK 293 cells, C127 cells, 3T3 cells, Chinese hamster ovary (CHO) cells, HeLa cells, BHK cell lines, and the CVI/EBNA cell line derived from the African green monkey kidney cell line CVI as described by McMahan et al., 1991, EMBO J. 10: 2821. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, New York, 1985).

[0081] The transformed cells can be cultured under conditions that promote which host cell expresses a fusion protein according to invention. Thus in one aspect the invention relates to a method for producing a fusion protein according to invention, the method comprising the step of cultivating a cell comprising at least one expression vector as defined herein, under conditions conducive to expression of a fusion protein according to invention, optionally, recovering the fusion protein according to invention.

[0082] A fusion protein according to invention can be recovered by conventional protein purification procedures, including e.g. protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography, using e.g. strepavidin/biotin (see e.g. Low et al., 2007, J. Chromatography B, 848:48-63; Shukla et al., 2007, J. Chromatography B, 848:28-39).

[0083] In a fifth aspect, the invention relates to a pharmaceutical composition comprising and/or consisting of a fusion protein according to the invention, a nucleic acid according to the invention, a vector or gene therapy vector according to the invention, or a host cell according to the invention and a pharmaceutically acceptable excipient.

[0084] The pharmaceutical composition further preferably comprises at least one pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier such as an adjuvant, or vehicle, is for administration of the antibody or antibody fragment to a subject. Said pharmaceutical composition can be used in the methods of treatment described herein below by administration of an effective amount of the composition to a subject in need thereof. The term "subject", as used herein, refers to all animals classified as mammals and includes, but is not restricted to, primates and humans. The subject is preferably a male or female human of any age or race.

[0085] The term "pharmaceutically acceptable carrier", as used herein, is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration (see e.g. "Handbook of Pharmaceutical Excipients", Rowe et al eds. 7.sup.th edition, 2012, wkApirv.pharrnpress.com). The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter ions such as sodium; metal complexes (e.g. Zn.sup.2+-protein complexes); and/or non-ionic surfactants such as TWEEN.TM., PLURONICS.TM. or polyethylene glycol (PEG).

[0086] Supplementary active compounds can also be incorporated into the pharmaceutical composition of the invention. Thus, in a particular embodiment, the pharmaceutical composition of the invention may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to further provide a chemotherapeutic agent, a cytokine, an analgesic agent, a thrombolytic or an immunomodulating agent, e.g. an immunosuppressive agent or an immunostimulating agent. The effective amount of such other active agents depends, among other things, on the amount of antibody of the invention present in the pharmaceutical composition, the type of disease or disorder or treatment, etc.

[0087] In an embodiment, the fusion protein according to the invention is prepared with carriers that will protect said compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems, e.g. liposomes. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. Liposomal suspensions, including targeted liposomes can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811 or WO2010/095940.

[0088] The administration route of the fusion protein according to the invention can be parenteral. The term "parenteral" as used herein includes intravenous, intra-arterial, intralymphatic, intraperitoneal, intramuscular, subcutaneous, rectal or vaginal administration. The intravenous forms of parenteral administration are preferred. By "systemic administration" is meant oral, intravenous, intraperitoneal and intramuscular administration. The amount of the fusion protein required for therapeutic or prophylactic effect will, of course, vary with the fusion protein chosen, the nature and severity of the condition being treated and the patient. In addition, the fusion protein may suitably be administered by pulse infusion, e.g., with declining doses of the fusion protein. Preferably the dosing is given by injections, most preferably intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.

[0089] Thus, in a particular embodiment, the pharmaceutical composition of the invention may be in a form suitable for parenteral administration, such as sterile solutions, suspensions or lyophilized products in the appropriate unit dosage form. Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, CremophorEM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, a pharmaceutically acceptable polyol like glycerol, propylene glycol, liquid polyetheylene glycol, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol or sodium chloride in the composition.

[0090] Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminium monostearate and gelatin.

[0091] Sterile injectable solutions can be prepared by incorporating the active compound (e.g a fusion protein) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.

[0092] In a particular embodiment, said pharmaceutical composition is administered via intravenous (IV) or subcutaneous (SC). Adequate excipients can be used, such as bulking agents, buffering agents or surfactants. The mentioned formulations will be prepared using standard methods for preparing parenterally administrable compositions as are well known in the art and described in more detail in various sources, including, for example, "Remington: The Science and Practice of Pharmacy" (Ed. Allen, L. V. 22nd edition, 2012, www,pharmpress.com).

[0093] It is especially advantageous to formulate the pharmaceutical compositions, namely parenteral compositions, in dosage unit form for ease administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound (antibody of the invention) calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.

[0094] Generally, for the prevention and/or treatment of the diseases and disorders mentioned herein and depending on the specific disease or condition to be treated and its severity, the potency of the specific fusion protein of the invention to be used, the specific route of administration and the specific pharmaceutical formulation or composition used, the fusion proteins of the invention will generally be administered in the range of from 0.001 to 1,000 mg/kg body weight/day, preferably about 0.01 to about 100 mg/kg body weight/day, most preferably from about 0.05 to 10 mg/kg body weight/day, such as about 1, 10, 100 or 1000 microgram per kg body weight per day, either continuously (e.g. by infusion), as a single daily dose or as multiple divided doses during the day. The clinician will generally be able to determine a suitable daily dose, depending on the factors mentioned herein. It will also be clear that in specific cases, the clinician may choose to deviate from these amounts, for example on the basis of the factors cited above and his expert judgment.

[0095] Aside from administration of a fusion protein according to the invention to the patient, the present application contemplates administration of a fusion proteins by gene therapy.

[0096] The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.

[0097] The fusion proteins and pharmaceutical compositions of this invention may be used with other drugs to provide a combination therapy. The other drugs may form part of the same composition, or be provided as a separate composition for administration at the same time or at different time.

[0098] In a sixth aspect, the invention pertains to at least one of a fusion protein, a gene therapy vector and a pharmaceutical composition, each as defined hereinabove, for use in the treatment or prevention of a disease or condition associated with thrombosis. The disease or condition to be prevented or treated can be any disease or condition associated with or involving thrombi comprising at least one of VWF and platelets. Such a disease or condition associated with thrombi comprising at least one of VWF and platelets can be any disease or condition involving macrovascular and/or microvascular thrombi (MVT), and/or involving sites of (yet) non-occlusive macro- or microvascular thrombi. Preferably, however, the disease or condition to be prevented or treated is a disease or condition associated with at least microvascular thrombosis (MVT). It is to be understood herein that the term "to prevent a disease or condition" includes and/or can be equal to reducing the risk of that disease or condition to occur or develop.

[0099] In a preferred embodiment the disease or condition associated with thrombi comprising at least one of VWF and platelets is a disease or condition is selected from the group consisting of: acquired or hereditary thrombotic thrombocytopenic purpura (TTP) complement-mediated thrombotic microangiopathy (as reviewed by George et al., 2014, N Engl J Med. 371(7):654-66) haemolytic uremic syndrome, antiphospholipid antibody syndrome, the formation of an occlusive thrombus, arterial thrombus formation, acute coronary occlusion, peripheral arterial occlusive disease, restenosis and disorders arising from coronary by-pass graft, coronary artery valve replacement and coronary interventions such angioplasty, stenting or atherectomy, hyperplasia after angioplasty, atherectomy or arterial stenting, occlusive syndrome in a vascular system or lack of patency of diseased arteries, transient cerebral ischemic attack, unstable or stable angina pectoris, cerebral infarction, HELLP syndrome (HELLP is Hemolysis, Elevated Liver enzymes, and Low Platelet count), carotid endarterectomy, carotid artery stenosis, critical limb ischemia, cardioembolism, peripheral vascular disease, restenosis, sickle cell disease and myocardial infarct.

[0100] Further diseases or conditions associated with thrombi comprising at least one of VWF and platelets to be treated or prevented in accordance with a method of the invention are diseases or conditions is selected from the group consisting of unstable angina, stable angina, angina pectoris, embolus formation, deep vein thrombosis, hemolytic anemia, acute renal failure, thrombolytic complications, disseminated intravascular coagulopathy (DIC), thrombosis, coronary heart disease, thromboembolic complications, myocardial infarction, restenosis, and atrial thrombosis formation in atrial fibrillation, chronic unstable angina, transient ischemic attacks and strokes, peripheral vascular disease, arterial thrombosis, pre-eclampsia, embolism, restenosis and/or thrombosis following angioplasty, anastomosis of vascular grafts, and chronic exposure to cardiovascular devices. Such conditions may also result from thromboembolism and reocculsion during and after thrombolytic therapy, after angioplasty, and after coronary artery bypass.

[0101] In a further embodiment a fusion protein, a gene therapy vector and a pharmaceutical composition, each as defined hereinabove, for use in the treatment or prevention of a plaque or thrombus in an individual. Said plaque or thrombus formation may be under conditions of high shear. In both thrombosis and reocclusion, the reversible adhesion or tethering of the platelets at high shear rate is followed by a firm adhesion through the collagen receptor on platelets resulting in platelet activation; the tethering of platelets by VWF to collagen exposed in the damaged vessel wall is especially important under high shear conditions. A fusion protein of the present invention performs well under high shear conditions.

[0102] In a seventh aspect the invention relates to method for treating or reducing the risk of a disease or condition associated with thrombi comprising at least one of VWF and platelets, wherein the method comprises the step of administering to a subject in need thereof, an effective amount of fusion protein as defined hereinabove, a gene therapy vector as defined hereinabove or a pharmaceutical composition as defined hereinabove, and wherein preferably with the disease or condition associated with microvascular thrombosis. Preferably, in the method the disease or condition associated with thrombi comprising at least one of VWF and platelets is selected from the group consisting of: acquired or hereditary thrombotic thrombocytopenic purpura (TTP), complement-mediated thrombotic microangiopathy, haemolytic uremic syndrome, antiphospholipid antibody syndrome, non-occlusive thrombus, the formation of an occlusive thrombus, arterial thrombus formation, acute coronary occlusion, peripheral arterial occlusive disease, restenosis and disorders arising from coronary by-pass graft, coronary artery valve replacement and coronary interventions such angioplasty, stenting or atherectomy, hyperplasia after angioplasty, atherectomy or arterial stenting, occlusive syndrome in a vascular system or lack of patency of diseased arteries, transient cerebral ischemic attack, unstable or stable angina pectoris, cerebral infarction, HELLP syndrome, carotid endarterectomy, carotid artery stenosis, critical limb ischemia, cardioembolism, peripheral vascular disease, restenosis, sickle cell disease and myocardial infarct, or a further diseases or conditions defined hereinabove.

[0103] In an eighth aspect the invention relates to method for treating or reducing the risk of at least one of microvascular thrombi, fibrin-independent thrombi and thrombi comprising at least one of VWF and platelets. Preferably, in the method at least one these thrombi is treated or the risk of its occurrence is reduced in a disease or condition is selected from the group consisting of: acquired or hereditary thrombotic thrombocytopenic purpura (TTP), complement-mediated thrombotic microangiopathy, haemolytic uremic syndrome, antiphospholipid antibody syndrome, non-occlusive thrombus, the formation of an occlusive thrombus, arterial thrombus formation, acute coronary occlusion, peripheral arterial occlusive disease, restenosis and disorders arising from coronary by-pass graft, coronary artery valve replacement and coronary interventions such angioplasty, stenting or atherectomy, hyperplasia after angioplasty, atherectomy or arterial stenting, occlusive syndrome in a vascular system or lack of patency of diseased arteries, transient cerebral ischemic attack, unstable or stable angina pectoris, cerebral infarction, HELLP syndrome, carotid endarterectomy, carotid artery stenosis, critical limb ischemia, cardioembolism, peripheral vascular disease, restenosis, sickle cell disease and myocardial infarct, or a further diseases or conditions defined hereinabove.

[0104] In this document and in its claims, the verb "to comprise" and its conjugations is used in its non-limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded. In addition, reference to an element by the indefinite article "a" or "an" does not exclude the possibility that more than one of the element is present, unless the context clearly requires that there be one and only one of the elements. The indefinite article "a" or "an" thus usually means "at least one".

[0105] The word "about" or "approximately" when used in association with a numerical value (e.g. about 10) preferably means that the value may be the given value (of 10) more or less 0.1% of the value.

[0106] All patent and literature references cited in the present specification are hereby incorporated by reference in their entirety.

[0107] The present invention is further described by the following examples which should not be construed as limiting the scope of the invention.

DESCRIPTION OF THE FIGURES

[0108] FIG. 1: VHH-miniUPA (mUPA) construct A) Schematic representation of an mUPA construct B) Schematic representation of an mUPA construct comprising a VHH coding sequence (VHH-mUPA).

[0109] FIG. 2: Western Blot of purified VHH-mUPA constructs.

[0110] FIG. 3: VHH-mUPA construct activity after activation by plasmin.

[0111] FIG. 4: Plasminogen activation by VHH-mUPA constructs.

[0112] FIG. 5: Plasminogen activation by VHH-mUPA constructs in the presence of globular or open VWF. A) Plasminogen activation by VHH-sVWF, B) Plasminogen activation by VHH-D3, C) Plasminogen activation by VHH-GP1B17, D) Plasminogen activation by VHH-R2, E) Plasminogen activation by VHH-A12.

[0113] FIG. 6: Plasmin substrate conversion after 5 minutes incubation at 37.degree. C. of the constructs VHH-sVWF, VHH-D3, VHH-GP1B17, VHH-R2, and VHH-A12.

[0114] FIG. 7: Micro-thrombolysis (i.e. enzymatic breakdown) of VWF-platelet agglutinates. Lysis of the agglutinates was monitored overtime A) Microthrombolysis induced by VHH-sVWF, B) Microthrombolysis induced by VHH-D3, C) Microthrombolysis induced by VHH-R2, D) Microthrombolysis induced by VHH-GP1B17.

[0115] FIG. 8: A) Graphic example of analytical method to determine time points by which 50% microthrombus degradation has occurred. B) 50% microthrombus degradation of the constructs VHH-sVWF, VHH-D3, VHH-GP1B17, VHH-R2, and VHH-A12.

[0116] FIG. 9: Micro-thrombolysis of VWF-platelet complexes adhered to human vascular endothelial cells as analyzed in flow perfusion experiments. VWF-platelet complexes are visible as strings of platelets and the number of visible string are counted as a function of time in response to the addition of fusion proteins as indicated.

[0117] FIG. 10: Micro-thrombolysis (i.e. enzymatic breakdown) of VWF-platelet agglutinates. Lysis of the agglutinates was monitored overtime on a light transmission aggregometer. A) Microthrombolysis induced by (154.3 nM) Caplacizumab or (154.3 nM) VHH-D3 fusion protein with UPA in the presence of (100 .mu.g/mL) plasminogen. B) Microthrombolysis induced by (154.3 nM) Caplacizumab or (154.3 nM) VHH-GP1B17 fusion protein with UPA in the presence of (100 .mu.g/mL) plasminogen.

EXAMPLES

Example 1

Methods and Materials

[0118] Nanobody-mUPA construction

[0119] The cDNA sequence for both human and mouse urokinase (PLAU) was obtained from the NCBI database (NM_002658.4 and NM_008873.3 respectively). The sequence for the signal peptide, EGF-like and Kringle domain were removed as well as the first part of the connecting peptide. To the remaining connecting peptide and S1 peptidase domain (Catalytic domain) a N-terminal sequence coding for a Tobacco Etch Virus cleavage site followed by an GGGGS linker was added. In the GGGGS linked a Pstl and BamHI digestion site were incorporated without disturbing the amino acid sequence. At the 5' side an EcoRl digestion site was added and at the 3' side and Notl digestion was added after the STOP codon of PLAU. The construct was obtained from IDT (Integrated DNA Technologies, Leuven, Belgium) as a custom gene construct.

[0120] Coding sequences for nanobodies (also known as VHH) were codon optimized via IDT for expression in a human host cells. At the N-terminal side of the VHH coding sequence, a sequence coding for a Tobacco Etch Virus cleavage site was placed and at the C-terminal side a GGGGS linker (encoding a Pstl and BamHl digestion site). These DNA segments were obtained from IDT as Double stranded DNA fragments (gBLocks).

[0121] The custom gene construct was propagated in E.coli TOP10 and selected by ampicillin resistance. Obtained plasmid DNA was digested by EcoRl and Notl. The resulting insert (886) was separated on and isolated from agarose gel and ligated into a modified pcDNA6 expression vector (pSM2) (De Maat et al, 2016 J Allergy Clin Immunol Nov;30;138(5):1414-23)). pSM2 encodes a N-terminal murine IgK secretion signal and a double STREP isolation tag whereafter the modified UPA construct is ligated.

[0122] The gBlocks were ligated into the pJET1.2 cloning vector according to manufacturer instructions (CloneJET PCR Cloning Kit; Thermo Fisher). The constructs were propagated in E.coli TOP10 and selected by ampicillin resistance. Obtained plasmid DNA was digested by EcoRl and BamHl. The resulting insert was separated on and isolated from agarose gel and ligated into the pSM2 vector containing the miniUPA construct. The gene constructs are schematically depicted in in FIG. 1. Table 1 lists the nanobody-mUPA fusion protein constructs that were prepared, including the targets of their nanobodies and their names.

TABLE-US-00004 TABLE 1 Description of nanobody-mUPA fusion protein constructs Specificity Name Target VWF sVWF-mUPA globular and unfolded VWF D3-mUPA D3 domain of VWF A11-mUPA A1 domain of VWF A12-mUPA A1 domain of VWF Platelets GP1B17-mUPA platelet GP1B receptor Negative control R2-mUPA no binding to VWF or platelets

Nanobody-mUPA Production

[0123] The nanobody/mUPA-pSM2 constructs were transfected into HEK293 FreeStyle.TM. cells using 239Fectin as instructed by the manufacturer (ThermoFisher). After 1 day cells were expanded to a 20 mL. 2 Days hereafter the cells were placed under blasticidin (5 .mu.g/mL) selection. Transfected cells were further cultured according to manufacturer instructions until the constructs were stably integrated into the HEK genome. Cell were expanded (to 1.1*10.sup.6 cells/mL) and after 7 days of protein production, the cells were spun down at 2000.times.g for 5 minutes. Hereafter the supernatant was collected and benzamine (0.174 mg/mL) was added, where after the supernatant was stored at -20.degree. C. until further use.

[0124] Nanobody-mUPA purification

[0125] Collected supernatant (400 mL) was concentrated on a Quixstand to 150 mL using a 10 kDA cutoff membrane (GE healthcare). Hereafter the concentrate was dialyzed against 2L of 1.times. STREP buffer containing benzamidine (100 mM Tris, 150 mM NaCl, 0.174 mg/mL Benzamidine, pH 8.0). The concentrate was flowed over a column containing 8 mL Strep-Tactin superflow beads (IBA). After washing the column with 20 mL of 1.times. STREP buffer, the protein was eluted via d-Desthiobiotin (2.5 mM; Sigma Aldrich) in 1.times. STREP buffer. The purified proteins were dialyzed against 2L sodium acetate (4 mM sodium acetate, 150 mM NaCl, pH 5.4) and stored at -80.degree. C.

Results

Purified Nanobody-mUPA Constructs on Western Blot

[0126] The nanobody-mUPA constructs were diluted in sample buffer (25 mM DTT) to a concentration of 100 .mu.g/mL. 10 .mu.L sample was loaded onto a 4-12% gradient Bis-Tris gel in MES buffer. Sample separation was performed at 165 Volt for 50 minutes. The gel is transferred onto a Immobilon-FL membrane in blotting buffer for 1 hour at 125 Volt. The membrane is blocked with 0.5.times. Odyssey blocking buffer where after the constructs are detected with a rabbit polyclonal anti human UPA antibody in combination with an 1R800 labeled Goat-anti-Rabbit antibody. Results were analyzed via the near-infrared odyssey scanner (Licor) according to manufacturer instructions. FIG. 2 shows that all fusion proteins except for A11-mUPA were expressed at near-equal levels.

Urokinase Activity of Nanobody-mUPA Constructs

[0127] The nanobody-mUPA constructs should display no spontaneous (i.e. non-induced) activity but should be activatable through molecular cleavage by plasmin.

[0128] To verify that none of the nanobody-mUPA constructs shows any spontaneous activity, the constructs (1 .mu.g/mL) were incubated in 0.2% BSA-HBS in the presence of a 0.5 mM urokinase substrate (11140; Bachem). Substrate conversion was measured according to manufacturer instruction at 37.degree. C. None of the fusion proteins showed any detectable spontaneous activity towards the urokinase substrate (data not shown).

[0129] To test whether nanobody-mUPA constructs are activatable by plasmin, plasminogen was pre-activated by streptokinase for 15 minutes at 37.degree. C. (hereafter called plasmin). The nanobody-mUPA fusion constructs (1 .mu.g/mL final concentration) were diluted in in 0.2% BSA-HBS and incubated for 12 minutes with plasmin (1 .mu.g/mL final concentration). Subsequently, urokinase substrate (0.5 mM 11140, Bachem) was added and its conversion was measured according to manufacturer's instructions at 37.degree. C. FIG. 3 shows that the fusion proteins are normally activatable.

Plasminogen Activation

[0130] The basis of plasminogen activation by urokinase depends on the reciprocal cleavage between urokinase and plasminogen. To test plasminogen activation by the nanobody-mUPA constructs, the constructs (1 .mu.g/mL) were incubated in 0.2% BSA-HBS in the presence of 100 .mu.g/mL plasminogen and 0.2 mM plasmin substrate (11390; Bachem). Substrate conversion was measured according to manufacturer instruction at 37.degree. C. FIG. 4 shows that all constructs showed development of comparable enzyme activity.

Binding of Anti-VWF Constructs to VWF as Determined by ELISA

[0131] A nunc maxisorp plate (Thermo) was coated overnight with 1 .mu.g/mL VWF in PBS. The following day the plate was blocked with 1% BSA-PBS. The anti-VWF nanobody-mUPA fusion constructs were diluted in 1% BSA-PBS at various concentrations after which 50 uL is added to each well and incubated for 1 hours. Hereafter the plate is washed with PBS-Tween 20 (PBST; 0.05% v/v). Bound construct was detected via rabbit anti-UPA polyclonal antibody in combination Goat-anti-rabbit-HRP secondary antibody (Abcam). Wells were rinsed with PBST, after which 100 .mu.l TMB was added at room temperature. Substrate was developed for 5 minutes after which 50 .mu.l H.sub.2SO.sub.4 (0.3 M) was added. Results were analyzed at 450 nm by absorption. Results were analyzed by Graphpad Prism 7.02 and the K.sub.d (in nM) was determined via non-linear regression curve fit. Binding affinities are listed in Table 2.

TABLE-US-00005 TABLE 2 Binding affinities of anti-VWF nanobody-mUPA fusion constructs to VWF as determined by ELISA. Construct K.sub.d (nM) Standard deviation sVWF-mUPA 0.03055 0.02491 D3-mUPA 0.3279 0.2005 A12-mUPA 12.84 6.571 R2-mUPA 1039010 1798731

Plasminogen Activation in the Presence of Globular or Open VWF

[0132] VWF is the scaffold for microthrombus formation. It also has plasmin(ogen) binding properties that are dependent on protein conformation (Tersteeg et al., 2014, supra). VWF unfolds under shear stress (as well as during immobilization on microtiter plates see previous experiment). This can be mimicked by incubation with the small molecule ristocetin. We asked whether plasminogen activation by our targeted fusion proteins is influenced by the conformation of VWF. The nanobody fusion constructs (0.25 .mu.g/mL) and VWF (5 .mu.g/mL) are diluted in 0.2% BSA-HBS. Hereafter, ristocetin (0.6 mg/mL) or buffer is added to open up the VWF or keep it globular, respectively, while incubating at 37.degree. C. for 5 minutes. Hereafter plasminogen is added (100 .mu.g/mL) followed by plasmin substrate (11390 Bachem; 0.2 mM). Substrate conversion was measured according to manufacturer's instructions at 37.degree. C. For comparison, the substrate at conversion after 5 minutes was shown for the different constructs. In the bar graph below. Data was processed in Graphpad Prism 7.02 and analyzed by one-way Anova. * P<0.05. FIGS. 5 and 6 show that the time to development of plasmin activity is significantly shorted by open VWF (in the presence of ristocetin) as compared to closed VWF.

Micro-Thrombolysis of VWF-Platelet Agglutinates.

[0133] Blood platelets were isolated from citrated whole blood according to earlier described methods (Tersteeg et al., 2014, supra). Isolated blood platelets (200.000 /mL) were incubated with VWF (5 .mu.g/mL), plasminogen (100 .mu.g/mL) and the aggregation inhibitors RGDW (200 .mu.M) and Iloprost (0.4 .mu.g/mL) for 15 minutes at 37.degree. C. in a light transmission aggregometer. Agglutination was induced by the addition of ristocetin (0.6 mg/mL). 6 minutes hereafter, the nanobody-mUPA constructs (1 .mu.g/mL) were added and lysis of the agglutinates was monitored overtime (FIG. 7). For all samples, time points were determined by which 50% microthrombus degradation has occurred (graphic example of analytical method is shown in FIG. 8A). Results were processed in Graphpad Prism 7.02 and analyzed by one-way Anova (* P<0.05) and are shown in FIG. 8B. Clearly, the targeting of plasminogen activation by at least the fusion proteins sVWF-mUPA, D3-mUPA and GP1B17-mUPA accelerates microthrombolysis.

Example 2

Micro-Thrombolysis of VWF-Platelet on Endothelial Cells in Flow Perfusion Materials and Methods

Human Vascular Endothelial Cell (Huvecs) Culture on Cover Glasses

[0134] Huvecs (passage 0) stored in liquid nitrogen were thawed at 37.degree. C. and added to medium 1:10 (EBM-2 Lonza or Promocel supplemented with huvec growth factors EGM2) and spun down 100 g for 5 minutes. Supernatant was discarded and cells were taken up in 5 mL medium and cultured in T25 flasks at 37 degrees Celsius, 5% CO.sub.2. The following day the cells were passed to 3.times. T75 flasks. On day 6 the cells are passed 1:6 to the cover glasses pre-treated with 1,25% glutaraldehyde in HT-buffer pH 7.4 (HEPES Tyrode buffer: 10 mM HEPES, 0.5 mM Na.sub.2HPO4, 145 mM NaCl, 5 mM KCl, 1 mM MgSO4).

[0135] To coat cover glasses with glutaraldehyde, coverglasses were rinsed with demi water and with ethanol. Cover glasses were then incubated in HCL 37% : methanol (1:1) for 30 minutes followed by a rinse with demi water for 5 minutes. Next cover glasses were incubated in aminopropyltriethoxysilane : ethanol (1:100) for 30 seconds followed by a rinse with demi water and with ethanol. Cover glasses were then dried and incubated with glutaraldehyde 20% : HT-buffer pH 7.4 (1:20) for 1 hour followed by a rinse with demi water and glasses are stored in ethanol until use.

[0136] Huvecs were cultured on the cover glasses for approximately 10-15 days prior to use.

Heat Inactivated Plasma Preparation

[0137] Heat inactivated plasma was prepared by mixing two bags of plasma (Ominplasma from octapharma both bloodtype AB Lot No: C442A9521, bags: X000214223782; X000214223577). 200 mL of this mix was divided over 10 falcon tubes (50mL, 20mL each) and were incubated in a water bath set at exactly 56.degree. C. for 30 minutes (the 20 mL was completely submerged) and halfway through (15 min) the falcon tubes were mixed. Following the 30 min incubation the falcon tubes were covered in ice and kept on ice until centrifuging (note: when removing the tubes from ice for centrifugation the tubes were still rather warm). The tubes were centrifuged 5 minutes (without cooling) at 15.000 g. The supernatant was combined and kept on ice until aliquoting in 1 mL aliquots.

Flow Chamber Setup

[0138] A laminar-flow perfusion chamber was filled with pre-warmed medium to remove all air from the tubing prior to placing the coverslips. The inlet tube was cut to a length that corresponds with a volume of 90,6 .mu.L so that during the perfusion the fluid that enters the inlet arrives into the perfusion chamber after exactly 1 minute. The syringe that is used has a diameter of 16 mm (only for braun 12 ml syringes) and the syringe pump is set to 90,6 .mu.L per minute as this (with 3 mm tubing) results in a shear rate of 300 s.sup.-1. The huvec coverslip is placed on the medium, attached with the vacuum set at 10 bar and the perfusion chamber is placed under an inverted microscope (Zeiss observer Z.1, Carl Zeiss) with heating module that keeps the perfusion chamber at 37.degree. C. Any remaining air bubbles are removed by perfusing medium.

Washed Platelets in Heat Inactivated Plasma

[0139] Blood from healthy consenting volunteers was collected into 0.1 volume 3.2% 10.9 mM trisodium citrate. Platelet-rich plasma (PRP) was obtained by centrifugation (160 g for 15 min at RT). PRP supplemented with 10% (v/v) acid citrate dextrose, 85 mM tri-sodiumcitrate, 71 mM citric acid, 111 mM D-glucose, was centrifuged (400 g for 15 min at RT) and platelets were resuspended in HEPES tyrode buffer pH 6.5 containing 0.145M NaCl, 5mM KCl, 0.5mM Na.sub.2HPO.sub.4, 1mM MgSO.sub.4, 10mM HEPES and 5.5 mM D-glucose. 10 .mu.g/mL PGl.sub.2 was added to the platelet suspension prior to another centrifugation step (400 g for 15 min at room temperature) and platelets were resuspended in heat inactivated plasma and platelet count was adjusted to a final count of 200 G/L.

Perfusion Experiment Setup

[0140] The heat inactivated plasma containing 200 G/L platelets (that is pre-warmed in 37.degree. C. waterbath) is divided over 2 mL eppendorfcups (40 min experiment.fwdarw.2.times.2mL required, etc). and prior to the start to all eppendorfcups illoprost (8 .mu.L (250 fold dilution) of 0.1 mg/mL stock is added, final concentration 0.4 .mu.g/mL, Bayer Schering Pharma AG) is added first, followed by histamine (4 .mu.L (500 fold dilution) of 500 .mu.M stock in medium, final concentration 100 .mu.M). The perfusion is started immediately after the addition of Iloprost and histamine by transferring the inlet tube from the 2 mL eppendorfcup containing medium to the eppendorfcup containing heat inactivated plasma with platelets by squeezing the tube to ensure no air is introduced. The experiment is started with frame 1 after approximately 1 minute, when the first platelets enter the flow chamber (visible change). After 7 minutes the constructs are added to the remaining (2000-634.2=1365.8 .mu.L because 7*90.6=634 .mu.L is used at this point) by pipetting the required volume directly into the eppendorfcup and mixing with a plastic pipette, final concentration is 10 .mu.g/mL. At this point the construct is also added to the additional Eppendorf cups to make sure the pre-incubation time with plasma remains equal. During the perfusion the 2mL Eppendorf cup needs to be re-filled by carefully adding plasma with a plastic pipette drop by drop. This refill is done at frames 150, 250, etc. so that potential disturbances due to the refilling can be matched to the corresponding frames/time points. During the experiment every 5 seconds a DIC image is made and at the end of the experiment 5 screenshots are made of other regions in the perfusion chamber and the number of platelet-VWF complexes, visible in the form of "platelet-strings" are counted.

Results

[0141] The results are shown in FIG. 9, which shows that targeted plasminogen activation by at least the fusion proteins GP1B17-mUPA, sVWF-mUPA and D3-mUPA accelerates thrombolysis of platelet-VWF complexes bound to Huvecs, as compared to the control fusion protein R2-mUPA. In particular fusion protein GP1B17-mUPA, rapidly clears platelet-VWF complexes, which demonstrates that in particular targeting of platelets is efficient in clearing platelet-VWF complexes in microthrombi.

Example 3

Methods and Materials

Caplacizumab Production

Cloning

[0142] Caplacizumab (a bi-valent variant of the Cablivi VHH) was produced in E.coli and purified via HIS-tag affinity chromatography. The Caplacizumab protein sequence was derived from its EMA assessment report (EMA/490172/2018; Procedure No. EMEA/H/C/004426/0000) and codon optimized for E.coli expression via the integrated DNA technologies (IDT) codon optimized tool. N-terminal BamHl and C-terminal Notl digestion sites were added to the constructs and ordered as a double stranded DNA fragment from IDT (SEQ ID NO:40).

[0143] The DNA fragment were dissolved in 5 mM Tris-buffer (pH=8.5) and heated at 50.degree. C. for 20 minutes. Hereafter the DNA fragment was ligated into the pJET1.2 vector (CloneJET PCR Cloning Kit; Thermo Fisher) according to manufacturer instructions. The ligated product was transformed into chemically competent E.coli TOP10 (Thermo Fisher) via heat shock according to manufacturer instructions. Transformed bacteria were cultured in 10 mL 2.times.YT media (containing 100 .mu.g/mL ampicillin) and grown overnight at 37.degree. C. Plasmid DNA was isolated via the plasmid isolation kit (M&N) according to manufacturer instructions. The insert was digested via BamHl-HF and Notl-HF (NEB) in Cutsmart buffer and separated on 0.7% (w/v) agarose gel (1.times.TBE buffer; 1:10.00 gel red) at 130V for 1 hours. The insert was excised from gel and purified via the PCR&Gel cleanup kit (M&N) according to manufacturer instructions.

[0144] The purified insert was ligated into the pTH4.0 vector. The pTH4.0 vector is a modified pET32a(+) vector encoding an N-terminal PeIB signal peptide; a His6 tag for purification purposes and a sequence encoding a cleavage site for the tobacco etch virus (TEV) protease followed by a BamHl digestion site. After the C-terminal Notl digestion a myc-tag was placed for detection purposes followed by a stop-codon (Table 1). The pTH4.0 vector was digested via BamHI-HF and Notl-HF and subsequently purified as described for the fragments. The fragment were ligated into the digested pTH4.0 vector in a 3:1 ratio via T4 ligase in 1.times. T4 ligate buffer according to manufacturer instructions. The ligation mixture was transformed in TOP10 bacteria as described before, and the transformed bacteria were grown on YT-agar plate (100 .mu.g/mL ampicillin, 2% (w/v) glucose) overnight at 37.degree. C. Colonies were picked, and grown in 10 mL 2.times.YT media (containing 100 .mu.g/mL ampicillin, 2% (w/v) glucose). Plasmid DNA was isolated as described before. The DNA sequence was confirmed by sanger-sequencing via Macrogen (SEQ ID NO: 41).

Production

[0145] Caplacizumab in pTH4.0 plasmid DNA was transformed into chemically competent BL21 pLysS E.coli (Thermo) according to manufacturer instructions. Transformed bacteria were cultured overnight at 37.degree. C. in 10 mL 2.times.YT media (containing 100 .mu.g/mL ampicillin, 34 .mu.g/mL chloramphenicol and 2% (w/v) glucose). The overnight was diluted 1:10 in 2.times.YT media (containing 100 .mu.g/mL ampicillin, 34 .mu.g/mL chloramphenicol and 2% (w/v) glucose) and grown for 3 hours at 37.degree. C. Hereafter the culture was diluted 1:100 in 2.times.YT media (containing 100 .mu.g/mL ampicillin, 34 .mu.g/mL chloramphenicol) and grown at 37.degree. C. for 3 hours. When the bacteria reached OD600nm=0.6, protein production was induced by the addition of Isopropyl .beta.-D-1-thiogalactopyranoside (0.1 mM final concentration). Protein production was performed overnight at 24.degree. C. Bacteria were pelleted at 5000.times.g for 15 minutes and the supernatant was discarded. The bacteria pellet from 400 ml culture was resuspended in 25 mL dulbecco's phosphate buffer saline (PBS; 137 mM NaCl, 2.7mM KCl, 1.5 mM KH2PO4, 8.2 mM Na2HPO4, pH=7.4) and frozen at -20.degree. C.

Purification

[0146] The frozen bacteria were thawed at 37.degree. C. and pelleted at 10.000.times.g for 15 min by centrifugation. The supernatant was transferred to new tubes. 5 mL of Cobalt-sepharose beads (TALON Superflow, G&E Heatlhcare; 50% solution;) were washed by PBS according to manufacturer instructions, added to the supernatant and incubated for 2 hours at room temperature on a roller bench. The TALON was pelleted at 1000.times.g for 5 minutes by centrifugation. Supernatant was discarded and the pellets were dissolved in 20 mL of PBS. The TALON washing was repeated three times in total. After the last step, the TALON was dissolved in 8 mL of PBS and loaded into a PD-10 column. The column was rinsed with an excess of PBS. The column was eluted with Imidazole (150 mM in PBS) and 0.5 mL fractions were collected. Protein containing fraction were pooled and dialyzed overnight against HEPES-buffered saline (HBS: 10mM HEPES, 150 mM NaCl, pH=7.4) via a 3.500 MWCO dialysis membrane (3 RC tubing; Spectra/Por). Protein concentration was determined by absorption at 280 nm on the DeNovix Spectrophotometer (DS-11), where after the concentrations were corrected for their extinction coefficient (calculated via ProtParam). Purity was assessed by SDS-PAGE with Coomassie Page Blue staining.

Microthrombolysis of VWF-Platelet Agglutinates.

[0147] Blood platelets were isolated from citrated whole blood according to earlier described methods (Tersteeg et al., 2014, supra). Isolated blood platelets (200.000 /.mu.L) were incubated with VWF (5 .mu.g/mL), plasma-purified plasminogen (100 .mu.g/mL) and the aggregation inhibitors RGDW (200 .mu.M) and Iloprost (0.4 .mu.g/mL) for 15 minutes at 37.degree. C. in a light transmission aggregometer. Agglutination was induced by the addition of ristocetin (0.6 mg/mL). 6 minutes hereafter, the nanobody-mUPA constructs or Caplacizumab were added and lysis of the agglutinates was monitored overtime. For all samples, time points were determined by which 50% microthrombus degradation has occurred (graphic example of analytical method is shown in FIG. 8A). Results were processed in Graphpad Prism 7.02 and analyzed by one-way ANOVA (* P<0.05) and are shown in FIG. 10.

Results

[0148] Results are shown in FIG. 10 wherein it can be clearly seen that the targeting of plasminogen activation by at least the fusion proteins, D3-mUPA and GP1 B17-mUPA accelerates microthrombolysis as compared to the microthrombolysis induced by Caplacizumab.

TABLE-US-00006 TABLE 3 Description of the sequences SEQ ID NO: Seq name Sequence 1 hmUPA LKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLIS PCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSA DTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFG KENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKT DSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHTKEENGLAL 2 mmUPA QGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGS LISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQLILHEY YREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEITGF GKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEW KTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLD WIQSHIGEEKGLAF 3 secretion signal METDTLLLWVLLLWVPGSTGD peptide 4 2xSTREP GSSAWSHPQFEKGSSAWSHPQFEK 5 TEV EFENLYFQS 6 LINKER SAAGGGGSGGGGSAAA 7 sVWF-hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGRTFSSNAMGWFRQAPGKE REFVAAISWSGGSTYYLDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYY CAGSAGLGYVGDPDAMDYWGKGTQVTVSSSAAGGGGSGGGGSAAALK FQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 8 D3-hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGQTLSNYVMGWFRQAPGKE REFVAVISRVGGSTSYADSAKGRFTISRDNAKNTVYLQMNSLKPEDTAVYY CAAAYTIAVVTAMREYDFWGQGTQVTVSSSAAGGGGSGGGGSAAALKF QCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 9 R2-hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSQVQLQESGGGLVQAGGSLRLSCAASGRATSGHGHYGMGWFRQV PGKEREFVAAIRWSGKETWYKDSVKGRFTISRDNAKTTVYLQMNSLKPED TAVYYCAARPVRVDDISLPVGFDYWGQGTQVTVSSSAAGGGGSGGGGSA AALKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSL ISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYS ADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGF GKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQW KTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLP WIRSHTKEENGLAL 10 A11-hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSAVQLVESGGRLVKAGASLRLSCAASGRTFSSLPMAWFRQAPGKER EFVAFIGSDSSTLYTSSVRGRFTISRDNGKNTVYLQMMNLKPEDTAVYYCA ARSSAFSSGIYYREGSYAYWGQGTQVTVSSSAAGGGGSGGGGSAAALKF QCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 11 A12-hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSQVQLVESGGGLVQAGGSLRLSCTASGRTFSTYALGWFRQVPGKGR EFIAVIYWRDGSSLYSDSVKGRFTISKDNAKNTVYLQMNSLKPEDTAVYYC ANRHDSRGTYYSSRGYDYWGQGTQVTVSSSAAGGGGSGGGGSAAALKF QCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 12 GP1B-17 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASDIFSINAMGWYRQAPGKQRE LVASITRGGDPWYADSVKGRFTISRDGAKNARNTVYLQMNSLKPEDTAVY YCNAMGIRGSGGDYAREAGGQGTQVTVSSSAAGGGGSGGGGSAAALKF QCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 13 12A5 AVQLVESGGGLVQPGGSLRLSCLASGRIFSIGAMGMYRQAPGKQRELVAT ITSGGSTNYADPVKGRFTISRDGPKNTVYLQMNSLKPEDTAVYYCYANLKQ GSYGYRFNDYWGQGTQVTVSS 14 12A5H1 EVQLVESGGGLVQPGGSLRLSCAASGRIFSIGAMGMYRQAPGKGRELVAT ITSGGSTNYADPVKGRFTISRDGPKNTVYLQMNSLRAEDTAVYYCYANLKQ GSYGYRFNDYWGQGTQVTVSS 15 R2-mmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSQVQLQESGGGLVQAGGSLRLSCAASGRATSGHGHYGMGWFRQV PGKEREFVAAIRWSGKETWYKDSVKGRFTISRDNAKTTVYLQMNSLKPED TAVYYCAARPVRVDDISLPVGFDYWGQGTQVTVSSSAAGGGGSGGGGSA AAQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKC GGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQLIL HEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEI TGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADP EWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFL DWIQSHIGEEKGLAF 16 uPA connecting ADGKKPSSPPEELKFQCGQKTLRPRFK peptide 17 tPA connecting STCGLRQYSQPQFR peptide 18 Plasmin PSFDCGKPQVEPKKCPGR connecting peptide 19 tPA calatytic STCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILIS domain sequence SCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDD DTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGK HEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQ ANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVT NYLDWIRDNMRP 20 GPB1-1- hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVRQAPGKG LEWVSAINTGGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKSEDTAVYY CAKDLPNSDSLGYDYWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQCG QKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVIS ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHH NDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDY LYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGD SGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE ENGLAL 21 GPB1-2- hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLICVGSDRIFSNYSMGWFRQAPGKE RQFVSTISRHGTSTAYADSVRGRFTISRDNAENIVYLQMNSLEPEDTAVYYC AARPHTQHYVRVESYGVWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQ CGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWV ISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENST DYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQ GDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT KEENGLAL 22 GPB1-3- hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGSINSIRAMGWYRQPPGKQR ELVATITRDGRTNYPDSVKGQFTISIDNARNTVSLQRNSLKPEDTAVYYCVA DWGEGYLTRVWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQCGQKTL RPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHC FIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIA LLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPE QLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENG LAL 23 GPB1-4 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASETFSIRAMGWYRQAPGKQRE LVAYITSGGSTNYADSVKGRFTISRDNDRNTVSLQMNSLKPEDTAVYYCYQ APRSGYDPVYWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQCGQKTLR PRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFI DYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALL KIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQL KMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLV CSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL 24 GPB1-5 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASEFTFSKHWMYWVRQAPGKG LEWVSGINLGGDSTYYADSVKGRFTISRDNAKNTLYLQMDSLKSEDTAVYY CAKGASSWFGDFGSWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQCG QKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVIS ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHH NDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDY LYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGD SGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE ENGLAL 25 GPB1-6 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGFTFSNFAMNWVRQAPGKG LEWVSFINRGGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVY YCAKFSRSVPPYYGMDYWGKGTLVTVSSSAAGGGGSGGGGSAAALKFQC GQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVI SATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENST DYLYPEQLKMTVVKLISHRECQQPHYYGSEVITKMLCAADPQWKTDSCQ GDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT KEENGLAL 26 GPB1-7 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGRVDSMAWFRQAPGKEREF VATITWSDSKIYYADSVKGRFTISGERAKNTMYLQMNTLRPEDTAVYYCAA AHRPYRSGYYYMQSRYDYWGQGTQVTVSSSAAGGGGSGGGGSAAALKF QCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 27 GPB1-8 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAAPSMFSINAMGWYRQAPGRQR ELVATITSGDSTYYADSVKGRFTISRDNAKYTKNTVYLQMNSLKPEDTAVYY CNAAHIRGSGGDYAREAWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQ CGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWV ISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENST DYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQ GDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT KEENGLAL 28 GPB1-9 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGPTVSNYYMGWFRQAPGKE RDFVAGISRSGVEKYYADSVKGRFTISRDNALNTVYLQMNSLKPEDTAAYY CAARERVGITFAHSTVDYWGKGTLVTVSSSAAGGGGSGGGGSAAALKFQ CGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWV ISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENST DYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQ GDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT KEENGLAL 29 GPB1-10 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGFTFSKYGMSWVRQAPGKGL EWVSIIDSGGGAIGYADAVKGRFTISRDNVKNTLYLQMNSLKPEDTAVYHC VFGDYKGQGTQVTVSSSAAGGGGSGGGGSAAALKFQCGQKTLRPRFKIIG GEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKE DYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKE GRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTV VKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQ GRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL 30 GPB1-11 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMTWVRQAPGKGL EWVSAINSGGSGTRYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYY CAKRRDGQNWYPGISYESMYRGQGTQVTVSSSAAGGGGSGGGGSAAAL KFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISP CWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAD TLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWI R SHTKEENGLAL 31 GPB1-12 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN

LYFQSEVQLVESGGGLVQAGGSLRLSCAASGRTFSSYTMAWFRQAPGKER EFVGLISWNAKSTYVTDSVKGRFTITRENAKDMVYLQMNSLKPEDSATYYC AANRYGSSVPGAYNYWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQCG QKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVIS ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHH NDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDY LYPEQLKMTVVKLISHRECQQPHYYGSEVITKMLCAADPQWKTDSCQGD SGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE ENGLAL 32 GPB1-13 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGL EWVSAINMGGGSTYYADSVKGRFTISRDNAKNTLYLQMSGLKPEDTALYY CVRGGSAYSVRYEYAYWGQGTQVTVSSSAAGGGGSGGGGSAAALKFQC GQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVI SATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENST DYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQ GDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT KEENGLAL 33 GPB1-14 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAAAASWFSIYAMGWYRQAPGKQ RELVAIILSDGDTDYADSVKGRFTISRDNAKNTKNTVYLQMNSLKPEDTAV YYCNARGIRGSGGDYAREAWGQGTQVTVSSSAAGGGGSGGGGSAAALK FQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 34 GPB1-15 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGSMFSINDMGWYRQAPGK QRELVATITRGGNTYYADSVKGRFTISRDNATYTKNTVYLQMNSLKPEDTA VYYCNARHIRGSGGDYAREAWGQGTQVTVSSSAAGGGGSGGGGSAAAL KFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISP CWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAD TLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 35 GPB1-16 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASRRTFSNYVMGWFRQAPGKE RESVTAIGRSGTILYADSMKGRITISRDNAKNTVYLQMNSLTPDDTAVYYC AASSGSMQQFWRMEYDYEGQGTQVTVSSSAAGGGGSGGGGSAAALKF QCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC WVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADT LAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKE NSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDS CQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL 36 GPB1-19 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQAGGSLRLSCAASGRTFGSYVMGWFRQAPGKE REFVAAIGRSGTTYYLDSVKGRFTISRDNAKNTVYLQMNSLKSEDTAVYYC GASLKGTVLGIARYEYDVRGQGTQVTVSSSAAGGGGSGGGGSAAALKFQ CGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWV ISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENST DYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQ GDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT KEENGLAL 37 GPB1-20 hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGSVQAGGSLRLSCAASGRTLSSLAMGWFRQAPGKER EFVAADRRNGGYTVVADYTDSVKGRFTIFRDNAKNTVYLQMNNLKPEDT AVYYCAADSDRTMSLRSTDYDYWGQGTQVIVSSSAAGGGGSGGGGSAA ALKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLI SPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYS ADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGF GKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQW KTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLP WIRSHTKEENGLAL 38 Flexible linker KESGSVSSEQLAQFRSLD 39 Flexible linker EGKSSGSGSESKST 40 Caplacizumab GGATCCGAAGTCCAGCTTGTAGAATCAGGAGGAGGCCTTGTCCAGCCA double stranded GGTGGTAGCCTTCGTCTGTCGTGTGCTGCTTCGGGCCGCACATTTTCGT DNA fragment ATAACCCTATGGGTTGGTTTCGCCAAGCACCCGGCAAGGGACGCGAGT TGGTGGCCGCGATTAGTCGTACGGGTGGTTCCACCTACTACCCGGATTC AGTGGAAGGACGCTTTACGATTAGCCGTGATAACGCGAAGCGTATGGT CTACTTACAGATGAATAGCTTGCGCGCGGAAGACACCGCGGTATACTA TTGTGCTGCAGCAGGAGTCCGTGCTGAGGATGGACGCGTCCGCACGTT ACCTAGTGAGTATACATTCTGGGGCCAGGGCACCCAAGTTACCGTATCC AGTGCAGCAGCGGAAGTACAACTGGTCGAATCTGGAGGAGGACTTGT ACAACCAGGGGGTTCCTTACGTTTGTCATGTGCGGCAAGTGGGCGCAC ATTTAGTTACAACCCTATGGGCTGGTTCCGTCAAGCCCCGGGAAAAGG GCGCGAACTTGTAGCCGCCATTTCGCGTACAGGGGGAAGTACCTATTA CCCGGACTCAGTAGAGGGACGCTTCACGATTTCTCGTGACAACGCAAA GCGCATGGTTTATCTGCAAATGAATAGTTTACGCGCCGAAGATACAGC AGTTTACTATTGCGCCGCAGCTGGAGTCCGCGCCGAAGACGGCCGTGT ACGCACCTTGCCTTCTGAATACACTTTTTGGGGTCAAGGAACACAGGTG ACCGTGTCATCTGCGGCCGC 41 Caplacizumab in MKYLLPTAAAGLLLLAAQPAMAQSGHHHHHHHHDYDIPSSENLYFQGSE pTH4.0 protein VQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAA sequence ISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAG VRAEDGRVRTLPSEYTFWGQGTQVTVSSAAAEVQLVESGGGLVQPGGSL RLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYYPDSVEGRF TISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTF WGQGTQVTVSSAAAEQKLISEEDL 42 Primer Fw TAATACGACTCACTATAGGG 43 Primer Rv GCTAGTTATTGCTCAGCGG 44 Cablivi-hmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKG RELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYY CAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSSSAAGGGGSGGGGSAA ALKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLI SPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYS ADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGF GKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQW KTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLP WIRSHTKEENGLAL 45 Cablivi-mmUPA METDTLLLWVLLLWVPGSTGDGSSAWSHPQFEKGSSAWSHPQFEKEFEN LYFQSEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKG RELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYY CAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSSSAAGGGGSGGGGSAA AQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCG GSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQLIL 46 Cablivi EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVA AISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAA GVRAEDGRVRTLPSEYTFWGQGTQVTVSS

Sequence CWU 1

1

461268PRTArtificial SequencehmUPA 1Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile1 5 10 15Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala 20 25 30Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly 35 40 45Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile 50 55 60Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg65 70 75 80Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu 85 90 95Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp 100 105 110Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro 115 120 125Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro 130 135 140Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser145 150 155 160Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu 165 170 175Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val 180 185 190Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser 195 200 205Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg 210 215 220Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys225 230 235 240Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile 245 250 255Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 260 2652269PRTArtificial SequencemmUPA 2Gln Gly Phe Gln Cys Gly Gln Lys Ala Leu Arg Pro Arg Phe Lys Ile1 5 10 15Val Gly Gly Glu Phe Thr Glu Val Glu Asn Gln Pro Trp Phe Ala Ala 20 25 30Ile Tyr Gln Lys Asn Lys Gly Gly Ser Pro Pro Ser Phe Lys Cys Gly 35 40 45Gly Ser Leu Ile Ser Pro Cys Trp Val Ala Ser Ala Ala His Cys Phe 50 55 60Ile Gln Leu Pro Lys Lys Glu Asn Tyr Val Val Tyr Leu Gly Gln Ser65 70 75 80Lys Glu Ser Ser Tyr Asn Pro Gly Glu Met Lys Phe Glu Val Glu Gln 85 90 95Leu Ile Leu His Glu Tyr Tyr Arg Glu Asp Ser Leu Ala Tyr His Asn 100 105 110Asp Ile Ala Leu Leu Lys Ile Arg Thr Ser Thr Gly Gln Cys Ala Gln 115 120 125Pro Ser Arg Ser Ile Gln Thr Ile Cys Leu Pro Pro Arg Phe Thr Asp 130 135 140Ala Pro Phe Gly Ser Asp Cys Glu Ile Thr Gly Phe Gly Lys Glu Ser145 150 155 160Glu Ser Asp Tyr Leu Tyr Pro Lys Asn Leu Lys Met Ser Val Val Lys 165 170 175Leu Val Ser His Glu Gln Cys Met Gln Pro His Tyr Tyr Gly Ser Glu 180 185 190Ile Asn Tyr Lys Met Leu Cys Ala Ala Asp Pro Glu Trp Lys Thr Asp 195 200 205Ser Cys Lys Gly Asp Ser Gly Gly Pro Leu Ile Cys Asn Ile Glu Gly 210 215 220Arg Pro Thr Leu Ser Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Glu225 230 235 240Lys Asn Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Asp Trp 245 250 255Ile Gln Ser His Ile Gly Glu Glu Lys Gly Leu Ala Phe 260 265321PRTArtificial Sequencesecretion signal peptide 3Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp 20424PRTArtificial SequenceSTREP 4Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Gly Ser Ser Ala1 5 10 15Trp Ser His Pro Gln Phe Glu Lys 2059PRTArtificial SequenceTEV 5Glu Phe Glu Asn Leu Tyr Phe Gln Ser1 5616PRTArtificial Sequencelinker 6Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala1 5 10 157462PRTArtificial SequencesVWF-hmUPA 7Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Phe Ser Ser Asn Ala Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Phe Val Ala Ala Ile Ser Trp Ser Gly Gly Ser Thr 100 105 110Tyr Tyr Leu Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Gly Ser Ala Gly Leu Gly Tyr Val Gly145 150 155 160Asp Pro Asp Ala Met Asp Tyr Trp Gly Lys Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 4608462PRTArtificial SequenceD3-hmUPA 8Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Gln Thr Leu Ser Asn Tyr Val Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Phe Val Ala Val Ile Ser Arg Val Gly Gly Ser Thr 100 105 110Ser Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Ala Ala Tyr Thr Ile Ala Val Val Thr145 150 155 160Ala Met Arg Glu Tyr Asp Phe Trp Gly Gln Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 4609466PRTArtificial SequenceR2-hmUPA 9Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Gln Val Gln Leu Gln Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Ala Thr Ser Gly His Gly His Tyr Gly Met Gly Trp Phe Arg Gln 85 90 95Val Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Arg Trp Ser Gly 100 105 110Lys Glu Thr Trp Tyr Lys Asp Ser Val Lys Gly Arg Phe Thr Ile Ser 115 120 125Arg Asp Asn Ala Lys Thr Thr Val Tyr Leu Gln Met Asn Ser Leu Lys 130 135 140Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Arg Pro Val Arg Val145 150 155 160Asp Asp Ile Ser Leu Pro Val Gly Phe Asp Tyr Trp Gly Gln Gly Thr 165 170 175Gln Val Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly 180 185 190Gly Gly Ser Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu 195 200 205Arg Pro Arg Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn 210 215 220Gln Pro Trp Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val225 230 235 240Thr Tyr Val Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser 245 250 255Ala Thr His Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val 260 265 270Tyr Leu Gly Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys 275 280 285Phe Glu Val Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr 290 295 300Leu Ala His His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu305 310 315 320Gly Arg Cys Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro 325 330 335Ser Met Tyr Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly 340 345 350Phe Gly Lys Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys 355 360 365Met Thr Val Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His 370 375 380Tyr Tyr Gly Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro385 390 395 400Gln Trp Lys Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val 405 410 415Cys Ser Leu Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly 420 425 430Arg Gly Cys Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser 435 440 445His Phe Leu Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu 450 455 460Ala Leu46510464PRTArtificial SequenceA11-hmUPA 10Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Ala Val Gln Leu Val Glu Ser Gly Gly Arg 50 55 60Leu Val Lys Ala Gly Ala Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Phe Ser Ser Leu Pro Met Ala Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Phe Val Ala Phe Ile Gly Ser Asp Ser Ser Thr Leu 100 105 110Tyr Thr Ser Ser Val Arg Gly Arg Phe Thr Ile Ser Arg Asp Asn Gly 115 120 125Lys Asn Thr Val Tyr Leu Gln Met Met Asn Leu Lys Pro Glu Asp Thr 130 135 140Ala Val Tyr Tyr Cys Ala Ala Arg Ser Ser Ala Phe Ser Ser Gly Ile145 150 155 160Tyr Tyr Arg Glu Gly Ser Tyr Ala Tyr Trp Gly Gln Gly Thr Gln Val 165 170 175Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly 180 185 190Ser Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro 195 200 205Arg Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro 210 215 220Trp Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr225 230 235 240Val Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr 245 250 255His Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu 260 265 270Gly Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu 275 280 285Val Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala 290 295 300His His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg305 310 315 320Cys Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met 325 330 335Tyr Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly 340 345 350Lys Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr 355 360 365Val Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr 370 375 380Gly Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp385 390 395 400Lys Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser 405 410 415Leu Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly 420 425 430Cys Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr

Arg Val Ser His Phe 435 440 445Leu Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46011463PRTArtificial SequenceA12-hmUPA 11Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Gln Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly65 70 75 80Arg Thr Phe Ser Thr Tyr Ala Leu Gly Trp Phe Arg Gln Val Pro Gly 85 90 95Lys Gly Arg Glu Phe Ile Ala Val Ile Tyr Trp Arg Asp Gly Ser Ser 100 105 110Leu Tyr Ser Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Lys Asp Asn 115 120 125Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Asn Arg His Asp Ser Arg Gly Thr Tyr145 150 155 160Tyr Ser Ser Arg Gly Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr 165 170 175Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 180 185 190Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg 195 200 205Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp 210 215 220Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val225 230 235 240Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His 245 250 255Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly 260 265 270Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val 275 280 285Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His 290 295 300His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys305 310 315 320Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr 325 330 335Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys 340 345 350Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val 355 360 365Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly 370 375 380Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys385 390 395 400Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu 405 410 415Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys 420 425 430Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu 435 440 445Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46012462PRTArtificial SequenceGP1B-17 hmUPA 12Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Asp65 70 75 80Ile Phe Ser Ile Asn Ala Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys 85 90 95Gln Arg Glu Leu Val Ala Ser Ile Thr Arg Gly Gly Asp Pro Trp Tyr 100 105 110Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Gly Ala Lys 115 120 125Asn Ala Arg Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu 130 135 140Asp Thr Ala Val Tyr Tyr Cys Asn Ala Met Gly Ile Arg Gly Ser Gly145 150 155 160Gly Asp Tyr Ala Arg Glu Ala Gly Gly Gln Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46013122PRTArtificial Sequence12A5 13Ala Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Leu Ala Ser Gly Arg Ile Phe Ser Ile Gly 20 25 30Ala Met Gly Met Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val 35 40 45Ala Thr Ile Thr Ser Gly Gly Ser Thr Asn Tyr Ala Asp Pro Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Gly Pro Lys Asn Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Tyr 85 90 95Ala Asn Leu Lys Gln Gly Ser Tyr Gly Tyr Arg Phe Asn Asp Tyr Trp 100 105 110Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 12014122PRTArtificial Sequence12A5H1 14Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Ile Phe Ser Ile Gly 20 25 30Ala Met Gly Met Tyr Arg Gln Ala Pro Gly Lys Gly Arg Glu Leu Val 35 40 45Ala Thr Ile Thr Ser Gly Gly Ser Thr Asn Tyr Ala Asp Pro Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Gly Pro Lys Asn Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Tyr 85 90 95Ala Asn Leu Lys Gln Gly Ser Tyr Gly Tyr Arg Phe Asn Asp Tyr Trp 100 105 110Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 12015467PRTArtificial SequenceR2-mmUPA 15Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Gln Val Gln Leu Gln Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Ala Thr Ser Gly His Gly His Tyr Gly Met Gly Trp Phe Arg Gln 85 90 95Val Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Arg Trp Ser Gly 100 105 110Lys Glu Thr Trp Tyr Lys Asp Ser Val Lys Gly Arg Phe Thr Ile Ser 115 120 125Arg Asp Asn Ala Lys Thr Thr Val Tyr Leu Gln Met Asn Ser Leu Lys 130 135 140Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Arg Pro Val Arg Val145 150 155 160Asp Asp Ile Ser Leu Pro Val Gly Phe Asp Tyr Trp Gly Gln Gly Thr 165 170 175Gln Val Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly 180 185 190Gly Gly Ser Ala Ala Ala Gln Gly Phe Gln Cys Gly Gln Lys Ala Leu 195 200 205Arg Pro Arg Phe Lys Ile Val Gly Gly Glu Phe Thr Glu Val Glu Asn 210 215 220Gln Pro Trp Phe Ala Ala Ile Tyr Gln Lys Asn Lys Gly Gly Ser Pro225 230 235 240Pro Ser Phe Lys Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ala 245 250 255Ser Ala Ala His Cys Phe Ile Gln Leu Pro Lys Lys Glu Asn Tyr Val 260 265 270Val Tyr Leu Gly Gln Ser Lys Glu Ser Ser Tyr Asn Pro Gly Glu Met 275 280 285Lys Phe Glu Val Glu Gln Leu Ile Leu His Glu Tyr Tyr Arg Glu Asp 290 295 300Ser Leu Ala Tyr His Asn Asp Ile Ala Leu Leu Lys Ile Arg Thr Ser305 310 315 320Thr Gly Gln Cys Ala Gln Pro Ser Arg Ser Ile Gln Thr Ile Cys Leu 325 330 335Pro Pro Arg Phe Thr Asp Ala Pro Phe Gly Ser Asp Cys Glu Ile Thr 340 345 350Gly Phe Gly Lys Glu Ser Glu Ser Asp Tyr Leu Tyr Pro Lys Asn Leu 355 360 365Lys Met Ser Val Val Lys Leu Val Ser His Glu Gln Cys Met Gln Pro 370 375 380His Tyr Tyr Gly Ser Glu Ile Asn Tyr Lys Met Leu Cys Ala Ala Asp385 390 395 400Pro Glu Trp Lys Thr Asp Ser Cys Lys Gly Asp Ser Gly Gly Pro Leu 405 410 415Ile Cys Asn Ile Glu Gly Arg Pro Thr Leu Ser Gly Ile Val Ser Trp 420 425 430Gly Arg Gly Cys Ala Glu Lys Asn Lys Pro Gly Val Tyr Thr Arg Val 435 440 445Ser His Phe Leu Asp Trp Ile Gln Ser His Ile Gly Glu Glu Lys Gly 450 455 460Leu Ala Phe4651627PRTArtificial Sequencehuman uPA connecting peptide 16Ala Asp Gly Lys Lys Pro Ser Ser Pro Pro Glu Glu Leu Lys Phe Gln1 5 10 15Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys 20 251714PRTArtificial Sequencehuman tPA connecting peptide 17Ser Thr Cys Gly Leu Arg Gln Tyr Ser Gln Pro Gln Phe Arg1 5 101818PRTArtificial Sequencehuman plasminogen connecting peptide 18Pro Ser Phe Asp Cys Gly Lys Pro Gln Val Glu Pro Lys Lys Cys Pro1 5 10 15Gly Arg19266PRTArtificial SequencetPA catalytic domain 19Ser Thr Cys Gly Leu Arg Gln Tyr Ser Gln Pro Gln Phe Arg Ile Lys1 5 10 15Gly Gly Leu Phe Ala Asp Ile Ala Ser His Pro Trp Gln Ala Ala Ile 20 25 30Phe Ala Lys His Arg Arg Ser Pro Gly Glu Arg Phe Leu Cys Gly Gly 35 40 45Ile Leu Ile Ser Ser Cys Trp Ile Leu Ser Ala Ala His Cys Phe Gln 50 55 60Glu Arg Phe Pro Pro His His Leu Thr Val Ile Leu Gly Arg Thr Tyr65 70 75 80Arg Val Val Pro Gly Glu Glu Glu Gln Lys Phe Glu Val Glu Lys Tyr 85 90 95Ile Val His Lys Glu Phe Asp Asp Asp Thr Tyr Asp Asn Asp Ile Ala 100 105 110Leu Leu Gln Leu Lys Ser Asp Ser Ser Arg Cys Ala Gln Glu Ser Ser 115 120 125Val Val Arg Thr Val Cys Leu Pro Pro Ala Asp Leu Gln Leu Pro Asp 130 135 140Trp Thr Glu Cys Glu Leu Ser Gly Tyr Gly Lys His Glu Ala Leu Ser145 150 155 160Pro Phe Tyr Ser Glu Arg Leu Lys Glu Ala His Val Arg Leu Tyr Pro 165 170 175Ser Ser Arg Cys Thr Ser Gln His Leu Leu Asn Arg Thr Val Thr Asp 180 185 190Asn Met Leu Cys Ala Gly Asp Thr Arg Ser Gly Gly Pro Gln Ala Asn 195 200 205Leu His Asp Ala Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Leu 210 215 220Asn Asp Gly Arg Met Thr Leu Val Gly Ile Ile Ser Trp Gly Leu Gly225 230 235 240Cys Gly Gln Lys Asp Val Pro Gly Val Tyr Thr Lys Val Thr Asn Tyr 245 250 255Leu Asp Trp Ile Arg Asp Asn Met Arg Pro 260 26520459PRTArtificial SequenceGPB1-1 - hmUPA 20Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Phe Thr Phe Ser Ser Tyr Trp Met Tyr Trp Val Arg Gln Ala Pro Gly 85 90 95Lys Gly Leu Glu Trp Val Ser Ala Ile Asn Thr Gly Gly Gly Ser Thr 100 105 110Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Lys Ser Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Lys Asp Leu Pro Asn Ser Asp Ser Leu145 150 155 160Gly Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Ser 165 170 175Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala Leu 180 185 190Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile Ile 195 200 205Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala Ile 210 215 220Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly Ser225 230 235 240Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile Asp 245 250 255Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg Leu 260 265 270Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu Ile 275 280 285Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp Ile 290 295 300Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro Ser305 310 315 320Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro Gln 325 330 335Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser Thr 340 345 350Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu Ile 355 360 365Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val Thr 370 375 380Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser Cys385 390 395 400Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg Met 405 410 415Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys Asp 420 425

430Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile Arg 435 440 445Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 45521462PRTArtificial SequenceGPB1-2-hmUPA 21Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Thr Cys Val Gly Ser Asp65 70 75 80Arg Thr Phe Ser Asn Tyr Ser Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Gln Phe Val Ser Thr Ile Ser Arg His Gly Thr Ser Thr 100 105 110Ala Tyr Ala Asp Ser Val Arg Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Glu Asn Ile Val Tyr Leu Gln Met Asn Ser Leu Glu Pro Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Ala Arg Pro His Thr Gln His Tyr Val145 150 155 160Arg Val Glu Ser Tyr Gly Val Trp Gly Gln Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46022456PRTArtificial SequenceGPB1-3- hmUPA 22Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Ser Ile Asn Ser Ile Arg Ala Met Gly Trp Tyr Arg Gln Pro Pro Gly 85 90 95Lys Gln Arg Glu Leu Val Ala Thr Ile Thr Arg Asp Gly Arg Thr Asn 100 105 110Tyr Pro Asp Ser Val Lys Gly Gln Phe Thr Ile Ser Ile Asp Asn Ala 115 120 125Arg Asn Thr Val Ser Leu Gln Arg Asn Ser Leu Lys Pro Glu Asp Thr 130 135 140Ala Val Tyr Tyr Cys Val Ala Asp Trp Gly Glu Gly Tyr Leu Thr Arg145 150 155 160Val Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Ser Ala Ala Gly 165 170 175Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala Leu Lys Phe Gln 180 185 190Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile Ile Gly Gly Glu 195 200 205Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala Ile Tyr Arg Arg 210 215 220His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly Ser Leu Ile Ser225 230 235 240Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile Asp Tyr Pro Lys 245 250 255Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg Leu Asn Ser Asn 260 265 270Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu Ile Leu His Lys 275 280 285Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp Ile Ala Leu Leu 290 295 300Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro Ser Arg Thr Ile305 310 315 320Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro Gln Phe Gly Thr 325 330 335Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser Thr Asp Tyr Leu 340 345 350Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu Ile Ser His Arg 355 360 365Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val Thr Thr Lys Met 370 375 380Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser Cys Gln Gly Asp385 390 395 400Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg Met Thr Leu Thr 405 410 415Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys Asp Lys Pro Gly 420 425 430Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile Arg Ser His Thr 435 440 445Lys Glu Glu Asn Gly Leu Ala Leu 450 45523455PRTArtificial SequenceGPB1-4 hmUPA 23Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Glu65 70 75 80Thr Phe Ser Ile Arg Ala Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys 85 90 95Gln Arg Glu Leu Val Ala Tyr Ile Thr Ser Gly Gly Ser Thr Asn Tyr 100 105 110Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Asp Arg 115 120 125Asn Thr Val Ser Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala 130 135 140Val Tyr Tyr Cys Tyr Gln Ala Pro Arg Ser Gly Tyr Asp Pro Val Tyr145 150 155 160Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Ser Ala Ala Gly Gly 165 170 175Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala Leu Lys Phe Gln Cys 180 185 190Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile Ile Gly Gly Glu Phe 195 200 205Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala Ile Tyr Arg Arg His 210 215 220Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly Ser Leu Ile Ser Pro225 230 235 240Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile Asp Tyr Pro Lys Lys 245 250 255Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg Leu Asn Ser Asn Thr 260 265 270Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu Ile Leu His Lys Asp 275 280 285Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp Ile Ala Leu Leu Lys 290 295 300Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro Ser Arg Thr Ile Gln305 310 315 320Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro Gln Phe Gly Thr Ser 325 330 335Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser Thr Asp Tyr Leu Tyr 340 345 350Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu Ile Ser His Arg Glu 355 360 365Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val Thr Thr Lys Met Leu 370 375 380Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser Cys Gln Gly Asp Ser385 390 395 400Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg Met Thr Leu Thr Gly 405 410 415Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys Asp Lys Pro Gly Val 420 425 430Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile Arg Ser His Thr Lys 435 440 445Glu Glu Asn Gly Leu Ala Leu 450 45524458PRTArtificial SequenceGPB1-5 hmUPA 24Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Glu65 70 75 80Phe Thr Phe Ser Lys His Trp Met Tyr Trp Val Arg Gln Ala Pro Gly 85 90 95Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Leu Gly Gly Asp Ser Thr 100 105 110Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Leu Tyr Leu Gln Met Asp Ser Leu Lys Ser Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Lys Gly Ala Ser Ser Trp Phe Gly Asp145 150 155 160Phe Gly Ser Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Ser Ala 165 170 175Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala Leu Lys 180 185 190Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile Ile Gly 195 200 205Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala Ile Tyr 210 215 220Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly Ser Leu225 230 235 240Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile Asp Tyr 245 250 255Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg Leu Asn 260 265 270Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu Ile Leu 275 280 285His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp Ile Ala 290 295 300Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro Ser Arg305 310 315 320Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro Gln Phe 325 330 335Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser Thr Asp 340 345 350Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu Ile Ser 355 360 365His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val Thr Thr 370 375 380Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser Cys Gln385 390 395 400Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg Met Thr 405 410 415Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys Asp Lys 420 425 430Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile Arg Ser 435 440 445His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 45525460PRTArtificial SequenceGPB1-6 hmUPA 25Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Phe Thr Phe Ser Asn Phe Ala Met Asn Trp Val Arg Gln Ala Pro Gly 85 90 95Lys Gly Leu Glu Trp Val Ser Phe Ile Asn Arg Gly Gly Gly Ser Thr 100 105 110Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Lys Phe Ser Arg Ser Val Pro Pro Tyr145 150 155 160Tyr Gly Met Asp Tyr Trp Gly Lys Gly Thr Leu Val Thr Val Ser Ser 165 170 175Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala 180 185 190Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile 195 200 205Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala 210 215 220Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly225 230 235 240Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile 245 250 255Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg 260 265 270Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu 275 280 285Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp 290 295 300Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro305 310 315 320Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro 325 330 335Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser 340 345 350Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu 355 360 365Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val 370 375 380Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser385 390 395 400Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg 405 410 415Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys 420 425 430Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile 435 440 445Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46026462PRTArtificial SequenceGPB1 - 7 hmUPA 26Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Val Asp Ser Met Ala Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg 85 90 95Glu Phe Val Ala Thr Ile Thr Trp Ser Asp Ser Lys Ile Tyr Tyr Ala 100 105 110Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Gly Glu Arg Ala Lys Asn

115 120 125Thr Met Tyr Leu Gln Met Asn Thr Leu Arg Pro Glu Asp Thr Ala Val 130 135 140Tyr Tyr Cys Ala Ala Ala His Arg Pro Tyr Arg Ser Gly Tyr Tyr Tyr145 150 155 160Met Gln Ser Arg Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46027462PRTArtificial SequenceGPB1-8 hmUPA 27Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Pro Ser65 70 75 80Met Phe Ser Ile Asn Ala Met Gly Trp Tyr Arg Gln Ala Pro Gly Arg 85 90 95Gln Arg Glu Leu Val Ala Thr Ile Thr Ser Gly Asp Ser Thr Tyr Tyr 100 105 110Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 115 120 125Tyr Thr Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu 130 135 140Asp Thr Ala Val Tyr Tyr Cys Asn Ala Ala His Ile Arg Gly Ser Gly145 150 155 160Gly Asp Tyr Ala Arg Glu Ala Trp Gly Gln Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46028462PRTArtificial SequenceGPB1-9 hmUPA 28Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Pro Thr Val Ser Asn Tyr Tyr Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Asp Phe Val Ala Gly Ile Ser Arg Ser Gly Val Glu Lys 100 105 110Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Leu Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Ala Tyr Tyr Cys Ala Ala Arg Glu Arg Val Gly Ile Thr Phe145 150 155 160Ala His Ser Thr Val Asp Tyr Trp Gly Lys Gly Thr Leu Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410 415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46029450PRTArtificial SequenceGPB1-10 hmUPA 29Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Phe Thr Phe Ser Lys Tyr Gly Met Ser Trp Val Arg Gln Ala Pro Gly 85 90 95Lys Gly Leu Glu Trp Val Ser Ile Ile Asp Ser Gly Gly Gly Ala Ile 100 105 110Gly Tyr Ala Asp Ala Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Val Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Val Tyr His Cys Val Phe Gly Asp Tyr Lys Gly Gln Gly Thr145 150 155 160Gln Val Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly 165 170 175Gly Gly Ser Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu 180 185 190Arg Pro Arg Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn 195 200 205Gln Pro Trp Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val 210 215 220Thr Tyr Val Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser225 230 235 240Ala Thr His Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val 245 250 255Tyr Leu Gly Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys 260 265 270Phe Glu Val Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr 275 280 285Leu Ala His His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu 290 295 300Gly Arg Cys Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro305 310 315 320Ser Met Tyr Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly 325 330 335Phe Gly Lys Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys 340 345 350Met Thr Val Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His 355 360 365Tyr Tyr Gly Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro 370 375 380Gln Trp Lys Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val385 390 395 400Cys Ser Leu Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly 405 410 415Arg Gly Cys Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser 420 425 430His Phe Leu Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu 435 440 445Ala Leu 45030464PRTArtificial SequenceGPB1-11 hmUPA 30Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Phe Thr Phe Ser Ser Ser Ala Met Thr Trp Val Arg Gln Ala Pro Gly 85 90 95Lys Gly Leu Glu Trp Val Ser Ala Ile Asn Ser Gly Gly Ser Gly Thr 100 105 110Arg Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Lys Arg Arg Asp Gly Gln Asn Trp Tyr145 150 155 160Pro Gly Ile Ser Tyr Glu Ser Met Tyr Arg Gly Gln Gly Thr Gln Val 165 170 175Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly 180 185 190Ser Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro 195 200 205Arg Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro 210 215 220Trp Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr225 230 235 240Val Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr 245 250 255His Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu 260 265 270Gly Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu 275 280 285Val Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala 290 295 300His His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg305 310 315 320Cys Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met 325 330 335Tyr Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly 340 345 350Lys Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr 355 360 365Val Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr 370 375 380Gly Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp385 390 395 400Lys Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser 405 410 415Leu Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly 420 425 430Cys Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe 435 440 445Leu Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46031460PRTArtificial SequenceGPB1-12 hmUPA 31Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Phe Ser Ser Tyr Thr Met Ala Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Phe Val Gly Leu Ile Ser Trp Asn Ala Lys Ser Thr 100 105 110Tyr Val Thr Asp Ser Val Lys Gly Arg Phe Thr Ile Thr Arg Glu Asn 115 120 125Ala Lys Asp Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 130 135 140Ser Ala Thr Tyr Tyr Cys Ala Ala Asn Arg Tyr Gly Ser Ser Val Pro145 150 155 160Gly Ala Tyr Asn Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 165 170 175Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala 180 185 190Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile 195 200 205Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala 210 215 220Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly225 230 235 240Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile 245 250 255Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg 260 265 270Leu Asn Ser Asn Thr

Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu 275 280 285Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp 290 295 300Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro305 310 315 320Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro 325 330 335Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser 340 345 350Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu 355 360 365Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val 370 375 380Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser385 390 395 400Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg 405 410 415Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys 420 425 430Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile 435 440 445Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46032460PRTArtificial SequenceGPB1-13 hmUPA 32Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Phe Thr Phe Ser Ser Tyr Tyr Met Ser Trp Val Arg Gln Ala Pro Gly 85 90 95Lys Gly Leu Glu Trp Val Ser Ala Ile Asn Met Gly Gly Gly Ser Thr 100 105 110Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Asn Thr Leu Tyr Leu Gln Met Ser Gly Leu Lys Pro Glu Asp 130 135 140Thr Ala Leu Tyr Tyr Cys Val Arg Gly Gly Ser Ala Tyr Ser Val Arg145 150 155 160Tyr Glu Tyr Ala Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 165 170 175Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala Ala 180 185 190Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys Ile 195 200 205Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala Ala 210 215 220Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly Gly225 230 235 240Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe Ile 245 250 255Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser Arg 260 265 270Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn Leu 275 280 285Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn Asp 290 295 300Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln Pro305 310 315 320Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp Pro 325 330 335Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn Ser 340 345 350Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys Leu 355 360 365Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu Val 370 375 380Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp Ser385 390 395 400Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly Arg 405 410 415Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu Lys 420 425 430Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp Ile 435 440 445Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46033463PRTArtificial SequenceGPB1-14 hmUPA 33Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ala Ala65 70 75 80Ser Trp Phe Ser Ile Tyr Ala Met Gly Trp Tyr Arg Gln Ala Pro Gly 85 90 95Lys Gln Arg Glu Leu Val Ala Ile Ile Leu Ser Asp Gly Asp Thr Asp 100 105 110Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala 115 120 125Lys Asn Thr Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro 130 135 140Glu Asp Thr Ala Val Tyr Tyr Cys Asn Ala Arg Gly Ile Arg Gly Ser145 150 155 160Gly Gly Asp Tyr Ala Arg Glu Ala Trp Gly Gln Gly Thr Gln Val Thr 165 170 175Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 180 185 190Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg 195 200 205Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp 210 215 220Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val225 230 235 240Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His 245 250 255Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly 260 265 270Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val 275 280 285Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His 290 295 300His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys305 310 315 320Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr 325 330 335Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys 340 345 350Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val 355 360 365Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly 370 375 380Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys385 390 395 400Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu 405 410 415Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys 420 425 430Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu 435 440 445Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46034463PRTArtificial SequenceGPB1- 15 hmUPA 34Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Ser Met Phe Ser Ile Asn Asp Met Gly Trp Tyr Arg Gln Ala Pro Gly 85 90 95Lys Gln Arg Glu Leu Val Ala Thr Ile Thr Arg Gly Gly Asn Thr Tyr 100 105 110Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala 115 120 125Thr Tyr Thr Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro 130 135 140Glu Asp Thr Ala Val Tyr Tyr Cys Asn Ala Arg His Ile Arg Gly Ser145 150 155 160Gly Gly Asp Tyr Ala Arg Glu Ala Trp Gly Gln Gly Thr Gln Val Thr 165 170 175Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 180 185 190Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg 195 200 205Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp 210 215 220Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val225 230 235 240Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His 245 250 255Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly 260 265 270Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val 275 280 285Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His 290 295 300His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys305 310 315 320Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr 325 330 335Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys 340 345 350Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val 355 360 365Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly 370 375 380Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys385 390 395 400Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu 405 410 415Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys 420 425 430Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu 435 440 445Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46035461PRTArtificial SequenceGPB1- 16 hmUPA 35Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Arg65 70 75 80Arg Thr Phe Ser Asn Tyr Val Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Ser Val Thr Ala Ile Gly Arg Ser Gly Thr Ile Leu 100 105 110Tyr Ala Asp Ser Met Lys Gly Arg Ile Thr Ile Ser Arg Asp Asn Ala 115 120 125Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Thr Pro Asp Asp Thr 130 135 140Ala Val Tyr Tyr Cys Ala Ala Ser Ser Gly Ser Met Gln Gln Phe Trp145 150 155 160Arg Met Glu Tyr Asp Tyr Glu Gly Gln Gly Thr Gln Val Thr Val Ser 165 170 175Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ala 180 185 190Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe Lys 195 200 205Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe Ala 210 215 220Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys Gly225 230 235 240Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys Phe 245 250 255Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg Ser 260 265 270Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu Asn 275 280 285Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His Asn 290 295 300Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala Gln305 310 315 320Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn Asp 325 330 335Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu Asn 340 345 350Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val Lys 355 360 365Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser Glu 370 375 380Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr Asp385 390 395 400Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln Gly 405 410 415Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala Leu 420 425 430Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro Trp 435 440 445Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46036462PRTArtificial SequenceGPB1- 19 hmUPA 36Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Phe Gly Ser Tyr Val Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Phe Val Ala Ala Ile Gly Arg Ser Gly Thr Thr Tyr 100 105 110Tyr Leu Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala 115 120 125Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Ser Glu Asp Thr 130 135 140Ala Val Tyr Tyr Cys Gly Ala Ser Leu Lys Gly Thr Val Leu Gly Ile145 150 155 160Ala Arg Tyr Glu Tyr Asp Val Arg Gly Gln Gly Thr Gln Val Thr Val 165 170 175Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala 180 185 190Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg Pro Arg Phe 195 200 205Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln Pro Trp Phe 210 215 220Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr Tyr Val Cys225 230 235 240Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala Thr His Cys 245 250 255Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr Leu Gly Arg 260 265 270Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe Glu Val Glu 275 280 285Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu Ala His His 290 295 300Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly Arg Cys Ala305 310 315 320Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser Met Tyr Asn 325 330 335Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe Gly Lys Glu 340 345 350Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met Thr Val Val 355 360 365Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr Tyr Gly Ser 370 375 380Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln Trp Lys Thr385 390 395 400Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys Ser Leu Gln 405 410

415Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg Gly Cys Ala 420 425 430Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His Phe Leu Pro 435 440 445Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala Leu 450 455 46037465PRTArtificial SequenceGPB1- 20 hmUPA 37Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Leu Ser Ser Leu Ala Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Glu Arg Glu Phe Val Ala Ala Asp Arg Arg Asn Gly Gly Tyr Thr 100 105 110Val Val Ala Asp Tyr Thr Asp Ser Val Lys Gly Arg Phe Thr Ile Phe 115 120 125Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Asn Leu Lys 130 135 140Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Asp Ser Asp Arg Thr145 150 155 160Met Ser Leu Arg Ser Thr Asp Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 165 170 175Val Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly Gly 180 185 190Gly Ser Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu Arg 195 200 205Pro Arg Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn Gln 210 215 220Pro Trp Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val Thr225 230 235 240Tyr Val Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser Ala 245 250 255Thr His Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val Tyr 260 265 270Leu Gly Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys Phe 275 280 285Glu Val Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr Leu 290 295 300Ala His His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu Gly305 310 315 320Arg Cys Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro Ser 325 330 335Met Tyr Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly Phe 340 345 350Gly Lys Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys Met 355 360 365Thr Val Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His Tyr 370 375 380Tyr Gly Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro Gln385 390 395 400Trp Lys Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val Cys 405 410 415Ser Leu Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly Arg 420 425 430Gly Cys Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser His 435 440 445Phe Leu Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu Ala 450 455 460Leu4653818PRTArtificial Sequenceflexible linker 38Lys Glu Ser Gly Ser Val Ser Ser Glu Gln Leu Ala Gln Phe Arg Ser1 5 10 15Leu Asp3914PRTArtificial Sequenceflexible linker 39Glu Gly Lys Ser Ser Gly Ser Gly Ser Glu Ser Lys Ser Thr1 5 1040791DNAArtificial SequencedsDNA 40ggatccgaag tccagcttgt agaatcagga ggaggccttg tccagccagg tggtagcctt 60cgtctgtcgt gtgctgcttc gggccgcaca ttttcgtata accctatggg ttggtttcgc 120caagcacccg gcaagggacg cgagttggtg gccgcgatta gtcgtacggg tggttccacc 180tactacccgg attcagtgga aggacgcttt acgattagcc gtgataacgc gaagcgtatg 240gtctacttac agatgaatag cttgcgcgcg gaagacaccg cggtatacta ttgtgctgca 300gcaggagtcc gtgctgagga tggacgcgtc cgcacgttac ctagtgagta tacattctgg 360ggccagggca cccaagttac cgtatccagt gcagcagcgg aagtacaact ggtcgaatct 420ggaggaggac ttgtacaacc agggggttcc ttacgtttgt catgtgcggc aagtgggcgc 480acatttagtt acaaccctat gggctggttc cgtcaagccc cgggaaaagg gcgcgaactt 540gtagccgcca tttcgcgtac agggggaagt acctattacc cggactcagt agagggacgc 600ttcacgattt ctcgtgacaa cgcaaagcgc atggtttatc tgcaaatgaa tagtttacgc 660gccgaagata cagcagttta ctattgcgcc gcagctggag tccgcgccga agacggccgt 720gtacgcacct tgccttctga atacactttt tggggtcaag gaacacaggt gaccgtgtca 780tctgcggccg c 79141320PRTArtificial SequenceCaplacizumab in pTH4.0 protein sequence 41Met Lys Tyr Leu Leu Pro Thr Ala Ala Ala Gly Leu Leu Leu Leu Ala1 5 10 15Ala Gln Pro Ala Met Ala Gln Ser Gly His His His His His His His 20 25 30His Asp Tyr Asp Ile Pro Ser Ser Glu Asn Leu Tyr Phe Gln Gly Ser 35 40 45Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 50 55 60Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Tyr Asn65 70 75 80Pro Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Leu Val 85 90 95Ala Ala Ile Ser Arg Thr Gly Gly Ser Thr Tyr Tyr Pro Asp Ser Val 100 105 110Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Arg Met Val Tyr 115 120 125Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 130 135 140Ala Ala Ala Gly Val Arg Ala Glu Asp Gly Arg Val Arg Thr Leu Pro145 150 155 160Ser Glu Tyr Thr Phe Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 165 170 175Ala Ala Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 180 185 190Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe 195 200 205Ser Tyr Asn Pro Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg 210 215 220Glu Leu Val Ala Ala Ile Ser Arg Thr Gly Gly Ser Thr Tyr Tyr Pro225 230 235 240Asp Ser Val Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Arg 245 250 255Met Val Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 260 265 270Tyr Tyr Cys Ala Ala Ala Gly Val Arg Ala Glu Asp Gly Arg Val Arg 275 280 285Thr Leu Pro Ser Glu Tyr Thr Phe Trp Gly Gln Gly Thr Gln Val Thr 290 295 300Val Ser Ser Ala Ala Ala Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu305 310 315 3204220DNAArtificial Sequenceprimer 42taatacgact cactataggg 204319DNAArtificial Sequenceprimer Rv 43gctagttatt gctcagcgg 1944466PRTArtificial SequenceCablivi-hmUPA 44Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Phe Ser Tyr Asn Pro Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Gly Arg Glu Leu Val Ala Ala Ile Ser Arg Thr Gly Gly Ser Thr 100 105 110Tyr Tyr Pro Asp Ser Val Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Arg Met Val Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Ala Ala Gly Val Arg Ala Glu Asp Gly145 150 155 160Arg Val Arg Thr Leu Pro Ser Glu Tyr Thr Phe Trp Gly Gln Gly Thr 165 170 175Gln Val Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly 180 185 190Gly Gly Ser Ala Ala Ala Leu Lys Phe Gln Cys Gly Gln Lys Thr Leu 195 200 205Arg Pro Arg Phe Lys Ile Ile Gly Gly Glu Phe Thr Thr Ile Glu Asn 210 215 220Gln Pro Trp Phe Ala Ala Ile Tyr Arg Arg His Arg Gly Gly Ser Val225 230 235 240Thr Tyr Val Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ile Ser 245 250 255Ala Thr His Cys Phe Ile Asp Tyr Pro Lys Lys Glu Asp Tyr Ile Val 260 265 270Tyr Leu Gly Arg Ser Arg Leu Asn Ser Asn Thr Gln Gly Glu Met Lys 275 280 285Phe Glu Val Glu Asn Leu Ile Leu His Lys Asp Tyr Ser Ala Asp Thr 290 295 300Leu Ala His His Asn Asp Ile Ala Leu Leu Lys Ile Arg Ser Lys Glu305 310 315 320Gly Arg Cys Ala Gln Pro Ser Arg Thr Ile Gln Thr Ile Cys Leu Pro 325 330 335Ser Met Tyr Asn Asp Pro Gln Phe Gly Thr Ser Cys Glu Ile Thr Gly 340 345 350Phe Gly Lys Glu Asn Ser Thr Asp Tyr Leu Tyr Pro Glu Gln Leu Lys 355 360 365Met Thr Val Val Lys Leu Ile Ser His Arg Glu Cys Gln Gln Pro His 370 375 380Tyr Tyr Gly Ser Glu Val Thr Thr Lys Met Leu Cys Ala Ala Asp Pro385 390 395 400Gln Trp Lys Thr Asp Ser Cys Gln Gly Asp Ser Gly Gly Pro Leu Val 405 410 415Cys Ser Leu Gln Gly Arg Met Thr Leu Thr Gly Ile Val Ser Trp Gly 420 425 430Arg Gly Cys Ala Leu Lys Asp Lys Pro Gly Val Tyr Thr Arg Val Ser 435 440 445His Phe Leu Pro Trp Ile Arg Ser His Thr Lys Glu Glu Asn Gly Leu 450 455 460Ala Leu46545297PRTArtificial SequenceCablivi-mmUPA 45Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro1 5 10 15Gly Ser Thr Gly Asp Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu 20 25 30Lys Gly Ser Ser Ala Trp Ser His Pro Gln Phe Glu Lys Glu Phe Glu 35 40 45Asn Leu Tyr Phe Gln Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 50 55 60Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly65 70 75 80Arg Thr Phe Ser Tyr Asn Pro Met Gly Trp Phe Arg Gln Ala Pro Gly 85 90 95Lys Gly Arg Glu Leu Val Ala Ala Ile Ser Arg Thr Gly Gly Ser Thr 100 105 110Tyr Tyr Pro Asp Ser Val Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn 115 120 125Ala Lys Arg Met Val Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp 130 135 140Thr Ala Val Tyr Tyr Cys Ala Ala Ala Gly Val Arg Ala Glu Asp Gly145 150 155 160Arg Val Arg Thr Leu Pro Ser Glu Tyr Thr Phe Trp Gly Gln Gly Thr 165 170 175Gln Val Thr Val Ser Ser Ser Ala Ala Gly Gly Gly Gly Ser Gly Gly 180 185 190Gly Gly Ser Ala Ala Ala Gln Gly Phe Gln Cys Gly Gln Lys Ala Leu 195 200 205Arg Pro Arg Phe Lys Ile Val Gly Gly Glu Phe Thr Glu Val Glu Asn 210 215 220Gln Pro Trp Phe Ala Ala Ile Tyr Gln Lys Asn Lys Gly Gly Ser Pro225 230 235 240Pro Ser Phe Lys Cys Gly Gly Ser Leu Ile Ser Pro Cys Trp Val Ala 245 250 255Ser Ala Ala His Cys Phe Ile Gln Leu Pro Lys Lys Glu Asn Tyr Val 260 265 270Val Tyr Leu Gly Gln Ser Lys Glu Ser Ser Tyr Asn Pro Gly Glu Met 275 280 285Lys Phe Glu Val Glu Gln Leu Ile Leu 290 29546128PRTArtificial SequenceCablivi VHH 46Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Tyr Asn 20 25 30Pro Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Gly Arg Glu Leu Val 35 40 45Ala Ala Ile Ser Arg Thr Gly Gly Ser Thr Tyr Tyr Pro Asp Ser Val 50 55 60Glu Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Arg Met Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ala Gly Val Arg Ala Glu Asp Gly Arg Val Arg Thr Leu Pro 100 105 110Ser Glu Tyr Thr Phe Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 125

Claims

1.-9. (canceled)

10. A method for treating or reducing the risk of microvascular thrombosis, wherein the method comprises the step of administering to a subject in need thereof a fusion protein comprising a plasminogen activator and a targeting agent for targeting the plasminogen activator to a site of a thrombus comprising al least one of VWF and platelets, wherein the targeting agent is not a targeting agent that specifically binds to only the activated form of the GPIIb/IIIa receptor on platelets, for use in the prevention or treatment of microvascular thrombosis.

11. The method of claim 10, wherein the microvascular thrombosis is treated or the risk of its occurrence is reduced in a disease or condition selected from the group consisting of: acquired or hereditary thrombotic thrombocytopenic purpura (TTP) complement-mediated thrombotic microangiopathy, haemolytic uremic syndrome, antiphospholipid antibody syndrome, non-occlusive thrombus, the formation of an occlusive thrombus, arterial thrombus formation, acute coronary occlusion, peripheral arterial occlusive disease, restenosis and disorders arising from coronary by-pass graft, coronary artery valve replacement and coronary interventions such angioplasty, stenting or atherectomy, hyperplasia after angioplasty, atherectomy or arterial stenting, occlusive syndrome in a vascular system or lack of patency of diseased arteries, transient cerebral ischemic attack, unstable or stable angina pectoris, cerebral infarction, HELLP syndrome, carotid endarterectomy, carotid artery stenosis, critical limb ischemia, cardioembolism, peripheral vascular disease, restenosis, sickle cell disease and myocardial infarct.

12. A fusion protein comprising a plasminogen activator and a targeting agent for targeting the plasminogen activator to a site of a thrombus comprising at least one of VWF and platelets, wherein the targeting agent is one or more of: a) a targeting agent that at least binds unfolded VWF, wherein preferably the targeting agent preferentially binds unfolded VWF over globular VWF; b) a targeting agent that binds the D3 domain of VWF; c) a targeting agent that binds integrin allb/(3III on platelets; d) a targeting agent that binds to a receptor that is preferentially expressed by activated endothelium, wherein preferably the receptor is selected form the group consisting of E-selectin, P-selectin, uPAR, c1q receptor, kinin B1 receptor, plasminogen receptor KT (PLGR-KT), endothelial protein C receptor, thrombomodulin, n-cadherin, ICAM-1 and VCAM-1; and, e) a targeting agent that binds to a membrane marker for activated or injured endothelium, wherein the membrane marker is one or more of anionic phospholipids, phosphatidylserine and phosphatidylethanolamine.

13. A fusion protein according to claim 12, wherein the fusion protein comprises more than one targeting agent.

14. A fusion protein according to claim 12, wherein the targeting agent comprises at least one of: a) an antibody variable domain that specifically binds to at least one of VWF, platelets, and activated vascular endothelium; and, b) a binding domain from a protein that naturally binds VWF, platelets and activated or injured vascular endothelium, which binding domain specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium.

15. A fusion protein according to claim 14, wherein the antibody variable domain is a VHH, preferably a humanized VHH, or wherein the binding domain comprises a binding domain selected from the group consisting of: i) a VWF-binding domain from one of ADAMTS13, Factor XII, Factor H (complement regulator), plasminogen and Factor VIII; and, ii) a membrane binding domain selected from the vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain, the C-domain from factor V and the C-domain from factor VIII.

16. A fusion protein according to claim 12, wherein the plasminogen activator comprises the protease domain of tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), plasminogen, streptokinase or staphylokinase, wherein preferably the plasminogen activator further comprises at least the cysteine-containing part of the connecting peptide that naturally occurs in the plasminogen activator immediately upstream of its protease domain, and wherein the fusion protein optionally comprises a linker amino acid sequence linking the targeting agent and the plasminogen activator.

17. A fusion protein according to claim 16, wherein the fusion protein comprises in a N- to C-terminal order: a) one or more targeting agents wherein the targeting agent is one or more of: a targeting agent that at least hinds unfolded VWP, wherein preferably the targeting agent preferentially binds unfolded VWF over globular VWF; ii) a targeting agent that binds the D3 domain of VWF; ill) a targeting agent that binds integrin .alpha.IIb/.beta.III on platelets; iv) a targeting agent that binds io a receptor that is preferentially expressed by activated endothelium, wherein preferably the receptor is selected form the groan consisting of E-selection, P-selection, uPAR, c1q receptor, kinin B1 receptor, plasminogen receptor KT (PLGR-KT), endothelial protein C receptor thrombomodulin, n-cadherin, ICAM-1 and VCAM-1; and, v) a targeting agent that binds to a membrane marker for activated or injured endothelium, wherein the membrane marker is one or more of anionic phospholipids, phosphatidylserine and phosphatldylethanoiamine, whereby, optionally the targeting agents are linked by linker amino acid sequences; b) optionally a linker amino acid sequence; and, c) the plasminogen activator or plasminogen-derived protease domain.

18. A nucleic acid molecule comprising a nucleotide sequence encoding a fusion protein as defined claim 12, wherein the nucleotide sequence encoding the fusion protein further preferably comprises a nucleotide sequence encoding a signal peptide operably linked to the fusion protein, and wherein nucleic acid molecule further preferably comprises regulatory elements conducive to the expression of the fusion protein, which regulatory elements are operably linked to the nucleotide sequence.

19.-20. (canceled)

21. The method of claim 10, wherein the targeting agent specifically binds to at least one of VWF, platelets and activated or injured vascular endothelium.

22. The method of claim 10, wherein the targeting agent is one or more of; a) a targeting, agent that at least binds unfolded VWF, wherein preferably the targeting agent preferentially binds unfolded VWF over globular VWF. b) a targeting agent that binds the D3 domain of VWF; c) a targeting agent that binds the GP1B receptor on platelets, d) a targeting agent that binds integrin .alpha.IIb/.beta.III on platelets; e) a targeting agent that binds to a receptor that is preferentially expressed by activated endothelium, wherein preferably the receptor is selected from the group consisting of E-setecan, P-selectin, uPAR, c1q receptor, thrombomodulin, n-cadherin, ICAM-1 and VCAM-1; and, f) a targeting agent that binds to a membrane marker for activated or injured endothelium, wherein the membrane marker is one or more of anionic phospholipids, phosphatidylserine and phosphatidylethanolamine.

23. The method of claim 10, wherein the fusion protein comprises more than one targeting agent.

24. The method of claim 10, wherein the targeting agent comprises at least one of: a) ao antibody variable domain that specifically binds to at least one of VWF, platelets, and activated vascular endothelium; and, b) a binding domain from a protein that naturally binds VWF, platelets and activated or injured vascular endothelium, which binding domain specifically binds to at least one of VWF, platelets, and activated or injured vascular endothelium.

25. The method of claim 24, wherein the antibody variable domain is a VHH, preferably a humanized VHH, or wherein the binding domain comprises a binding domain selected front the group consisting of: i) the platelet GP1B receptor-binding A1 domain from VWF; ii) a VWF-binding domain from one of ADAMTS13, Factor XII, Factor H (complement regulator), plasminogen and Factor VIII, and, iii) a membrane binding domain selected from the vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain, the C-domain from factor V and the C-domain from factor VIII.

26. The method of claim 10, wherein the plasminogen activator comprises the protease domain of tissue plasminogen activator ((PAT urokinase plasminogen activator (nPA), plasminogen, streptokinase or staphylokinase, wherein preferably the plasminogen activator further comprises at least the cysteine-containing part of the connecting peptide that naturally occurs in the plasminogen activator immediately upstream of its protease domain, and wherein the fusion protein optionally comprises a linker amino acid sequence linking the targeting agent and the plasminogen activator

27. The method of claim 26. wherein the fusion protein comprises in a N- to C-terminal order; a) the one or more targeting agents, whereby, optionally the targeting agents axe linked by linker amino acid sequences; b) optionally a linker amino acid sequence; and, c) the plasminogen activator or plasminogen-derived protease domain.

Images