U.S. patent application number 16/716033 was filed with the patent office on 2020-12-10 for modified friedreich ataxia genes and vectors for gene therapy.
The applicant listed for this patent is Bamboo Therapeutics, Inc.. Invention is credited to Richard J. Samulski.
Application Number | 20200384073 16/716033 |
Document ID | / |
Family ID | 1000005039015 |
Filed Date | 2020-12-10 |
United States Patent
Application |
20200384073 |
Kind Code |
A1 |
Samulski; Richard J. |
December 10, 2020 |
MODIFIED FRIEDREICH ATAXIA GENES AND VECTORS FOR GENE THERAPY
Abstract
The present invention relates to a modified FXN gene providing
for increased expression of the encoded protein frataxin that can
be used for treatment of Friedreich ataxia.
Inventors: |
Samulski; Richard J.;
(Chapel Hill, NC) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Bamboo Therapeutics, Inc. |
Chapel Hill |
NC |
US |
|
|
Family ID: |
1000005039015 |
Appl. No.: |
16/716033 |
Filed: |
December 16, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15340721 |
Nov 1, 2016 |
10548947 |
|
|
16716033 |
|
|
|
|
62411980 |
Oct 24, 2016 |
|
|
|
62251288 |
Nov 5, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 48/00 20130101;
C12N 7/00 20130101; A61K 38/1709 20130101; A61K 48/0075 20130101;
C07K 14/47 20130101; A61K 35/76 20130101; C12N 2800/22 20130101;
C12N 2750/14143 20130101 |
International
Class: |
A61K 38/17 20060101
A61K038/17; A61K 48/00 20060101 A61K048/00; A61K 35/76 20060101
A61K035/76; C07K 14/47 20060101 C07K014/47; C12N 7/00 20060101
C12N007/00 |
Claims
1-33. (canceled)
34. A modified nucleic acid encoding frataxin (FXN), wherein the
FXN comprises the amino acid sequence of SEQ ID NO:1, wherein the
modified nucleic acid is expressed at a greater level compared with
the level of expression of the wild type FXN nucleic acid sequence
of SEQ ID NO:2 in an otherwise identical cell, and wherein the
modified nucleic acid comprises the nucleic acid sequence of SEQ ID
NO:5.
35. The modified nucleic acid of claim 34, wherein the nucleic acid
comprises a GC content of at least 61%, a number of CpG
dinucleotides not greater than 117, and a codon adaptation index
(CAI) of at least 0.95.
36. A recombinant expression vector comprising the modified nucleic
acid encoding FXN of claim 34.
37. The recombinant expression vector of claim 36, wherein the
vector is a recombinant adeno-associated virus (rAAV) vector and
the modified nucleic acid encoding FXN is self-complementary.
38. The recombinant expression vector of claim 36, wherein the
vector is a recombinant adeno-associated virus (rAAV) vector.
39. A recombinant adeno-associated virus (rAAV) vector comprising
the modified nucleic acid of claim 34, and a capsid selected from
the group consisting of a capsid of AAV serotype AAV1, AAV2, AAV3,
AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAVrh10,
AAVrh74, RHM4-1, RHM15-1, RHM15-2, RHM15-3/RHM15-5, RHM15-4,
RHM15-6, AAVHu.26, AAV1.1, AAV2.5, AAV6.1, AAV6.3.1, AAV9.45,
AAV2i8, AAV2G9, AAV2i8G9, AAV2-TT, AAV2-TT-S312N, AAV3B-S312N, and
AAV-LK03.
40. The rAAV vector of claim 39, wherein the capsid is selected
from the group consisting of a capsid of AAV serotype AAV2i8, AAV9,
AAV-LK03 and AAV2-TT-S312N.
41. The rAAV vector of claim 39, wherein the modified nucleic acid
further comprises at least one element selected from the group
consisting of at least one adeno-associated virus (AAV) terminal
repeat sequence, an enhancer, a promoter, a collagen stabilizing
sequence (CSS), a stop codon, and a poly-adenylation (polyA) signal
sequence.
42. The rAAV vector of claim 41, wherein the rAAV vector comprises
two AAV terminal repeat sequences, a cytomegalovirus
enhancer/chicken beta actin (CBh) promoter, a CSS, and a bovine
growth hormone poly-adenylation signal sequence (bGHpolyA).
43. An rAAV vector comprising a nucleic acid comprising from 5' to
3': (a) an AAV2 terminal repeat; (b) a CBh promoter comprising the
nucleic acid sequence of SEQ ID NO:26; (c) a modified nucleic acid
encoding frataxin (FXN) comprising the nucleic acid sequence of SEQ
ID NO:5; (d) a CSS comprising the nucleic acid sequence of SEQ ID
NO:25; (e) a bGHpolyA signal sequence comprising the nucleic acid
sequence of SEQ ID NO:27; and (f) an AAV2 terminal repeat.
44. The rAAV vector of claim 43, further comprising an AAV2i8
capsid wherein the VP1 comprises the amino acid sequence of SEQ ID
NO:29, and wherein the vector comprises a nucleic acid comprising
from 5' to 3': (a) an AAV2 terminal repeat; (b) a CBh promoter
comprising the nucleic acid sequence of SEQ ID NO:26; (c) a
modified nucleic acid encoding FXN comprising the nucleic acid
sequence of SEQ ID NO:5; (d) a CSS comprising the nucleic acid
sequence of SEQ ID NO: 25; (e) a bGHpolyA signal sequence
comprising the nucleic acid sequence of SEQ ID NO:27; and (f) an
AAV2 terminal repeat.
45. The rAAV vector of claim 43, further comprising an
AAV2-TT-S312N capsid wherein the VP1 comprises the amino acid
sequence of SEQ ID NO:33, and wherein the vector comprises a
nucleic acid comprising from 5' to 3': (a) an AAV2 terminal repeat;
(b) a CBh promoter comprising the nucleic acid sequence of SEQ ID
NO:26; (c) a modified nucleic acid encoding FXN comprising the
nucleic acid sequence of SEQ ID NO:5; (d) a CSS comprising the
nucleic acid sequence of SEQ ID NO:25; (e) a bGHpolyA signal
sequence comprising the nucleic acid sequence of SEQ ID NO:27; and
(f) an AAV2 terminal repeat.
46. An rAAV vector for treating Friedreich ataxia (FRDA) in a
patient in need thereof, wherein the vector comprises a modified
nucleic acid encoding frataxin (FXN) comprising the nucleic acid
sequence of SEQ ID NO:5.
47. A pharmaceutical composition comprising the rAAV vector of
claim 46, and a pharmaceutically acceptable carrier.
48. A method of treating FRDA in a mammal, the method comprising
administering a therapeutically effective amount of the rAAV vector
of claim 46.
49. The method of claim 48, wherein the rAAV vector is administered
systemically, by direct cardiac administration or by intracranial
administration.
50. The method of claim 49, wherein the systemic administration is
intravenous administration.
51. The method of claim 49, wherein the rAAV vector is administered
directly into the heart.
52. The method of claim 49, wherein the rAAV vector is administered
intracranially.
53. A method of treating a disease, disorder or condition mediated
by a decreased level of FXN in a mammal, the method comprising
administering a therapeutically effective amount of the rAAV vector
of claim 46.
54. An isolated host cell comprising a modified nucleic acid
encoding frataxin (FXN) comprising the nucleic acid sequence of SEQ
ID NO:5.
55. The host cell of claim 54, wherein the cell is selected from
the group consisting of VERO, WI38, MRC5, A549, HEK293, B-50 HeLa,
HepG2, Saos-2, HuH7, and HT1080.
56. The host cell of claim 55, wherein the cell is a HEK293 cell
adapted to growth in suspension culture.
57. The host cell of claim 55, wherein the cell is a HEK293 cell
having American Type Culture Collection (ATCC) No. PTA 13274.
58. The host cell of claim 54, wherein the cell comprises at least
one nucleic acid encoding a protein selected from the group
consisting of a replication (Rep) protein, a capsid (Cap) protein,
an adenovirus early region 1a (E1a) protein, a E1b protein, an E2a
protein, an E4 protein and a viral associated (VA) RNA and a
combination thereof.
59. A method for increasing the level of frataxin in a cell, the
method comprising transducing the cell with an rAAV vector
comprising a modified nucleic acid encoding frataxin (FXN)
comprising the nucleic acid sequence of SEQ ID NO:5.
60. An rAAV vector comprising a nucleic acid comprising from 5' to
3': (a) an AAV2 terminal repeat; (b) a CBh promoter comprising the
nucleic acid sequence of SEQ ID NO:26; (c) the modified nucleic
acid encoding FXN of claim 34; (d) a bGHpolyA signal sequence
comprising the nucleic acid sequence of SEQ ID NO:27; and (e) an
AAV2 terminal repeat.
61. The rAAV vector of claim 60, further comprising a capsid
selected from the group consisting of a capsid of AAV serotype
AAV2i8, AAV9, AAV-LK03, and AAV2-TT-S312N.
62. The rAAV vector of claim 61, further comprising a CSS
comprising the nucleic acid sequence of SEQ ID NO:25 immediately
following the sequence encoding FXN.
63. The rAAV vector of claim 62, further comprising a capsid of
AAV2i8, and wherein the vector comprises a nucleic acid comprising
from 5' to 3': (a) an AAV2 terminal repeat; (b) a CBh promoter
comprising the nucleic acid sequence of SEQ ID NO:26; (c) the
modified nucleic acid encoding FXN comprising the nucleic acid
sequence of SEQ ID NO:5; (d) a CSS comprising the nucleic acid
sequence of SEQ ID NO:25; (e) a bGHpolyA signal sequence comprising
the nucleic acid sequence of SEQ ID NO:27; and (f) an AAV2 terminal
repeat.
64. The rAAV vector of claim 62, further comprising a capsid of
AAV9, and wherein the vector comprises a nucleic acid comprising
from 5' to 3': (a) an AAV2 terminal repeat; (b) a CBh promoter
comprising the nucleic acid sequence of SEQ ID NO:26; (c) the
modified nucleic acid encoding FXN comprising the nucleic acid
sequence of SEQ ID NO:5; (d) a CSS comprising the nucleic acid
sequence of SEQ ID NO:25; (e) a bGHpolyA signal sequence comprising
the nucleic acid sequence of SEQ ID NO:27; and (f) an AAV2 terminal
repeat.
65. The rAAV vector of claim 62, further comprising a capsid of
AAV-LK03, and wherein the vector comprises a nucleic acid
comprising from 5' to 3': (a) an AAV2 terminal repeat; (b) a CBh
promoter comprising the nucleic acid sequence of SEQ ID NO:26; (c)
the modified nucleic acid encoding FXN comprising the nucleic acid
sequence of SEQ ID NO:5; (d) a CSS comprising the nucleic acid
sequence of SEQ ID NO:25; (e) a bGHpolyA signal sequence comprising
the nucleic acid sequence of SEQ ID NO:27; and (f) an AAV2 terminal
repeat.
Description
RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional
Application No. 62/251,288, filed Nov. 5, 2015, and U.S.
Provisional Application No. 62/411,980, filed Oct. 24, 2016, the
contents of each of which applications are hereby incorporated by
reference in their entirety.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted electronically as a text file in ASCII format
and is hereby incorporated by reference in its entirety. Said text
file, created on Nov. 1, 2016, is named
PC45291A_Seq_Listing_ST25.txt and is 71,065 bytes in size.
FIELD OF THE INVENTION
[0003] The invention relates to modified frataxin (FXN) genes,
vectors comprising the modified FXN genes, methods of using the
modified FXN genes, and vectors containing them in the treatment of
Friedreich ataxia, including cardiomyopathy and/or
neurodegenerative disease associated therewith, by providing
increased expression levels of non-mutated (wild type)
mitochondrial protein frataxin.
BACKGROUND OF THE INVENTION
[0004] Friedreich ataxia (FRDA) is associated with reduction of
expression of and/or mutation in the FXN gene that encodes for the
mitochondria protein frataxin. FRDA is an autosomal recessive
disease, meaning individuals only develop this disease if they
inherit a defective gene from both parents. FRDA is caused by
mutations in the FXN gene that results in reduction of mRNA and
protein levels of frataxin. Defective frataxin expression causes
critical metabolic changes, including redox imbalance and ATP
deficiency.
[0005] FRDA is a neurodegenerative disease that affects children
and young adults and leads to progressive disability and premature
death. Neurological signs are associated with degeneration of
sensory neurons and the flow of sensory information through the
peripheral nerves and the spinal cord is severely affected. There
is also some impairment of muscle-controlling signals from the
cerebellum and spinal cord. These problems lead to the progressive
loss of balance, coordination and muscle strength that characterize
FRDA. Further, patients often develop a hypertrophic cardiomyopathy
that is likely the cause of premature death. Enlargement of the
heart, irregular heartbeat and other symptoms of heart trouble are
evident.
[0006] It is believed that the frataxin protein regulates the
levels of iron inside the mitochondria which is necessary for using
oxygen to produce energy. Frataxin appears to act as a storage
depot for iron, releasing it only when it's needed for synthesis of
enzymes in the mitochondrial. Therefore, a deficiency of frataxin
results in a deficiency of these enzymes and further reduces
mitochondrial function which likely explains why Friedreich ataxia
affects cells of the nervous system and heart.
[0007] To date, no treatment exists for stopping or slowing down
the negative effects of FRDA. Current therapeutic approaches in
clinical use or under evaluation are directed at alleviating
symptoms and maximizing quality of life. Physical therapy and
speech therapy have been used to improve movement. Further, some
medications have been used to treat heart disease. Thus, there is
an important need for a novel therapeutic approach to treat the
symptoms associated with FRDA.
SUMMARY OF THE INVENTION
[0008] Disclosed and exemplified herein are modified nucleic acids
encoding frataxin (FXN) and vectors comprising the modified nucleic
acid and methods of treating a disease mediated by decreased level
of FXN by administering the modified nucleic acid or the vector
comprising the nucleic acid to a patient in need thereof.
[0009] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the invention described
herein. Such equivalents are intended to be encompassed by the
following embodiments (E).
E1. A modified FXN gene for treating FRDA in a human subject
wherein the modified FXN gene has been modified to alter the
content of GC nucleotides and/or to have a reduced number of CpG
dinucleotides. E2. The modified FXN gene of embodiment 1 wherein
the reduced number of CpG dinucleotides is in an amount sufficient
to suppress the silencing of gene expression due to the methylation
of CpG motifs. E3. The modified FXN gene of embodiment 1 wherein
the content of GC nucleotides is greater than 10%, 20%, 30%, 40%,
50%, 60% or 70% relative to the wild-type gene. E4. The modified
FXN gene of embodiment 3, having a codon adaptation index that is
>0.75, >0.80, >0.85, >0.90, or >0.95. E5. The
modified FXN gene of embodiment 3, comprising a sequence selected
from any one of SEQ ID NOs: 3 to 9. E6. The modified FXN gene of
embodiment 1 wherein the content of GC nucleotides is less than
10%, 20%, 30%, 40%, 50%, 60% or 70% relative to the wild-type gene.
E7. The modified FXN gene of embodiment 1 included in a viral
vector or plasmid. E8. The modified FXN gene of embodiment 7,
wherein the viral vector is a self-complementary AAV sequence. E9.
The modified FXN gene of embodiment 8, wherein the viral vector is
selected from the group consisting of AAV1, AAV2, AAV3, AAV4, AAV5,
AAV6, AAV7 AAV8, AAV9, AAV10, AAV11, AAV12, AAV1.1, AAV2.5, AAV6.1,
AAV6.3.1, AAV9.45, AAV Hu.26, AAV2i8, AAV2G9, rhAAV10, rhAAV74,
RHM4-1, RHM15-1, RHM15-2, RHM15-3/RHM15-5, RHM15-4, RHM15-6,
AAV2-TT, AAV2-TT-S312N, AAV3B-S312N, AAV-LK03, and combinations and
variants thereof. E10. The modified FXN gene of embodiment 8,
wherein the viral vector is an ancestral AAV vector. E11. The
modified FXN gene of embodiment 8, wherein the viral vector is a
chimeric AAV including a combination of AAV backbones from AAV2,
AAV3B, AAV6 or AAV8 and further comprising a galactose (Gal)
binding footprint from AAV9. E12. The modified FXN gene of
embodiment 1, wherein frataxin protein has an amino acid sequence
of SEQ ID NO. 1 or a functional fragment thereof. E13. A method for
treating a disease associated with frataxin deficiency in a subject
in need thereof, comprising administering to said subject a
therapeutically effective amount of a modified FXN gene wherein the
modified FXN gene has been modified to increase or decrease content
of GC nucleotides and/or to reduce the number of CpG dinucleotides.
E14. The method of embodiment 13, wherein the modified FXN gene
encodes the frataxin protein having the amino acid sequence of SEQ
ID NO. 1. E15. The method of embodiment 13, wherein the modified
FXN gene is expressed in target cells, wherein the target cells are
cardiac or neuron cells E16. The method of embodiment 13, wherein
the modified FXN gene is delivered in a viral or non-viral vector
to the target cells. E17. The method of embodiment 16, wherein the
vector is delivered by systemic injection or by direct cardiac or
intracranial injection. E18. A method of treating Friedreich ataxia
(FRDA) in a subject in need thereof, the method comprising:
providing at least one recombinant virus vector comprising a
modified FXN gene, wherein the modified FXN gene has been modified
to increase or decrease the content of GC nucleotides and/or to
reduce the amount of CpG dinucleotides; and administering the
recombinant virus vector to the subject under conditions such that
the modified FXN gene is expressed at a level which produces a
therapeutically effective amount of frataxin in cardiac and/or
neuron tissue of the subject. E19. The method of embodiment 18,
wherein the recombinant virus vector is administered to neurons or
heart muscles cells of the subject. E20. A host cell transfected
with a modified FXN gene that encodes a frataxin peptide or a
functional fragment thereof wherein the modified FXN gene has been
modified to increase or decrease content of GC nucleotides and/or
to reduce number of CpG dinucleotides. E21. A process of preparing
a frataxin peptide or fragment thereof comprising: transfecting a
host cell with a modified FXN gene that encodes the frataxin
peptide or functional fragment thereof; and maintaining the host
cell under biological conditions sufficient for expression of the
frataxin peptide. E22. The process of embodiment 21, wherein the
modified FXN gene has increased levels of GC nucleotides and/or
reduced levels of CpG dinucleotides compared with the nucleic acid
sequence of wild type frataxin as set forth in SEQ ID NO:2. E23. A
pharmaceutical composition comprising a modified FXN gene, wherein
the modified FXN gene has an increased or decreased content of GC
nucleotides and/or a reduced number of CpG dinucleotides, and a
pharmaceutically acceptable carrier. E24. A method for treating
FRDA comprising delivering to a subject in need of treatment, a
vector comprising a modified polynucleotide sequence encoding a FXN
gene, wherein the FXN gene is expressed in the target cells,
thereby treating FRDA in the subject. The target cells are
preferably cardiac or neuron cells and the vector is preferably
delivered to the target cells via direct cardiac or intracranial
injection. E25. The modified nucleic acid of embodiment 1, wherein
the modified nucleic acid has a reduced GC content, relative to the
wild type gene, that being 20%, 30%, 40%, 50%, or 60% less than the
wild type gene while still having the same expression level as the
wild type. Silent mutations can be introduced into the coding
sequence in order to reduce the GC content of the gene. E26. A
modified nucleic acid encoding FXN with a reduced level of CpG
dinucleotides. E27. A modified nucleic acid encoding FXN (also
referred to as a "modified FXN gene") for treating FRDA in a human
subject in need thereof, wherein the modified FXN gene had been
modified to increase GC content and reduce certain cis motifs
relative to the wild type nucleic acid sequence encoding FXN set
forth as SEQ ID NO:2. E28. A modified FXN gene having a reduced
number of CpG dinucleotides in an amount to suppress the silencing
of gene expression due to the methylation of CpG motifs compared
with the number of CpG dinucleotides present in the wild type
nucleic acid sequence encoding FXN set forth as SEQ ID NO:2. E29. A
method of treating FRDA in a subject, the method comprising:
providing at least one recombinant virus vector comprising a
modified FXN gene of any one of embodiments 1-12, 23, and 25-28,
and administering the recombinant virus vector to the subject under
conditions such that the modified FXN gene is expressed at a level
which produces a therapeutically effective amount of frataxin in
cardiac and or neuron tissue of the subject. E30. A method for
reducing the effects of or treating Friedreich ataxia in neurons
and heart muscles cells of a subject in need thereof, comprising
administering to said subject a therapeutically effective amount of
a recombinant virus vector which comprises a modified FXN nucleic
acid encoding the protein frataxin. E31. A method for treating
Friedreich ataxia in a subject in need thereof, including gene
therapy based on administration of a nucleic acid comprising a
nucleotide sequence selected from the group consisting of a
sequence of SEQ ID NOs:3-9. E32. A composition comprising an
adeno-associated virus (AAV) vector comprising a modified FXN gene,
or functional fragment thereof, wherein the AAV vector comprises a
single stranded AAV vector genome, a double-stranded AAV vector
genome or a self-complementary (sc) AAV vector genome. E33. An
expression vector comprising a polynucleotide that includes a
modified FXN gene or fragment thereof. E34. The vector of
embodiment 33, wherein the AAV comprises a capsid of a serotype
selected from the group consisting of AAV1, AAV2, AAV3, AAV4, AAV5,
AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, rhAAV10, rhAAV74,
RHM4-1, RHM15-1, RHM15-2, RHM15-3/RHM15-5, RHM15-4, RHM15-6, AAV
Hu.26, AAV1.1 (SEQ ID NO:15), AAV2.5 (SEQ ID NO. 13), AAV6.1 (SEQ
ID NO:17), AAV6.3.1 (SEQ ID NO:18), AAV9.45, AAV2i8 (SEQ ID NO:29),
AAV2G9, AAV2-TT (SEQ ID NO:31), AAV2-TT-S312N (SEQ ID NO:33),
AAV3B-S312N, and AAV-LK03. E35. The vector of embodiment 34,
further comprising a AAV1.1 capsid wherein amino acid residue 265
is deleted (SEQ ID NO: 15), an AAV 6.1 capsid wherein amino acid
residue 265 is deleted (SEQ ID NO: 17), an AAV 6.3.1 capsid wherein
amino acid residue 265 is deleted and amino acid residue 531 is
changed from a Lys to a Glu (SEQ ID NO: 18). The nucleotide
sequence of wildtype AAV 1 capsid is shown in (SEQ ID NO: 14) and
the nucleotide sequence of wildtype AAV 6 capsid is set forth in
(SEQ ID NO: 16). E36. A chimeric AAV virus vector comprising the
modified FXN gene of any one of embodiments 1-12, 23, and 25-28,
further comprising a capsid that includes the combination of AAV
backbones from AAV2, AAV3, AAV6, AAV8, with a galactose (Gal)
binding footprint from AAV9. Specifically, the galactose (Gal)
binding footprint from AAV9 is grafted onto the heparin
sulfate-binding AAV serotype 2 to improve transduction efficiency.
E37. A chimeric AAV virus vector comprising the modified FXN gene
of any one of embodiments 1-12, 23, and 25-28, further comprising
wherein the vector capsid includes tyrosine mutants in combination
with 265 deletion mutations of AAV1 and or AAV6 as well as addition
of a galactose binding footprint to the capsid protein. E38. A
chimeric AAV virus vector comprising the modified FXN gene of any
one of embodiments 1-12, 23, and 25-28, further comprising a
targeting peptides inserted in the HI structure loop of AAV or in
position of 585 aa in AAV 2 backbone. Additionally, ancestral AAV
vectors may be used for therapeutic in vivo gene therapy. Notably,
the use of the virus particles assembled from ancestral viral
sequences exhibit reduced susceptibility to pre-existing immunity
in current day human population than do contemporary viruses or
portions thereof. E39. A host cell comprising the modified FXN gene
of any one of embodiments 1-12, 23, and 25-28. E40. A process of
preparing a frataxin peptide or fragment thereof comprising:
transfecting a host cell with the modified FXN gene of any one of
embodiments 1-12, 23, and 25-28, and maintaining the host cell
under biological conditions sufficient for expression of the
frataxin peptide. E41. Use of a modified FXN gene of any one of
embodiments 1-12, 23, and 25-28, in the treatment of Friedreich
ataxia. E42. A pharmaceutical composition comprising a modified FXN
gene for treating Friedreich ataxia that causes degeneration of
neurons and cells in the cardiac tissues of a human subject wherein
the modified FXN gene has an increased amount of GC nucleotides,
decreased amount of GC nucleotides and/or has a reduced number of
CpG dinucleotides; and a pharmaceutically acceptable carrier. E43.
An expression optimized nucleic acid encoding frataxin comprising a
nucleic acid sequence selected from any one of SEQ ID NOs:3-9. E44.
A modified nucleic acid encoding frataxin comprising the amino acid
set forth in SEQ ID NO:1, wherein the nucleic acid has a GC content
of at least 55%, a decreased number of CpG dinucleotides compared
with the nucleic acid sequence of SEQ ID NO:2, a codon adaptation
index (CAI) of at least 0.8, and wherein it is expressed at a
greater level compared with the level of expression of wild type
frataxin comprising the nucleic acid sequence of SEQ ID NO:2. E45.
The modified nucleic acid of embodiment 44, wherein the CAI is at
least 0.86. E46. The modified nucleic acid of embodiment 44,
wherein the CAI is at least 0.95. E47. The modified nucleic acid of
embodiment 44, wherein the CAI is at least 0.98. E48. The modified
nucleic acid of any one of embodiments 44-47, wherein the GC
content is at least 61%. E49. The modified nucleic acid of any one
of embodiments 44-47, wherein the GC content is at least 69%. E50.
The modified nucleic acid of any one of embodiments 44-49, wherein
the number of CpG dinucleotides is from about 114 to 124. E51. A
modified nucleic acid encoding frataxin (FXN) comprising the amino
acid sequence set forth in SEQ ID NO:1, wherein said nucleic acid
is expressed at a greater level compared with the expression level
of the wild type FXN nucleic acid sequence of SEQ ID NO:2, and
wherein said modified nucleic acid comprises at least one
characteristic selected from the group consisting of: a GC content
of at least 55%, a number of CpG dinucleotides not greater than
124, and a codon adaptation index (CAI) of at least 0.76. E52. The
modified nucleic acid of embodiment 51, said nucleic acid
comprising at least one characteristic selected from the group
consisting of: a CAI of at least 0.86, at least 0.95, or at least
0.98; a GC content is at least 57%, at least 61%, or at least 69%;
a number of CpG dinucleotides is less than 124; and a nucleic acid
sequence selected from the group consisting of a sequence as set
forth in SEQ ID NOs:3-9. E53. A modified nucleic acid encoding FXN,
wherein said nucleic acid is expressed at a greater level compared
with the level of expression of the wild type FXN nucleic acid
sequence of SEQ ID NO:2, and wherein the nucleic acid comprises at
least one of: a nucleic acid sequence selected from the group
consisting of SEQ ID NOs:3-9; a GC content of at least 55%; a
number of CpG dinucleotides not greater than 117; and a CAI of at
least 0.86. E54. The modified nucleic acid of embodiment 53,
wherein the nucleic acid sequence is selected from the group
consisting of SEQ ID NO:5 and SEQ ID NO:7. E55. The modified
nucleic acid of claim any one of embodiments 43-54, comprising the
nucleic acid sequence of SEQ ID NO:7. E56. The modified nucleic
acid of any one of embodiments 1-12, 23, 25-28 and 43-55, further
comprising a nucleic acid sequence encoding at least one AAV
terminal repeat (TR). E57. The modified nucleic acid of embodiment
55 wherein the nucleic acid single stranded, double stranded,
and/or self complementary. E58. The modified nucleic acid of
embodiment 57, wherein the nucleic acid is self complementary. E59.
The modified nucleic acid of any one of embodiments 1-12, 23,
25-28, and 43-58, further comprising an enhancer. E60. The modified
nucleic acid of embodiment 59, wherein the enhancer is a
cytomegalovirus (CMV) immediate-early enhancer. E61. The modified
nucleic acid of any one of embodiments 1-12, 23, 25-28, and 43-60,
further comprising a promoter. E62. The modified nucleic acid of
any one of embodiments 1-12, 23, 25-28, and 43-61, wherein the
promoter is constitutive or regulated. E63. The modified nucleic
acid of embodiment 62, wherein the promoter is regulated. E64. The
modified nucleic acid of embodiment 63, wherein the promoter
inducible or repressible. E65. The modified nucleic acid of any one
of embodiments 1-12, 23, 25-28, and 43-64, further comprising a
nucleic acid sequence encoding a collagen stabilization sequence
(CSS). E66. The modified nucleic acid of any one of embodiments
1-12, 23, 25-28, and 43-65, further comprising a stop codon. E67.
The modified nucleic acid of any one of embodiments 1-12, 23,
25-28, and 43-66, further comprising a poly-adenylation (polyA)
signal sequence. E68. The modified nucleic acid of embodiment 67,
wherein the promoter is selected from the group consisting of a
chicken beta-actin (CBA) promoter, a cytomegalovirus (CMV)
promoter, a CMV enhancer/CBA promoter (CBh), and a synthetic CAG
promoter. E69. The modified nucleic acid of embodiment 68, wherein
the promoter is a CBh promoter. E70. The modified nucleic acid of
any one of embodiments 1-6, 12, 25-28, and 44-69, further
comprising a nucleic acid sequence encoding a collagen
stabilization sequence (CSS). E71. A recombinant AAV vector (rAAV)
comprising the modified nucleic acid encoding FXN of any one of
embodiments 1-12, 23, 25-28, and 43-70. E72. The rAAV of embodiment
71, wherein the rAAV comprises a capsid selected from the group
consisting of a capsid from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6,
AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAVrh10, AAVrh74, AAV2.5
(SEQ ID NO. 13), AAV hu.26, AAV1.1, AAV2.5, AAV6.1, AAV6.3.1,
AAV2i8, AAV2G9, AAV9.45, AAV2i8G9, RHM4-1, RHM15-1, RHM15-2,
RHM15-3/RHM15-5, RHM15-4, RHM15-6, AAV2-TT, AAV2-TT-S312N,
AAV3B-S312N, and AAV-LK03. E73. The rAAV of embodiment 72, wherein
the capsid is selected from the group consisting of AAV2-TT,
AAV2-TT-S312N, and AAV2i8 capsid. E74. The rAAV of embodiment 73,
wherein the modified nucleic acid comprises the sequence of SEQ ID
NO:7 and wherein the capsid is selected from an AAV2i8 capsid and
an AAV2-TT-S312N capsid. E75. The rAAV of embodiment 74, wherein
the nucleic acid further comprises two AAV terminal repeat
sequences flanking the sequence encoding FXN, and further comprises
a CBh promoter upstream of the sequence encoding FXN. E76. The rAAV
of embodiment 75, said nucleic acid further comprising a collagen
stabilization sequence (CSS; SEQ ID NO:25) 3' from the sequence
encoding FXN. E77. The rAAV of any one of embodiments 71-76,
wherein the nucleic acid comprises a bovine growth hormone polyA
(bGHpolyA) signal sequence. E78. A rAAV vector comprising an AAV2i8
capsid wherein VP1 comprises the amino acid of SEQ ID NO:29, and
further comprising a nucleic acid comprising, from 5' to 3':
[0010] (a) an AAV2 terminal repeat (TR);
[0011] (b) a CBh promoter comprising the nucleic acid sequence of
SEQ ID NO:26;
[0012] (c) a modified nucleic acid encoding FXN comprising a
nucleic acid sequence selected from the group consisting of SEQ ID
NOs:3-9;
[0013] (d) a CSS having the sequence of SEQ ID NO:25;
[0014] (e) a bGHpolyA signal sequence having the sequence of SEQ ID
NO:27; and
[0015] (f) an AAV2 TR.
E79. A rAAV vector comprising an AAV2-TT capsid wherein VP1
comprises the amino acid of SEQ ID NO:31, and further comprising a
nucleic acid comprising, from 5' to 3':
[0016] (a) an AAV2 TR;
[0017] (b) a CBh promoter comprising the nucleic acid sequence of
SEQ ID NO:26;
[0018] (c) a modified nucleic acid encoding FXN comprising a
nucleic acid sequence selected from the group consisting of SEQ ID
NOs:3-9;
[0019] (d) a CSS having the sequence of SEQ ID NO:25;
[0020] (e) a bGHpolyA signal sequence having the sequence of SEQ ID
NO:27; and
[0021] (f) an AAV2 TR.
E80. A rAAV vector comprising an AAV2-TT-S312N capsid wherein VP1
comprises the amino acid of SEQ ID NO:33, and further comprising a
nucleic acid comprising, from 5' to 3':
[0022] (a) an AAV2 TR;
[0023] (b) a CBh promoter comprising the nucleic acid sequence of
SEQ ID NO:26;
[0024] (c) a modified nucleic acid encoding FXN comprising a
nucleic acid sequence selected from the group consisting of SEQ ID
NOs:3-9;
[0025] (d) a CSS having the sequence of SEQ ID NO:25;
[0026] (e) a bGHpolyA signal sequence having the sequence of SEQ ID
NO:27; and
[0027] (f) an AAV2 TR.
E81. The rAAV vector of any one of embodiments 71-80, wherein the
modified nucleic acid encoding FXN comprises the nucleic acid
sequence of SEQ ID NO:7. E82. A rAAV vector for treating Friedreich
ataxia in a subject in need thereof, wherein said vector comprises
the modified nucleic acid encoding frataxin of any one of
embodiments 1-6, 12, 25-28 and 71-81. E83. A pharmaceutical
composition comprising the rAAV vector of any one of embodiments
7-11, 33-39, and 71-82, and a pharmaceutically acceptable carrier.
E84. A method of treating FRDA in a subject, the method comprising
administering at least one of: a modified nucleic acid encoding
frataxin of any one of embodiments 1-12, 23, 25-28 and 43-70; a
rAAV vector of any one of embodiments 7-11, 33-39 and 71-82; and
the pharmaceutical composition of embodiment 83. E85. The method of
embodiment 84, wherein the rAAV vector of any one of embodiments
7-11, 33-39, and 71-82, is administered systemically, or by direct
cardiac or intracranial administration. E86. The method of
embodiment 85, wherein the rAAV vector of any one of embodiments
71-82 is administered intracranially. E87. The method of embodiment
85, wherein the rAAV vector of any one of embodiments 71-82 is
directly administered into the heart. E88. The method of embodiment
84, wherein the modified nucleic acid encoding FXN comprises the
nucleic acid sequence of SEQ ID NO:6. E89. The method of embodiment
84, wherein the modified nucleic acid encoding FXN comprises the
nucleic acid sequence of SEQ ID NO:7. E90. A method of treating a
disease, disorder or condition mediated by a decreased level of
FTX, the method comprising administering at least one of: the
modified nucleic acid encoding frataxin of any one of embodiments
1-6, 12, 25-28 and 43-70; the rAAV vector of any one of embodiments
7-11, 33-39 and 71-82; and the pharmaceutical composition of
embodiment 83. E91. A host cell comprising a modified nucleic acid
encoding FXN of any one of embodiments 1-6, 12, 25-28 and 43-70.
E92. The host cell of embodiment 91, wherein the cell is selected
from the group consisting of VERO, WI38, MRC5, A549, HEK293 cells,
B-50 or any other HeLa cells, HepG2, Saos-2, HuH7, and HT1080. E93.
The host cell of embodiment 92, wherein the host cell is a HEK293
adapted to growth in suspension culture. E94. The host cell of any
one of embodiments 91-93, wherein the cell is a HEK293 cell having
ATCC No. PTA 13274. E95. A packaging cell comprising a rAAV vector
of any one of embodiments 7-11, 33-39, and 70-82, wherein said cell
further comprises at least one nucleic acid encoding an AAV Rep
protein, at least one nucleic acid encoding an AAV Cap protein, and
at least one nucleic acid encoding a helper function. E96. A method
for producing a rAAV vector, the method comprising culturing the
cell of any one of embodiments 91-95 under conditions where rAAV is
produced. E97. The method of embodiment 96, further comprising
isolating the rAAV produced. E98. Use of at least one of: the
modified nucleic acid encoding frataxin of any one of embodiments
1-6, 12, 25-28 and 43-70; the rAAV vector of any one of embodiments
7-11, 33-39 and 71-82; and the pharmaceutical composition of
embodiment 83 to increase the level of frataxin in a cell. E99. The
modified nucleic acid encoding frataxin of any one of embodiments
1-6, 12, 25-28 and 43-70; the rAAV vector of any one of embodiments
7-11, 33-39 and 71-82; and the pharmaceutical composition of
embodiment 83 for use in increasing the level of frataxin in a
subject. E100. The modified nucleic acid encoding frataxin of any
one of embodiments 1-6, 12, 25-28 and 43-70; the rAAV vector of any
one of embodiments 7-11, 33-39 and 71-82; and the pharmaceutical
composition of embodiment 83 for use in treating Friedreich ataxia
in a subject.
[0028] Other features and advantages of the invention will be
apparent from the following detailed description, drawings,
exemplary embodiments and claims
BRIEF DESCRIPTION OF THE DRAWINGS
[0029] FIGS. 1A and 1B. FIGS. 1A and 1B both show the results of
expression in HeLa cells of frataxin from selected modified nucleic
acids encoding FXN compared to a wild type nucleic acid (lane 1).
Extracts from HeLa cells comprising the following modified nucleic
acids were examined to detect FXN produced in the cells. Frataxin
was detected by Western blotting using an anti-frataxin antibody
detected using a secondary antibody conjugated with HRP (horse
radish peroxidase) for chemiluminescence detection by exposure of
the Western blot to light sensitive film. The lanes were loaded
with extracts from HeLa cells transfected with the following
modified nucleic acids encoding frataxin: lane 1: wild type control
nucleic acid; lane 2: IDT2; lane 3: IDT5; lane 4: JCAT; lane 5:
GeneArt; lane 6: Genscript (control); and lane 7: Genscript (low
CpG).
[0030] FIGS. 2A-2F show the sequence of various modified FXN gene
constructs for cloning into the self-complementary rAAV vector
pTRs-KS-CBh-EGFP-bGHpolyA--where the EGFP marker gene was replaced
with either wild type FXN gene (SEQ ID NO:2) or a modified version
thereof (e.g., SEQ ID NOs:3-9). Each figure shows WT FXN (FIG. 2A)
or a modified FXN gene (FIGS. 2B-2F). Each construct comprises
(from 5' to 3') an AgeI cut site, the FXN/modified FXN gene, AvrII
cut site, a collagen stability sequence (CSS), a SpeI cut site, a
bGHpolyA signal sequence, and a MluI cut site. FIG. 2A shows the
pTRs-KS-CBh-WT FXN-bGHpolyA construct (SEQ ID NO:19); FIG. 2B shows
the Integrated DNA Technologies IDT 1 (IDT1) modified FXN gene
construct pTRs-KS-CBh-IDT1 FXN-bGHpolyA (SEQ ID NO:20); FIG. 2C
shows IDT3 modified FXN gene construct pTRs-KS-CBh-IDT3
FXN-bGHpolyA (SEQ ID NO:21); FIG. 2D shows the IDT4 modified FXN
gene construct pTRs-KS-CBh-IDT4 FXN-bGHpolyA (SEQ ID NO:22); FIG.
2E shows the GenScript modified FXN gene construct
pTRs-KS-CBh-GenScript FXN-bGHpolyA (SEQ ID NO:23); and FIG. 2F
shows the GenScript (low CpG) modified FXN gene construct
pTRs-KS-CBh-Genscript (low CpG) FXN-bGHpolyA (SEQ ID NO:24), each
sequence includes the elements (e.g., AgeI, AvrII, CSS, SpeI,
bGHpolyA, and MluI) which are indicated as follows, from 5' to 3',
in FIGS. 2A-2F: an AgeI cut site (ACCGGT) indicated in bold; the
FXN gene in lower case letters, an AvrII cut site (CCTAGG)
indicated by underlining; a sequence encoding a collagen
stabilization sequence (CSS) indicated by double underlining; an
SpeI cut site (ACTAGT) indicated in bold underlined; a bovine
growth hormone poly-adenylation signal sequence (bGHpolyA)
indicated in italics; and a MluI cut site (ACGCGT) indicated in
bold italics. The FXN gene in the construct is under the control of
the CBh promoter upstream from the AgeI cut site. The sequence of
the CBh promoter is not shown in FIGS. 2A-2F, but is set forth in
SEQ ID NO:25.
[0031] FIG. 3 shows a vector (plasmid) map for the pTRs-KS-CBh-eGFP
cloning construct depicting the various restriction (cut) sites and
elements of the vector including the CBh promoter upstream from the
AgeI cut site.
[0032] FIGS. 4A and 4B show graphs illustrating the baseline
cardiac phenotype in control, treated mutant and untreated mutant
male (FIG. 4A) and female (FIG. 4B) mice. FIG. 4A shows the cardiac
phenotype for, from left to right within each grouping: control
males, treated mutants and untreated mutants, where the groupings
are: EF (ejection fraction), FS (fractional shortening); LV Vol_d
(left ventricle volume diastolic); and LV Vol_s (left ventricle
volume systolic). FIG. 4B shows the baseline cardiac phenotype for
female mice groups: control (circles); treated mutants (squares);
and untreated mutants (triangles).
[0033] FIGS. 5A and 5B show graphs illustrating the reversal of
FRDA cardiac phenotype in treated Mck mutant mice compared with the
cardiac phenotype in untreated Mck mutant mice at 5 weeks of age
(and 14 days post-treatment in treated mutants). FIG. 5A shows the
cardiac phenotype of control (circles), treated mutant (squares)
and untreated mutant (triangles) male mice 14 days after rAAV-FXN
injection. The abbreviations are as follows: AoV SV (aortic valve
stroke volume); AoV CO (aortic valve cardiac output); FS
(fractional shortening); and LV Mass AW (left ventricle mass
anterior wall). FIG. 5B shows the cardiac phenotype of control
(circles), treated mutant (squares) and untreated mutant
(triangles) female mice 14 days after rAAV-FXN injection. The
abbreviations are as follows: ES (ejection fraction): FS
(fractional shortening); AoV SV (aortic valve stroke volume); AoV
CO (aortic valve cardiac output).
[0034] FIGS. 6A-6C show graphs illustrating cardiac function in
male and female control mice (circles), treated mutants male and
female mice (squares), and untreated mutant male and female mice
(triangles) twenty-eight (28) days post-rAAV-FXN treatment in the
treated Mck mutant group. FIG. 6A shows the left ventricle mass
(LVM) echocardiography assessment for all three mouse groups over
successive weeks, i.e., at 3 weeks of age (time of rAAV
administration), 5 weeks of age (14 days post-rAAV administration)
and 7 weeks of age (28 days post-rAAV administration) where
treatment was administered at the age of 5 weeks. FIG. 6B shows the
shortening factor (SF) echocardiography assessment for all three
mouse groups over successive weeks. FIG. 6C shows the cardiac
output echocardiography assessment for all three mouse groups over
successive weeks. The data are mean.+-.S.E.M of 8 mice per group.
The data of Mck mutant mice were compared to the Mck positive
control group using multiple t-tests comparisons (Sidak-Bonferroni
method). * p<0.05.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0035] Unless otherwise defined, all technical and scientific terms
used herein have the meaning commonly understood by one of ordinary
skill in the art to which this invention belongs. The terminology
used herein is for the purpose of describing particular embodiments
only and is not intended to be limiting of the invention. As used
in the description of the invention and the appended claims, the
singular forms "a", "an" and "the" are intended to include the
plural forms as well, unless the context clearly indicates
otherwise. The following terms have the meanings given:
[0036] The term "about," as used herein, when referring to a
measurable value such as an amount of the biological activity,
length of a polynucleotide or polypeptide sequence, content of G
and C nucleotides, codon adaptation index, number of CpG
dinucleotides, dose, time, temperature, and the like, is meant to
encompass variations of 20%, 10%, 5%, 1%, 0.5% or even 0.1% of the
specified amount.
[0037] As used herein, the term "and/or" refers to and encompasses
any and all possible combinations of one or more of the associated
listed items, as well as the lack of combinations when interpreted
in the alternative ("or").
[0038] AAV "rep" and "cap" genes refer to polynucleotide sequences
encoding replication and encapsidation proteins of adeno-associated
virus. AAV rep and cap are referred to herein as AAV "packaging
genes."
[0039] The present disclosure provides a recombinant
adeno-associated virus (rAAV) vector. "AAV" is an abbreviation for
adeno-associated virus, and may be used to refer to the virus
itself or derivatives thereof. The term covers all subtypes and
both naturally occurring and recombinant forms, except where
required otherwise. The abbreviation "rAAV" refers to recombinant
adeno-associated virus, also referred to as a recombinant AAV
vector (or "rAAV vector") or simply, an "AAV vector." The term
"AAV" includes, for example, AAVs of various serotypes, e.g., AAV
type 1 (AAV-1), AAV type 2 (AAV-2), AAV type 3 (AAV-3), AAV type 4
(AAV-4), AAV type 5 (AAV-5), AAV type 6 (AAV-6), AAV type 7
(AAV-7), AAV type 8 (AAV-8), AAV type 9 (AAV-9), AAV type 10
(AAV-10, including AAVrh10), AAVrh74, AAV type 12 (AAV-12), avian
AAV, bovine AAV, canine AAV, equine AAV, primate AAV, non-primate
AAV, and ovine AAV. "Primate AAV" refers to AAV that infect
primates, "non-primate AAV" refers to AAV that infect non-primate
mammals, "bovine AAV" refers to AAV that infect bovine mammals, and
so on.
[0040] The various serotypes of AAV are attractive for several
reasons, most prominently that AAV is believed to be non-pathogenic
and that the wildtype virus can integrate its genome
site-specifically into human chromosome 19 (Linden et al., 1996,
Proc Natl Acad Sci USA 93:11288-11294). The insertion site of AAV
into the human genome is called AAVS1. Site-specific integration,
as opposed to random integration, is believed to likely result in a
predictable long-term expression profile.
[0041] The genomic sequences of various serotypes of AAV, as well
as the sequences of the native terminal repeats (TRs), Rep
proteins, and capsid subunits are known in the art. Such sequences
may be found in the literature or in public databases such as
GenBank. See, e.g., GenBank Accession Numbers NC-002077 (AAV-1),
AF063497 (AAV-1), NC-001401 (AAV-2), AF043303 (AAV-2), NC-001729
(AAV-3), NC-001829 (AAV-4), U89790 (AAV-4), NC-006152 (AAV-5),
AF513851 (AAV-7), AF513852 (AAV-8), and NC-006261 (AAV-8); the
disclosures of which are incorporated by reference herein. See
also, e.g., Srivistava et al., 1983, J. Virology 45:555; Chiorini
et al., 1998, J. Virology 71:6823; Chiorini et al., 1999, J.
Virology 73: 1309; Bantel-Schaal et al., 1999, J. Virology 73:939;
Xiao et al., 1999, J. Virology 73:3994; Muramatsu et al., 1996,
Virology 221:208; Shade et al., 1986, J. Virol. 58:921; Gao et al.,
2002, Proc. Nat. Acad. Sci. USA 99: 11854; Moris et al., 2004,
Virology 33:375-383; international patent publications WO 00/28061,
WO 99/61601, WO 98/11244; WO 2013/063379; WO 2014/194132; WO
2015/121501, and U.S. Pat. Nos. 6,156,303 and 7,906,111.
[0042] An "rAAV vector" as used herein refers to an AAV vector
comprising a polynucleotide sequence not of AAV origin (i.e., a
polynucleotide heterologous to AAV), typically a sequence of
interest for the genetic transformation of a cell. In some
embodiments, the heterologous polynucleotide may be flanked by at
least one, and sometimes by two, AAV inverted terminal repeat
sequences (ITRs). The term rAAV vector encompasses both rAAV vector
particles and rAAV vector plasmids. A rAAV vector may either be
single-stranded (ssAAV) or self-complementary (scAAV). An "AAV
virus" or "AAV viral particle" or "rAAV vector particle" refers to
a viral particle composed of at least one AAV capsid protein
(typically by all of the capsid proteins of a wild-type AAV) and an
encapsidated polynucleotide rAAV vector. If the particle comprises
a heterologous polynucleotide (i.e., a polynucleotide other than a
wild-type AAV genome such as a transgene to be delivered to a
mammalian cell), it is typically referred to as a "rAAV vector
particle" or simply an "rAAV vector". Thus, production of rAAV
particle necessarily includes production of rAAV vector, as such a
vector is contained within an rAAV particle.
[0043] "Recombinant," as used herein means that the vector,
polynucleotide, polypeptide or cell is the product of various
combinations of cloning, restriction or ligation steps (e.g.
relating to a polynucleotide or polypeptide comprised therein),
and/or other procedures that result in a construct that is distinct
from a product found in nature. A recombinant virus or vector is a
viral particle comprising a recombinant polynucleotide. The terms
respectively include replicates of the original polynucleotide
construct and progeny of the original virus construct.
[0044] "AAV Rep" means AAV replication proteins and analogs
thereof.
[0045] "AAV Cap" means AAV capsid proteins, VP1, VP2 and VP3 and
analogs thereof. In wild type AAV virus, three capsid genes vp1,
vp2 and vp3 overlap each other. See, Grieger and Samulski, 2005, J.
Virol. 79(15):9933-9944. A single P40 promoter allows all three
capsid proteins to be expressed at a ratio of about 1:1:10, vp1,
vp2, vp3, respectively, which complement with rAAV production. For
the production of recombinant AAV vectors, desired ratio of
VP1:VP2:VP3 is in the range of about 1:1:1 to about 1:1:100,
preferably in the range of about 1:1:2 to about 1:1:50, more
preferably in the range of about 1:1:5 to about 1:1:20. Although
the desired ratio of VP1:VP2 is 1:1, the ratio range of VP1:VP2
could vary from 1:50 to 50:1.
[0046] A comprehensive list and alignment of amino acid sequences
of capsids of known AAV serotypes is provided by Marsic et al.,
2014, Molecular Therapy 22(11):1900-1909, especially at
supplementary FIG. 1.
[0047] For illustrative purposes only, wild type AAV2 comprises a
small (20-25 nm) icosahedral virus capsid of AAV composed of three
proteins (VP1, VP2, and VP3; a total of 60 capsid proteins compose
the AAV capsid) with overlapping sequences. The proteins VP1 (735
aa; Genbank Accession No. AAC03780), VP2 (598 aa; Genbank Accession
No. AAC03778) and VP3 (533 aa; Genbank Accession No. AAC03779)
exist in a 1:1:10 ratio in the capsid. That is, for AAVs, VP1 is
the full length protein and VP2 and VP3 are progressively shorter
versions of VP1, with increasing truncation of the N-terminus
relative to VP1.
[0048] "AAV TR" means a palindromic terminal repeat sequence at or
near the ends of the AAV genome, comprising mostly complementary,
symmetrically arranged sequences, and includes analogs of native
AAV TRs and analogs thereof.
[0049] "Cis-motifs" includes conserved sequences such as found at
or close to the termini of the genomic sequence and recognized for
initiation of replication; cryptic promoters or sequences at
internal positions likely used for transcription initiation,
splicing or termination.
[0050] "Treating" or "treatment" means reversing, alleviating, or
inhibiting the progress of the disorder or condition to which such
term applies, or one or more symptoms of such disorder or
condition.
[0051] "Therapeutically effective amount" means a minimal amount of
active agent which is necessary to impart therapeutic benefit to a
subject. For example, a "therapeutically effective amount" to a
patient is such an amount which induces, ameliorates, stabilizes,
slows down the progression or otherwise causes an improvement in
the pathological symptoms, disease progression or physiological
conditions associated with or resistance to succumbing to a
disorder.
[0052] "Gene" means a polynucleotide containing at least one open
reading frame that is capable of encoding a particular polypeptide
or protein after being transcribed and translated.
[0053] "Coding sequence" means a sequence which encodes a
particular protein" or "encoding nucleic acid", denotes a nucleic
acid sequence which is transcribed (in the case of DNA) and
translated (in the case of mRNA) into a polypeptide in vitro or in
vivo when placed under the control of (operably linked to)
appropriate regulatory sequences. The boundaries of the coding
sequence are determined by a start codon at the 5' (amino) terminus
and a translation stop codon at the 3' (carboxy) terminus. A coding
sequence can include, but is not limited to, cDNA from prokaryotic
or eukaryotic mRNA, genomic DNA sequences from prokaryotic or
eukaryotic DNA, and even synthetic DNA sequences.
[0054] "Chimeric" means, with respect to a viral capsid or
particle, that the capsid or particle includes sequences from
different parvoviruses, preferably different AAV serotypes, as
described in Rabinowitz et al., U.S. Pat. No. 6,491,907, the
disclosure of which is incorporated in its entirety herein by
reference. See also Rabinowitz et al., 2004, J. Virol.
78(9):4421-4432. A particularly preferred chimeric viral capsid is
the AAV2.5 capsid, which has the sequence of the AAV2 capsid with
the following mutations: 263 Q to A; 265 insertion T; 705 N to A;
708 V to A; and 716 T to N. wherein the nucleotide sequence
encoding such capsid is defined as SEQ ID NO: 15 as described in WO
2006/066066. Other preferred chimeric AAVs include, but are not
limited to, AAV2i8 described in WO 2010/093784, AAV2G9 and AAV8G9
described in WO 2014/144229, and AAV9.45 (Pulicherla et al., 2011,
Molecular Therapy 19(6):1070-1078).
[0055] "Flanked," with respect to a sequence that is flanked by
other elements, indicates the presence of one or more the flanking
elements upstream and/or downstream, i.e., 5' and/or 3', relative
to the sequence. The term "flanked" is not intended to indicate
that the sequences are necessarily contiguous. For example, there
may be intervening sequences between the nucleic acid encoding the
transgene and a flanking element. A sequence (e.g., a transgene)
that is "flanked" by two other elements (e.g., TRs), indicates that
one element is located 5' to the sequence and the other is located
3' to the sequence; however, there may be intervening sequences
there between.
[0056] "Polynucleotide" means a sequence of nucleotides connected
by phosphodiester linkages. Polynucleotides are presented herein in
the direction from the 5' to the 3' direction. A polynucleotide of
the present invention can be a deoxyribonucleic acid (DNA) molecule
or ribonucleic acid (RNA) molecule. Where a polynucleotide is a DNA
molecule, that molecule can be a gene or a cDNA molecule.
Nucleotide bases are indicated herein by a single letter code:
adenine (A), guanine (G), thymine (T), cytosine (C), inosine (I)
and uracil (U). A polynucleotide of the present invention can be
prepared using standard techniques well known to one of skill in
the art.
[0057] "Transduction" of a cell by a virus means that there is
transfer of a nucleic acid from the virus particle to the cell.
[0058] "Modified FXN gene" means a modified nucleic acid encoding
FXN (e.g., the amino acid sequence of SEQ ID NO:1) with at least
one modification compared with a wild type nucleic acid encoding
FXN (e.g., SEQ ID NO:2), wherein the modification includes, but is
not limited to, increased GC content, decreased GC content or a FXN
gene with a reduced CpG content. Preferably, the modified FXN gene
exhibits improved protein expression, e.g., the protein encoded
thereby is expressed at a detectably greater level in a cell
compared with the level of expression of the protein provided by
the wild type gene in an otherwise identical cell.
[0059] "Transfection" of a cell means that genetic material is
introduced into a cell for the purpose of genetically modifying the
cell. Transfection can be accomplished by a variety of means known
in the art, such as calcium phosphate, polyethyleneimine,
electroporation, and the like.
[0060] "Polypeptide" encompasses both peptides and proteins, unless
indicated otherwise.
[0061] "Gene transfer" or "gene delivery" refers to methods or
systems for reliably inserting foreign DNA into host cells. Such
methods can result in transient expression of non-integrated
transferred DNA, extrachromosomal replication and expression of
transferred replicons (e.g. episomes), or integration of
transferred genetic material into the genomic DNA of host
cells.
[0062] The terms "host cell," "host cell line," and "host cell
culture" are used interchangeably and refer to cells into which
exogenous nucleic acid has been introduced, including the progeny
of such cells. Host cells include "transformants, "transformed
cells," and "transduced cells," which include the primary
transformed cell and progeny derived therefrom without regard to
the number of passages.
[0063] "Transgene" is used to mean any heterologous nucleotide
sequence incorporated in a vector, including a viral vector, for
delivery to and including expression in a target cell (also
referred to herein as a "host cell"), and associated expression
control sequences, such as promoters. It is appreciated by those of
skill in the art that expression control sequences will be selected
based on ability to promote expression of the transgene in the
target cell. An example of a transgene is a nucleic acid encoding a
therapeutic polypeptide.
[0064] "Vector," means a recombinant plasmid or virus that
comprises a polynucleotide to be delivered into a host cell, either
in vitro or in vivo.
[0065] "Substantial homology" or "substantial similarity," means,
when referring to a nucleic acid or fragment thereof, indicates
that, when optimally aligned with appropriate nucleotide insertions
or deletions with another nucleic acid (or its complementary
strand), there is nucleotide sequence identity in at least about 95
to 99% of the sequence.
[0066] "Recombinant viral vector" means a recombinant
polynucleotide vector comprising one or more heterologous sequences
(i.e., polynucleotide sequence not of viral origin). In the case of
recombinant parvovirus vectors, the recombinant polynucleotide is
flanked by at least one, preferably two, inverted terminal repeat
sequences (ITRs).
[0067] "Homologous" used in reference to peptides, refers to amino
acid sequence similarity between two peptides. When an amino acid
position in both of the peptides is occupied by identical amino
acids, they are homologous at that position. Thus by "substantially
homologous" means an amino acid sequence that is largely, but not
entirely, homologous, and which retains most or all of the activity
as the sequence to which it is homologous. As used herein,
"substantially homologous" as used herein means that a sequence is
at least 50% identical, and preferably at least 75% and more
preferably 95% homology to the reference peptide. Additional
peptide sequence modification are included, such as minor
variations, deletions, substitutions or derivatizations of the
amino acid sequence of the sequences disclosed herein, so long as
the peptide has substantially the same activity or function as the
unmodified peptides. Derivatives of an amino acid may include but
not limited to trifluoroleucine, hexafluoroleucine,
5,5,5-trifluoroisoleucine, 4,4,4-trifluorovaline,
p-fluorophenylaline, o-fluorotyrosine, m-fluorotyrosine,
2,3-difluorotyrosine, 4-fluorohistidine, 2-fluorohistidine,
2,4-difluorohistidine, fluoroproline, difluoroproline,
4-hydroxyproline, selenomethionine, telluromethionine,
selenocysteine, selenatryptophans, 4-aminotryptophan,
5-aminotryptophan, 5-hydroxytryptophan, 7-azatryptophan,
4-fluorotryptophan, 5-fluorotryptophan, 6-fluorotryptophan,
homoallylglycine, homopropargylglycine, 2-butynylglycine,
cis-crotylglycine, allylglycine, dehydroleucine, dehydroproline,
2-amino-3-methyl-4-pentenoic acid, azidohomoalanine, asidoalanine,
azidonorleucine, p-ethynylphenylalanine, p-azidophenylalanine,
p-bromophenylalanine, p-acetylphenylalanine and
benzofuranylalanine. Notably, a modified peptide will retain
activity or function associated with the unmodified peptide, the
modified peptide will generally have an amino acid sequence
"substantially homologous" with the amino acid sequence of the
unmodified sequence.
[0068] A polynucleotide or polypeptide has a certain percent
"sequence identity" to another polynucleotide or polypeptide,
meaning that, when aligned, that percentage of bases or amino acids
are the same when comparing the two sequences. Sequence similarity
can be determined in a number of different manners. To determine
sequence identity, sequences can be aligned using the methods and
computer programs, including BLAST, available over the world wide
web at ncbi.nlm.nih.gov/BLAST/. Another alignment algorithm is
FASTA, available in the Genetics Computing Group (GCG) package,
from Madison, Wis., USA. Other techniques for alignment are
described in Methods in Enzymology, vol. 266: Computer Methods for
Macromolecular Sequence Analysis (1996), ed. Doolittle, Academic
Press, Inc. Of particular interest are alignment programs that
permit gaps in the sequence. The Smith-Waterman is one type of
algorithm that permits gaps in sequence alignments. See Meth. Mol.
Biol. 70: 173-187 (1997). Also, the GAP program using the Needleman
and Wunsch alignment method can be utilized to align sequences. See
J. Mol. Biol. 48: 443-453 (1970).
[0069] Of interest is the BestFit program using the local homology
algorithm of Smith and Waterman (1981, Advances in Applied
Mathematics 2: 482-489) to determine sequence identity. The gap
generation penalty will generally range from 1 to 5, usually 2 to 4
and in many embodiments will be 3. The gap extension penalty will
generally range from about 0.01 to 0.20 and in many instances will
be 0.10. The program has default parameters determined by the
sequences inputted to be compared. Preferably, the sequence
identity is determined using the default parameters determined by
the program. This program is available also from Genetics Computing
Group (GCG) package, from Madison, Wis., USA.
[0070] Another program of interest is the FastDB algorithm. FastDB
is described in Current Methods in Sequence Comparison and
Analysis, Macromolecule Sequencing and Synthesis, Selected Methods
and Applications, pp. 127-149, 1988, Alan R. Liss, Inc.
[0071] Percent sequence identity is calculated by FastDB based upon
the following parameters: Mismatch Penalty: 1.00; Gap Penalty:
1.00; Gap Size Penalty: 0.33; and Joining Penalty: 30.0.
[0072] The present invention provides for modified FXN genes. The
invention also provides nucleic acid constructs, such as vectors,
which include as part of their sequence a modified FXN gene, e.g.,
GC content optimized FXN gene sequence comprising a greater or
lesser amount of GC nucleotides compared with the wild type FXN
gene sequence and/or a FXN gene sequence having reduced levels of
CpG dinucleotides compared with the level of CpG dinucleotides
present in the wild type FXN gene. For example, the invention
includes plasmids and/or other vectors that include the modified
FXN sequence along with other elements, such as regulatory
elements. Further, the invention provides packaged gene delivery
vehicle, such as a viral capsid, including the modified FXN
sequence. The invention also includes methods of delivery and,
preferably, expressing the modified FXN gene by delivering the
modified sequence into a cell along with elements required to
promote expression in the cell. The invention also provides gene
therapy methods in which the modified FXN gene sequence is
administered to a subject, e.g., as a component of a vector and/or
packaged as a component of a viral gene delivery vehicle. Treatment
may, for example, be effected to increase levels of frataxin in a
subject and treat a frataxin deficiency in the subject. Each of
these aspects of the invention is discussed further in the ensuing
sections.
Modified Nucleic Acid for Expression of Frataxin
[0073] The invention provides a modified nucleotide sequence
encoding frataxin. The modified nucleotide sequence includes the
wild type or native FXN gene sequence including one or more
modifications.
[0074] In one aspect, the modified nucleic acid sequence provides a
detectably greater level of expression of frataxin in a cell
compared with the expression of frataxin from the wild type nucleic
acid sequence of SEQ ID NO:2 in an otherwise identical cell. This
can be referred to as an "expression optimized" or "enhanced
expression" nucleic acid, or simply, as a "modified nucleic
acid."
[0075] "Optimized" or "codon-optimized" as referred to
interchangeably herein, refers to a coding sequence that has been
optimized relative to a wild type coding sequence (e.g., a coding
sequence for frataxin) to increase expression of the coding
sequence, e.g., by minimizing usage of rare codons, decreasing the
number of CpG dinucleotides, removing cryptic splice donor or
acceptor sites, removing Kozak sequences, removing ribosomal entry
sites, and the like.
[0076] Examples of modifications include elimination of one or more
cis-acting motifs and introduction of one or more Kozak sequences.
In one embodiment, one or more cis-acting motifs are eliminated and
one or more Kozak sequences are introduced.
[0077] Examples of cis acting motifs that may be eliminated include
internal TATA-boxes; chi-sites; ribosomal entry sites; ARE, INS,
and/or CRS sequence elements; repeat sequences and/or RNA secondary
structures; (cryptic) splice donor and/or acceptor sites, branch
points; and Sall.
[0078] In one embodiment, the GC content (e.g., the number of G and
C nucleotides present in a nucleic acid sequence) is enhanced
relative to wild-type FXN gene sequence of SEQ ID NO:2. The GC
content is preferably at least 5%, more preferably, at least 6%,
yet more preferably, at least 7%, even more preferably, at least
8%, more preferably, at least 9%, even more preferably, at least
10%, yet more preferably, at least 12%, even more preferably, at
least 14%, yet more preferably, at least 15%, more preferably, at
least 17%, even more preferably, at least 20%, even further
preferably, at least 30%, yet more preferably, at least 40%, more
preferably, at least 50%, even more preferably, at least 60%, and
most preferably, at least 70% greater than the wild type gene (SEQ
ID NO:2).
[0079] In another embodiment, the GC content is expressed as a
percentage of G (guanine) and C (cytosine) nucleotides in the
sequence. That is, the GC content of the wild type nucleic acid
encoding frataxin (SEQ ID NO:1) is about 55% whereas the GC content
of representative modified FXN genes of the invention ranges from
about 57% for IDT-3 (SEQ ID NO:8), 57% for Genescript (SEQ ID
NO:6); 61% for GeneArt (SEQ ID NO:5), and 69% for JCAT (SEQ ID
NO:4). Thus, the modified nucleic acid of the invention comprises a
of at least 57%, more preferably, a GC content of at least 61%,
even more preferably, a GC content of least 69%, compared with the
GC content of about 55% of the wild type nucleic acid sequence
encoding frataxin as set forth in SEQ ID NO:2.
[0080] In one embodiment, the GC content of a modified nucleic acid
of the invention is greater than the GC content of the wild type
nucleic acid encoding frataxin comprising the nucleic acid sequence
of SEQ ID NO:2. One skilled in the art would appreciate, knowing
the degeneracy of the nucleic acid code, that irrespective of the
sequence of the nucleic acid encoding the protein, the amino acid
sequence of frataxin expressed therefrom is, preferably, the amino
acid sequence of SEQ ID NO:1.
[0081] In one embodiment, the GC content of a modified nucleic acid
encoding FXN of the invention is about the same, i.e., 55%, as the
GC content of wild type FNX gene (SEQ ID NO:2).
[0082] Additionally, the codon adaptation index of the modified
nucleic acid encoding frataxin (i.e., the modified FXN gene) is
preferably at least 0.74, preferably, at least 0.76, even more
preferably, at least 0.77, yet more preferably, at least 0.80,
preferably, at least 0.85, more preferably, at least 0.86, yet more
preferably, at least 0.87, even more preferably, at least 0.90, yet
more preferably, at least 0.95, and most preferably, at least
0.98.
[0083] In another embodiment the modified FXN sequence has a
reduced level of CpG dinucleotides that being a reduction of about
10%, 20%, 30%, 50% or more, compared with the wild type nucleic
acid sequence encoding FXN (e.g., SEQ ID NO:2).
[0084] It is known that methylation of CpG dinucleotides plays an
important role in the regulation of gene expression in eukaryotes.
Specifically, methylation of CpG dinucleotides in eukaryotes
essentially serves to silence gene expression through interfering
with the transcriptional machinery. As such, because of the gene
silencing evoked by methylation of CpG motifs, the nucleic acids
and vectors of the invention having a reduced number of CpG
dinucleotides will provide for high and long lasting transgene
expression level.
[0085] In one embodiment, the modified FXN gene comprises fewer
potential CpG island regions than wild type FXN gene, i.e., 128.
Preferably, the modified FXN gene comprises about 124 potential CpG
island regions, more preferably, about 123, even more preferably,
about 117, and more preferably, about 114 potential CpG island
regions.
[0086] The modified FXN gene sequence may also include flanking
restriction sites to facilitate subcloning into expression vector.
Many such restriction sites are well known in the art, and include,
but are not limited to, those shown in FIGS. 2A-2F, and FIG. 3
(plasmid map of scAAV plasmid vector pTRs-KS-CBh-EGFP-BGH) and
Table 8 (SEQ ID NOs:19-23), such as, AgeI, AvrII, SpeI and
MluI.
[0087] The invention also includes fragments of any one of
sequences SEQ ID NOs:3 through 9 which encode a functionally active
fragment frataxin. "Functionally active" or "functional frataxin"
indicates that the fragment provides the same or similar biological
activity as a full-length frataxin. That is, the fragment provides
the same activity including, but not limited to, correcting primary
Fe-S cluster deficit, decreasing mitochondrial iron accumulation
(Puccio et al., 2001, Nature Genetics 27:181-186; Seznec et al.,
2004, Human Mol. Genet. 13:1017-1024) and other deficiencies as
discussed in Perdomini et al., 2014, Nature Med. 20(5):542-547. The
biological activity of FXN, or a functional fragment thereof, also
encompasses reversing or preventing the cardiac phenotype
associated with FRDA as demonstrated elsewhere herein in Mck
mice.
[0088] The invention includes a nucleic acid vector including the
modified FXN gene sequence and various regulatory or control
elements. The precise nature of regulatory elements useful for gene
expression will vary from organism to organism and from cell type
to cell type. In general, they include a promoter which directs the
initiation of RNA transcription in the cell of interest. The
promoter may be constitutive or regulated. Constitutive promoters
are those which cause an operably linked gene to be expressed
essentially at all times. Regulated promoters are those which can
be activated or deactivated. Regulated promoters include inducible
promoters, which are usually "off" but which may be induced to turn
"on," and "repressible" promoters, which are usually "on" but may
be turned "off." Many different regulators are known, including
temperature, hormones, cytokines, heavy metals and regulatory
proteins. The distinctions are not absolute; a constitutive
promoter may often be regulated to some degree. In some cases an
endogenous pathway may be utilized to provide regulation of the
transgene expression, e.g., using a promoter that is naturally
downregulated when the pathological condition improves.
[0089] Examples of suitable promoters include adenoviral promoters,
such as the adenoviral major late promoter; heterologous promoters,
such as the cytomegalovirus (CMV) promoter; the respiratory
syncytial virus promoter; the Rous Sarcoma Virus (RSV) promoter;
the albumin promoter; inducible promoters, such as the Mouse
Mammary Tumor Virus (MMTV) promoter; the metallothionein promoter;
heat shock promoters; the .alpha.-1-antitrypsin promoter; the
hepatitis B surface antigen promoter; the transferrin promoter; the
apolipoprotein A-1 promoter; chicken beta-actin CBA) promoter, the
CBh promoter (SEQ ID NO:25), and the CAG promoter (cytomegalovirus
early enhancer element and the promoter, the first exon, and the
first intron of chicken beta-actin gene and the splice acceptor of
the rabbit beta-globin gene) (Alexopoulou et al., 2008, BioMed.
Central Cell Biol. 9:2), and human FXN promoters. The promoter may
be a tissue-specific promoter, such as the mouse albumin promoter,
which is active in liver cells as well as the transthyretin
promoter (TTR).
[0090] In another aspect, the modified nucleic acid encoding FXN
further comprises an enhancer to increase expression of the FXN
protein. Many enhancers are known in the art, including, but not
limited to, the cytomegalovirus major immediate-early enhancer.
More specifically, the CMV MIE promoter comprises three regions:
the modulator, the unique region and the enhancer (Isomura and
Stinski, 2003, J. Virol. 77(6):3602-3614). The CMV enhancer region
can be combined with other promoters, or a portion thereof, to form
hybrid promoters to further increase expression of a nucleic acid
operably linked thereto. For example, a chicken beta-actin (CBA)
promoter, or a portion thereof, can be combined with the CMV
promoter/enhancer, or a portion thereof, to make a version of CBA
termed the "CBh" promoter, which stands for chicken beta-actin
hybrid promoter, as described in Gray et al. (2011, Human Gene
Therapy 22:1143-1153).
[0091] Further, the control elements can include a collagen
stabilization sequence (CSS), a stop codon, a termination sequence,
and a poly-adenylation signal sequence, such as, but not limited to
a bovine growth hormone poly A signal sequence (bGHpolyA), to drive
efficient addition of a poly-adenosine "tail" at the 3' end of a
eukaryotic mRNA (see, e.g., Goodwin and Rottman, 1992, J. Biol.
Chem. 267(23):16330-16334).
Non-Viral Vectors
[0092] In a particular embodiment, the vector used according to the
invention is a non-viral vector. Typically, the non-viral vector
may be a plasmid which includes nucleic acid sequences reciting the
modified FXN gene, or variants thereof.
Packaged Modified FXN Sequence
[0093] The modified FXN gene sequence may also be provided as a
component of a packaged viral vector. In general, packaged viral
vectors include a viral vector packaged in a capsid. Viral vectors
and viral capsids are discussed in the ensuing sections. The
nucleic acid packaged in the rAAV vector can be single-stranded
(ss), self-complementary (sc), or double-stranded (ds).
Viral Vector
[0094] Typically, viral vectors carrying transgenes are assembled
from polynucleotides encoding the transgene, suitable regulatory
elements and elements necessary for production of viral proteins
which mediate cell transduction. Examples of a viral vector include
but are not limited to adenoviral, retroviral, lentiviral,
herpesvirus and adeno-associated virus (AAV) vectors.
[0095] The viral vector component of the packaged viral vectors
produced according to the methods of the invention includes at
least one transgene, e.g., a modified FXN gene sequence and
associated expression control sequences for controlling expression
of the modified FXN gene sequence.
[0096] In a preferred embodiment, the viral vector includes a
portion of a parvovirus genome, such as an AAV genome with rep and
cap deleted and/or replaced by the modified FXN gene sequence and
its associated expression control sequences. The modified FXN gene
sequence is typically inserted adjacent to one or two (i.e., is
flanked by) AAV TRs or TR elements adequate for viral replication
(Xiao et al., 1997, J. Virol. 71(2): 941-948), in place of the
nucleic acid encoding viral rep and cap proteins. Other regulatory
sequences suitable for use in facilitating tissue-specific
expression of the modified FXN gene sequence in the target cell may
also be included.
[0097] One skilled in the art would appreciate that an AAV vector
comprising a transgene and lacking virus proteins needed for viral
replication (e.g., cap and rep), cannot replicate since such
proteins are necessary for virus replication and packaging.
Further, AAV is a Dependovirus in that it cannot replicate in a
cell without co-infection of the cell by a helper virus. Helper
viruses include, typically, adenovirus or herpes simplex virus.
Alternatively, as discussed below, the helper functions (E1a, E1b,
E2a, E4, and VA RNA) can be provided to a packaging cell including
by transfecting the cell with one or more nucleic acids encoding
the various helper elements and/or the cell can comprise the
nucleic acid encoding the helper protein. For instance, HEK 293
were generated by transforming human cells with adenovirus 5 DNA
and now express a number of adenoviral genes, including, but not
limited to E1 and E3 (see, e.g., Graham et al., 1977, J. Gen.
Virol. 36:59-72). Thus, those helper functions can be provided by
the HEK 293 packaging cell without the need of supplying them to
the cell by, e.g., a plasmid encoding them.
[0098] The viral vector may be any suitable nucleic acid construct,
such as a DNA or RNA construct and may be single stranded, double
stranded, or duplexed (i.e., self complementary as described in WO
2001/92551).
[0099] One skilled in the art would appreciate that a rAAV vector
can further include a "stuffer" or "filler" sequence
(filler/stuffer) where the nucleic acid comprising the transgene is
less than the approximately 4.1 to 4.9 kb size for optimal
packaging of the nucleic acid into the AAV capsid. See, Grieger and
Samulski, 2005, J. Virol. 79(15):9933-9944. That is, AAV vectors
typically accept inserts of DNA having a defined size range which
is generally about 4 kb to about 5.2 kb, or slightly more. Thus,
for shorter sequences, inclusion of a filler/stuffer in the insert
fragment in order to adjust the length to near or at the normal
size of the virus genomic sequence acceptable for AAV vector
packaging into virus particle. In various embodiments, a
filler/stuffer nucleic acid sequence is an untranslated
(non-protein encoding) segment of nucleic acid. In particular
embodiments of a rAAV vector, a heterologous polynucleotide
sequence has a length less than 4.7 Kb and the filler/stuffer
polynucleotide sequence has a length that when combined (e.g.,
inserted into a vector) with the heterologous polynucleotide
sequence has a total length between about 3.0-5.5 Kb, or between
about 4.0-5.0 Kb, or between about 4.3-4.8 Kb.
[0100] An intron can also function as a filler/stuffer
polynucleotide sequence in order to achieve a length for AAV vector
packaging into a virus particle. Introns and intron fragments that
function as a filler/stuffer polynucleotide sequence also can
enhance expression. For example, inclusion of an intron element may
enhance expression compared with expression in the absence of the
intron element (Kurachi et al., 1995, J. Biol. Chem.
270(10):5276-5281). Furthermore, filler/stuffer polynucleotide
sequences are well known in the art and include, but are not
limited to, those described in WO 2014/144486.
Viral Capsid
[0101] The viral capsid component of the packaged viral vectors may
be a parvovirus capsid. AAV Cap and chimeric capsids are preferred.
Examples of suitable parvovirus viral capsid components are capsid
components from the family Parvoviridae, such as an autonomous
parvovirus or a Dependovirus. For example, the viral capsid may be
an AAV capsid (e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7 AAV8,
AAV9, AAV10, AAV11, AAV12, AAV1.1, AAV2.5, AAV6.1, AAV6.3.1,
AAV9.45, AAVrh10, AAVrh74, RHM4-1 (SEQ ID NO:5 of WO 2015/013313),
AAV2-TT, AAV2-TT-S312N, AAV3B-S312N, AAV-LK03, snake AAV, avian
AAV, bovine AAV, canine AAV, equine AAV, ovine AAV, goat AAV,
shrimp AAV, and any other AAV now known or later discovered. see,
e.g., Fields et al., VIROLOGY, volume 2, chapter 69 (4.sup.th ed.,
Lippincott-Raven Publishers). Capsids may be derived from a number
of AAV serotypes disclosed in U.S. Pat. No. 7,906,111; Gao et al.,
2004, J. Virol. 78:6381; Moris et al., 2004, Virol. 33:375; WO
2013/063379; WO 2014/194132; and include true type AAV (AAV-TT)
variants disclosed in WO 2015/121501, and RHM4-1, RHM15-1 through
RHM15-6, and variants thereof, disclosed in WO 2015/013313, and one
skilled in the art would know there are likely other variants not
yet identified that perform the same or similar function, or may
include components from two or more AAV capsids. A full complement
of AAV Cap proteins includes VP1, VP2, and VP3. The ORF comprising
nucleotide sequences encoding AAV VP capsid proteins may comprise
less than a full complement AAV Cap proteins or the full complement
of AAV Cap proteins may be provided.
[0102] One or more of the AAV Cap proteins may be a chimeric
protein, including amino acid sequences of AAV Caps from two or
more viruses, preferably two or more AAVs, as described in
Rabinowitz et al., U.S. Pat. No. 6,491,907, the entire disclosure
of which is incorporated herein by reference. For example, the
chimeric virus capsid can include an AAV1 Cap protein or subunit
and at least one AAV2 Cap or subunit. The chimeric capsid can, for
example, include an AAV capsid with one or more B19 Cap subunits,
e.g., an AAV Cap protein or subunit can be replaced by a B19 Cap
protein or subunit. For example, in a preferred embodiment, the Vp3
subunit of the AAV capsid can be replaced by the Vp2 subunit of
B19.
[0103] Another embodiment includes chimeric viral strains
synthesized include the combination of AAV backbones from AAV2,
AAV3, AAV6, AAV8, etc., with a galactose (Gal) binding footprint
from AAV9. Adeno-associated viruses (AAVs) are helper-dependent
parvoviruses that exploit heparan sulfate (HS), galactose (Gal), or
sialic acids (Sia) as primary receptors for cell surface binding.
For instance, AAV serotypes 2 and 3b utilize HS. AAV1, 4, and 5
bind Sia with different linkage specificities, AAV serotype 6,
which recognizes both Sia and HS, whereas AAV9 exploits Gal for
host cell attachment. Specifically, the galactose (Gal) binding
footprint from AAV9 was grafted onto the heparin sulfate-binding
AAV serotype 2 and just grafting of orthogonal glycan binding
footprints improves transduction efficiency. A new dual
glycan-binding strain (AAV2G9) and a chimeric, muscle-tropic strain
(AAV2i8G9) were generated by incorporating the Gal binding
footprint from AAV9 into the AAV2 VP3 backbone or the chimeric
AAV2i8 capsid template using structural alignment and site-directed
mutagenesis. In vitro binding and transduction assays confirmed the
exploitation of both HS and Gal receptors by AAV2G9 for cell entry.
Subsequent in vivo characterization of the kinetics of transgene
expression and vector genome biodistribution profiles indicate
fast, sustained, and enhanced transgene expression by this
rationally engineered chimeric AAV strain. A similar, improved
transduction profile was observed with the liver-detargeted,
muscle-specific AAV2i8G9 chimera (Shen, et al., 2013, J. Biol.
Chem. 288(4):28814-28823). Such new grafting combination is fully
described in WO2014/144229 the contents of which are incorporated
by reference herein. Additional liver de-targeted AAVs, such as
AAV9.45, are described in Pulicherla et al., 2011, Molecular
Therapy 19(6):1070-1078, the contents of which are incorporated by
reference as if set forth in their entirety herein.
[0104] In yet another embodiment the present invention provides for
the use of ancestral AAV vectors for use in therapeutic in vivo
gene therapy. Specifically, in silico-derived sequences were
synthesized de novo and characterized for biological activities.
This effort led to the generation of nine functional putative
ancestral AAVs and the identification of Anc80, the predicted
ancestor of AAV serotypes 1, 2, 8 and 9 (Zinn et al., 2015, Cell
Reports 12:1056-1068). Predicting and synthesis of such ancestral
sequences in addition to assembling into a virus particle may be
accomplished by using the methods described in WO 2015/054653, the
contents of which are incorporated by reference herein. Notably,
the use of the virus particles assembled from ancestral viral
sequences exhibit reduced susceptibility to pre-existing immunity
in current day human population than do contemporary viruses or
portions thereof.
Production of Packaged Viral Vector
[0105] The invention includes packaging cells, which are
encompassed by "host cells," which may be cultured to produce
packaged viral vectors of the invention. The packaging cells of the
invention generally include cells with heterologous (1) viral
vector function(s), (2) packaging function(s), and (3) helper
function(s). Each of these component functions is discussed in the
ensuing sections.
[0106] Initially, the vectors can be made by several methods known
to skilled artisans (see, e.g., WO 2013/063379). A preferred method
is described in Grieger, et al. 2015, Molecular Therapy
24(2):287-297, the contents of which are incorporated by reference
herein for all purposes. Briefly, efficient transfection of HEK293
cells is used as a starting point, wherein an adherent HEK293 cell
line from a qualified clinical master cell bank is used to grow in
animal component-free suspension conditions in shaker flasks and
WAVE bioreactors that allow for rapid and scalable rAAV production.
Using the triple transfection method (e.g., WO 96/40240), the
suspension HEK293 cell line generates greater than 1.times.10.sup.5
vector genome containing particles (vg)/cell or greater than
1.times.10.sup.14 vg/L of cell culture when harvested 48 hours
post-transfection. More specifically, triple transfection refers to
the fact that the packaging cell is transfected with three
plasmids: one plasmid encodes the AAV rep and cap genes, another
plasmid encodes various helper functions (e.g., adenovirus or HSV
proteins such as E1a, E1b, E2a, E4, and VA RNA, and another plasmid
encodes the transgene and its various control elements (e.g.,
modified FXN gene and CBh promoter).
[0107] To achieve the desired yields, a number of variables are
optimized such as selection of a compatible serum-free suspension
media that supports both growth and transfection, selection of a
transfection reagent, transfection conditions and cell density. A
universal purification strategy, based on ion exchange
chromatography methods, was also developed that resulted in high
purity vector preps of AAV serotypes 1-6, 8, 9 and various chimeric
capsids. This user-friendly process can be completed within one
week, results in high full to empty particle ratios (>90% full
particles), provides post-purification yields
(>1.times.10.sup.13 vg/L) and purity suitable for clinical
applications and is universal with respect to all serotypes and
chimeric particles. This scalable manufacturing technology has been
utilized to manufacture GMP Phase I clinical AAV vectors for
retinal neovascularization (AAV2), Hemophilia B (scAAV8), Giant
Axonal Neuropathy (scAAV9) and Retinitis Pigmentosa (AAV2), which
have been administered into patients. In addition, a minimum of a
5-fold increase in overall vector production by implementing a
perfusion method that entails harvesting rAAV from the culture
media at numerous time-points post-transfection.
Viral Vector Functions
[0108] The packaging cells of the invention include viral vector
functions, along with packaging and vector functions. The viral
vector functions typically include a portion of a parvovirus
genome, such as an AAV genome, with rep and cap deleted and
replaced by the modified FXN sequence and its associated expression
control sequences. The viral vector functions include sufficient
expression control sequences to result in replication of the viral
vector for packaging. Typically, the viral vector includes a
portion of a parvovirus genome, such as an AAV genome with rep and
cap deleted and replaced by the transgene and its associated
expression control sequences. The transgene is typically flanked by
two AAV TRs, in place of the deleted viral rep and cap ORFs.
Appropriate expression control sequences are included, such as a
tissue-specific promoter and other regulatory sequences suitable
for use in facilitating tissue-specific expression of the transgene
in the target cell. The transgene is typically a nucleic acid
sequence that can be expressed to produce a therapeutic polypeptide
or a marker polypeptide.
[0109] "Duplexed vectors" may interchangeably be referred to herein
as "dimeric" or "self-complementary" vectors. The duplexed
parvovirus particles may, for example, comprise a parvovirus capsid
containing a virion DNA (vDNA). The vDNA is self-complementary so
that it may form a hairpin structure upon release from the viral
capsid. The duplexed vDNA appears to provide to the host cell a
double-stranded DNA that may be expressed (i.e., transcribed and,
optionally, translated) by the host cell without the need for
second-strand synthesis, as required with conventional parvovirus
vectors. Duplexed/self-complementary rAAV vectors are well-known in
the art and described, e.g., in WO 2001/92551, WO 2015/006743, and
many others.
[0110] The viral vector functions may suitably be provided as
duplexed vector templates, as described in U.S. Pat. No. 7,465,583
to Samulski et al. (the entire disclosure of which is incorporated
herein by reference for its teaching regarding duplexed vectors).
Duplexed vectors are dimeric self-complementary (sc)
polynucleotides (typically, DNA). The duplexed vector genome
preferably contains sufficient packaging sequences for
encapsidation within the selected parvovirus capsid (e.g., AAV
capsid). Those skilled in the art will appreciate that the duplexed
vDNA may not exist in a double-stranded form under all conditions,
but has the ability to do so under conditions that favor annealing
of complementary nucleotide bases. "Duplexed parvovirus particle"
encompasses hybrid, chimeric and targeted virus particles.
Preferably, the duplexed parvovirus particle has an AAV capsid,
which may further be a chimeric or targeted capsid, as described
above.
[0111] The viral vector functions may suitably be provided as
duplexed vector templates, as described in U.S. Pat. No. 7,465,583
to Samulski et al. (the entire disclosure of which is incorporated
herein by reference for its teaching regarding duplexed vectors).
Duplexed vectors are dimeric self-complementary (sc)
polynucleotides (typically, DNA). For example, the DNA of the
duplexed vectors can be selected so as to form a double-stranded
hairpin structure due to intrastrand base pairing. Both strands of
the duplexed DNA vectors may be packaged within a viral capsid. The
duplexed vector provides a function comparable to double-stranded
DNA virus vectors and can alleviate the need of the target cell to
synthesize complementary DNA to the single-stranded genome normally
encapsulated by the virus.
[0112] The TR(s) (resolvable and non-resolvable) selected for use
in the viral vectors are preferably AAV sequences, with serotypes
1, 2, 3, 4, 5 and 6 being preferred. Resolvable AAV TRs need not
have a wild-type TR sequence (e.g., a wild-type sequence may be
altered by insertion, deletion, truncation or missense mutations),
as long as the TR mediates the desired functions, e.g., virus
packaging, integration, and/or provirus rescue, and the like. The
TRs may be synthetic sequences that function as AAV inverted
terminal repeats, such as the "double-D sequence" as described in
U.S. Pat. No. 5,478,745 to Samulski et al., the entire disclosure
of which is incorporated in its entirety herein by reference.
Typically, but not necessarily, the TRs are from the same
parvovirus, e.g., both TR sequences are from AAV2
[0113] The packaging functions include capsid components. The
capsid components are preferably from a parvoviral capsid, such as
an AAV capsid or a chimeric AAV capsid function. Examples of
suitable parvovirus viral capsid components are capsid components
from the family Parvoviridae, such as an autonomous parvovirus or a
Dependovirus. For example, the capsid components may be selected
from AAV capsids, e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7,
AAV8, AAV9, AAV10, AAV11, AAV12, AAVrh10, AAVrh74, RHM4-1, RHM15-1,
RHM15-2, RHM15-3/RHM15-5, RHM15-4, RHM15-6, AAV Hu.26, AAV1.1 (SEQ
ID NO:15), AAV2.5 (SEQ ID NO. 13), AAV6.1 (SEQ ID NO:17), AAV6.3.1
(SEQ ID NO:18), AAV9.45, AAV2i8 (SEQ ID NO:29), AAV2G9, AAV2i8G9,
AAV2-TT (SEQ ID NO:31), AAV2-TT-S312N (SEQ ID NO:33), AAV3B-S312N,
and AAV-LK03, and other novel capsids as yet unidentified or from
non-human primate sources. Capsid components may include components
from two or more AAV capsids.
[0114] In a more preferred embodiment, one or more of the VP capsid
proteins is a chimeric protein, comprising amino acid sequences
from two or more viruses, preferably two or more AAVs, as described
in Rabinowitz et al., U.S. Pat. No. 6,491,907. A chimeric capsid is
described herein as having at least one amino acid residue from one
serotype combined with another serotype that is sufficient to
modify a) viral yield, b) immune response, c) targeting, d)
de-targeting, etc.
[0115] Further chimeric proteins can be made by instruction set
forth in Li, et al., 2008, Mol. Ther. 16(7):1252-1260, the contents
of which are incorporated by reference herein. Specifically, a DNA
shuffling-based approach was used for developing cell type-specific
vectors through directed evolution. Capsid genomes of
adeno-associated virus (AAV) serotypes 1-9 were randomly fragmented
and reassembled using PCR to generate a chimeric capsid library. A
single infectious clone (chimeric-1829) containing genome fragments
from AAV1, 2, 8, and 9 was isolated from an integrin minus hamster
melanoma cell line previously shown to have low permissiveness to
AAV. Molecular modeling studies suggest that AAV2 contributes to
surface loops at the icosahedral threefold axis of symmetry, while
AAV1 and 9 contribute to two- and five-fold symmetry interactions,
respectively. The C-terminal domain (AAV9) was identified as a
critical structural determinant of melanoma tropism through
rational mutagenesis. Chimeric-1829 utilizes heparan sulfate as a
primary receptor and transduces melanoma cells more efficiently
than all serotypes. Application of this technology to alternative
cell/tissue types using AAV or other viral capsid sequences is
likely to yield a new class of biological nanoparticles as vectors
for human gene transfer.
[0116] The packaged viral vector generally includes the modified
FXN gene sequence and expression control sequences flanked by TR
elements, referred to herein as the "transgene" or "transgene
expression cassette," sufficient to result in packaging of the
vector DNA and subsequent expression of the modified FXN gene
sequence in the transduced cell. The viral vector functions may,
for example, be supplied to the cell as a component of a plasmid or
an amplicon. The viral vector functions may exist
extrachromosomally within the cell line and/or may be integrated
into the cell's chromosomal DNA.
[0117] Any method of introducing the nucleotide sequence carrying
the viral vector functions into a cellular host for replication and
packaging may be employed, including but not limited to,
electroporation, calcium phosphate precipitation, microinjection,
cationic or anionic liposomes, and liposomes in combination with a
nuclear localization signal. In embodiments wherein the viral
vector functions are provided by transfection using a virus vector;
standard methods for producing viral infection may be used.
Packaging Functions
[0118] The packaging functions include genes for viral vector
replication and packaging. Thus, for example, the packaging
functions may include, as needed, functions necessary for viral
gene expression, viral vector replication, rescue of the viral
vector from the integrated state, viral gene expression, and
packaging of the viral vector into a viral particle. The packaging
functions may be supplied together or separately to the packaging
cell using a genetic construct such as a plasmid or an amplicon, a
Baculovirus, or HSV helper construct. The packaging functions may
exist extrachromosomally within the packaging cell, but are
preferably integrated into the cell's chromosomal DNA. Examples
include genes encoding AAV Rep and Cap proteins.
Helper Functions
[0119] The helper functions include helper virus elements needed
for establishing active infection of the packaging cell, which is
required to initiate packaging of the viral vector. Examples
include functions derived from adenovirus, baculovirus and/or
herpes virus sufficient to result in packaging of the viral vector.
For example, adenovirus helper functions will typically include
adenovirus components E1a, E1b, E2a, E4, and VA RNA. The packaging
functions may be supplied by infection of the packaging cell with
the required virus. The packaging functions may be supplied
together or separately to the packaging cell using a genetic
construct such as a plasmid or an amplicon. See, e.g., pXR helper
plasmids as described in Rabinowitz et al., 2002, J. Virol. 76:791,
and pDG plasmids described in Grimm et al., 1998, Human Gene
Therapy 9:2745-2760. The packaging functions may exist
extrachromosomally within the packaging cell, but are preferably
integrated into the cell's chromosomal DNA (e.g., E1 or E3 in HEK
293 cells).
[0120] Any suitable helper virus functions may be employed. For
example, where the packaging cells are insect cells, baculovirus
may serve as a helper virus. Herpes virus may also be used as a
helper virus in AAV packaging methods. Hybrid herpes viruses
encoding the AAV Rep protein(s) may advantageously facilitate for
more scalable AAV vector production schemes.
[0121] Any method of introducing the nucleotide sequence carrying
the helper functions into a cellular host for replication and
packaging may be employed, including but not limited to,
electroporation, calcium phosphate precipitation, microinjection,
cationic or anionic liposomes, and liposomes in combination with a
nuclear localization signal. In embodiments wherein the helper
functions are provided by transfection using a virus vector or
infection using a helper virus; standard methods for producing
viral infection may be used.
Packaging Cell
[0122] Any suitable permissive or packaging cell known in the art
may be employed in the production of the packaged viral vector.
Mammalian cells or insect cells are preferred. Examples of cells
useful for the production of packaging cells in the practice of the
invention include, for example, human cell lines, such as VERO,
WI38, MRC5, A549, HEK 293 cells (which express functional
adenoviral E1 under the control of a constitutive promoter), B-50
or any other HeLa cells, HepG2, Saos-2, HuH7, and HT1080 cell
lines. In one aspect, the packaging cell is capable of growing in
suspension culture, more preferably, the cell is capable of growing
in serum-free culture. In one embodiment, the packaging cell is a
HEK293 that grows in suspension in serum free medium. In another
embodiment, the packaging cell is the HEK293 cell described in U.S.
Pat. No. 9,441,206 and deposited as ATCC No. PTA 13274. Numerous
rAAV packaging cell lines are known in the art, including, but not
limited to, those disclosed in WO 2002/46359.
[0123] Cell lines for use as packaging cells include insect cell
lines. Any insect cell which allows for replication of AAV and
which can be maintained in culture can be used in accordance with
the present invention. Examples include Spodoptera frugiperda, such
as the Sf9 or Sf21 cell lines, Drosophila spp. cell lines, or
mosquito cell lines, e.g., Aedes albopictus derived cell lines. A
preferred cell line is the Spodoptera frugiperda Sf9 cell line. The
following references are incorporated herein for their teachings
concerning use of insect cells for expression of heterologous
polypeptides, methods of introducing nucleic acids into such cells,
and methods of maintaining such cells in culture: Methods in
Molecular Biology, ed. Richard, Humana Press, N J (1995); O'Reilly
et al., Baculovirus Expression Vectors: A Laboratory Manual, Oxford
Univ. Press (1994); Samulski et al., 1989, J. Virol. 63:3822-3828;
Kajigaya et al., 1991, Proc. Nat'l. Acad. Sci. USA 88: 4646-4650;
Ruffing et al., 1992, J. Virol. 66:6922-6930; Kimbauer et al.,
1996, Virol. 219:37-44; Zhao et al., 2000, Virol. 272:382-393; and
Samulski et al., U.S. Pat. No. 6,204,059.
[0124] Virus capsids according to the invention can be produced
using any method known in the art, e.g., by expression from a
baculovirus (Brown et al., (1994) Virology 198:477-488). As a
further alternative, the virus vectors of the invention can be
produced in insect cells using baculovirus vectors to deliver the
rep/cap genes and rAAV template as described, for example, by Urabe
et al., 2002, Human Gene Therapy 13:1935-1943.
[0125] In another aspect, the present invention provide for a
method of rAAV production in insect cells wherein a baculovirus
packaging system or vectors may be constructed to carry the AAV Rep
and Cap coding region by engineering these genes into the
polyhedrin coding region of a baculovirus vector and producing
viral recombinants by transfection into a host cell. Notably when
using Baculavirus production for AAV, preferably the AAV DNA vector
product is a self-complementary AAV like molecule without using
mutation to the AAV ITR. This appears to be a by-product of
inefficient AAV rep nicking in insect cells which results in a
self-complementary DNA molecule by virtue of lack of functional Rep
enzyme activity. The host cell is a baculovirus-infected cell or
has introduced therein additional nucleic acid encoding baculovirus
helper functions or includes these baculovirus helper functions
therein. These baculovirus viruses can express the AAV components
and subsequently facilitate the production of the capsids.
[0126] During production, the packaging cells generally include one
or more viral vector functions along with helper functions and
packaging functions sufficient to result in replication and
packaging of the viral vector. These various functions may be
supplied together or separately to the packaging cell using a
genetic construct such as a plasmid or an amplicon, and they may
exist extrachromosomally within the cell line or integrated into
the cell's chromosomes.
[0127] The cells may be supplied with any one or more of the stated
functions already incorporated, e.g., a cell line with one or more
vector functions incorporated extrachromosomally or integrated into
the cell's chromosomal DNA, a cell line with one or more packaging
functions incorporated extrachromosomally or integrated into the
cell's chromosomal DNA, or a cell line with helper functions
incorporated extrachromosomally or integrated into the cell's
chromosomal DNA
rAAV Purification
[0128] The rAAV vector may be purified by methods standard in the
art such as by column chromatography or cesium chloride gradients.
Methods for purifying rAAV vectors are known in the art and include
methods described in Clark et al., 1999, Human Gene Therapy
10(6):1031-1039; Schenpp and Clark, 2002, Methods Mol. Med.
69:427-443; U.S. Pat. No. 6,566,118 and WO 98/09657.
Treatment Methods
[0129] The modified FXN gene may be used for gene therapy of
Friedreich ataxia associated disorders, such as, degenerative
neuro-muscular disorders and/or cardiomyopathy associated with
Friedreich ataxia. An individual may be in need of gene therapy
because, as a result of one or more mutations in the coding
sequence of the FXN gene, FXN is expressed inappropriately, e.g.,
has an incorrect amino acid sequence, or is expressed in the wrong
tissues or at the wrong times or is underexpressed. The modified
FXN gene of the present invention may be used as gene therapy to
enhance production of the protein frataxin and thereby increasing
energy production in the mitochondria. See., e.g., U.S. Pat. No.
9,066,966.
[0130] The target cells of the vectors of the instant invention are
cells capable of expressing frataxin, such as those of the cardiac
system of a mammal, neuron cells, muscle cells, and other cells
with the proper cellular machinery to process the precursor to
yield protein with frataxin activity.
Pharmaceutical Composition
[0131] In particular embodiments, the present invention provides a
pharmaceutical composition for preventing or treating a disease or
condition mediated by or associated with decreased expression of
frataxin, e.g., Friedreich ataxia. The composition comprises a
therapeutically effective amount of a vector which comprises a
modified FXN gene which can increase the level of expression of FXN
in a call. The composition comprises the vector comprising the
modified, e.g., optimized, nucleic acid encoding FXN wherein the
composition further comprises a pharmaceutically-acceptable carrier
and/or other medicinal agents, pharmaceutical agents, carriers,
adjuvants, diluents, etc. For injection, the carrier will typically
be a liquid. As an injection medium, it is preferred to use water
that contains the additives usual for injection solutions, such as
stabilizing agents, salts or saline, and/or buffers.
[0132] Exemplary pharmaceutically acceptable carriers include
sterile, pyrogen-free water and sterile, pyrogen-free, phosphate
buffered saline. Physiologically-acceptable carriers include
pharmaceutically-acceptable carriers. Pharmaceutically acceptable
carriers are those which are that is not biologically or otherwise
undesirable, i.e., the material may be administered to a subject
without causing undesirable biological effects which outweigh the
advantageous biological effects of the material.
[0133] A pharmaceutical composition may be used, for example, in
transfection of a cell ex vivo or in administering a viral vector
or cell directly to a subject.
[0134] Recombinant virus vectors comprising the modified FXN gene
are preferably administered to the cell in a biologically-effective
amount. If the virus vector is administered to a cell in vivo
(e.g., the virus is administered to a subject as described below),
a biologically-effective amount of the virus vector is an amount
that is sufficient to result in transduction and expression of the
transgene in a target cell.
[0135] In one embodiment, the invention includes a method of
increasing the level of frataxin in a cell by administering to the
cell a nucleic acid, either alone or in a vector (including a
plasmid, a virus, a nanoparticle, a liposome, or any known method
for providing a nucleic acid to a cell) comprising a modified
nucleic acid encoding frataxin. The method comprises a method
wherein the level of mRNA encoding frataxin and/or the level of
frataxin protein expressed is detectably greater than the level of
frataxin (mRNA and/or protein) in an otherwise identical cell that
is not administered the nucleic acid. The skilled artisan would
understand that the cell can be cultured or grown in vitro or can
be present in an organism (i.e., in vivo). Further, the cell may
express endogenous frataxin such that the level of frataxin in the
cell can be increased, and/or the cell can express an endogenous
frataxin that is a mutant or variant of wild type frataxin, e.g.,
frataxin having the sequence of SEQ ID NO:2, especially as there
may be more than one wild type alleles for human frataxin. Thus,
the level of frataxin is increased compared with the level of
frataxin compared with the level of frataxin expressed in an
otherwise identical but untreated cell.
[0136] A further aspect of the invention is a method of treating
subjects in vivo with the vector containing modified genes.
Administration of the vector to a human subject or an animal in
need thereof can be by any means known in the art for administering
virus vectors.
[0137] The vector can be administered in addition, and as an
adjunct to, the standard of care. That is, the vector can be
co-administered with another therapeutic agent or compound, either
simultaneously, contemporaneously, or at a determined dosing
interval as would be determined by one skilled in the art using
routine methods.
[0138] In one aspect, the rAAV of the invention can be
co-administered with empty capsids (i.e., a virus capsid that does
not contain a nucleic acid molecule) comprising the same, or a
different, capsid protein as the rAAV-FXN vector. This is because
one skilled in the art would understand that co-administration of
empty capsids may decrease an immune response, e.g., a neutralizing
response, the rAAV of the invention. That is, the empty capsid may
serve as a decoy allowing the rAAV-FXN vector to avoid a
neutralizing antibody (Nab) immune response as discussed in, e.g.,
WO 2015/013313.
[0139] Exemplary modes of administration systemic administration,
including, but not limited to, intravenous, subcutaneous,
intradermal, intramuscular, and intraarticular administration, and
the like, as well as direct tissue or organ injection.
[0140] In one embodiment, the vector is administered systemically.
One skilled in the art would appreciate that systemic
administration can deliver the therapeutic gene encoding FXN to all
tissues, including all muscles, affected by the reduced level of
FXN therein.
[0141] Nonetheless, the skilled artisan would appreciate that the
vector can be delivered directly to areas affected by the FXN
deficiency, i.e., the brain and the heart.
[0142] Accordingly, in other preferred embodiments, the inventive
vector comprising the modified FXN gene is administered by direct
injection into cardiac or central nervous system (CNS) tissue.
[0143] In one embodiment, modified nucleic acid encoding FNX, the
vector, or composition comprising the vector, is delivered
intracranially including, intrathecal, intraneural, intra-cerebral,
intra-ventricular administration.
[0144] In one embodiment, modified nucleic acid encoding FNX, the
vector, or composition comprising the vector, is delivered to the
heart by direct administration into the myocardium by epicardiac
injection followed by minithoracotomy, by intracoronary injection,
by endomyocardic injection or by another type of injection useful
in the heart.
[0145] Additional routes of administration may also comprise local
application of the vector under direct visualization, e.g.,
superficial cortical application, or other nonstereotactic
application. The vector may also be delivered, for example,
intrathecally, into the ventricles or by intravenous injection.
[0146] The target cells of the vectors of the present invention are
cells of the myocardium of a subject afflicted with a
cardiomyopathy associated with Friedreich ataxia. Preferably the
subject is a human being, adult or child. However, veterinary
applications are also contemplated.
[0147] The target cells of the vectors of the present invention
also include cells of the CNS, preferably neurons. Delivery to the
brain to treat neurodegenerative aspects of Friedreich ataxia may
be by intrathecal administration.
[0148] In one aspect, modified nucleic acid encoding FNX, the
vector, or composition comprising the vector, is delivery
systemically, e.g., intravenously, to treat the FA associated
cardiomyopathy and/or the neurodegenerative aspect of the
disease.
[0149] In another embodiment, the vector is administered by at
least two routes. That is, the vector can be administered
systemically and also directly into the brain and/or heart, or any
combination thereof.
[0150] If performed via at least two routes, the administration of
the vector can be, but need not be, simultaneous or
contemporaneous. Instead, the administrations via different routes
can be performed separately with an interval of time between each
administration. Appropriate dosing regimens are routinely
determined by those skilled in the art to achieve maximum
therapeutic benefit for each individual patient.
[0151] In one aspect, the invention includes at least one modified
nucleic acid encoding frataxin of the invention, including, but not
limited to, the nucleic acid in a vector or a pharmaceutical
composition, for use in increasing the level of frataxin in a
subject.
[0152] In one aspect, the invention includes at least one modified
nucleic acid, rAAV vector comprising the nucleic acid, and a
pharmaceutical composition comprising either the nucleic acid or
the vector, for use in treating Friedreich ataxia in a subject.
[0153] The use encompasses administering the modified nucleic acid,
or vector comprising the same, in addition to and/or concurrent
with, the standard of care for FRDA as known in the art.
[0154] Injectables can be prepared in conventional forms, either as
liquid solutions or suspensions, solid forms suitable for solution
or suspension in liquid prior to injection, or as emulsions.
[0155] Dosages of the virus vector with the modified FXN gene will
depend upon the mode of administration, the disease or condition to
be treated, the individual subject's condition, the particular
viral vector, and the gene to be delivered, and can be determined
in a routine manner. Exemplary doses for achieving therapeutic
effects are virus titers of at least about 10.sup.5, 106, 10.sup.7,
10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13,
10.sup.14, 10.sup.15 transducing units or more, preferably about
10.sup.8-1013 transducing units, yet more preferably 10.sup.12
transducing units/kg body weight.
[0156] The modified FXN gene may be administered as components of a
DNA molecule having regulatory elements appropriate for expression
in the target cells. The modified FXN gene may be administered as
components of viral plasmids, such as rAAV vectors. Viral particles
may be administered as viral particles alone, whether as an in vivo
direct delivery to the portal vasculature or as an ex vivo
treatment comprising administering the vector viral particles in
vitro to cells from the animal receiving treatment followed by
introduction of the transduced cells back into the donor.
EQUIVALENTS
[0157] The foregoing written specification is considered to be
sufficient to enable one skilled in the art to practice the
disclosure. The foregoing description and Examples detail certain
exemplary embodiments of the disclosure. It will be appreciated,
however, that no matter how detailed the foregoing may appear in
text, the disclosure may be practiced in many ways and the
disclosure should be construed in accordance with the appended
claims and any equivalents thereof.
[0158] All references cited herein, including patents, patent
applications, papers, text books, and the like, and the references
cited therein, to the extent that they are not already, are hereby
incorporated herein by reference in their entirety.
EXEMPLARY EMBODIMENTS
[0159] The invention is further described in detail by reference to
the following experimental examples. These examples are provided
for purposes of illustration only, and are not intended to be
limiting unless otherwise specified. Thus, the invention should in
no way be construed as being limited to the following examples, but
rather, should be construed to encompass any and all variations
which become evident as a result of the teaching provided
herein.
EXAMPLES
Example 1: Generation of a Self-Complimentary rAAV-FXN
Construct
Materials and Methods
[0160] Vector Construction
[0161] The pTRs-KS-CBh-EGFP-bGHpolyA construct (shown
diagrammatically in FIG. 3) encoding a self-complementary AAV
genome was used as the backbone of the transgene expression
construct (Gray et al., 2011, Human Gene Therapy 22:1143-1153). Two
codon optimized FXN gene inserts were ordered from GenScript in
pUC57, i.e., Genscript and Genscript (low CpG), and used to replace
the EGFP in the backbone vector. The Genscript (SEQ ID NO:6) and
Genscript (low CpG) (SEQ ID NO:7) modified FXN genes were each
operably linked to the CBh promoter as illustrated in FIG. 3. The
GenScript FXN (SEQ ID NO: 6 and 7) constructs included an
N-terminal AgeI site, a collagen stability sequence (CSS)
(5'-CCCAGCCCACTTTTCCCCAA-3') downstream of the FXN stop codon, a
bovine growth hormone (BGH) polyA sequence downstream of the CSS,
and a MluI site downstream of the BGH polyA all as shown in FIGS.
2E (Genscript) and 2F (Genscript (low CpG)). Exemplary inserts for
insertion into the pTRs-KS-CBh-FXN-bGHpolyA constructs are shown in
FIGS. 2A-2F and are set forth in Table 8. More specifically, wild
type frataxin gene (WT FXN; SEQ ID NO:2) was cloned into
pTRs-KS-CBh-WT FXN-bGHpolyA (FIG. 2A); an IDT1 modified FXN gene
(SEQ ID NO:11) was cloned into pTRs-KS-CBh-IDT1-bGHpolyA (FIG. 2B);
a nucleic acid encoding IDT3 low expresser modified FXN gene (SEQ
ID NO:8) was cloned into pTRs-KS-CBh-IDT3-bGHpolyA (FIG. 2C); an I
DT4 modified FXN gene (SEQ ID NO:12) was cloned into
pTRs-KS-CBh-IDT4-bGHpolyA (FIG. 2D); a Genscript (control) modified
FXN gene (SEQ ID NO:6) was cloned into
pTRs-KS-CBh-Genescript-bGHpolyA (FIG. 2E); and a Genscript (low
CpG) modified FXN gene (SEQ ID NO:7) was cloned into
pTRs-KS-CBh-Genescript (low CpG)-bGHpolyA (FIG. 2F). Each insert
encoding a FXN gene was cloned into the vector and the gene was
flanked by an AgeI site on the 5' side and by an AvrII cut site on
the 3' side, followed by a CSS sequence after the AvrII site, a
SpeI cut site after the CSS, a bGHpolyA signal sequence after the
SpeI cut site, and a MluI cut site after the polyA signal
sequence.
[0162] The backbone pTRs-KS-CBh-EGFP-bGHpolyA and the FXN gene
constructs were digested with AgeI and MluI (New England Biolabs,
R0552S and R0198S, respectively), gel extracted, and ligated using
ExTaq polymerase (Clontech, RR001A). The ligation reaction was
transformed into SURE cells (Agilent, 200227), placed in SOC
recovery media (Cat. No. 15544-034, Invitrogen) for one hour at
37.degree. C., then plated on LB plates with ampicillin (10 mg/ml).
Colonies were sequenced and chosen for amplification for virus
production. Recombinant AAV (rAAV) vectors with the AAV serotype 2
capsid were produced the UNC Vector Core by a triple-transfection
method in human embryonic kidney 293 (HEK293) cells as described
(Grieger et al., 2006, Nature Protocols 1:1412-1428).
Alternatively, rAAV vector with the serotype 2i8 capsid (amino acid
sequence of SEQ ID NO:28) was similarly produced. Highly pure
recombinant virus containing self-complementary genomes was
recovered by passage through a non-ionic iodixanol gradient
followed by ion exchange chromatography. Peak fractions were
determined by qPCR then dialyzed in phosphate-buffered saline (PBS)
containing 5% d-sorbitol. Viral titers were determined by qPCR
(Gray et al., 2010, J. Amer. Soc. Gene Therapy 18:570-578).
Following preliminary testing in vitro (below), GenScript (low CpG)
was used to generate a construct with an HA tag
TACCCATACGATGTTCCAGATTACGCT inserted prior to the FXN stop codon in
pTRs-KS-CBh-Genescript (low CpG)-bGHpolyA.
[0163] The University of North Carolina (UNC) Vector Core generated
viruses with the FXN-HA construct with rAAV TK serotypes.
[0164] In Vitro Testing of Sc rAAV-FXN.
[0165] HEK293 (ATCC: CRL-1573) and HeLa (ATCC: CCL-2) cells were
maintained in Dulbecco's modified Eagle's medium (DMEM, Gibco).
Cell growth media was supplemented with 9% fetal bovine serum (FBS,
Gibco), 3.4 mM I-glutamine, 100 U/ml penicillin and 100 .mu.g/ml
streptomycin (Gibco). Cells were kept in a 5% CO2 atmosphere at
37.degree. C. Dipstick assay: Cells were seeded in 24-well plates
so that they reached approximately 60% confluence at 24 hours (h),
then mock treated or infected in triplicate with scAAV-FXN
(interchangeably referred to herein as "rAAV-FXN" or "rAAV-FXN-HA")
at MOI 10,000 (VG/cell). At 60 h post transduction (h p.t.) cells
were according to the manufacturer protocol for the Frataxin
Protein Quantity Dipstick Assay (Abcam, ab109881). Data was
processed using ImageJ.
[0166] Western Blotting:
[0167] Cells were seeded in 6-well plates so that they reached
approximately 60% confluence at 24 h, then mock treated or infected
with scAAV-FXN at MOI 10,000 (VG/cell). At 60 h post transduction
cells were lysed with cellular lysis buffer (0.0625 M Tris-HCl pH
6.8, 10% glycerol, 2% SDS, 5% 2-mercaptoethanol, 0.02% (w/v)
Bromophenol blue). Fifteen (15) .mu.l of HeLa protein lysate was
separated by gel electrophoresis on a 15-4% TGX gel and the
proteins were electroblotted to a nitrocellulose membrane (NCM).
NCMs were blocked using 5% non-fat powdered milk in PBS-T. The
anti-frataxin antibody (Abcam, 18A5DB1) was used in PBS-T with 5%
milk. A horseradish peroxidase (HRP)-conjugated secondary antibody
in PBS-T with 5% milk antibodies was used to detect the presence of
anti-frataxin. The WesternBright ECL Western Blotting Detection kit
(Advansta, K-12045-D50) was used for detection per manufacturer's
instructions.
[0168] FIG. 1A-1B shows the results for expression of various
optimized sequences compared with expression of the unoptimized,
i.e., wild type, sequence encoding FXN (SEQ ID NO:1) in HeLa cells.
More specifically, both FIGS. 1A and 1B show a photograph of a
Western blot showing expression of frataxin (FXN) in HeLa cells
transfected with an expression vector comprising an insert encoding
frataxin. FIG. 1A shows expression of FXN in HeLa cells in a
photograph of a WesternBright blot film exposed for 1 second. FIG.
1B shows a repeat of the experiment shown in FIG. 1A demonstrating
expression of FXN in HeLa cells as shown in a photograph of a
WesternBright blot film exposed for 1 second. Each gel lane in
FIGS. 1A and 1B shows the expression of FXN from a modified FXN
gene of the invention compared with expression from a wild type
nucleic acid sequence encoding FXN. That is, lane 1 shows
expression driven by wild type non-modified nucleic acid encoding
FXN (SEQ ID NO:2); lane 2 shows expression driven by IDT2 modified
FXN gene (SEQ ID NO:3); lane 3 shows expression driven by IDT5
modified FXN gene (SEQ ID NO:9); lane 4 shows expression driven by
JCAT modified FXN gene (SEQ ID NO:4); lane 5 shows expression
driven by GeneArt modified FXN gene (SEQ ID NO:5); lane 6 shows
expression driven by GenScript (control) modified FXN gene (SEQ ID
NO:6); lane 7 shows expression driven by Genscript (low CpG)
modified FXN gene (SEQ ID NO:7); and lane GFP shows expression
transgene encoding green fluorescent protein, a detectable marker,
which is encoded by the insert instead of a nucleic acid encoding
FXN.
[0169] The data shown demonstrate that several modified FXN nucleic
acid sequences--especially lanes 4 (JCAT), 5 (GeneArt), 6
(Genscript) and 7 (Genscript low CpG)--provided greater expression
of frataxin in HeLa cells relative to the wild type nucleic acid
sequence (lane 1). An actin loading control in each lane is as a
protein loading control.
[0170] The GC nucleotide content in a nucleic acid sequence,
typically expressed as a percentage of the total number of
nucleotides in the sequence, can have multiple influences,
including, but not limited to, the stability of the mRNA is
increased, and the secondary structure and transgenes which are
typically negatively impacted by increased GC content. Thus, the
skilled artisan would appreciate that the GC content of a modified
nucleic acid reflects a balance between increased stability of the
nucleic acid, and mRNA transcribed therefrom, against the negative
effect, e.g., on secondary structure mediated by increased GC
content.
[0171] The CAI (codon adaptation index) is a measure of synonymous
codon usage bias. The index uses a reference set of highly
expressed genes from a species to assess the relative values of
each codon, and a score for a gene is calculated from the frequency
of use of all codons in that gene. The index assesses the extent to
which selection has been effective in selecting the pattern of
codon usage. It can be utilized for predicting the level of
expression of a gene and for making comparisons of codon usage in
different organisms/species. Human codon optimization was carried
out on the frataxin gene to achieve a balance of the below
factors:
[0172] Transcription Efficiency--GC content, CpG dinucleotides
content, Cryptic splicing sites, etc.;
[0173] Translation Efficiency--Codon usage bias, GC content, mRNA
secondary structure, premature polyA sites, RNA instability motifs,
internal ribosomal binding sites; and
[0174] Protein refolding--codon usage bias, interaction of codon
and anti-codon, RNA secondary structures.
[0175] Basically, codon optimization balances these variables to,
preferably, achieve a higher expressing frataxin gene sequence,
increase stability of the message (GC content, secondary structure
in both DNA and RNA), and the like, as well-known in the art.
[0176] CpG islands can be recognized by Tol-like receptor nine
(TLR9) in a transduced cell and can elicit an immune response to
the foreign (exogenous) DNA. Accordingly, in one embodiment, the
invention encompasses a modified nucleic acid encoding frataxin
wherein the number of CpG islands has been reduced compared with
the number of CpG island motifs in a wild type nucleic acid
sequence (e.g., SEQ ID NO:2) encoding frataxin.
[0177] The CAI, percent GC content, and number of potential CpG
island regions for each modified FXN gene exemplified herein is
shown in Table 1 below.
TABLE-US-00001 TABLE 1 FIG. 1A Number of and 1B Codon potential SEQ
gel lane adaptation % GC CpG island ID number FXN gene name index
(CAI) content regions NO: 1 WT-FXN 0.71 55 128 2 Nucleotide 0.71 55
-- 10 sequence 22 IDT-1 0.73 52 114 11 2 IDT-2 0.76 56 124 3 IDT-3
0.80 57 123 8 IDT-4 0.74 54 123 12 3 IDT-5 0.77 55 124 9 4 JCAT
0.98 69 144 4 5 GeneART 0.95 61 117 5 6 Genescript 0.87 57 257 6
(Control) 7 Genescript 0.86 55 117 7 (low CpG)
[0178] That is, for wild type nucleic acid encoding FXN (WT-FXN;
SEQ ID NO:2), the nucleic acid sequence demonstrates a CAI of 0.71
and a % GC content of 55%. In contrast, the JCAT modified FXN gene
demonstrates a CAI of 0.98 and a GC content of 69%, both of which
are substantially higher than the values for WT-FXN.
[0179] Potential CpG Islands were identified using publicly
available software found at
http://www.bioinformatics.org/sms2/cpg_islands.html. The CpG
Islands software reported potential CpG island regions using the
method described by Gardiner-Garden and Frommer, 1987, J. Mol.
Biol. 196(2):261-282. The calculation was performed using a 200
basepair (bp) window moving across the sequence at 1 bp intervals.
CpG islands are defined as sequence ranges where the Obs/Exp value
is greater than 0.6 and the GC content is greater than 50%. The
expected number of CpG dimers in a window was calculated as the
number of `C`s in the window multiplied by the number of `G`s in
the window, divided by the window length. Thus, the potential CpG
islands present in a nucleic acid sequence can be readily
determined by inputting the sequence at issue into the window
provided by software (indicated by the instructions to "Paste the
raw sequence or one or more FASTA sequences into the text area
below. Input limit is 100000 characters."). CpG islands are often
found in the 5` regions of vertebrate genes, therefore this program
can be used to highlight potential genes in genomic sequences.
[0180] Because of the high level of expression and the high GC
content (55%), high CAI (0.86) and low number of CpG dinucleotides
(117), the Genscript (low CpG) modified FXN gene was selected for
production of a scAAV-2i8 vector used in the animal experiments set
forth below.
Example 2: In Vivo Treatment in a Mouse Model of Friedreich
Ataxia
[0181] An art-recognized mouse model of FRDA (Perdomini et al.,
2014, Nature Med. 20(5):542) was used to assess the potential
efficacy of rAAV mediated FXN gene therapy. That is, three groups
of mice were examined: untreated Mck positive control mice (Mck-Cre
x FXN L3/WT), untreated Mck mutant mice (Mck-Cre x FXN L3/L-), and
treated Mck mutant mice that received a dose of rAAV comprising a
FXN gene wherein the modified FXN gene comprised the nucleic acid
sequence of SEQ ID NO:7 (GenScript (low CpG)) and the FXN gene was
cloned into the pTRs-KS-CBh-EGFP-BGH construct as described above
to provide pTRs-KS-CBh-Genscript (low CpG)-bGHpolyA.
[0182] The rAAV-FXN vector used in the mouse studies further
comprised a AAV2i8 capsid. Moreover, the pTRs-KS-CBh-Genscript (low
CpG)-bGHpolyA construct further comprised a nucleic acid sequence
encoding a detectable hemagglutinin tag (rAAV-FXN-HA) wherein the
sequence encoding the HA tag was located 3' of the modified FXN
gene such that expression of frataxin could be readily detected and
localized by detecting the presence of HA, e.g., using an anti-HA
antibody such as anti-HA mouse mAb (HA.11 clone 16B12, Covance
Research Products, Inc., Princeton, N.J.). The vector was
designated rAAV-FXN-HA.
[0183] The three animal groups of the study are listed and
described in Table 2.
TABLE-US-00002 TABLE 2 No. of Dose Animals Level Mixed Termination
Groups label Group No. vg/kg gender Weeks of age Mck positive
Mck-Cre .times. FXN 0 8 Week 8 control L3/WT Untreated Mck
Untreated 0 8 Week 8 mutant mice Mck-Cre .times. FXN L3/L- Treated
Mck rAAV-FXN-HA 1 .times. 10.sup.13 8 Week 8 mutant mice treated
Mck-Cre .times. FXN L3/L-
A. Biomarker Study
[0184] Methods
Measurement of Galectin-3 and H-FABP in Plasma
[0185] Blood was collected by retro orbital puncture after
isoflurane anaesthesia at the age of 5 weeks (2 weeks after
treatment) and 8 weeks (5 weeks after treatment).
[0186] Galectin-3 was measured in plasma using the Mouse Galectin-3
Elisa Kit from RayBiotech according to manufacturer's
instructions.
[0187] H-FABP was measured in plasma using the Mouse H-FABP Elisa
Kit from HycultBiotech according to manufacturer's
instructions.
Measurement of Succinate Dehydrogenase Activity in Heart
Homogenate
[0188] Upon sacrifice, the heart was collected and half of the
heart of 4 mice of each group was snap frozen for the measurement
of SDH activity.
[0189] SDH activity measurement in heart homogenate was performed
following the instruction of the Succinate Dehydrogenase Activity
Colorimetric Assay Kit (Catalog #K660-100) from Biovision.
Measurement of Human Frataxin in Tissues
[0190] Upon sacrifice, heart (half), skeletal muscle
(gastrocnemius) and liver tissues were collected and snap frozen
for the measurement of frataxin.
[0191] The measurement in tissue homogenates was performed
following the instructions of the Human Frataxin Elisa Kit (Abcam;
ab176112).
Histology
[0192] Cerebellum (including dentate nucleus), gonads, heart,
kidney, liver, lung, pancreas, skeletal muscle (gastrocnemius and
soleus), spleen and cervical, thoracic and lumbar vertebras were
formol-fixed. Vertebras were then decalcified using EDTA solution.
All organs were paraffin embedded to obtain 5 .mu.m-thick sections;
transversal sections for vertebras (including both spinal cord and
dorsal root ganglia) and heart. All organs were hematoxylin and
eosin stained; cardiac fibrosis was evaluated using Masson's
trichrome staining.
Echocardiography:
[0193] Transthoracic Echocardiographic images were captured by the
mean of a 30 MHz linear probe (MS 400) on a Vevo-2100 Visual Sonics
echograph in anesthetized mice (Isoflurane 1-2%).
[0194] The following parameters are measured to assess:
a) The cardiac morphology and ventricular systolic function (Short
axis, SAX): left ventricular end-diastolic (LVEDD) and end systolic
diameters (LVESD), septal (SW) and posterior wall thicknesses
(PVV), left ventricular mass (LVM=1.055.times.[EDD+SW+PVV)
3-EDD3)]), Ejection and shortening Fraction and cardiac output; b)
Hemodynamic profiles: pulmonary and aortic artery velocity and
pressures to detect intra-cardiac pressures changes (AoV and RV
function).
Mice
[0195] Mice were maintained in a temperature- and
humidity-controlled animal facility, with a 12-h light-dark cycle
and free access to water and a standard rodent chow (D03, SAFE,
Villemoisson-sur-Orge, France). All animal procedures and
experiments were approved by the local ethical committee (Comite
d'Ethique en Experimentation Animale IGBMC-ICS) for Animal Care and
Use (Com'Eth 2011-007).
[0196] Bi-daily clinical observation of mice was performed, body
weight was recorded weekly and food intake every 2 days until the
end of the protocol.
[0197] For bio-distribution and gene therapy studies, 3-weeks-old
mice were anesthetized with isoflurane (1-2%) and injected
intravenously into the retro-orbital vein with a rAAV-FXN-HA vector
at a dose of 1.times.10.sup.13 vg/kg for the treated group and with
an equivalent volume of saline water for Untreated MCK Mutant mice
and Control.
[0198] Mouse cardiac function was evaluated under isoflurane
anesthesia (1-2%) by echocardiography 2 days before starting the
treatment (baseline phenotype), at 5 weeks of age (14 days after
treatment) and 7 weeks of age (28 days after treatment). At 5 and 8
weeks of age, blood collection was performed to measure the
concentration of the heart type fatty acid binding protein
(H-FABP), galectin-3 and Succinate dehydrogenase (SDH) as detailed
elsewhere herein.
[0199] Upon sacrifice, body weight, body length, heart, spleen,
kidney, adrenals, and liver weights were recorded from all animals.
Adrenals, cerebellum, cervical, thoracic and lumbar vertebras,
gonads (testes and ovaries), heart, kidney, liver, lungs, pancreas,
prostate in males, skeletal muscle (gastrocnemius and soleus),
spleen and thymus were collected from 4 animals per group for
pathological evaluation and ELISA assays.
[0200] Cerebellum (including dentate nucleus), cervical, thoracic
and lumbar dorsal root ganglia, heart, kidneys, liver, lungs,
gonads, pancreas, skeletal muscle (gastrocnemius and soleus), and
spleen of 4 other animals per group were collected and immediately
snap frozen for molecular biology.
Results
Identification of Potential Biomarkers
[0201] The levels of various biomarkers were determined in three
groups of mice: untreated Mck positive control, untreated Mck
mutant mice and treated Mck mutant mice that received a dose of
rAAV2i8 comprising a FXN gene and further comprising a nucleic acid
encoding an HA tag peptide (AAV-FXN-HA).
Measurement of Galectin-3 and H-FABP in Plasma
[0202] Blood was collected by retro orbital puncture after
isoflurane anaesthesia at the age of 5 weeks (2 weeks of AAV
treatment for the treated Mck mutant mice) and 8 weeks (5 weeks of
rAAV treatment for the treated Mck mutant mice group) and the
levels of galectin-3 and H-FABP were measured using standard
methods.
Galectin-3:
[0203] At the age of 5 weeks, galectin-3 levels were comparable
between the 3 groups, even if galectin-3 levels tended to be higher
in the untreated Mck positive control group and in the treated Mck
mutant mice group compared to the untreated Mck mutant mice
group.
[0204] As show in Table 3, at the age of 8 weeks, galectin-3 levels
were significantly lower in the untreated Mck mutant group than in
the negative control group. Galectin-3 levels tended to be lower in
the experimental group than in the negative control group, while
Galectin-3 levels were comparable between the experimental group
and the positive control group.
TABLE-US-00003 TABLE 3 Plasma Galectin-3 level (ng/ml) week 5 week
8 mean +/- sem mean +/- sem Untreated Mck positive 41.2 +/- 3.5 68
+/- 7.8 control mice (n = 8) Untreated Mck mutant 49.7 +/- 3.6 42
+/- 2.1 mice (n = 8) Treated Mck mutant 49.7 +/- 4.4 48.9 +/-
4.5.sup. mice (n = 8)
[0205] Surprisingly, mice of the untreated Mck positive control
group displayed higher levels of Galectin-3 at the age of 8 weeks
than at the age of 5 weeks, while the levels of Galectin-3 at the
age of 8 weeks were comparable to the levels at the age of 5 weeks
for the untreated Mck mutant mice group and for the treated Mck
mutant mice group.
[0206] In conclusion, it appears that Galectin-3 is not an
appropriate heart biomarker for this study on Mck mice. The mice of
the untreated Mck mutant mice group did not show an expected, if
galectin-3 was an appropriate biomarker, increase in this
parameter.
H-FABP:
[0207] Great variability was observed in H-FABP levels between mice
within the same sample group using standard methods of
detection.
[0208] As shown in Table 4, H-FABP blood levels were comparable
between the 3 groups of mice both at the age of 5 weeks and 8
weeks.
TABLE-US-00004 TABLE 4 Plasma H-FABP (ng/ml) week 5 week 8 mean +/-
sem mean +/- sem Untreated Mck positive 177.8 +/- 33.9 98.8 +/-
25.0 control (n = 8) Untreated Mck mutant 187.1 +/- 38.8 139.8 +/-
41.5 mice (n = 8) Treated Mck mutant 232.2 +/- 53.3 129.6 +/- 25.8
mice (n = 8)
[0209] No significant change was observed in H-FABP levels between
the age of 5 and 8 weeks in each group.
[0210] In conclusion, it seems that H-FABP is not the appropriate
heart biomarker for this study on Mck mice; the expected increase
in this parameter was not observed in the untreated Mck mutant
group and an important variability was observed between mice in a
same group.
SDH Activity in Heart Homogenates
[0211] SDH activity was measured in heart homogenate from heart
collected at the end of the study (8 weeks of age, 5 weeks of AAV
treatment in the treated mutant mice group) using standard methods.
Each group was comprised of four (4) mice.
[0212] The results shown in Table 5 show that SDH activity was
comparable between the 3 groups of mice. No decrease was observed
in SDH activity in the untreated Mck positive control group
compared to the untreated Mck mutant group.
TABLE-US-00005 TABLE 5 SDH activity in heart homogenate (U/g
proteins) Untreated Mck positive 4.14 +/- 0.52 control (n = 4)
Untreated Mck mutant 3.64 +/- 0.77 mice (n = 4) Treated Mck mutant
4.24 +/- 0.62 mice (n = 4)
[0213] An important variability in SDH activity was observed
between mice in a same group. Further, the expected decrease in SDH
activity in the untreated Mck positive control group was not
observed.
Frataxin Levels in Heart, Skeletal Muscle and Liver Homogenates
[0214] The level human frataxin protein was measured from heart,
skeletal muscle and liver collected at sacrifice using standard
methods as shown in Table 6.
[0215] Human frataxin was not detectable in any of the tissues
examined (heart, skeletal muscle and liver) of the untreated Mck
positive control and the untreated Mck mutant groups (i.e., the
level was below the lowest limit of detection [LLD] of the
assay).
[0216] In treated Mck mutant mice receiving rAAV-FXN, human
frataxin protein was detected in heart homogenate at the level of
38.35+/-1.99 ng/mg, and in skeletal muscle at a lower
concentration: 4.57+/-0.39 ng/mg. Furthermore, traces of human
frataxin were detected in the liver (0.07+/-0.01 ng/mg of
proteins).
TABLE-US-00006 TABLE 6 Frataxin in tissue (ng/mg proteins) heart
skeletal muscle liver mean +/- sem mean +/- sem mean +/- sem
Negative control <LLD <LLD <LLD (n = 4) Positive control
<LLD <LLD <LLD (n = 4) Experimental 38.35 +/- 1.99 4.57
+/- 0.39 0.07 +/- 0.01 group (n = 4)
[0217] These data demonstrate that treatment with rAAV vector
comprising a FXN gene can increase frataxin levels in a mouse model
of Friedreich ataxia (FRDA) Additionally, these data show that FXN
levels can be increased in vivo by rAAV-FXN systemic administration
such that FXN levels are increased in heart and, to a lesser
extent, skeletal muscle, with much lower level in the liver. Thus,
these data demonstrate that in vivo FXN levels can be selectively
increased in affected tissues, e.g., heart and skeletal muscle,
while minimizing delivery of FXN where it is not needed and/or
desired--i.e., to the liver.
Gross Pathology
[0218] Untreated Mck positive Control male mice were significantly
longer compared to untreated and AAV-treated Mck mutant animals
(9.39 cm vs 8.89 cm [+5.62%]. P=0.011 [t-test]). No other
significant macroscopic lesion was observed, especially no
macroscopic lesion or significant change was observed in heart
weight in both males and females.
Histology
Heart
[0219] Minimal interstitial fibrosis was observed in one untreated
Mck positive Control animal (#58). All other 3 untreated Mck
positive Control group hearts were normal.
[0220] However, minimal (mouse #38) and moderate (mice #41, #49,
and 81) interstitial fibrosis was observed in all 4 untreated Mck
mutant animals analyzed. This lesion was associated to endocardiac
focus of cardiomyocytes swelling in mice #38 (minimal) and #81
(slight). Fibrosis was associated to moderate macrophagic
inflammation, minimal disseminated swelling and slight
vacuolization of cardiomyocyte, in mice #41 and #49. Anitschkow
(Howl eye-shaped) nuclei were observed in mice #41 and #81.
[0221] In stark contrast to the untreated Mck mutant cohort, on
overall assessment, hearts of rAAV-FXN-treated Mck mutant mice
appeared normal except that few Anitschkow nuclei were observed in
mice #47 and #13.
Kidneys
[0222] In all groups, significant mineralization was frequently
observed in lumen of multiple medullar tubules. Frequency was 4/4
for untreated Mck positive control animals (although they express
the Cre transgene), 3/4 for untreated Mck mutant animals and 2/4
for treated Mck mutant animals receiving a dose of rAAV-FXN.
Severity of the mineralization appeared decreased in the
rAAV-treated Mck Mutant group compared to untreated Mck positive
Control and untreated Mck mutant groups. Tubular basophilia
(regeneration) was observed in 2/4 animals in the untreated Mck
positive control group, in 3/4 animals in the untreated Mck mutant
group and in 1 animal in the AAV-treated Mck mutant group.
Liver: minimal periportal inflammation was observed in one
untreated Mck positive control animal (#38). Lung: slight
peribronchial inflammation was observed in one untreated Mck mutant
animal (#41).
[0223] No other significant microscopic lesion was observed.
Especially, spinal cord, dorsal root ganglia, and cerebellum were
all normal.
Echocardiography
Basal Phenotype Before Treatment
[0224] Echocardiography measurements showed a reduced
left-ventricular function in untreated Mck Mutant males mice
compared to untreated Mck positive Control. This cardiac
insufficiency is characterized by a decrease of the left
ventricular (LV) contractility (shortening fraction and ejection
fraction) and an increase of the LV volume, both systolic and
diastolic. At that stage, no cardiac phenotype was observed in
untreated Mck Mutant female mice.
[0225] FIG. 4A shows graphs evaluation of the systolic function and
LV volumes by echocardiography at 3 weeks of age (A) males and (B)
females. Data are mean.+-.S.E.M of 8 mice per groups. The data of
Mck Mutant (both treated and untreated) mice were compared to the
untreated Mck positive Control group using multiple t-tests
comparisons (Sidak-Bonferroni method). * p<0.05
Results 14 Days after rAAV Treatment (5 Weeks of Age):
[0226] To investigate the potential of a gene therapy approach for
the treatment of the FRDA cardiomyopathy, a single intravenous
injection of AAV.FXN-HA at a dose of 1.times.10.sup.13 vg/kg was
administered to 3-weeks-old Mutant mice (treated Mck mutant group).
14 days after injection (5 weeks of age), echocardiography
measurements showed an improvement of the cardiac hemodynamics
(cardiac output) and a near normal morphological development in
Treated Mck Mutant males (contractility, LV mass). In contrast,
cardiac insufficiency was still observed in untreated Mck Mutant
mice. Surprisingly, in females, the cardiac contractility defect
was observed in all Mck Mutant mice whether treated or
untreated.
[0227] FIGS. 5A-5B show the evaluation of the systolic function and
LV volumes by echocardiography at 5 weeks of age in males (FIG. 5A)
and females (FIG. 5B). Data are mean.+-.S.E.M of 8 mice per groups.
The data of Mutant mice were compared to the Control groups using
multiple t-tests comparisons (Sidak-Bonferroni method). *
p<0.05.
Results 28 Days after rAAV Treatment (7 Weeks of Age):
[0228] Twenty-eight (28) days rAAV treatment (7 weeks of age),
treated Mck mutant males and females were fully normalized and
became indistinguishable between them and from untreated Mck
positive control mice. This, a complete correction (males) and
prevention (females) of the cardiac disease was demonstrated in
treated Mck mutant mice. In contrast, untreated Mck Mutant mice
developed a rapidly progressing cardiac insufficiency, with a
marked decrease in left ventricle shortening fraction and cardiac
output, as well as left ventricle hypertrophy.
[0229] FIGS. 6A-6C show graphs depicting data obtained using
echocardiography assessment of the left ventricle mass (LVm),
shortening fraction (SF) and cardiac output for untreated Mck
positive control, and Treated and Untreated Mck mutant mice over
successive weeks. Data are mean.+-.S.E.M of 8 mice per groups. The
data of Mck Mutant mice were compared to the untreated Mck positive
control group using multiple t-tests comparisons (Sidak-Bonferroni
method). * p<0.05.
Conclusions
Results of Echocardiography
[0230] In this study, the efficacy of an rAAV-FXN optionally
further comprising a detectable hemagglutinin tag (HA) vector
(referred to herein as rAAV-FXN-HA) at a dose of 1.times.10.sup.13
vg/kg was assessed. This dose was approximately 5-fold less than
the dose previously described in the same Mck mouse
cardiac-specific Friedreich ataxia mouse model using an rrhAAV10
vector encoding wild type FXN (Perdomini et al., 2014, Nature
Medicine 20(5):542).
[0231] As shown in FIG. 5A, at 3 weeks of age, the untreated Mck
Mutant male mice started to develop a left ventricular (LV)
dysfunction, not observed in females of the same group at the same
age (FIG. 5B). Fourteen (14) days after the AAV. FXN-HA injection
(at 5 weeks of age), a progressive correction of the cardiac
phenotype was observed in Mck mutant males, but it was less in Mck
mutant females. Without wishing to be bound by any particular
theory, this difference may be due to a later start of the cardiac
phenotype in females compared to males or to the reduced number of
mice used so far in this protocol.
[0232] These results suggest that systemic administration of
rAAV-modified FXN reverses the cardiac disease phenotype in Mck
mutant mouse model of FRDA. These results further suggest that
rAAV-modified FXN administration can prevent and/or reverse FRDA in
a subject in need thereof.
[0233] Twenty-eight (28) days post-rAAV-FXN injection, a complete
recovery of the cardiac function was observed in treated Mck mutant
males and females, suggesting a robust correction of the pathology
by the injected FXN transgene. That is, the data shown in FIGS.
6A-6C demonstrate the correction in the FRDA cardiac phenotype by
twenty-eight (28) days after rAAV-FXN administration. More
specifically, FIG. 6A shows the left ventricle mass (LVm) of both
treated Mck mutant mice and control (WT wild type Mck-Cre mice) is
indistinguishable while the untreated (triangles) Mck mutant mice
exhibit significantly greater LVm (*p<0.05). FIG. 6B shows data
demonstrating that by 28 days after rAAV-FXN treatment, both
positive control (WT L3 Mck-Cre mice; circles) and treated Mck
mutant (L-) mice (squares) demonstrated substantially identical
shortening fraction (SF) measurements. In contrast, FIG. 6B
demonstrates that untreated Mck mutant mice (triangles)
demonstrated greatly decreased SF (*p<0.05). In addition, FIG.
6C shows data demonstrating that by 28 days following treatment
with rAAV, treated Mck mutant mice (squares) exhibited cardiac
output that was indistinguishable from control mice (circles)
compared with untreated Mck mutant mice (triangles) which showed
markedly decreased cardiac output (triangles; *p<0.05). All
(treated and untreated) Mck mutant mice were compared with the
control untreated mice using multiple t-test comparisons
(Sidak-Bonferroni method). For each graph shown in FIGS. 6A-6C,
*<0.05 is indicated.
[0234] These data amply demonstrate that administration of rAAV
comprising modified nucleic acid encoding frataxin can reverse,
and/or prevent, the Mck phenotype in an art-recognized mouse model
of FRDA. Thus, these data support that rAAV-modified FXN mediated
treatment may be a potential useful therapeutic to treat, or
prevent, FRDA, or a disease, disorder or condition mediated by
decreased level of wild type (e.g., functional) frataxin, in a
subject in need thereof. Although these data demonstrate that
rAAV-modified-FXN administered systemically can treat or prevent
FRDA, these results further support that therapy also includes
other, e.g., more direct, routes of rAAV-FXN administration, such
as, but not limited to, intracranial or direct cardiac
administration. That is, because systemic administration was
demonstrated to be therapeutic, one skilled in the art would
understand based upon the disclosure provided herein that more
direct administration routes can also provide a therapeutic
benefit.
[0235] These results strongly support that gene therapy using rAAV
vector delivery of a modified FXN gene is a potential therapeutic
approach for patients with FRDA and to treat or prevent kidney
stones in a subject demonstrating a decreased level of wild
type/functional frataxin.
Example 3: Histology Study of In Vivo Administration of rAAV-FXN in
a Mouse Model of Friedreich Ataxia
Study Design
[0236] Twenty four (24) 8-weeks old C57BL6/N male and female mice
were assessed for histopathological analyses.
[0237] Eight (8) mice harbored a Mck-Cre transgene (MCK: Muscular
Creatine Kinase) associated to a functional engineered human
Frataxin allele (Mck-Cre x FXN L3/WT; hereinafter referred as "Mck
positive control mice"). Sixteen (16) mice harbored the same
transgene now associated to an inactive engineered frataxin allele
(Mck-Cre x FXN L3/L-; hereinafter referred to as "Mck mutant
mice"). Among the Mck mutant mice, eight (8) were injected with a
frataxin-encoding rAAV2i8 (rAAV-FXN; 10.sup.13 vg/kg) (hereinafter
"treated Mck mutant mice"). The remaining eight (8) Mck mutant mice
received an equivalent volume of saline water (hereinafter
"untreated Mck mutant mice"). The positive control mice group
(Mck-Cre x FXN L3/WT) were administered saline water. See Table 7
below.
TABLE-US-00007 TABLE 7 No. of Dose Animals Level (Mixed Termination
Groups label Group No. vg/kg gender) Weeks of age Mck positive
Mck-Cre .times. FXN 0 8 Week 8 control mice L3/WT Untreated Mck
Untreated 0 8 Week 8 mutant mice Mck-Cre .times. FXN L3/L- Treated
Mck rAAV-FXN-HA 1 .times. 10.sup.13 8 Week 8 mutant mice treated
Mck-Cre .times. FXN L3/L-
Methods
[0238] Upon sacrifice, body weight, body length and heart, spleen,
kidney, adrenals, and liver weight weights were recorded from all
animals. Adrenals, cerebellum, cervical, thoracic and lumbar
vertebras, Gonads (testes and ovaries), heart, kidney, liver,
lungs, pancreas, prostate in males, skeletal muscle (gastrocnemius
and soleus), spleen, and thymus, were collected from four (4)
animals per group for pathological evaluation and ELISA assays.
[0239] Cerebellum (including dentate nucleus), cervical, thoracic
and lumbar dorsal root ganglia, heart, kidneys, liver, lungs,
gonads, pancreas, skeletal muscle (gastrocnemius and soleus), and
spleen of 4 other animals per group were collected and immediately
snap frozen for molecular biology.
Histology
[0240] Cerebellum (including dentate nucleus), gonads, heart,
kidney, liver, lung, pancreas, skeletal muscle (gastrocnemius and
soleus), spleen and cervical, thoracic and lumbar vertebras were
formol-fixed. Vertebras were then decalcified, using EDTA solution.
All organs were paraffin embedded to obtain 5 .mu.m-thick sections,
transversal sections for vertebras (including both spinal cord and
dorsal root ganglia) and heart. All organs were hematoxylin and
eosin stained. Cardiac fibrosis was evaluated using Masson's
trichrome staining.
ELISA Assays
[0241] Half of the heart, right lobe of the liver, and soleus and
gastrocnemius muscles were snap frozen immediately after
collection.
Results
[0242] Gross Pathology
[0243] Mck positive control male mice were significantly longer
compared to untreated Mck mutant mice and treated Mck mutant mice
(9.39 cm vs 8.89 cm [+5.62%]. P=0.011 [t-test]). No other
significant macroscopic lesion was observed, especially no
macroscopic lesion or significant change was observed in heart
weight in both males and females.
Histology
Heart
[0244] Mck-Cre x FXN L3/WT: Minimal interstitial fibrosis was
observed in one Mck positive control animal (#58). All other 3
positive control mouse hearts were normal.
[0245] Untreated Mck-Cre x FXN L3/L-: In contrast, minimal (mouse
#38) and moderate (mice #41, #49, and 81) interstitial fibrosis was
observed in all 4 untreated Mck mutant mice analyzed. This lesion
was associated to endocardiac focus of cardiomyocytes swelling in
mice #38 (minimal) and #81 (slight). Fibrosis was associated to
moderate macrophagic inflammation, minimal disseminated swelling
and slight vacuolization of cardiomyocyte, in mice #41 and #49.
Anitschkow (owl eye-shaped) nuclei were observed in mouse #41 and
#81.
[0246] Treated Mck-Cre x FXN L3/L-: In contrast to untreated Mck
mutant mice, hearts of rAAV-FXN treated Mck mutant mice appeared
normal except that a few Anitschkow nuclei were observed in mice
#47 and #13.
Kidneys
[0247] In all three groups, significant mineralization was
frequently observed in the lumen of multiple medullar tubules.
Frequency of mineralization was 4/4 for Mck positive control
animals, 3/4 for untreated Mck mutant animals and 2/4 for rAAV-FXN
treated Mck mutant animals. The severity of mineralization appeared
decreased in rAAV-FXN treated Mck mutant group compared to Mck
positive control and untreated Mck mutant groups. Tubular
basophilia (regeneration) was observed in 2/4 animals in Mck
positive control mice, in 3/4 animals in the untreated Mck mutant
group and in 1 animal in the rAAV-FXN treated Mck mutant group.
Liver: minimal periportal inflammation was observed in one Mck
positive control animal (#38). Lung: slight peribronchial
inflammation was observed in one untreated Mck mutant animal
(#41).
[0248] No other significant microscopic lesion was observed.
Especially, spinal cord, dorsal root ganglia, and cerebellum were
all normal for all groups.
Results of Histology
[0249] With respect to histology, owl eye-nuclei, swelling and
vacuolization observed in cardiomyocytes of untreated Mck mutant
mice are all landmarks for cardiac degeneration. Interstitial
fibrosis associated to macrophage inflammation may correspond to
cardiomyocyte cell death. Thus, cardiomyocytes of untreated Mck
mutant mice degenerate, meaning cells undergo decreased function
and pathology evolve to cell death and subsequent heart
failure.
[0250] Strikingly, rAAV-FXN systemic delivery reverses this
phenotype and rAAV-treated Mck mutant mice (both males and females)
appeared normal and showed no significant sign of cardiomyocytes
degeneration. These data demonstrate that the rAAV-huFXN
transduction is sufficiently efficient to reverse the endogenous
mouse Fxn gene inactivation effects. Thus, these data further
support that rAAV-modified FXN mediated systemic administration can
reverse and/or prevent a disease, disorder or condition mediated by
a decreased level of wild type (functional) frataxin, such as, but
not limited to, Friedreich ataxia, in a subject in need thereof. As
noted previously, the skilled artisan, armed with the teachings of
the instant disclosure, would appreciate that other routes of
administration, e.g., more direct routes including intracranial and
into the heart, could be used to provide a therapeutic benefit to
the subject in need thereof.
[0251] Analysis of the kidneys identified the presence of kidney
stones in medulla of both untreated Mck positive control and
untreated Mck mutant animals which is an uncommon lesion. Since no
specific diet was proposed to these animals and considering their
age, the frequency and the severity of the lesions strongly suggest
that this is not an incidental lesion, but a lesion related to
genotype. Interestingly, this lesion severity is partially reduced
by rAAV-FXN treatment, suggesting that the kidney stones
development is related to an alteration in the Fxn function and or
in the level of the protein. Hence, the so-called L3 allele, in
which the mouse frataxin gene is flanked by loxP sequences
(although in the intronic regions), could be a hypomorph allele.
This would be consistent with the critical role of mitochondria in
these cells to maintain trans-epithelial electrolyte active
transports. To the best of applicants' knowledge and belief, these
lesions have not been reported in Friedreich ataxia clinical
observations, or in FRDA mouse models, to date.
[0252] Therefore, the invention encompasses a method of treating or
preventing kidney disease, disorder or condition, including, but
not limited to, development or growth of kidney stones, in a
subject in need thereof, wherein the kidney disease, disorder or
condition is mediated by a decreased level of frataxin (e.g.,
functional and/or wild type frataxin) in the subject.
[0253] In one embodiment, the invention includes assessing the
level of frataxin in a subject, comparing the level of frataxin in
the subject with the level of frataxin in a subject known not to be
afflicted with kidney stones and/or comparing the level of frataxin
with a "standard level of frataxin" determined for otherwise
healthy individuals or known in the art, and administering a
rAAV-modified frataxin to the subject if the level of frataxin in
the subject is less than the level of frataxin in an otherwise
healthy individual and/or below the standard level of frataxin,
thereby treating and/or preventing a kidney stone in the
subject.
[0254] Finally, HA staining can be used to detect rAAV-FXN-HA
within cells. First, this would be important to quantitate how many
cells should express FXN to restore or maintain the cardiac
function. Second, the Mck gene (and thus the Cre recombinase driven
by the Mck promoter) is not expected to be expressed in kidney.
Detecting, or not, rAAV-FXN-HA in kidney may help to elucidate
whether the kidney stone formation is an unexpected direct effect
of HA-FXN on medulla homeostasis, or not.
Conclusion
[0255] In sum, the data presented herein demonstrate that
administration, even systemically, of rAAV encoding a modified FXN
gene can treat (prevent and/or reverse) the effects associated with
a decrease or absence of frataxin. Thus, the data support that rAAV
mediated expression of frataxin in cells and subjects in need
thereof can be a useful therapeutic to treat a disease or disorder
associated with or mediated by a lack or deficit of frataxin such
as, but not limited to, Friedreich ataxia.
[0256] Although the disclosed teachings have been described with
reference to various applications, methods, kits, and compositions,
it will be appreciated that various changes and modifications can
be made without departing from the teachings herein and the claimed
invention below. The foregoing examples are provided to better
illustrate the disclosed teachings and are not intended to limit
the scope of the teachings presented herein. While the present
teachings have been described in terms of these exemplary
embodiments, the skilled artisan will readily understand that
numerous variations and modifications of these exemplary
embodiments are possible without undue experimentation. All such
variations and modifications are within the scope of the current
teachings.
[0257] All references cited herein, including patents, patent
applications, papers, text books, and the like, and the references
cited therein, to the extent that they are not already, are hereby
incorporated by reference in their entirety. In the event that one
or more of the incorporated literature and similar materials
differs from or contradicts this application, including but not
limited to defined terms, term usage, described techniques, or the
like, this application controls.
[0258] The foregoing description and Examples detail certain
specific embodiments of the invention and describes the best mode
contemplated by the inventors. It will be appreciated, however,
that no matter how detailed the foregoing may appear in text, the
invention may be practiced in many ways and the invention should be
construed in accordance with the appended claims and any
equivalents thereof.
TABLE-US-00008 TABLE 8 SEQUENCES SEQ ID Amino acid MWTLGRRAVA
TGLLASPSPA QAQTLTRVPR PAELAPLCGR NO: 1 sequence of human RGLRTDIDAT
CPRRASSNQR GLNQIWNVKK QSVYLMNLRK wild type frataxin SGTLGHPGSL
DETTYERLAE ETLDSLAEFF EDLADKPYTF EDYDVSFGSG VLTVKLGGDL GTYVINKQTP
NKQIWLSSPS SGPKRYDWTG KNWVYSHDGV SLHELLAAEL TKALKTKLDL SSLAYSGKDA
SEQ ID Nucleotide ATGTGGACTCTCGGGCGCCGCGCAGTAGCCGGCCTCCTGGCGT NO: 2
sequence encoding CACCCAGCCCAGCCCAGGCCCAGACCCTCACCCGGGTCCCGCG wild
type frataxin GCCGGCAGAGTTGGCCCCACTCTGCGGCCGCCGTGGCCTGCGC (FIGS.
1A-1B; lane 1) ACCGACATCGATGCGACCTGCACGCCCCGCCGCGCAAGTTCGA
ACCAACGTGGCCTCAACCAGATTTGGAATGTCAAAAAGCAGAG
TGTCTATTTGATGAATTTGAGGAAATCTGGAACTTTGGGCCAC
CCAGGCTCTCTAGATGAGACCACCTATGAAAGACTAGCAGAGG
AAACGCTGGACTCTTTAGCAGAGTTTTTTGAAGACCTTGCAGA
CAAGCCATACACGTTTGAGGACTATGATGTCTCCTTTGGGAGT
GGTGTCTTAACTGTCAAACTGGGTGGAGATCTAGGAACCTATG
TGATCAACAAGCAGACGCCAAACAAGCAAATCTGGCTATCTTC
TCCATCCAGTGGACCTAAGCGTTATGACTGGACTGGGAAAAAC
TGGGTGTACTCCCACGACGGCGTGTCCCTCCATGAGCTGCTGG
CCGCAGAGCTCACTAAAGCCTTAAAAACCAAACTGGACTTGTC
TTCCTTGGCCTATTCCGGAAAAGATGCT SEQ ID IDT2 optimized
ATGTGGACACTGGGCAGAAGGGCGGTGGCCGGACTGTTGGCGA NO: 3 nucleotide
sequence GTCCCAGTCCCGCGCAGGCGCAGACCCTTACTAGGGTGCCGCG encoding
frataxin GCCCGCGGAGCTGGCGCCACTCTGCGGTCGCCGCGGTCTGAGA (FIGS. 1A-1B;
lane 2) ACGGACATTGATGCCACTTGTACACCTCGGAGGGCCAGCTCCA
ACCAAAGGGGCCTTAATCAAATTTGGAACGTGAAGAAGCAGTC
CGTCTACCTGATGAACCTTCGGAAGTCAGGGACCCTGGGCCAC
CCGGGAAGCTTGGATGAAACAACTTACGAAAGGTTGGCGGAGG
AGACCTTGGATTCTCTTGCAGAGTTCTTCGAAGACCTGGCTGA
TAAGCCTTACACCTTTGAGGACTACGATGTGTCTTTTGGATCT
GGAGTGCTGACCGTTAAACTGGGCGGGGATCTGGGCACCTACG
TGATTAACAAGCAAACTCCAAACAAGCAGATCTGGCTTTCAAG
CCCCAGTAGCGGGCCAAAACGCTACGATTGGACCGGAAAGAAT
TGGGTTTACAGCCACGATGGCGTTTCACTGCACGAGCTTCTGG
CAGCAGAACTGACAAAAGCACTCAAGACGAAGCTCGACTTGTC
ATCCTTGGCATACTCCGGAAAGGATGCC SEQ ID JCAT Optimized
ATGTGGACCCTGGGCCGCCGCGCCGTGGCCGGCCTGCTGGCCA NO: 4 Nucleotide
GCCCCAGCCCCGCCCAGGCCCAGACCCTGACCCGCGTGCCCCG sequence encoding
CCCCGCCGAGCTGGCCCCCCTGTGCGGCCGCCGCGGCCTGCGC frataxin (FIGS. 1A-
ACCGACATCGACGCCACCTGCACCCCCCGCCGCGCCAGCAGCA 1B; Lane 4)
ACCAGCGCGGCCTGAACCAGATCTGGAACGTGAAGAAGCAGAG
CGTGTACCTGATGAACCTGCGCAAGAGCGGCACCCTGGGCCAC
CCCGGCAGCCTGGACGAGACCACCTACGAGCGCCTGGCCGAGG
AGACCCTGGACAGCCTGGCCGAGTTCTTCGAGGACCTGGCCGA
CAAGCCCTACACCTTCGAGGACTACGACGTGAGCTTCGGCAGC
GGCGTGCTGACCGTGAAGCTGGGCGGCGACCTGGGCACCTACG
TGATCAACAAGCAGACCCCCAACAAGCAGATCTGGCTATCTAG
CCCCAGCAGCGGCCCCAAGCGCTACGACTGGACCGGCAAGAAC
TGGGTGTACAGCCACGACGGCGTGAGCCTGCACGAGCTGCTGG
CCGCCGAGCTGACCAAGGCCCTGAAGACCAAGCTCGACCTGAG
CAGCCTGGCCTACAGCGGCAAGGACGCC SEQ ID GeneArt optimized
ATGTGGACACTGGGGAGAAGGGCTGTGGCCGGACTGCTGGCTT NO: 5 nucleotide
sequence CTCCATCTCCAGCCCAGGCCCAGACCCTGACCAGAGTGCCTAG encoding
frataxin ACCTGCCGAACTGGCCCCTCTGTGTGGCAGAAGAGGCCTGAGA (FIGS. 1A-1B;
Lane ACCGACATCGACGCCACCTGTACCCCCAGAAGGGCCAGCAGCA 5)
ATCAGCGGGGCCTGAATCAGATCTGGAACGTGAAGAAACAGAG
CGTGTACCTGATGAACCTGAGAAAGAGCGGCACCCTGGGCCAC
CCTGGAAGCCTGGATGAGACAACCTACGAGCGGCTGGCCGAGG
AAACCCTGGATTCCCTGGCCGAGTTCTTCGAGGACCTGGCCGA
CAAGCCCTACACCTTCGAGGATTACGACGTGTCCTTCGGCAGC
GGCGTGCTGACAGTGAAGCTGGGCGGAGATCTGGGCACCTACG
TGATCAACAAGCAGACCCCCAACAAACAGATCTGGCTATCTAG
CCCCAGCAGCGGCCCCAAGAGATACGATTGGACCGGCAAGAAC
TGGGTGTACAGCCACGACGGCGTGTCCCTGCATGAGCTGCTGG
CTGCCGAGCTGACCAAGGCCCTGAAAACAAAGCTGGACCTGTC
CAGCCTGGCCTACAGCGGCAAGGATGCC SEQ ID Genscript (control)
ATGTGGACACTGGGCCGGAGAGCCGTCGCTGGGCTGCTGGCAT NO: 6 optimized
CACCATCCCCCGCACAGGCACAGACCCTGACAAGAGTCCCTCG Nucleotide
GCCAGCAGAGCTGGCCCCACTGTGCGGGCGGAGAGGACTGCGA sequence encoding
ACCGACATCGATGCTACTTGTACCCCAAGGCGAGCAAGCTCCA frataxin
ACCAGCGAGGGCTGAACCAGATTTGGAATGTGAAGAAACAGTC FIGS. 1A-1B; lane 6)
TGTCTACCTGATGAATCTGAGAAAGAGCGGCACTCTGGGACAC
CCTGGCAGCCTGGACGAGACCACCTACGAGCGGCTGGCCGAGG
AAACCCTGGATTCCCTGGCCGAGTTCTTTGAAGACCTGGCTGA
TAAGCCATACACCTTCGAAGACTATGACGTGAGCTTCGGCAGC
GGCGTGCTGACAGTCAAACTGGGCGGGGACCTGGGAACATACG
TGATCAACAAGCAGACTCCTAACAAGCAGATTTGGCTGTCTAG
TCCCTCAAGCGGCCCTAAGAGGTACGACTGGACAGGGAAAAAC
TGGGTGTATAGTCACGATGGCGTCTCACTGCATGAGCTGCTGG
CCGCTGAACTGACTAAAGCCCTGAAAACTAAACTGGACCTGTC
TTCCCTGGCATACTCTGGCAAGGACGCC SEQ ID Genscript (low CpG)
ATGTGGACTCTGGGCCGGAGAGCAGTGGCAGGACTGCTGGCAA NO: 7 nucleotide
sequence GTCCATCACCTGCTCAGGCACAGACTCTGACAAGAGTCCCAAG encoding
frataxin ACCTGCAGAGCTGGCTCCACTGTGCGGGAGGCGCGGACTGAGA (FIGS. 1A-1B;
Lane ACAGACATCGATGCTACATGTACTCCTCGACGGGCAAGCTCCA 7)
ACCAGCGAGGGCTGAACCAGATTTGGAATGTGAGAACAGTCCG
TCTACCTGATGAATCTGAGGAAGTCAGGCACCCTGGGGCACCC
AGGAAGTCTGGACGAGACCACATATGAACGGCTGGCTGAGGAA
ACACTGGATTCTCTGGCCGAGTTCTTTGAAGACCTGGCTGATA
AGCCCTACACATTCGAAGACTATGATGTGAGCTTTGGATCCGG
CGTGCTGACTGTCAAACTGGGCGGGGACCTGGGCACTTACGTG
ATCAACAAGCAGACCCCTAACAAGCAGATTTGGCTGTCTAGTC
CTTCAAGCGGACCAAAGCGGTACGACTGGACCGGCAAAAACTG
GGTGTATTCTCACGATGGGGTCAGTCTGCATGAGCTGCTGGCC
GCTGAACTGACCAAGGCCCTGAAGACAAAACTGGACCTGTCCT
CTCTGGCATATAGCGGAAAAGATGCC SEQ ID IDT3 optimized
ATGTGGACACTGGGAAGGCGCGCCGTGGCCGGTCTGTTGGCAT NO: 8 Nucleotide
CACCATCCCCAGCCCAGGCTCAGACACTCACCCGAGTCCCAAG sequence encoding
ACCCGCAGAGCTGGCCCCTCTGTGCGGGCGCCGAGGCCTTCGC frataxin
ACCGATATCGATGCTACATGCACGCCACGCAGAGCTAGCTCAA
ATCAGAGGGGACTCAACCAGATATGGAATGTCAAGAAGCAAAG
CGTGTATCTCATGAACCTCCGGAAAAGCGGCACCCTGGGACAT
CCCGGGTCTCTCGACGAGACCACTTATGAAAGACTGGCAGAGG
AGACTCTTGACAGTCTGGCGGAGTTCTTCGAAGACCTCGCTGA
CAAGCCATATACCTTCGAAGATTACGACGTCTCCTTCGGCTCT
GGGGTGCTGACTGTCAAGCTTGGCGGCGACCTGGGGACCTACG
TGATCAACAAGCAGACTCCAAACAAGCAAATCTGGCTATCTAG
TCCAAGCTCCGGACCCAAGAGATACGATTGGACAGGCAAGAAT
TGGGTTTACTCCCACGACGGGGTGTCCCTCCATGAGCTGCTGG
CCGCAGAGCTGACGAAGGCCCTGAAGACCAAGCTGGATCTCTC
CTCCCTGGCATACAGTGGTAAGGACGCT SEQ ID IDT5 optimized
ATGTGGACACTGGGCCGGCGCGCCGTCGCTGGGCTGCTCGCAA NO: 9 Nucleotide
GCCCCAGCCCAGCCCAAGCGCAGACTCTGACTAGGGTGCCGCG sequence encoding
GCCTGCCGAGTTGGCCCCCCTGTGCGGTAGGAGAGGCCTGCGC frataxin
ACAGACATCGATGCCACTTGCACACCCCGGCGGGCCAGCTCTA (FIGS. 1A-1B; Lane
ACCAAAGGGGCCTGAATCAAATTTGGAACGTCAAAAAACAGTC 3)
TGTATATCTGATGAATCTCCGGAAATCTGGAACGCTCGGGCAT
CCCGGATCTCTTGACGAGACCACCTACGAGCGACTGGCCGAGG
AAACCCTTGACAGCCTGGCAGAATTCTTTGAGGATCTGGCTGA
TAAACCCTATACCTTTGAAGATTACGATGTGAGTTTTGGTAGC
GGAGTACTGACTGTTAAGCTGGGCGGTGATCTCGGTACGTATG
TTATCAATAAACAAACCCCCAATAAACAGATTTGGCTCTCCTC
CCCATCCTCTGGGCCTAAGCGCTATGACTGGACAGGAAAGAAT
TGGGTCTATTCACACGACGGAGTCAGTTTGCACGAGCTCCTCG
CCGGCAGAGTTACCAAGGCCCTTAAGACTAAGCTCGACCTGTC
AAGCCTCGCTTACTCTGGTAAGGACGCT SEQ ID Nucleotide
ATGTGGACTCTCGGGCGCCGCGCAGTAGCCGGCCTCCTGGCGT NO: 10 sequence
encoding CACCCAGCCCGGCCCAGGCCCAGACCCTCACCCGGGTCCCGCG frataxin
(nucleic GCCGGCAGAGTTGGCCCCACTCTGCGGCCGCCGTGGCCTGCGC acid 22)
ACCGACATCGATGCGACCTGCACGCCCCGCCGCGCAAGTTCGA
ACCAACGTGGCCTCAACCAGATTTGGAATGTCAAAAAGCAGAG
TGTCTATTTGATGAATTTGAGGAAATCTGGAACTTTGGGCCAC
CCAGGCTCTCTAGATGAGACCACCTATGAAAGACTAGCAGAGG
AAACGCTGGACTCTTTAGCAGAGTTTTTTGAAGACCTTGCAGA
CAAGCCATACACGTTTGAGGACTATGATGTCTCCTTTGGGAGT
GGTGTCTTAACTGTCAAACTGGGTGGAGATCTAGGAACCTATG
TGATCAACAAGCAGACGCCAAACAAGCAAATCTGGCTATCTTC
TCCATCCAGTGGACCTAAGCGTTATGACTGGACTGGGAAAAAC
TGGGTGTACTCCCACGACGGCGTGTCCCTCCATGAGCTGCTGG
CCGCAGAGCTCACTAAAGCCTTAAAAACCAAACTGGACTTGTC
TTCCTTGGCCTATTCCGGAAAAGATGCT SEQ ID IDT-1 optimized
ATGTGGACTCTGGGTAGGCGAGCGGTGGCCGGCCTGTTGGCAT NO: 11 Nucleotide
CTCCTAGTCCTGCACAAGCTCAAACGCTGACTAGAGTCCCTCG sequence encoding
GCCAGCAGAACTGGCGCCACTTTGCGGCCGGCGCGGTCTTCGC frataxin (nucleic
ACTGATATTGATGCCACTTGCACACCCCGGCGCGCCTCCAGTA acid 23)
ATCAGCGGGGACTTAATCAAATTTGGAATGTGAAGAAGCAGTC
TGTGTATCTTATGAATCTGCGGAAGAGCGGGACCCTGGGCCAC
CCTGGTAGCCTTGATGAAACCACCTATGAGCGCCTGGCCGAAG
AGACACTGGACAGTCTTGCCGAGTTTTTTGAGGATCTGGCCGA
CAAACCTTATACTTTTGAGGACTATGACGTGTCCTTTGGATCT
GGTGTATTGACCGTAAAACTCGGGGGAGACCTTGGGACGTATG
TAATAAATAAGCAGACCCCAAACAAGCAGATCTGGCTATCTTC
TCCAAGTAGTGGTCCTAAGAGATATGATTGGACGGGCAAGAAC
TGGGTCTATTCCCATGATGGCGTCTCTTTGCATGAACTCCTTG
CAGCAGAGCTGACCAAGGCCTTGAAGACCAAATTGGATCTCAG
CAGCCTCGCCTATAGTGGCAAAGATGCA SEQ ID IDT-4 optimized
ATGTGGACTCTGGGCCGGCGGGCCGTAGCTGGCTTGCTGGCTA NO: 12 Nucleotide
GCCCAAGTCCCGCCCAGGCTCAGACTCTCACCAGGGTACCCAG sequence encoding
GCCCGCAGAGCTTGCTCCACTCTGCGGACGCAGGGGTCTGCGA frataxin (nucleic
ACCGATATCGACGCAACTTGCACGCCGCGGAGGGCCTCTTCAA acid 26)
ACCAGAGAGGACTCAATCAAATTTGGAATGTAAAGAAACAGAG
CGTGTATCTCATGAACCTCCGAAAGAGTGGGACTCTTGGGCAC
CCCGGCTCCCTGGACGAGACTACTTACGAGCGCCTGGCCGAAG
AAACCTTGGATTCCCTGGCGGAGTTTTTTGAAGACTTGGCAGA
CAAGCCTTATACCTTCGAGGATTACGACGTGAGTTTTGGCTCT
GGTGTTCTTACAGTCAAGCTCGGTGGCGACCTTGGCACTTATG
TAATTAACAAGCAGACACCTAACAAGCAGATCTGGCTTTCTAG
TCCGTCTTCCGGTCCCAAAAGGTACGATTGGACTGGAAAGAAC
TGGGTCTACAGTCACGACGGTGTCTCCCTGCACGAATTGCTTG
CGGCAGAGCTGACTAAGGCGCTCAAAACAAAACTGGATCTGTC
CAGCCTTGCCTATAGCGGGAAGGACGCA SEQ ID Nucleotide
ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACACTC NO: 13 sequence
encoding TCTCTGAAGGAATAAGACAGTGGTGGAAGCTCAAACCTGGCCC chimeric
AAV2.5 ACCACCACCAAAGCCCGCAGAGCGGCATAAGGACGACAGCAGG Vector Capsid
VP1 GGTCTTGTGCTTCCTGGGTACAAGTACCTCGGACCCTTCAACG
GACTCGACAAGGGAGAGCCGGTCAACGAGGCAGACGCCGCGGC
CCTCGAGCACGACAAAGCCTACGACCGGCAGCTCGACAGCGGA
GACAACCCGTACCTCAAGTACAACCACGCCGACGCGGAGTTTC
AGGAGCGCCTTAAAGAAGATACGTCTTTTGGGGGCAACCTCGG
ACGAGCAGTCTTCCAGGCGAAAAAGAGGGTTCTTGAACCTCTG
GGCCTGGTTGAGGAACCTGTTAAGACGGCTCCGGGAAAAAAGA
GGCCGGTAGAGCACTCTCCTGTGGAGCCAGACTCCTCCTCGGG
AACCGGAAAGGCGGGCCAGCAGCCTGCAAGAAAAAGATTGAAT
TTTGGTCAGACTGGAGACGCAGACTCAGTACCTGACCCCCAGC
CTCTCGGACAGCCACCAGCAGCCCCCTCTGGTCTGGGAACTAA
TACGATGGCTACAGGCAGTGGCGCACCAATGGCAGACAATAAC
GAGGGCGCCGACGGAGTGGGTAATTCCTCGGGAAATTGGCATT
GCGATTCCACATGGATGGGCGACAGAGTCATCACCACCAGCAC
CCGAACCTGGGCCCTGCCCACCTACAACAACCACCTCTACAAA
CAAATTTCCAGCGCTTCAACGGGAGCCTCGAACGACAATCACT
ACTTTGGCTACAGCACCCCTTGGGGGTATTTTGACTTCAACAG
ATTCCACTGCCACTTTTCACCACGTGACTGGCAAAGACTCATC
AACAACAACTGGGGATTCCGACCCAAGAGACTCAACTTCAAGC
TCTTTAACATTCAAGTCAAAGAGGTCACGCAGAATGACGGTAC
GACGACGATTGCCAATAACCTTACCAGCACGGTTCAGGTGTTT
ACTGACTCGGAGTACCAGCTCCCGTACGTCCTCGGCTCGGCGC
ATCAAGGATGCCTCCCGCCGTTCCCAGCAGACGTCTTCATGGT
GCCACAGTATGGATACCTCACCCTGAACAACGGGAGTCAGGCA
GTAGGACGCTCTTCATTTTACTGCCTGGAGTACTTTCCTTCTC
AGATGCTGCGTACCGGAAACAACTTTACCTTCAGCTACACTTT
TGAGGACGTTCCTTTCCACAGCAGCTACGCTCACAGCCAGAGT
CTGGACCGTCTCATGAATCCTCTCATCGACCAGTACCTGTATT
ACTTGAGCAGAACAAACACTCCAAGTGGAACCACCACGCAGTC
AAGGCTTCAGTTTTCTCAGGCCGGAGCGAGTGACATTCGGGAC
CAGTCTAGGAACTGGCTTCCTGGACCCTGTTACCGCCAGCAGC
GAGTATCAAAGACATCTGCGGATAACAACAACAGTGAATACTC
GTGGACTGGAGCTACCAAGTACCACCTCAATGGCAGAGACTCT
CTGGTGAATCCGGGCCCGGCCATGGCAAGCCACAAGGACGATG
AAGAAAAGTTTTTTCCTCAGAGCGGGGTTCTCATCTTTGGGAA
GCAAGGCTCAGAGAAAACAAATGTGGACATTGAAAAGGTCATG
ATTACAGACGAAGAGGAAATCAGGACAACCAATCCCGTGGCTA
CGGAGCAGTATGGTTCTGTATCTACCAACCTCCAGAGAGGCAA
CAGACAAGCAGCTACCGCAGATGTCAACACACAAGGCGTTCTT
CCAGGCATGGTCTGGCAGGACAGAGATGTGTACCTTCAGGGGC
CCATCTGGGCAAAGATTCCACACACGGACGGACATTTTCACCC
CTCTCCCCTCATGGGTGGATTCGGACTTAAACACCCTCCTCCA
CAGATTCTCATCAAGAACACCCCGGTACCTGCGAATCCTTCGA
CCACCTTCAGTGCGGCAAAGTTTGCTTCCTTCATCACACAGTA
CTCCACGGGACAGGTCAGCGTGGAGATCGAGTGGGAGCTGCAG
AAGGAAAACAGCAAACGCTGGAATCCCGAAATTCAGTACACTT
CCAACTACGCCAAGTCTGTCAATGTGGACTTTACTGTGGACAA
TAATGGCGTGTATTCAGAGCCTCGCCCCATTGGCACCAGATAC CTGACTCGTAATCTGTAA SEQ
ID Nucleotide ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACAACC NO: 14
sequence encoding TCTCTGAGGGCATTCGCGAGTGGTGGGACTTGAAACCTGGAGC wild
type AAV1 CCCGAAGCCCAAAGCCAACCAGCAAAAGCAGGACGACGGCCGG capsid (VP1)
GGTCTGGTGCTTCCTGGCTACAAGTACCTCGGACCCTTCAACG
GACTCGACAAGGGGGAGCCCGTCAACGCGGCGGACGCAGCGGC
CCTCGAGCACGACAAGGCCTACGACCAGCAGCTCAAAGCGGGT
GACAATCCGTACCTGCGGTATAACCACGCCGACGCCGAGTTTC
AGGAGCGTCTGCAAGAAGATACGTCTTTTGGGGGCAACCTCGG
GCGAGCAGTCTTCCAGGCCAAGAAGCGGGTTCTCGAACCTCTC
GGTCTGGTTGAGGAAGGCGCTAAGACGGCTCCTGGAAAGAAAC
GTCCGGTAGAGCAGTCGCCACAAGAGCCAGACTCCTCCTCGGG
CATCGGCAAGACAGGCCAGCAGCCCGCTAAAAAGAGACTCAAT
TTTGGTCAGACTGGCGACTCAGAGTCAGTCCCCGATCCACAAC
CTCTCGGAGAACCTCCAGCAACCCCCGCTGCTGTGGGACCTAC
TACAATGGCTTCAGGCGGTGGCGCACCAATGGCAGACAATAAC
GAAGGCGCCGACGGAGTGGGTAATGCCTCAGGAAATTGGCATT
GCGATTCCACATGGCTGGGCGACAGAGTCATCACCACCAGCAC
CCGCACCTGGGCCTTGCCCACCTACAATAACCACCTCTACAAG
CAAATCTCCAGTGCTTCAACGGGGGCCAGCAACGACAACCACT
ACTTCGGCTACAGCACCCCCTGGGGGTATTTTGATTTCAACAG
ATTCCACTGCCACTTTTCACCACGTGACTGGCAGCGACTCATC
AACAACAATTGGGGATTCCGGCCCAAGAGACTCAACTTCAAAC
TCTTCAACATCCAAGTCAAGGAGGTCACGACGAATGATGGCGT
CACAACCATCGCTAATAACCTTACCAGCACGGTTCAAGTCTTC
TCGGACTCGGAGTACCAGCTTCCGTACGTCCTCGGCTCTGCGC
ACCAGGGCTGCCTCCCTCCGTTCCCGGCGGACGTGTTCATGAT
TCCGCAATACGGCTACCTGACGCTCAACAATGGCAGCCAAGCC
GTGGGACGTTCATCCTTTTACTGCCTGGAATATTTCCCTTCTC
AGATGCTGAGAACGGGCAACAACTTTACCTTCAGCTACACCTT
TGAGGAAGTGCCTTTCCACAGCAGCTACGCGCACAGCCAGAGC
CTGGACCGGCTGATGAATCCTCTCATCGACCAATACCTGTATT
ACCTGAACAGAACTCAAAATCAGTCCGGAAGTGCCCAAAACAA
GGACTTGCTGTTTAGCCGTGGGTCTCCAGCTGGCATGTCTGTT
CAGCCCAAAAACTGGCTACCTGGACCCTGTTATCGGCAGCAGC
GCGTTTCTAAAACAAAAACAGACAACAACAACAGCAATTTTAC
CTGGACTGGTGCTTCAAAATATAACCTCAATGGGCGTGAATCC
ATCATCAACCCTGGCACTGCTATGGCCTCACACAAAGACGACG
AAGACAAGTTCTTTCCCATGAGCGGTGTCATGATTTTTGGAAA
AGAGAGCGCCGGAGCTTCAAACACTGCATTGGACAATGTCATG
ATTACAGACGAAGAGGAAATTAAAGCCACTAACCCTGTGGCCA
CCGAAAGATTTGGGACCGTGGCAGTCAATTTCCAGAGCAGCAG
CACAGACCCTGCGACCGGAGATGTGCATGCTATGGGAGCATTA
CCTGGCATGGTGTGGCAAGATAGAGACGTGTACCTGCAGGGTC
CCATTTGGGCCAAAATTCCTCACACAGATGGACACTTTCACCC
GTCTCCTCTTATGGGCGGCTTTGGACTCAAGAACCCGCCTCCT
CAGATCCTCATCAAAAACACGCCTGTTCCTGCGAATCCTCCGG
CGGAGTTTTCAGCTACAAAGTTTGCTTCATTCATCACCCAATA
CTCCACAGGACAAGTGAGTGTGGAAATTGAATGGGAGCTGCAG
AAAGAAAACAGCAAGCGCTGGAATCCCGAAGTGCAGTACACAT
CCAATTATGCAAAATCTGCCAACGTTGATTTTACTGTGGACAA
CAATGGACTTTATACTGAGCCTCGCCCCATTGGCACCCGTTAC CTTACCCGTCCCCTGTAA SEQ
ID Nucleotide ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACAACC NO: 15
sequence encoding TCTCTGAGGGCATTCGCGAGTGGTGGGACTTGAAACCTGGAGC
modified AAV1.1 CCCGAAGCCCAAAGCCAACCAGCAAAAGCAGGACGACGGCCGG capsid
VP1 (amino GGTCTGGTGCTTCCTGGCTACAAGTACCTCGGACCCTTCAACG acid residue
number GACTCGACAAGGGGGAGCCCGTCAACGCGGCGGACGCAGCGGC 265 is deleted)
CCTCGAGCACGACAAGGCCTACGACCAGCAGCTCAAAGCGGGT
GACAATCCGTACCTGCGGTATAACCACGCCGACGCCGAGTTTC
AGGAGCGTCTGCAAGAAGATACGTCTTTTGGGGGCAACCTCGG
GCGAGCAGTCTTCCAGGCCAAGAAGCGGGTTCTCGAACCTCTC
GGTCTGGTTGAGGAAGGCGCTAAGACGGCTCCTGGAAAGAAAC
GTCCGGTAGAGCAGTCGCCACAAGAGCCAGACTCCTCCTCGGG
CATCGGCAAGACAGGCCAGCAGCCCGCTAAAAAGAGACTCAAT
TTTGGTCAGACTGGCGACTCAGAGTCAGTCCCCGATCCACAAC
CTCTCGGAGAACCTCCAGCAACCCCCGCTGCTGTGGGACCTAC
TACAATGGCTTCAGGCGGTGGCGCACCAATGGCAGACAATAAC
GAAGGCGCCGACGGAGTGGGTAATGCCTCAGGAAATTGGCATT
GCGATTCCACATGGCTGGGCGACAGAGTCATCACCACCAGCAC
CCGCACCTGGGCCTTGCCCACCTACAATAACCACCTCTACAAG
CAAATCTCCAGTGCTTCAGGGGCCAGCAACGACAACCACTACT
TCGGCTACAGCACCCCCTGGGGGTATTTTGATTTCAACAGATT
CCACTGCCACTTTTCACCACGTGACTGGCAGCGACTCATCAAC
AACAATTGGGGATTCCGGCCCAAGAGACTCAACTTCAAACTCT
TCAACATCCAAGTCAAGGAGGTCACGACGAATGATGGCGTCAC
AACCATCGCTAATAACCTTACCAGCACGGTTCAAGTCTTCTCG
GACTCGGAGTACCAGCTTCCGTACGTCCTCGGCTCTGCGCACC
AGGGCTGCCTCCCTCCGTTCCCGGCGGACGTGTTCATGATTCC
GCAATACGGCTACCTGACGCTCAACAATGGCAGCCAAGCCGTG
GGACGTTCATCCTTTTACTGCCTGGAATATTTCCCTTCTCAGA
TGCTGAGAACGGGCAACAACTTTACCTTCAGCTACACCTTTGA
GGAAGTGCCTTTCCACAGCAGCTACGCGCACAGCCAGAGCCTG
GACCGGCTGATGAATCCTCTCATCGACCAATACCTGTATTACC
TGAACAGAACTCAAAATCAGTCCGGAAGTGCCCAAAACAAGGA
CTTGCTGTTTAGCCGTGGGTCTCCAGCTGGCATGTCTGTTCAG
CCCAAAAACTGGCTACCTGGACCCTGTTATCGGCAGCAGCGCG
TTTCTAAAACAAAAACAGACAACAACAACAGCAATTTTACCTG
GACTGGTGCTTCAAAATATAACCTCAATGGGCGTGAATCCATC
ATCAACCCTGGCACTGCTATGGCCTCACACAAAGACGACGAAG
ACAAGTTCTTTCCCATGAGCGGTGTCATGATTTTTGGAAAAGA
GAGCGCCGGAGCTTCAAACACTGCATTGGACAATGTCATGATT
ACAGACGAAGAGGAAATTAAAGCCACTAACCCTGTGGCCACCG
AAAGATTTGGGACCGTGGCAGTCAATTTCCAGAGCAGCAGCAC
AGACCCTGCGACCGGAGATGTGCATGCTATGGGAGCATTACCT
GGCATGGTGTGGCAAGATAGAGACGTGTACCTGCAGGGTCCCA
TTTGGGCCAAAATTCCTCACACAGATGGACACTTTCACCCGTC
TCCTCTTATGGGCGGCTTTGGACTCAAGAACCCGCCTCCTCAG
ATCCTCATCAAAAACACGCCTGTTCCTGCGAATCCTCCGGCGG
AGTTTTCAGCTACAAAGTTTGCTTCATTCATCACCCAATACTC
CACAGGACAAGTGAGTGTGGAAATTGAATGGGAGCTGCAGAAA
GAAAACAGCAAGCGCTGGAATCCCGAAGTGCAGTACACATCCA
ATTATGCAAAATCTGCCAACGTTGATTTTACTGTGGACAACAA
TGGACTTTATACTGAGCCTCGCCCCATTGGCACCCGTTACCTT ACCCGTCCCCTGTAA SEQ ID
Nucleotide ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACAACC NO: 16
sequence encoding TCTCTGAGGGCATTCGCGAGTGGTGGGACTTGAAACCTGGAGC
wildtype AAV6 CCCGAAACCCAAAGCCAACCAGCAAAAGCAGGACGACGGCCGG capsid
(VP1) GGTCTGGTGCTTCCTGGCTACAAGTACCTCGGACCCTTCAACG
GACTCGACAAGGGGGAGCCCGTCAACGCGGCGGATGCAGCGGC
CCTCGAGCACGACAAGGCCTACGACCAGCAGCTCAAAGCGGGT
GACAATCCGTACCTGCGGTATAACCACGCCGACGCCGAGTTTC
AGGAGCGTCTGCAAGAAGATACGTCTTTTGGGGGCAACCTCGG
GCGAGCAGTCTTCCAGGCCAAGAAGAGGGTTCTCGAACCTTTT
GGTCTGGTTGAGGAAGGTGCTAAGACGGCTCCTGGAAAGAAAC
GTCCGGTAGAGCAGTCGCCACAAGAGCCAGACTCCTCCTCGGG
CATTGGCAAGACAGGCCAGCAGCCCGCTAAAAAGAGACTCAAT
TTTGGTCAGACTGGCGACTCAGAGTCAGTCCCCGACCCACAAC
CTCTCGGAGAACCTCCAGCAACCCCCGCTGCTGTGGGACCTAC
TACAATGGCTTCAGGCGGTGGCGCACCAATGGCAGACAATAAC
GAAGGCGCCGACGGAGTGGGTAATGCCTCAGGAAATTGGCATT
GCGATTCCACATGGCTGGGCGACAGAGTCATCACCACCAGCAC
CCGAACATGGGCCTTGCCCACCTATAACAACCACCTCTACAAG
CAAATCTCCAGTGCTTCAACGGGGGCCAGCAACGACAACCACT
ACTTCGGCTACAGCACCCCCTGGGGGTATTTTGATTTCAACAG
ATTCCACTGCCATTTCTCACCACGTGACTGGCAGCGACTCATC
AACAACAATTGGGGATTCCGGCCCAAGAGACTCAACTTCAAGC
TCTTCAACATCCAAGTCAAGGAGGTCACGACGAATGATGGCGT
CACGACCATCGCTAATAACCTTACCAGCACGGTTCAAGTCTTC
TCGGACTCGGAGTACCAGTTGCCGTACGTCCTCGGCTCTGCGC
ACCAGGGCTGCCTCCCTCCGTTCCCGGCGGACGTGTTCATGAT
TCCGCAGTACGGCTACCTAACGCTCAACAATGGCAGCCAGGCA
GTGGGACGGTCATCCTTTTACTGCCTGGAATATTTCCCATCGC
AGATGCTGAGAACGGGCAATAACTTTACCTTCAGCTACACCTT
CGAGGACGTGCCTTTCCACAGCAGCTACGCGCACAGCCAGAGC
CTGGACCGGCTGATGAATCCTCTCATCGACCAGTACCTGTATT
ACCTGAACAGAACTCAGAATCAGTCCGGAAGTGCCCAAAACAA
GGACTTGCTGTTTAGCCGGGGGTCTCCAGCTGGCATGTCTGTT
CAGCCCAAAAACTGGCTACCTGGACCCTGTTACCGGCAGCAGC
GCGTTTCTAAAACAAAAACAGACAACAACAACAGCAACTTTAC
CTGGACTGGTGCTTCAAAATATAACCTTAATGGGCGTGAATCT
ATAATCAACCCTGGCACTGCTATGGCCTCACACAAAGACGACA
AAGACAAGTTCTTTCCCATGAGCGGTGTCATGATTTTTGGAAA
GGAGAGCGCCGGAGCTTCAAACACTGCATTGGACAATGTCATG
ATCACAGACGAAGAGGAAATCAAAGCCACTAACCCCGTGGCCA
CCGAAAGATTTGGGACTGTGGCAGTCAATCTCCAGAGCAGCAG
CACAGACCCTGCGACCGGAGATGTGCATGTTATGGGAGCCTTA
CCTGGAATGGTGTGGCAAGACAGAGACGTATACCTGCAGGGTC
CTATTTGGGCCAAAATTCCTCACACGGATGGACACTTTCACCC
GTCTCCTCTCATGGGCGGCTTTGGACTTAAGCACCCGCCTCCT
CAGATCCTCATCAAAAACACGCCTGTTCCTGCGAATCCTCCGG
CAGAGTTTTCGGCTACAAAGTTTGCTTCATTCATCACCCAGTA
TTCCACAGGACAAGTGAGCGTGGAGATTGAATGGGAGCTGCAG
AAAGAAAACAGCAAACGCTGGAATCCCGAAGTGCAGTATACAT
CTAACTATGCAAAATCTGCCAACGTTGATTTCACTGTGGACAA
CAATGGACTTTATACTGAGCCTCGCCCCATTGGCACCCGTTAC CTCACCCGTCCCCTGTAA SEQ
ID Nucleotide ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACAACC NO: 17
sequence encoding TCTDGAGGGCATTCGCGAGTGGTGGGACTTGAAACCTGGAGCC
modified AAV6.1 CCGAAACCCAAAGCCAACCAGCAAAAGCAGGACGACGGCCGGG capsid
VP1 (aa GTDGGTGCTTCCTGGCTACAAGTACCTCGGACCCTTCAACGGA residue number
265 CTCGACAAGGGGGAGCCCGTCAACGCGGCGGATGCAGCGGCCC is deleted)
TCGAGCACGACAAGGCCTACGACCAGCAGCTCAAAGCGGGTGA
CAATCCGTACCTGCGGTATAACCACGCCGACGCCGAGTTTCAG
GAGCGTCTGCAAGAAGATACGTCTTTTGGGGGCAACCTCGGGC
GAGCAGTCTTCCAGGCCAAGAAGAGGGTTCTCGAACCTTTTGG
TDGGTTGAGGAAGGTGCTAAGACGGCTCCTGGAAAGAAACGTC
CGGTAGAGCAGTCGCCACAAGAGCCAGACTCCTCCTCGGGCAT
TGGCAAGACAGGCCAGCAGCCCGCTAAAAAGAGACTCAATTTT
GGTCAGACTGGCGACTCAGAGTCAGTCCCCGACCCACAACCTC
TCGGAGAACCTCCAGCAACCCCCGCTGCTGTGGGACCTACTAC
AATGGCTTCAGGCGGTGGCGCACCAATGGCAGACAATAACGAA
GGCGCCGACGGAGTGGGTAATGCCTCAGGAAATTGGCATTGCG
ATTCCACATGGCTGGGCGACAGAGTCATCACCACCAGCACCCG
AACATGGGCCTTGCCCACCTATAACAACCACCTCTACAAGCAA
ATCTCCAGTGCTTCAGGGGCCAGCAACGACAACCACTACTTCG
GCTACAGCACCCCCTGGGGGTATTTTGATTTCAACAGATTCCA
CTGCCATTTCTCACCACGTGACTGGCAGCGACTCATCAACAAC
AATTGGGGATTCCGGCCCAAGAGACTCAACTTCAAGCTCTTCA
ACATCCAAGTCAAGGAGGTCACGACGAATGATGGCGTCACGAC
CATCGCTAATAACCTTACCAGCACGGTTCAAGTCTTCTCGGAC
TCGGAGTACCAGTTGCCGTACGTCCTCGGCTCTGCGCACCAGG
GCTGCCTCCCTCCGTTCCCGGCGGACGTGTTCATGATTCCGCA
GTACGGCTACCTAACGCTCAACAATGGCAGCCAGGCAGTGGGA
CGGTCATCCTTTTACTGCCTGGAATATTTCCCATCGCAGATGC
TGAGAACGGGCAATAACTTTACCTTCAGCTACACCTTCGAGGA
CGTGCCTTTCCACAGCAGCTACGCGCACAGCCAGAGCCTGGAC
CGGCTGATGAATCCTCTCATCGACCAGTACCTGTATTACCTGA
ACAGAACTCAGAATCAGTCCGGAAGTGCCCAAAACAAGGACTT
GCTGTTTAGCCGGGGGTCTCCAGCTGGCATGTCTGTTCAGCCC
AAAAACTGGCTACCTGGACCCTGTTACCGGCAGCAGCGCGTTT
CTAAAACAAAAACAGACAACAACAACAGCAACTTTACCTGGAC
TGGTGCTTCAAAATATAACCTTAATGGGCGTGAATCTATAATC
AACCCTGGCACTGCTATGGCCTCACACAAAGACGACAAAGACA
AGTTCTTTCCCATGAGCGGTGTCATGATTTTTGGAAAGGAGAG
CGCCGGAGCTTCAAACACTGCATTGGACAATGTCATGATCACA
GACGAAGAGGAAATCAAAGCCACTAACCCCGTGGCCACCGAAA
GATTTGGGACTGTGGCAGTCAATCTCCAGAGCAGCAGCACAGA
CCCTGCGACCGGAGATGTGCATGTTATGGGAGCCTTACCTGGA
ATGGTGTGGCAAGACAGAGACGTATACCTGCAGGGTCCTATTT
GGGCCAAAATTCCTCACACGGATGGACACTTTCACCCGTCTCC
TCTCATGGGCGGCTTTGGACTTAAGCACCCGCCTCCTCAGATC
CTCATCAAAAACACGCCTGTTCCTGCGAATCCTCCGGCAGAGT
TTTCGGCTACAAAGTTTGCTTCATTCATCACCCAGTATTCCAC
AGGACAAGTGAGCGTGGAGATTGAATGGGAGCTGCAGAAAGAA
AACAGCAAACGCTGGAATCCCGAAGTGCAGTATACATCTAACT
ATGCAAAATCTGCCAACGTTGATTTCACTGTGGACAACAATGG
ACTTTATACTGAGCCTCGCCCCATTGGCACCCGTTACCTCACC CGTCCCCTGTAA SEQ ID
Nucleotide ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACAACC NO: 18
sequence encoding TCTCTGAGGGCATTCGCGAGTGGTGGGACTTGAAACCTGGAGC
modified AAV6.3.1 CCCGAAACCCAAAGCCAACCAGCAAAAGCAGGACGACGGCCGG
capsid VP1 (aa GGTCTGGTGCTTCCTGGCTACAAGTACCTCGGACCCTTCAACG residue
265 deleted, GACTCGACAAGGGGGAGCCCGTCAACGCGGCGGATGCAGCGGC Lys 531
changed to CCTCGAGCACGACAAGGCCTACGACCAGCAGCTCAAAGCGGGT Glu)
GACAATCCGTACCTGCGGTATAACCACGCCGACGCCGAGTTTC
AGGAGCGTCTGCAAGAAGATACGTCTTTTGGGGGCAACCTCGG
GCGAGCAGTCTTCCAGGCCAAGAAGAGGGTTCTCGAACCTTTT
GGTCTGGTTGAGGAAGGTGCTAAGACGGCTCCTGGAAAGAAAC
GTCCGGTAGAGCAGTCGCCACAAGAGCCAGACTCCTCCTCGGG
CATTGGCAAGACAGGCCAGCAGCCCGCTAAAAAGAGACTCAAT
TTTGGTCAGACTGGCGACTCAGAGTCAGTCCCCGACCCACAAC
CTCTCGGAGAACCTCCAGCAACCCCCGCTGCTGTGGGACCTAC
TACAATGGCTTCAGGCGGTGGCGCACCAATGGCAGACAATAAC
GAAGGCGCCGACGGAGTGGGTAATGCCTCAGGAAATTGGCATT
GCGATTCCACATGGCTGGGCGACAGAGTCATCACCACCAGCAC
CCGAACATGGGCCTTGCCCACCTATAACAACCACCTCTACAAG
CAAATCTCCAGTGCTTCAGGGGCCAGCAACGACAACCACTACT
TCGGCTACAGCACCCCCTGGGGGTATTTTGATTTCAACAGATT
CCACTGCCATTTCTCACCACGTGACTGGCAGCGACTCATCAAC
AACAATTGGGGATTCCGGCCCAAGAGACTCAACTTCAAGCTCT
TCAACATCCAAGTCAAGGAGGTCACGACGAATGATGGCGTCAC
GACCATCGCTAATAACCTTACCAGCACGGTTCAAGTCTTCTCG
GACTCGGAGTACCAGTTGCCGTACGTCCTCGGCTCTGCGCACC
AGGGCTGCCTCCCTCCGTTCCCGGCGGACGTGTTCATGATTCC
GCAGTACGGCTACCTAACGCTCAACAATGGCAGCCAGGCAGTG
GGACGGTCATCCTTTTACTGCCTGGAATATTTCCCATCGCAGA
TGCTGAGAACGGGCAATAACTTTACCTTCAGCTACACCTTCGA
GGACGTGCCTTTCCACAGCAGCTACGCGCACAGCCAGAGCCTG
GACCGGCTGATGAATCCTCTCATCGACCAGTACCTGTATTACC
TGAACAGAACTCAGAATCAGTCCGGAAGTGCCCAAAACAAGGA
CTTGCTGTTTAGCCGGGGGTCTCCAGCTGGCATGTCTGTTCAG
CCCAAAAACTGGCTACCTGGACCCTGTTACCGGCAGCAGCGCG
TTTCTAAAACAAAAACAGACAACAACAACAGCAACTTTACCTG
GACTGGTGCTTCAAAATATAACCTTAATGGGCGTGAATCTATA
ATCAACCCTGGCACTGCTATGGCCTCACACAAAGACGACGAAG
ACAAGTTCTTTCCCATGAGCGGTGTCATGATTTTTGGAAAGGA
GAGCGCCGGAGCTTCAAACACTGCATTGGACAATGTCATGATC
ACAGACGAAGAGGAAATCAAAGCCACTAACCCCGTGGCCACCG
AAAGATTTGGGACTGTGGCAGTCAATCTCCAGAGCAGCAGCAC
AGACCCTGCGACCGGAGATGTGCATGTTATGGGAGCCTTACCT
GGAATGGTGTGGCAAGACAGAGACGTATACCTGCAGGGTCCTA
TTTGGGCCAAAATTCCTCACACGGATGGACACTTTCACCCGTC
TCCTCTCATGGGCGGCTTTGGACTTAAGCACCCGCCTCCTCAG
ATCCTCATCAAAAACACGCCTGTTCCTGCGAATCCTCCGGCAG
AGTTTTCGGCTACAAAGTTTGCTTCATTCATCACCCAGTATTC
CACAGGACAAGTGAGCGTGGAGATTGAATGGGAGCTGCAGAAA
GAAAACAGCAAACGCTGGAATCCCGAAGTGCAGTATACATCTA
ACTATGCAAAATCTGCCAACGTTGATTTCACTGTGGACAACAA
TGGACTTTATACTGAGCCTCGCCCCATTGGCACCCGTTACCTC ACCCGTCCCCTGTAA SEQ ID
Nucleotide TAGAAGACCGGTCGCCACCatgtggactctcgggcgccgcgca NO: 19
sequence encoding gtagccggcctcctggcgtcacccagcccagcccaggcccaga human
wild type ccctcacccgggtcccgcggccggcagagttggccccactctg frataxin (WT
FXN) cggccgccgtggcctgcgcaccgacatcgatgcgacctgcacg for cloning into
ccccgccgcgcaagttcgaaccaacgtggcctcaaccagattt pTRs-KS-CBh-
ggaatgtcaaaaagcagagtgtctatttgatgaatttgaggaa EGFP-BGH scAAV
atctggaactttgggccacccaggctctctagatgagaccacc vector
tatgaaagactagcagaggaaacgctggactctttagcagagt AgeI site in bold;
tttttgaagaccttgcagacaagccatacacgtttgaggacta AvrII underlined;
tgatgtctcctttgggagtggtgtcttaactgtcaaactgggt CSS double
ggagatctaggaacctatgtgatcaacaagcagacgccaaaca underlined;
agcaaatctggctatcttctccatccagtggacctaagcgtta SpeI in bold
tgactggactgggaaaaactgggtgtactcccacgacggcgtg underlined;
tccctccatgagctgctggccgcagagctcactaaagccttaa bGHpolyA in italics;
aaaccaaactggacttgtcttccttggcctattccggaaaaga MluI site in bold
tgcttgaCGAGCGGCCGCTCCTAGGAGCAGTATCGATCCCAGC italics
CCACTTTTCCCCAATACGACTAGTACTCGACTGTGCCTTCTAG (See FIG. 2A)
TTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG
ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATG
AGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCT
GGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA
GACAACAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTT
CTGAGGCGGAAAGAACCAGCTTTGG CTTAAG SEQ ID IDT1 Codon
TAGAAGACCGGTCGCCACCatgtggactctgggtaggcgagcg NO: 20 optimized
nucleotide gtggccggcctgttggcatctcctagtcctgcacaagctcaaa sequence
encoding cgctgactagagtccctcggccagcagaactggcgccactttg FXN for
cloning into cggccggcgcggtcttcgcactgatattgatgccacttgcaca
pTRs-KS-CBh- ccccggcgcgcctccagtaatcagcggggacttaatcaaattt EGFP-BGH
scAAV ggaatgtgaagaagcagtctgtgtatcttatgaatctgcggaa vector
gagcgggaccctgggccaccctggtagccttgatgaaaccacc AgeI site in bold;
tatgagcgcctggccgaagagacactggacagtcttgccgagt AvrII underlined;
tttttgaggatctggccgacaaaccttatacttttgaggacta CSS double
tgacgtgtcctttggatctggtgtattgaccgtaaaactcggg underlined;
ggagaccttgggacgtatgtaataaataagcagaccccaaaca SpeI in bold
agcagatctggctcagctctccaagtagtggtcctaagagata underlined;
tgattggacgggcaagaactgggtctattcccatgatggcgtc bGHpolyA in italics;
tctttgcatgaactccttgcagcagagctgaccaaggccttga MluI site in bold
agaccaaattggatctcagcagcctcgcctatagtggcaaaga italics
tgcatagCGAGCGGCCGCTCCTAGGAGCAGTATCGATCCCAGC (See FIG. 2B)
CCACTTTTCCCCAATACGACTAGTACTCGACTGTGCCTTCTAG
TTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG
ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATG
AGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCT
GGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA
GACAACAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTT
CTGAGGCGGAAAGAACCAGCTTTGG CTTAAG SEQ ID Codon optimized
TAGAAGACCGGTCGCCACCatgtggacactgggaaggcgcgcc NO: 21 nucleotide
sequence gtggccggtctgttggcatcaccatccccagcccaggctcaga encoding FXN
IDT3 cactcacccgagtcccaagacccgcagagctggcccctctgtg (low expresser)
for cgggcgccgaggccttcgcaccgatatcgatgctacatgcacg cloning into pTRs-
ccacgcagagctagctcaaatcagaggggactcaaccagatat KS-CBh-EGFP-BGH
ggaatgtcaagaagcaaagcgtgtatctcatgaacctccggaa scAAV vector
aagcggcaccctgggacatcccgggtctctcgacgagaccact AgeI site in bold;
tatgaaagactggcagaggagactcttgacagtctggcggagt AvrII underlined;
tcttcgaagacctcgctgacaagccatataccttcgaagatta CSS double
cgacgtctccttcggctctggggtgctgactgtcaagcttggc underlined;
ggcgacctggggacctacgtgatcaacaagcagactccaaaca SpeI in bold
agcaaatctggctcagcagtccaagctccggacccaagagata underlined;
cgattggacaggcaagaattgggtttactcccacgacggggtg bGHpolyA in italics;
tccctccatgagctgctggccgctgagctgacgaaggccctga MluI site in bold
agaccaagctggatctctcctccctggcatacagtggtaagga italics
cgcttgaCGAGCGGCCGCTCCTAGGAGCAGTATCGATCCCAGC (See FIG. 2C)
CCACTTTTCCCCAATACGACTAGTACTCGACTGTGCCTTCTAG
TTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG
ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATG
AGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCT
GGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA
GACAACAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTT
CTGAGGCGGAAAGAACCAGCTTTGG CTTAAG SEQ ID Codon-optimized
TAGAAGACCGGTCGCCACCatgtggactctgggccggcgggcc NO: 22 nucleotide
sequence gtagctggcttgctggctagcccaagtcccgcccaggctcaga encoding FXN
IDT4 ctctcaccagggtacccaggcccgcagagcttgctccactctg for cloning into
cggacgcaggggtctgcgaaccgatatcgacgcaacttgcacg pTRs-KS-CBh-
ccgcggagggcctcttcaaaccagagaggactcaatcaaattt EGFP-BGH scAAV
ggaatgtaaagaaacagagcgtgtatctcatgaacctccgaaa vector
gagtgggactcttgggcaccccggctccctggacgagactact AgeI site in bold;
tacgagcgcctggccgaagaaaccttggattccctggcggagt AvrII underlined;
tttttgaagacttggcagacaagccttataccttcgaggatta CSS double
cgacgtgagttttggctctggtgttcttacagtcaagctcggt underlined;
ggcgaccttggcacttatgtaattaacaagcagacacctaaca SpeI in bold
agcagatctggctttctagtccgtcttccggtcccaaaaggta underlined;
cgattggactggaaagaactgggtctacagtcacgacggtgtc bGHpolyA in italics;
tccctgcacgaattgcttgcggctgagctgactaaggcgctca MluI site in bold
aaacaaaactggatctgtccagccttgcctatagcgggaagga italics
cgcatgaCGAGCGGCCGCTCCTAGGAGCAGTATCGATCCCAGC (See FIG. 2D)
CCACTTTTCCCCAATACGACTAGTACTCGACTGTGCCTTCTAG
TTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG
ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATG
AGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCT
GGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA
GACAACAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTT
CTGAGGCGGAAAGAACCAGCTTTGG CTTAAG SEQ ID Codon-optimized
TAGAAGACCGGTCGCCACCatgtggacactgggccggagagcc NO: 23 nucleotide
sequence gtcgctgggctgctggcatcaccatcccccgcacaggcacaga encoding FXN
ccctgacaagagtccctcggccagcagagctggccccactgtg GenScript for
cgggcggagaggactgcgaaccgacatcgatgctacttgtacc cloning into pTRs-
ccaaggcgagcaagctccaaccagcgagggctgaaccagattt KS-CBh-EGFP-BGH
ggaatgtgaagaaacagtctgtctacctgatgaatctgagaaa scAAV vector
gagcggcactctgggacaccctggcagcctggacgagaccacc AgeI site in bold;
tacgagcggctggccgaggaaaccctggattccctggccgagt AvrII underlined;
tctttgaagacctggctgataagccatacaccttcgaagacta CSS double
tgacgtgagcttcggcagcggcgtgctgacagtcaaactgggc underlined;
ggggacctgggaacatacgtgatcaacaagcagactcctaaca SpeI in bold
agcagatttggctgtctagtccctcaagcggccctaagaggta underlined;
cgactggacagggaaaaactgggtgtatagtcacgatggcgtc bGHpolyA in italics;
tcactgcatgagctgctggccgctgaactgactaaagccctga MluI site in bold
aaactaaactggacctgtcttccctggcatactctggcaagga italics
cgcctgaCGAGCGGCCGCTCCTAGGAGCAGTATCGATCCCAGC (See FIG. 2E)
CCACTTTTCCCCAATACGACTAGTACTCGACTGTGCCTTCTAG
TTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG
ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATG
AGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCT
GGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA
GACAACAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTT
CTGAGGCGGAAAGAACCAGCTTTGG CTTAAG SEQ ID Codon-optimized
TAGAAGACCGGTCGCCACCatgtggactctgggccggagagca NO: 24 nucleotide
sequence gtggcaggactgctggcaagtccatcacctgctcaggcacaga encoding FXN
ctctgacaagagtcccaagacctgcagagctggctccactgtg GenScript (low CpG)
cgggaggcgcggactgagaacagacatcgatgctacatgtact for cloning into
cctcgacgggcaagctccaaccagcgagggctgaaccagattt pTRs-KS-CBh-
ggaatgtgaagaaacagtccgtctacctgatgaatctgaggaa EGFP-BGH scAAV
gtcaggcaccctggggcacccaggaagtctggacgagaccaca vector
tatgaacggctggctgaggaaacactggattctctggccgagt Agel site in bold;
tctttgaagacctggctgataagccctacacattcgaagacta Awll underlined;
tgatgtgagctttggatccggcgtgctgactgtcaaactgggc CSS double
ggggacctgggcacttacgtgatcaacaagcagacccctaaca underlined;
agcagatttggctgtctagtccttcaagcggaccaaagcggta Spel in bold
cgactggaccggcaaaaactgggtgtattctcacgatggggtc underlined;
agtctgcatgagctgctggccgctgaactgaccaaggccctga bGHpolyA in italics;
agacaaaactggacctgtcctctctggcatatagcggaaaaga Miul site in bold
tgcctgaCGAGCGGCCGCTCCTAGGAGCAGTATCGATCCCAGC italics
CCACTTTTCCCCAATACGACTAGTACTCGACTGTGCCTTCTAG (See Figure 2F)
TTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG
ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATG
AGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCT
GGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA
GACAACAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTT
CTGAGGCGGAAAGAACCAGCTTTGG CTTAAG SEQ ID Nucleic acid
CCCAGCCCACTTTTCCCCAA NO: 25 sequence encoding collagen stabilizing
sequence (CSS) SEQ ID Nucleic acid
tacataacttacggtaaatggcccgcctggctgaccgcccaac NO: 26 sequence of CBh
gacccccgcccattgacgtcaatagtaacgccaatagggactt promoter
tccattgacgtcaatgggtggagtatttacggtaaactgccca
cttggcagtacatcaagtgtatcatatgccaagtacgccccct
attgacgtcaatgacggtaaatggcccgcctggcattgtgccc
agtacatgaccttatgggactttcctacttggcagtacatcta
cgtattagtcatcgctattaccatggtcgaggtgagccccacg
ttctgcttcactctccccatctcccccccctccccacccccaa
ttttgtatttatttattttttaattattttgtgcagcgatggg
ggcggggggggggggggggcgcgcgccaggcggggcggggcgg
ggcgaggggcggggcggggcgaggcggagaggtgcggcggcag
ccaatcagagcggcgcgctccgaaagtttccttttatggcgag
gcggcggcggcggcggccctataaaaagcgaagcgcgcggcgg
gcgggagtcgctgcgacgctgccttcgccccgtgccccgctcc
gccgccgcctcgcgccgcccgccccggctctgactgaccgcgt
tactcccacaggtgagcgggcgggacggcccttctcctccggg
ctgtaattagctgagcaagaggtaagggtttaagggatggttg
gttggtggggtattaatgtttaattacctggagcacctgcctg aaatcactttttttcaggttgga
SEQ ID Nucleic acid CTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCC NO:
27 sequence of TCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTG bGHpoly
A signal TCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAG sequence
TAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGC
AAGGGGGAGGATTGGGAAGACAACAGCAGGCATGCTGGGGATG
CGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCT SEQ ID Nucleotide
atggctgccgatggttatcttccagattggctcgaggacactc NO: 28 sequence
encoding tctctgaaggaataagacagtggtggaagctcaaacctggccc AAV2i8 capsid
accaccaccaaagcccgcagagcggcataaggacgacagcagg (VP1)
ggtcttgtgcttcctgggtacaagtacctcggacccttcaacg
gactcgacaagggagagccggtcaacgaggcagacgccgcggc
cctcgagcacgacaaagcctacgaccggcagctcgacagcgga
gacaacccgtacctcaagtacaaccacgccgacgcggagtttc
aggagcgccttaaagaagatacgtcttttgggggcaacctcgg
acgagcagtcttccaggcgaaaaagagggttcttgaacctctg
ggcctggttgaggaacctgttaagacggctccgggaaaaaaga
ggccggtagagcactctcctgtggagccagactcctcctcggg
aaccggaaaggcgggccagcagcctgcaagaaaaagattgaat
tttggtcagactggagacgcagactcagtacctgacccccagc
ctctcggacagccaccagcagccccctctggtctgggaactaa
tacgatggctacaggcagtggcgcaccaatggcagacaataac
gagggcgccgacggagtgggtaattcctcgggaaattggcatt
gcgattccacatggatgggcgacagagtcatcaccaccagcac
ccgaacctgggccctgcccacctacaacaaccacctctacaaa
caaatttccagccaatcaggagcctcgaacgacaatcactact
ttggctacagcaccccttgggggtattttgacttcaacagatt
ccactgccacttttcaccacgtgactggcaaagactcatcaac
aacaactggggattccgacccaagagactcaacttcaagctct
ttaacattcaagtcaaagaggtcacgcagaatgacggtacgac
gacgattgccaataaccttaccagcacggttcaggtgtttact
gactcggagtaccagctcccgtacgtcctcggctcggcgcatc
aaggatgcctcccgccgttcccagcagacgtcttcatggtgcc
acagtatggatacctcaccctgaacaacgggagtcaggcagta
ggacgctcttcattttactgcctggagtactttccttctcaga
tgctgcgtaccggaaacaactttaccttcagctacacttttga
ggacgttcctttccacagcagcta
cgctcacagccagagtctggaccgtctcatgaatcctctcatc
gaccagtacctgtattacttgagcagaacaaacactccaagtg
gaaccaccacgcagtcaaggcttcagttttctgtggccggacc
cagtaacatggctgtccagggaaggaactggcttcctggaccc
tgttaccgccagcagcgagtatcaaagacatctgcggataaca
acaacagtgaatttgcttggactggagctaccaagtaccacct
caatggcagagactctctggtgaatccgggcccggccatggca
agccacaaggacgatgaagaaaagttttttcctcagagcgggg
ttctcatctttgggaagcaaggctcagagaaaacaaatgtgga
cattgaaaaggtcatgattacagacgaagaggaaatcaggaca
accaatcccgtggctacggagcagtatggttctgtatctacca
acctccagcaacagaacacagcaccagctaccgcagatgtcaa
cacacaaggcgttcttccaggcatggtctggcaggacagagat
gtgtaccttcaggggcccatctgggcaaagattccacacacgg
acggacattttcacccctctcccctcatgggtggattcggact
taaacaccctcctccacagattctcatcaagaacaccccggta
cctgcgaatccttcgaccaccttcagtgcggcaaagtttgctt
ccttcatcacacagtactccacgggacaggtcagcgtggagat
cgagtgggagctgcagaaggaaaacagcaaacgctggaatccc
gaaattcagtacacttccaactacaacaagtctgttaatgtgg
actttactgtggacactaatggcgtgtattcagagcctcgccc
cattggcaccagatacctgactcgtaatctgtaa SEQ ID Amino acid
MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSR NO: 29 sequence of
AAV2i8 GLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSG capsid (VP1)
DNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPL
GLVSEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLN
FGQTGDADSVPDPQPLGQPPAAPSGLGTNTMATGSGAPMADNN
EGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYK
QISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLIN
NNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFT
DSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAV
GRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSL
DRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSVAGPSNMAVQ
GRNWLPGPCYRQQRVSKTSADNNNSEFAWTGATKYHLNGRDSL
VNPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMI
TDEEEIRTTNPVATEQYGSVSTNLQQQNTAPATADVNTQGVLP
GMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQ
ILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQK
ENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYL
TRNL SEQ ID Nucleic acid
ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACACTC NO: 30 encoding AAV2-TT
TCTCTGAAGGAATAAGACAGTGGTGGAAGCTCAAACCTGGCCC capsid (VP1)
ACCACCACCAAAGCCCGCAGAGCGGCATAAGGACGACAGCAGG (nucleotides that
GGTCTTGTGCTTCCTGGGTACAAGTACCTCGGACCCTTCAACG differ from WT AAV2
GACTCGACAAGGGAGAGCCGGTCAACGAGGCAGACGCCGCGGC are underlined)
CCTCGAGCACGACAAAGCCTACGACCGGCAGCTCGACAGCGGA
GACAACCCGTACCTCAAGTACAACCACGCCGACGCGGAGTTTC
AGGAGCGCCTTAAAGAAGATACGTCTTTTGGGGGCAACCTCGG
ACGAGCAGTCTTCCAGGCGAAAAAGAGGATTCTTGAACCTCTG
GGCCTGGTTGAGGAACCTGTTAAGACGGCTCCGGGAAAAAAGA
GGCCGGTAGAGCACTCTCCTGCGGAGCCAGACTCCTCCTCGGG
AACCGGAAAGTCGGGCCAGCAGCCTGCAAGAAAAAGATTGAAT
TTTGGTCAGACTGGAGACGCAGACTCAGTACCTGACCCCCAGC
CTCTCGGACAGCCACCAGCAGCCCCCTCTGGTCTGGGAACTAA
TACGATGGCTTCAGGCAGTGGCGCACCAATGGCAGACAATAAC
GAGGGCGCCGACGGAGTGGGTAATTCCTCGGGAAATTGGCATT
GCGATTCCACATGGATGGGCGACAGAGTCATCACCACCAGCAC
CCGAACCTGGGCCCTGCCCACCTACAACAACCACCTCTACAAA
CAAATTTCCAGCCAATCAGGAGCCTCGAACGACAATCACTACT
TTGGCTACAGCACCCCTTGGGGGTATTTTGACTTCAACAGATT
CCACTGCCACTTTTCACCACGTGACTGGCAAAGACTCATCAAC
AACAACTGGGGATTCCGACCCAAGAGACTCAGCTTCAAGCTCT
TTAACATTCAAGTCAAAGAGGTCACGCAGAATGACGGTACGAC
GACGATTGCCAATAACCTTACCAGCACGGTTCAGGTGTTTACT
GACTCGGAGTACCAGCTCCCGTACGTCCTCGGCTCGGCGCATC
AAGGATGCCTCCCGCCGTTCCCAGCAGACGTCTTCATGGTGCC
ACAGTATGGATACCTCACCCTGAACAACGGGAGTCAGGCAGTA
GGACGCTCTTCATTTTACTGCCTGGAGTACTTTCCTTCTCAGA
TGCTGCGTACCGGAAACAACTTTACCTTCAGCTACACTTTTGA
GGACGTTCCTTTCCACAGCAGCTACGCTCACAGCCAGAGTCTG
GACCGTCTCATGAATCCTCTCATCGACCAGTACCTGTATTACT
TGAGCAGAACAAACACTCCAAGTGGAACCACCACGATGTCAAG
GCTTCAGTTTTCTCAGGCCGGAGCGAGTGACATTCGGGACCAG
TCTAGGAACTGGCTTCCTGGACCCTGTTACCGCCAGCAGCGAG
TATCAAAGACAGCTGCGGATAACAACAACAGTGATTACTCGTG
GACTGGAGCTACCAAGTACCACCTCAATGGCAGAGACTCTCTG
GTGAATCCGGGCCCGGCCATGGCAAGCCACAAGGACGATGAAG
AAAAGTATTTTCCTCAGAGCGGGGTTCTCATCTTTGGGAAGCA
AGACTCAGGAAAAACAAATGTGGACATTGAAAAGGTCATGATT
ACAGACGAAGAGGAAATCAGGACAACCAATCCCGTGGCTACGG
AGCAGTATGGTTCTGTATCTACCAACCTCCAGAGCGGCAACAC
ACAAGCAGCTACCTCAGATGTCAACACACAAGGCGTTCTTCCA
GGCATGGTCTGGCAGGACAGAGATGTGTACCTTCAGGGGCCCA
TCTGGGCAAAGATTCCACACACGGACGGACATTTTCACCCCTC
TCCCCTCATGGGTGGATTCGGACTTAAACACCCTCCTCCACAG
ATTCTCATCAAGAACACCCCGGTACCTGCGAATCCTTCGACCA
CCTTCAGTGCGGCAAAGTTTGCTTCCTTCATCACACAGTACTC
CACGGGACAGGTCAGCGTGGAGATCGAGTGGGAGCTGCAGAAG
GAAAACAGCAAACGCTGGAATCCCGAAATTCAGTACACTTCCA
ACTACAACAAGTCTGTTAATGTGGACTTTACTGTGGACACTAA
TGGCGTGTATTCAGAGCCTCGCCCCATTGGCACCAGATACCTG ACTCGTAATCTGTAA SEQ ID
Amino acid MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSR NO: 31
sequence of AAV2- GLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSG TT
capsid (VP1) DNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRILEPL
GLVPEPVKTAPGKKRPVEHSPAPPDSSSGTGKSGQQPARKRLN
FGQTGDADSVPDPQPLGQPPAAPSGLGTNTMASGSGAPMADNN
EGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYK
QISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLIN
NNWGFRPKRLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFT
DSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAV
GRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSL
DRLMNPLIDQYLYYLSRTNTPSGTTTMSRLQFSQAGASDIRDQ
SRNWLPGPCYRQQRVSKTAADNNNSDYSWTGATKYHLNGRDSL
VNPGPAMASHKDDEEKYFPQSGVLIFGKQDSGKTNVDIEKVMI
TDEEEIRTTNPVATEQYGSVSTNLQSGNTQAATSDVNTQGVLP
GMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQ
ILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQK
ENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYL TRNL SEQ ID Nucleic
acid ATGGCTGCCGATGGTTATCTTCCAGATTGGCTCGAGGACACTC NO: 32 encoding
AAV2-TT- TCTCTGAAGGAATAAGACAGTGGTGGAAGCTCAAACCTGGCCC S312N capsid
ACCACCACCAAAGCCCGCAGAGCGGCATAAGGACGACAGCAGG (VP1)
GGTCTTGTGCTTCCTGGGTACAAGTACCTCGGACCCTTCAACG (nucleotides that
GACTCGACAAGGGAGAGCCGGTCAACGAGGCAGACGCCGCGGC differ from WT AAV2
CCTCGAGCACGACAAAGCCTACGACCGGCAGCTCGACAGCGGA are underlined)
GACAACCCGTACCTCAAGTACAACCACGCCGACGCGGAGTTTC
AGGAGCGCCTTAAAGAAGATACGTCTTTTGGGGGCAACCTCGG
ACGAGCAGTCTTCCAGGCGAAAAAGAGGATTCTTGAACCTCTG
GGCCTGGTTGAGGAACCTGTTAAGACGGCTCCGGGAAAAAAGA
GGCCGGTAGAGCACTCTCCTGCGGAGCCAGACTCCTCCTCGGG
AACCGGAAAGTCGGGCCAGCAGCCTGCAAGAAAAAGATTGAAT
TTTGGTCAGACTGGAGACGCAGACTCAGTACCTGACCCCCAGC
CTCTCGGACAGCCACCAGCAGCCCCCTCTGGTCTGGGAACTAA
TACGATGGCTTCAGGCAGTGGCGCACCAATGGCAGACAATAAC
GAGGGCGCCGACGGAGTGGGTAATTCCTCGGGAAATTGGCATT
GCGATTCCACATGGATGGGCGACAGAGTCATCACCACCAGCAC
CCGAACCTGGGCCCTGCCCACCTACAACAACCACCTCTACAAA
CAAATTTCCAGCCAATCAGGAGCCTCGAACGACAATCACTACT
TTGGCTACAGCACCCCTTGGGGGTATTTTGACTTCAACAGATT
CCACTGCCACTTTTCACCACGTGACTGGCAAAGACTCATCAAC
AACAACTGGGGATTCCGACCCAAGAGACTCAACTTCAAGCTCT
TTAACATTCAAGTCAAAGAGGTCACGCAGAATGACGGTACGAC
GACGATTGCCAATAACCTTACCAGCACGGTTCAGGTGTTTACT
GACTCGGAGTACCAGCTCCCGTACGTCCTCGGCTCGGCGCATC
AAGGATGCCTCCCGCCGTTCCCAGCAGACGTCTTCATGGTGCC
ACAGTATGGATACCTCACCCTGAACAACGGGAGTCAGGCAGTA
GGACGCTCTTCATTTTACTGCCTGGAGTACTTTCCTTCTCAGA
TGCTGCGTACCGGAAACAACTTTACCTTCAGCTACACTTTTGA
GGACGTTCCTTTCCACAGCAGCTACGCTCACAGCCAGAGTCTG
GACCGTCTCATGAATCCTCTCATCGACCAGTACCTGTATTACT
TGAGCAGAACAAACACTCCAAGTGGAACCACCACGATGTCAAG
GCTTCAGTTTTCTCAGGCCGGAGCGAGTGACATTCGGGACCAG
TCTAGGAACTGGCTTCCTGGACCCTGTTACCGCCAGCAGCGAG
TATCAAAGACAGCTGCGGATAACAACAACAGTGATTACTCGTG
GACTGGAGCTACCAAGTACCACCTCAATGGCAGAGACTCTCTG
GTGAATCCGGGCCCGGCCATGGCAAGCCACAAGGACGATGAAG
AAAAGTATTTTCCTCAGAGCGGGGTTCTCATCTTTGGGAAGCA
AGACTCAGGAAAAACAAATGTGGACATTGAAAAGGTCATGATT
ACAGACGAAGAGGAAATCAGGACAACCAATCCCGTGGCTACGG
AGCAGTATGGTTCTGTATCTACCAACCTCCAGAGCGGCAACAC
ACAAGCAGCTACCTCAGATGTCAACACACAAGGCGTTCTTCCA
GGCATGGTCTGGCAGGACAGAGATGTGTACCTTCAGGGGCCCA
TCTGGGCAAAGATTCCACACACGGACGGACATTTTCACCCCTC
TCCCCTCATGGGTGGATTCGGACTTAAACACCCTCCTCCACAG
ATTCTCATCAAGAACACCCCGGTACCTGCGAATCCTTCGACCA
CCTTCAGTGCGGCAAAGTTTGCTTCCTTCATCACACAGTACTC
CACGGGACAGGTCAGCGTGGAGATCGAGTGGGAGCTGCAGAAG
GAAAACAGCAAACGCTGGAATCCCGAAATTCAGTACACTTCCA
ACTACAACAAGTCTGTTAATGTGGACTTTACTGTGGACACTAA
TGGCGTGTATTCAGAGCCTCGCCCCATTGGCACCAGATACCTG ACTCGTAATCTGTAA SEQ ID
Amino acid MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSR NO: 33
sequence of AAV2- GLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSG
TT-S312N capsid DNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRILEPL (VP1)
GLVEEPVKTAPGKKRPVEHSPAEPDSSSGTGKSGQQPARKRLN
FGQTGDADSVPDPQPLGQPPAAPSGLGTNTMASGSGAPMADNN
EGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYK
QISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLIN
NNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFT
DSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAV
GRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSL
DRLMNPLIDQYLYYLSRTNTPSGTTTMSRLQFSQAGASDIRDQ
SRNWLPGPCYRQQRVSKTAADNNNSDYSWTGATKYHLNGRDSL
VNPGPAMASHKDDEEKYFPQSGVLIFGKQDSGKTNVDIEKVMI
TDEEEIRTTNPVATEQYGSVSTNLQSGNTQAATSDVNTQGVLP
GMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQ
ILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQK
ENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYL TRNL
Sequence CWU 1
1
331210PRTArtificial SequenceAmino acid sequence of human wild type
frataxin 1Met Trp Thr Leu Gly Arg Arg Ala Val Ala Thr Gly Leu Leu
Ala Ser1 5 10 15Pro Ser Pro Ala Gln Ala Gln Thr Leu Thr Arg Val Pro
Arg Pro Ala 20 25 30Glu Leu Ala Pro Leu Cys Gly Arg Arg Gly Leu Arg
Thr Asp Ile Asp 35 40 45Ala Thr Cys Pro Arg Arg Ala Ser Ser Asn Gln
Arg Gly Leu Asn Gln 50 55 60Ile Trp Asn Val Lys Lys Gln Ser Val Tyr
Leu Met Asn Leu Arg Lys65 70 75 80Ser Gly Thr Leu Gly His Pro Gly
Ser Leu Asp Glu Thr Thr Tyr Glu 85 90 95Arg Leu Ala Glu Glu Thr Leu
Asp Ser Leu Ala Glu Phe Phe Glu Asp 100 105 110Leu Ala Asp Lys Pro
Tyr Thr Phe Glu Asp Tyr Asp Val Ser Phe Gly 115 120 125Ser Gly Val
Leu Thr Val Lys Leu Gly Gly Asp Leu Gly Thr Tyr Val 130 135 140Ile
Asn Lys Gln Thr Pro Asn Lys Gln Ile Trp Leu Ser Ser Pro Ser145 150
155 160Ser Gly Pro Lys Arg Tyr Asp Trp Thr Gly Lys Asn Trp Val Tyr
Ser 165 170 175His Asp Gly Val Ser Leu His Glu Leu Leu Ala Ala Glu
Leu Thr Lys 180 185 190Ala Leu Lys Thr Lys Leu Asp Leu Ser Ser Leu
Ala Tyr Ser Gly Lys 195 200 205Asp Ala 2102630DNAArtificial
SequenceNucleotide sequence encoding wild type frataxin 2atgtggactc
tcgggcgccg cgcagtagcc ggcctcctgg cgtcacccag cccagcccag 60gcccagaccc
tcacccgggt cccgcggccg gcagagttgg ccccactctg cggccgccgt
120ggcctgcgca ccgacatcga tgcgacctgc acgccccgcc gcgcaagttc
gaaccaacgt 180ggcctcaacc agatttggaa tgtcaaaaag cagagtgtct
atttgatgaa tttgaggaaa 240tctggaactt tgggccaccc aggctctcta
gatgagacca cctatgaaag actagcagag 300gaaacgctgg actctttagc
agagtttttt gaagaccttg cagacaagcc atacacgttt 360gaggactatg
atgtctcctt tgggagtggt gtcttaactg tcaaactggg tggagatcta
420ggaacctatg tgatcaacaa gcagacgcca aacaagcaaa tctggctatc
ttctccatcc 480agtggaccta agcgttatga ctggactggg aaaaactggg
tgtactccca cgacggcgtg 540tccctccatg agctgctggc cgcagagctc
actaaagcct taaaaaccaa actggacttg 600tcttccttgg cctattccgg
aaaagatgct 6303630DNAArtificial SequenceIDT2 optimized nucleotide
sequence encoding frataxin 3atgtggacac tgggcagaag ggcggtggcc
ggactgttgg cgagtcccag tcccgcgcag 60gcgcagaccc ttactagggt gccgcggccc
gcggagctgg cgccactctg cggtcgccgc 120ggtctgagaa cggacattga
tgccacttgt acacctcgga gggccagctc caaccaaagg 180ggccttaatc
aaatttggaa cgtgaagaag cagtccgtct acctgatgaa ccttcggaag
240tcagggaccc tgggccaccc gggaagcttg gatgaaacaa cttacgaaag
gttggcggag 300gagaccttgg attctcttgc agagttcttc gaagacctgg
ctgataagcc ttacaccttt 360gaggactacg atgtgtcttt tggatctgga
gtgctgaccg ttaaactggg cggggatctg 420ggcacctacg tgattaacaa
gcaaactcca aacaagcaga tctggctttc aagccccagt 480agcgggccaa
aacgctacga ttggaccgga aagaattggg tttacagcca cgatggcgtt
540tcactgcacg agcttctggc agcagaactg acaaaagcac tcaagacgaa
gctcgacttg 600tcatccttgg catactccgg aaaggatgcc 6304630DNAArtificial
SequenceJCAT Optimized Nucleotide sequence encoding frataxin
4atgtggaccc tgggccgccg cgccgtggcc ggcctgctgg ccagccccag ccccgcccag
60gcccagaccc tgacccgcgt gccccgcccc gccgagctgg cccccctgtg cggccgccgc
120ggcctgcgca ccgacatcga cgccacctgc accccccgcc gcgccagcag
caaccagcgc 180ggcctgaacc agatctggaa cgtgaagaag cagagcgtgt
acctgatgaa cctgcgcaag 240agcggcaccc tgggccaccc cggcagcctg
gacgagacca cctacgagcg cctggccgag 300gagaccctgg acagcctggc
cgagttcttc gaggacctgg ccgacaagcc ctacaccttc 360gaggactacg
acgtgagctt cggcagcggc gtgctgaccg tgaagctggg cggcgacctg
420ggcacctacg tgatcaacaa gcagaccccc aacaagcaga tctggctatc
tagccccagc 480agcggcccca agcgctacga ctggaccggc aagaactggg
tgtacagcca cgacggcgtg 540agcctgcacg agctgctggc cgccgagctg
accaaggccc tgaagaccaa gctggacctg 600agcagcctgg cctacagcgg
caaggacgcc 6305630DNAArtificial SequenceGeneArt optimized
nucleotide sequence encoding frataxin 5atgtggacac tggggagaag
ggctgtggcc ggactgctgg cttctccatc tccagcccag 60gcccagaccc tgaccagagt
gcctagacct gccgaactgg cccctctgtg tggcagaaga 120ggcctgagaa
ccgacatcga cgccacctgt acccccagaa gggccagcag caatcagcgg
180ggcctgaatc agatctggaa cgtgaagaaa cagagcgtgt acctgatgaa
cctgagaaag 240agcggcaccc tgggccaccc tggaagcctg gatgagacaa
cctacgagcg gctggccgag 300gaaaccctgg attccctggc cgagttcttc
gaggacctgg ccgacaagcc ctacaccttc 360gaggattacg acgtgtcctt
cggcagcggc gtgctgacag tgaagctggg cggagatctg 420ggcacctacg
tgatcaacaa gcagaccccc aacaaacaga tctggctatc tagccccagc
480agcggcccca agagatacga ttggaccggc aagaactggg tgtacagcca
cgacggcgtg 540tccctgcatg agctgctggc tgccgagctg accaaggccc
tgaaaacaaa gctggacctg 600tccagcctgg cctacagcgg caaggatgcc
6306630DNAArtificial SequenceGenscript (control) optimized
Nucleotide sequence encoding frataxin 6atgtggacac tgggccggag
agccgtcgct gggctgctgg catcaccatc ccccgcacag 60gcacagaccc tgacaagagt
ccctcggcca gcagagctgg ccccactgtg cgggcggaga 120ggactgcgaa
ccgacatcga tgctacttgt accccaaggc gagcaagctc caaccagcga
180gggctgaacc agatttggaa tgtgaagaaa cagtctgtct acctgatgaa
tctgagaaag 240agcggcactc tgggacaccc tggcagcctg gacgagacca
cctacgagcg gctggccgag 300gaaaccctgg attccctggc cgagttcttt
gaagacctgg ctgataagcc atacaccttc 360gaagactatg acgtgagctt
cggcagcggc gtgctgacag tcaaactggg cggggacctg 420ggaacatacg
tgatcaacaa gcagactcct aacaagcaga tttggctgtc tagtccctca
480agcggcccta agaggtacga ctggacaggg aaaaactggg tgtatagtca
cgatggcgtc 540tcactgcatg agctgctggc cgctgaactg actaaagccc
tgaaaactaa actggacctg 600tcttccctgg catactctgg caaggacgcc
6307630DNAArtificial SequenceGenscript (low CpG) nucleotide
sequence encoding frataxin 7atgtggactc tgggccggag agcagtggca
ggactgctgg caagtccatc acctgctcag 60gcacagactc tgacaagagt cccaagacct
gcagagctgg ctccactgtg cgggaggcgc 120ggactgagaa cagacatcga
tgctacatgt actcctcgac gggcaagctc caaccagcga 180gggctgaacc
agatttggaa tgtgaagaaa cagtccgtct acctgatgaa tctgaggaag
240tcaggcaccc tggggcaccc aggaagtctg gacgagacca catatgaacg
gctggctgag 300gaaacactgg attctctggc cgagttcttt gaagacctgg
ctgataagcc ctacacattc 360gaagactatg atgtgagctt tggatccggc
gtgctgactg tcaaactggg cggggacctg 420ggcacttacg tgatcaacaa
gcagacccct aacaagcaga tttggctgtc tagtccttca 480agcggaccaa
agcggtacga ctggaccggc aaaaactggg tgtattctca cgatggggtc
540agtctgcatg agctgctggc cgctgaactg accaaggccc tgaagacaaa
actggacctg 600tcctctctgg catatagcgg aaaagatgcc 6308630DNAArtificial
SequenceIDT3 optimized Nucleotide sequence encoding frataxin
8atgtggacac tgggaaggcg cgccgtggcc ggtctgttgg catcaccatc cccagcccag
60gctcagacac tcacccgagt cccaagaccc gcagagctgg cccctctgtg cgggcgccga
120ggccttcgca ccgatatcga tgctacatgc acgccacgca gagctagctc
aaatcagagg 180ggactcaacc agatatggaa tgtcaagaag caaagcgtgt
atctcatgaa cctccggaaa 240agcggcaccc tgggacatcc cgggtctctc
gacgagacca cttatgaaag actggcagag 300gagactcttg acagtctggc
ggagttcttc gaagacctcg ctgacaagcc atataccttc 360gaagattacg
acgtctcctt cggctctggg gtgctgactg tcaagcttgg cggcgacctg
420gggacctacg tgatcaacaa gcagactcca aacaagcaaa tctggctatc
tagtccaagc 480tccggaccca agagatacga ttggacaggc aagaattggg
tttactccca cgacggggtg 540tccctccatg agctgctggc cgcagagctg
acgaaggccc tgaagaccaa gctggatctc 600tcctccctgg catacagtgg
taaggacgct 6309630DNAArtificial SequenceIDT5 optimized Nucleotide
sequence encoding frataxin 9atgtggacac tgggccggcg cgccgtcgct
gggctgctcg caagccccag cccagcccaa 60gcgcagactc tgactagggt gccgcggcct
gccgagttgg cccccctgtg cggtaggaga 120ggcctgcgca cagacatcga
tgccacttgc acaccccggc gggccagctc taaccaaagg 180ggcctgaatc
aaatttggaa cgtcaaaaaa cagtctgtat atctgatgaa tctccggaaa
240tctggaacgc tcgggcatcc cggatctctt gacgagacca cctacgagcg
actggccgag 300gaaacccttg acagcctggc agaattcttt gaggatctgg
ctgataaacc ctataccttt 360gaagattacg atgtgagttt tggtagcgga
gtactgactg ttaagctggg cggtgatctc 420ggtacgtatg ttatcaataa
acaaaccccc aataaacaga tttggctctc ctccccatcc 480tctgggccta
agcgctatga ctggacagga aagaattggg tctattcaca cgacggagtc
540agtttgcacg agctcctcgc cggcagagtt accaaggccc ttaagactaa
gctcgacctg 600tcaagcctcg cttactctgg taaggacgct
63010630DNAArtificial SequenceNucleotide sequence encoding frataxin
10atgtggactc tcgggcgccg cgcagtagcc ggcctcctgg cgtcacccag cccggcccag
60gcccagaccc tcacccgggt cccgcggccg gcagagttgg ccccactctg cggccgccgt
120ggcctgcgca ccgacatcga tgcgacctgc acgccccgcc gcgcaagttc
gaaccaacgt 180ggcctcaacc agatttggaa tgtcaaaaag cagagtgtct
atttgatgaa tttgaggaaa 240tctggaactt tgggccaccc aggctctcta
gatgagacca cctatgaaag actagcagag 300gaaacgctgg actctttagc
agagtttttt gaagaccttg cagacaagcc atacacgttt 360gaggactatg
atgtctcctt tgggagtggt gtcttaactg tcaaactggg tggagatcta
420ggaacctatg tgatcaacaa gcagacgcca aacaagcaaa tctggctatc
ttctccatcc 480agtggaccta agcgttatga ctggactggg aaaaactggg
tgtactccca cgacggcgtg 540tccctccatg agctgctggc cgcagagctc
actaaagcct taaaaaccaa actggacttg 600tcttccttgg cctattccgg
aaaagatgct 63011630DNAArtificial SequenceIDT-1 optimized Nucleotide
sequence encoding frataxin 11atgtggactc tgggtaggcg agcggtggcc
ggcctgttgg catctcctag tcctgcacaa 60gctcaaacgc tgactagagt ccctcggcca
gcagaactgg cgccactttg cggccggcgc 120ggtcttcgca ctgatattga
tgccacttgc acaccccggc gcgcctccag taatcagcgg 180ggacttaatc
aaatttggaa tgtgaagaag cagtctgtgt atcttatgaa tctgcggaag
240agcgggaccc tgggccaccc tggtagcctt gatgaaacca cctatgagcg
cctggccgaa 300gagacactgg acagtcttgc cgagtttttt gaggatctgg
ccgacaaacc ttatactttt 360gaggactatg acgtgtcctt tggatctggt
gtattgaccg taaaactcgg gggagacctt 420gggacgtatg taataaataa
gcagacccca aacaagcaga tctggctatc ttctccaagt 480agtggtccta
agagatatga ttggacgggc aagaactggg tctattccca tgatggcgtc
540tctttgcatg aactccttgc agcagagctg accaaggcct tgaagaccaa
attggatctc 600agcagcctcg cctatagtgg caaagatgca
63012630DNAArtificial SequenceIDT-4 optimized Nucleotide sequence
encoding frataxin 12atgtggactc tgggccggcg ggccgtagct ggcttgctgg
ctagcccaag tcccgcccag 60gctcagactc tcaccagggt acccaggccc gcagagcttg
ctccactctg cggacgcagg 120ggtctgcgaa ccgatatcga cgcaacttgc
acgccgcgga gggcctcttc aaaccagaga 180ggactcaatc aaatttggaa
tgtaaagaaa cagagcgtgt atctcatgaa cctccgaaag 240agtgggactc
ttgggcaccc cggctccctg gacgagacta cttacgagcg cctggccgaa
300gaaaccttgg attccctggc ggagtttttt gaagacttgg cagacaagcc
ttataccttc 360gaggattacg acgtgagttt tggctctggt gttcttacag
tcaagctcgg tggcgacctt 420ggcacttatg taattaacaa gcagacacct
aacaagcaga tctggctttc tagtccgtct 480tccggtccca aaaggtacga
ttggactgga aagaactggg tctacagtca cgacggtgtc 540tccctgcacg
aattgcttgc ggcagagctg actaaggcgc tcaaaacaaa actggatctg
600tccagccttg cctatagcgg gaaggacgca 630132211DNAArtificial
SequenceNucleotide sequence encoding chimeric AAV2.5 Vector Capsid
VP1 13atggctgccg atggttatct tccagattgg ctcgaggaca ctctctctga
aggaataaga 60cagtggtgga agctcaaacc tggcccacca ccaccaaagc ccgcagagcg
gcataaggac 120gacagcaggg gtcttgtgct tcctgggtac aagtacctcg
gacccttcaa cggactcgac 180aagggagagc cggtcaacga ggcagacgcc
gcggccctcg agcacgacaa agcctacgac 240cggcagctcg acagcggaga
caacccgtac ctcaagtaca accacgccga cgcggagttt 300caggagcgcc
ttaaagaaga tacgtctttt gggggcaacc tcggacgagc agtcttccag
360gcgaaaaaga gggttcttga acctctgggc ctggttgagg aacctgttaa
gacggctccg 420ggaaaaaaga ggccggtaga gcactctcct gtggagccag
actcctcctc gggaaccgga 480aaggcgggcc agcagcctgc aagaaaaaga
ttgaattttg gtcagactgg agacgcagac 540tcagtacctg acccccagcc
tctcggacag ccaccagcag ccccctctgg tctgggaact 600aatacgatgg
ctacaggcag tggcgcacca atggcagaca ataacgaggg cgccgacgga
660gtgggtaatt cctcgggaaa ttggcattgc gattccacat ggatgggcga
cagagtcatc 720accaccagca cccgaacctg ggccctgccc acctacaaca
accacctcta caaacaaatt 780tccagcgctt caacgggagc ctcgaacgac
aatcactact ttggctacag caccccttgg 840gggtattttg acttcaacag
attccactgc cacttttcac cacgtgactg gcaaagactc 900atcaacaaca
actggggatt ccgacccaag agactcaact tcaagctctt taacattcaa
960gtcaaagagg tcacgcagaa tgacggtacg acgacgattg ccaataacct
taccagcacg 1020gttcaggtgt ttactgactc ggagtaccag ctcccgtacg
tcctcggctc ggcgcatcaa 1080ggatgcctcc cgccgttccc agcagacgtc
ttcatggtgc cacagtatgg atacctcacc 1140ctgaacaacg ggagtcaggc
agtaggacgc tcttcatttt actgcctgga gtactttcct 1200tctcagatgc
tgcgtaccgg aaacaacttt accttcagct acacttttga ggacgttcct
1260ttccacagca gctacgctca cagccagagt ctggaccgtc tcatgaatcc
tctcatcgac 1320cagtacctgt attacttgag cagaacaaac actccaagtg
gaaccaccac gcagtcaagg 1380cttcagtttt ctcaggccgg agcgagtgac
attcgggacc agtctaggaa ctggcttcct 1440ggaccctgtt accgccagca
gcgagtatca aagacatctg cggataacaa caacagtgaa 1500tactcgtgga
ctggagctac caagtaccac ctcaatggca gagactctct ggtgaatccg
1560ggcccggcca tggcaagcca caaggacgat gaagaaaagt tttttcctca
gagcggggtt 1620ctcatctttg ggaagcaagg ctcagagaaa acaaatgtgg
acattgaaaa ggtcatgatt 1680acagacgaag aggaaatcag gacaaccaat
cccgtggcta cggagcagta tggttctgta 1740tctaccaacc tccagagagg
caacagacaa gcagctaccg cagatgtcaa cacacaaggc 1800gttcttccag
gcatggtctg gcaggacaga gatgtgtacc ttcaggggcc catctgggca
1860aagattccac acacggacgg acattttcac ccctctcccc tcatgggtgg
attcggactt 1920aaacaccctc ctccacagat tctcatcaag aacaccccgg
tacctgcgaa tccttcgacc 1980accttcagtg cggcaaagtt tgcttccttc
atcacacagt actccacggg acaggtcagc 2040gtggagatcg agtgggagct
gcagaaggaa aacagcaaac gctggaatcc cgaaattcag 2100tacacttcca
actacgccaa gtctgtcaat gtggacttta ctgtggacaa taatggcgtg
2160tattcagagc ctcgccccat tggcaccaga tacctgactc gtaatctgta a
2211142211DNAArtificial SequenceNucleotide sequence encoding
wildtypeAAV1 capsid (VP1) 14atggctgccg atggttatct tccagattgg
ctcgaggaca acctctctga gggcattcgc 60gagtggtggg acttgaaacc tggagccccg
aagcccaaag ccaaccagca aaagcaggac 120gacggccggg gtctggtgct
tcctggctac aagtacctcg gacccttcaa cggactcgac 180aagggggagc
ccgtcaacgc ggcggacgca gcggccctcg agcacgacaa ggcctacgac
240cagcagctca aagcgggtga caatccgtac ctgcggtata accacgccga
cgccgagttt 300caggagcgtc tgcaagaaga tacgtctttt gggggcaacc
tcgggcgagc agtcttccag 360gccaagaagc gggttctcga acctctcggt
ctggttgagg aaggcgctaa gacggctcct 420ggaaagaaac gtccggtaga
gcagtcgcca caagagccag actcctcctc gggcatcggc 480aagacaggcc
agcagcccgc taaaaagaga ctcaattttg gtcagactgg cgactcagag
540tcagtccccg atccacaacc tctcggagaa cctccagcaa cccccgctgc
tgtgggacct 600actacaatgg cttcaggcgg tggcgcacca atggcagaca
ataacgaagg cgccgacgga 660gtgggtaatg cctcaggaaa ttggcattgc
gattccacat ggctgggcga cagagtcatc 720accaccagca cccgcacctg
ggccttgccc acctacaata accacctcta caagcaaatc 780tccagtgctt
caacgggggc cagcaacgac aaccactact tcggctacag caccccctgg
840gggtattttg atttcaacag attccactgc cacttttcac cacgtgactg
gcagcgactc 900atcaacaaca attggggatt ccggcccaag agactcaact
tcaaactctt caacatccaa 960gtcaaggagg tcacgacgaa tgatggcgtc
acaaccatcg ctaataacct taccagcacg 1020gttcaagtct tctcggactc
ggagtaccag cttccgtacg tcctcggctc tgcgcaccag 1080ggctgcctcc
ctccgttccc ggcggacgtg ttcatgattc cgcaatacgg ctacctgacg
1140ctcaacaatg gcagccaagc cgtgggacgt tcatcctttt actgcctgga
atatttccct 1200tctcagatgc tgagaacggg caacaacttt accttcagct
acacctttga ggaagtgcct 1260ttccacagca gctacgcgca cagccagagc
ctggaccggc tgatgaatcc tctcatcgac 1320caatacctgt attacctgaa
cagaactcaa aatcagtccg gaagtgccca aaacaaggac 1380ttgctgttta
gccgtgggtc tccagctggc atgtctgttc agcccaaaaa ctggctacct
1440ggaccctgtt atcggcagca gcgcgtttct aaaacaaaaa cagacaacaa
caacagcaat 1500tttacctgga ctggtgcttc aaaatataac ctcaatgggc
gtgaatccat catcaaccct 1560ggcactgcta tggcctcaca caaagacgac
gaagacaagt tctttcccat gagcggtgtc 1620atgatttttg gaaaagagag
cgccggagct tcaaacactg cattggacaa tgtcatgatt 1680acagacgaag
aggaaattaa agccactaac cctgtggcca ccgaaagatt tgggaccgtg
1740gcagtcaatt tccagagcag cagcacagac cctgcgaccg gagatgtgca
tgctatggga 1800gcattacctg gcatggtgtg gcaagataga gacgtgtacc
tgcagggtcc catttgggcc 1860aaaattcctc acacagatgg acactttcac
ccgtctcctc ttatgggcgg ctttggactc 1920aagaacccgc ctcctcagat
cctcatcaaa aacacgcctg ttcctgcgaa tcctccggcg 1980gagttttcag
ctacaaagtt tgcttcattc atcacccaat actccacagg acaagtgagt
2040gtggaaattg aatgggagct gcagaaagaa aacagcaagc gctggaatcc
cgaagtgcag 2100tacacatcca attatgcaaa atctgccaac gttgatttta
ctgtggacaa caatggactt 2160tatactgagc ctcgccccat tggcacccgt
taccttaccc gtcccctgta a 2211152208DNAArtificial SequenceNucleotide
sequence encoding modified AAV1.1 capsid VP1 15atggctgccg
atggttatct tccagattgg ctcgaggaca acctctctga gggcattcgc 60gagtggtggg
acttgaaacc tggagccccg aagcccaaag ccaaccagca aaagcaggac
120gacggccggg gtctggtgct tcctggctac aagtacctcg gacccttcaa
cggactcgac 180aagggggagc ccgtcaacgc ggcggacgca gcggccctcg
agcacgacaa ggcctacgac 240cagcagctca aagcgggtga caatccgtac
ctgcggtata accacgccga cgccgagttt 300caggagcgtc tgcaagaaga
tacgtctttt gggggcaacc tcgggcgagc agtcttccag 360gccaagaagc
gggttctcga acctctcggt ctggttgagg aaggcgctaa gacggctcct
420ggaaagaaac gtccggtaga gcagtcgcca caagagccag actcctcctc
gggcatcggc 480aagacaggcc agcagcccgc taaaaagaga ctcaattttg
gtcagactgg cgactcagag 540tcagtccccg atccacaacc tctcggagaa
cctccagcaa cccccgctgc tgtgggacct 600actacaatgg cttcaggcgg
tggcgcacca atggcagaca ataacgaagg cgccgacgga 660gtgggtaatg
cctcaggaaa ttggcattgc gattccacat ggctgggcga cagagtcatc
720accaccagca cccgcacctg ggccttgccc acctacaata accacctcta
caagcaaatc 780tccagtgctt caggggccag caacgacaac cactacttcg
gctacagcac cccctggggg 840tattttgatt tcaacagatt ccactgccac
ttttcaccac gtgactggca gcgactcatc 900aacaacaatt ggggattccg
gcccaagaga ctcaacttca aactcttcaa catccaagtc 960aaggaggtca
cgacgaatga tggcgtcaca accatcgcta ataaccttac cagcacggtt
1020caagtcttct cggactcgga gtaccagctt ccgtacgtcc tcggctctgc
gcaccagggc 1080tgcctccctc cgttcccggc ggacgtgttc atgattccgc
aatacggcta cctgacgctc 1140aacaatggca gccaagccgt gggacgttca
tccttttact gcctggaata tttcccttct 1200cagatgctga gaacgggcaa
caactttacc ttcagctaca cctttgagga agtgcctttc 1260cacagcagct
acgcgcacag ccagagcctg gaccggctga tgaatcctct catcgaccaa
1320tacctgtatt acctgaacag aactcaaaat cagtccggaa gtgcccaaaa
caaggacttg 1380ctgtttagcc gtgggtctcc agctggcatg tctgttcagc
ccaaaaactg gctacctgga 1440ccctgttatc ggcagcagcg cgtttctaaa
acaaaaacag acaacaacaa cagcaatttt 1500acctggactg gtgcttcaaa
atataacctc aatgggcgtg aatccatcat caaccctggc 1560actgctatgg
cctcacacaa agacgacgaa gacaagttct ttcccatgag cggtgtcatg
1620atttttggaa aagagagcgc cggagcttca aacactgcat tggacaatgt
catgattaca 1680gacgaagagg aaattaaagc cactaaccct gtggccaccg
aaagatttgg gaccgtggca 1740gtcaatttcc agagcagcag cacagaccct
gcgaccggag atgtgcatgc tatgggagca 1800ttacctggca tggtgtggca
agatagagac gtgtacctgc agggtcccat ttgggccaaa 1860attcctcaca
cagatggaca ctttcacccg tctcctctta tgggcggctt tggactcaag
1920aacccgcctc ctcagatcct catcaaaaac acgcctgttc ctgcgaatcc
tccggcggag 1980ttttcagcta caaagtttgc ttcattcatc acccaatact
ccacaggaca agtgagtgtg 2040gaaattgaat gggagctgca gaaagaaaac
agcaagcgct ggaatcccga agtgcagtac 2100acatccaatt atgcaaaatc
tgccaacgtt gattttactg tggacaacaa tggactttat 2160actgagcctc
gccccattgg cacccgttac cttacccgtc ccctgtaa 2208162211DNAArtificial
SequenceNucleotide sequence encoding wildtype AAV6 capsid (VP1)
16atggctgccg atggttatct tccagattgg ctcgaggaca acctctctga gggcattcgc
60gagtggtggg acttgaaacc tggagccccg aaacccaaag ccaaccagca aaagcaggac
120gacggccggg gtctggtgct tcctggctac aagtacctcg gacccttcaa
cggactcgac 180aagggggagc ccgtcaacgc ggcggatgca gcggccctcg
agcacgacaa ggcctacgac 240cagcagctca aagcgggtga caatccgtac
ctgcggtata accacgccga cgccgagttt 300caggagcgtc tgcaagaaga
tacgtctttt gggggcaacc tcgggcgagc agtcttccag 360gccaagaaga
gggttctcga accttttggt ctggttgagg aaggtgctaa gacggctcct
420ggaaagaaac gtccggtaga gcagtcgcca caagagccag actcctcctc
gggcattggc 480aagacaggcc agcagcccgc taaaaagaga ctcaattttg
gtcagactgg cgactcagag 540tcagtccccg acccacaacc tctcggagaa
cctccagcaa cccccgctgc tgtgggacct 600actacaatgg cttcaggcgg
tggcgcacca atggcagaca ataacgaagg cgccgacgga 660gtgggtaatg
cctcaggaaa ttggcattgc gattccacat ggctgggcga cagagtcatc
720accaccagca cccgaacatg ggccttgccc acctataaca accacctcta
caagcaaatc 780tccagtgctt caacgggggc cagcaacgac aaccactact
tcggctacag caccccctgg 840gggtattttg atttcaacag attccactgc
catttctcac cacgtgactg gcagcgactc 900atcaacaaca attggggatt
ccggcccaag agactcaact tcaagctctt caacatccaa 960gtcaaggagg
tcacgacgaa tgatggcgtc acgaccatcg ctaataacct taccagcacg
1020gttcaagtct tctcggactc ggagtaccag ttgccgtacg tcctcggctc
tgcgcaccag 1080ggctgcctcc ctccgttccc ggcggacgtg ttcatgattc
cgcagtacgg ctacctaacg 1140ctcaacaatg gcagccaggc agtgggacgg
tcatcctttt actgcctgga atatttccca 1200tcgcagatgc tgagaacggg
caataacttt accttcagct acaccttcga ggacgtgcct 1260ttccacagca
gctacgcgca cagccagagc ctggaccggc tgatgaatcc tctcatcgac
1320cagtacctgt attacctgaa cagaactcag aatcagtccg gaagtgccca
aaacaaggac 1380ttgctgttta gccgggggtc tccagctggc atgtctgttc
agcccaaaaa ctggctacct 1440ggaccctgtt accggcagca gcgcgtttct
aaaacaaaaa cagacaacaa caacagcaac 1500tttacctgga ctggtgcttc
aaaatataac cttaatgggc gtgaatctat aatcaaccct 1560ggcactgcta
tggcctcaca caaagacgac aaagacaagt tctttcccat gagcggtgtc
1620atgatttttg gaaaggagag cgccggagct tcaaacactg cattggacaa
tgtcatgatc 1680acagacgaag aggaaatcaa agccactaac cccgtggcca
ccgaaagatt tgggactgtg 1740gcagtcaatc tccagagcag cagcacagac
cctgcgaccg gagatgtgca tgttatggga 1800gccttacctg gaatggtgtg
gcaagacaga gacgtatacc tgcagggtcc tatttgggcc 1860aaaattcctc
acacggatgg acactttcac ccgtctcctc tcatgggcgg ctttggactt
1920aagcacccgc ctcctcagat cctcatcaaa aacacgcctg ttcctgcgaa
tcctccggca 1980gagttttcgg ctacaaagtt tgcttcattc atcacccagt
attccacagg acaagtgagc 2040gtggagattg aatgggagct gcagaaagaa
aacagcaaac gctggaatcc cgaagtgcag 2100tatacatcta actatgcaaa
atctgccaac gttgatttca ctgtggacaa caatggactt 2160tatactgagc
ctcgccccat tggcacccgt tacctcaccc gtcccctgta a
2211172205DNAArtificial SequenceNucleotide sequence encoding
modified AAV6.1 capsid VP1 17atggctgccg atggttatct tccagattgg
ctcgaggaca acctctdgag ggcattcgcg 60agtggtggga cttgaaacct ggagccccga
aacccaaagc caaccagcaa aagcaggacg 120acggccgggg tdggtgcttc
ctggctacaa gtacctcgga cccttcaacg gactcgacaa 180gggggagccc
gtcaacgcgg cggatgcagc ggccctcgag cacgacaagg cctacgacca
240gcagctcaaa gcgggtgaca atccgtacct gcggtataac cacgccgacg
ccgagtttca 300ggagcgtctg caagaagata cgtcttttgg gggcaacctc
gggcgagcag tcttccaggc 360caagaagagg gttctcgaac cttttggtdg
gttgaggaag gtgctaagac ggctcctgga 420aagaaacgtc cggtagagca
gtcgccacaa gagccagact cctcctcggg cattggcaag 480acaggccagc
agcccgctaa aaagagactc aattttggtc agactggcga ctcagagtca
540gtccccgacc cacaacctct cggagaacct ccagcaaccc ccgctgctgt
gggacctact 600acaatggctt caggcggtgg cgcaccaatg gcagacaata
acgaaggcgc cgacggagtg 660ggtaatgcct caggaaattg gcattgcgat
tccacatggc tgggcgacag agtcatcacc 720accagcaccc gaacatgggc
cttgcccacc tataacaacc acctctacaa gcaaatctcc 780agtgcttcag
gggccagcaa cgacaaccac tacttcggct acagcacccc ctgggggtat
840tttgatttca acagattcca ctgccatttc tcaccacgtg actggcagcg
actcatcaac 900aacaattggg gattccggcc caagagactc aacttcaagc
tcttcaacat ccaagtcaag 960gaggtcacga cgaatgatgg cgtcacgacc
atcgctaata accttaccag cacggttcaa 1020gtcttctcgg actcggagta
ccagttgccg tacgtcctcg gctctgcgca ccagggctgc 1080ctccctccgt
tcccggcgga cgtgttcatg attccgcagt acggctacct aacgctcaac
1140aatggcagcc aggcagtggg acggtcatcc ttttactgcc tggaatattt
cccatcgcag 1200atgctgagaa cgggcaataa ctttaccttc agctacacct
tcgaggacgt gcctttccac 1260agcagctacg cgcacagcca gagcctggac
cggctgatga atcctctcat cgaccagtac 1320ctgtattacc tgaacagaac
tcagaatcag tccggaagtg cccaaaacaa ggacttgctg 1380tttagccggg
ggtctccagc tggcatgtct gttcagccca aaaactggct acctggaccc
1440tgttaccggc agcagcgcgt ttctaaaaca aaaacagaca acaacaacag
caactttacc 1500tggactggtg cttcaaaata taaccttaat gggcgtgaat
ctataatcaa ccctggcact 1560gctatggcct cacacaaaga cgacaaagac
aagttctttc ccatgagcgg tgtcatgatt 1620tttggaaagg agagcgccgg
agcttcaaac actgcattgg acaatgtcat gatcacagac 1680gaagaggaaa
tcaaagccac taaccccgtg gccaccgaaa gatttgggac tgtggcagtc
1740aatctccaga gcagcagcac agaccctgcg accggagatg tgcatgttat
gggagcctta 1800cctggaatgg tgtggcaaga cagagacgta tacctgcagg
gtcctatttg ggccaaaatt 1860cctcacacgg atggacactt tcacccgtct
cctctcatgg gcggctttgg acttaagcac 1920ccgcctcctc agatcctcat
caaaaacacg cctgttcctg cgaatcctcc ggcagagttt 1980tcggctacaa
agtttgcttc attcatcacc cagtattcca caggacaagt gagcgtggag
2040attgaatggg agctgcagaa agaaaacagc aaacgctgga atcccgaagt
gcagtataca 2100tctaactatg caaaatctgc caacgttgat ttcactgtgg
acaacaatgg actttatact 2160gagcctcgcc ccattggcac ccgttacctc
acccgtcccc tgtaa 2205182208DNAArtificial SequenceNucleotide
sequence encoding modified AAV6.3.1 capsid VP1 18atggctgccg
atggttatct tccagattgg ctcgaggaca acctctctga gggcattcgc 60gagtggtggg
acttgaaacc tggagccccg aaacccaaag ccaaccagca aaagcaggac
120gacggccggg gtctggtgct tcctggctac aagtacctcg gacccttcaa
cggactcgac 180aagggggagc ccgtcaacgc ggcggatgca gcggccctcg
agcacgacaa ggcctacgac 240cagcagctca aagcgggtga caatccgtac
ctgcggtata accacgccga cgccgagttt 300caggagcgtc tgcaagaaga
tacgtctttt gggggcaacc tcgggcgagc agtcttccag 360gccaagaaga
gggttctcga accttttggt ctggttgagg aaggtgctaa gacggctcct
420ggaaagaaac gtccggtaga gcagtcgcca caagagccag actcctcctc
gggcattggc 480aagacaggcc agcagcccgc taaaaagaga ctcaattttg
gtcagactgg cgactcagag 540tcagtccccg acccacaacc tctcggagaa
cctccagcaa cccccgctgc tgtgggacct 600actacaatgg cttcaggcgg
tggcgcacca atggcagaca ataacgaagg cgccgacgga 660gtgggtaatg
cctcaggaaa ttggcattgc gattccacat ggctgggcga cagagtcatc
720accaccagca cccgaacatg ggccttgccc acctataaca accacctcta
caagcaaatc 780tccagtgctt caggggccag caacgacaac cactacttcg
gctacagcac cccctggggg 840tattttgatt tcaacagatt ccactgccat
ttctcaccac gtgactggca gcgactcatc 900aacaacaatt ggggattccg
gcccaagaga ctcaacttca agctcttcaa catccaagtc 960aaggaggtca
cgacgaatga tggcgtcacg accatcgcta ataaccttac cagcacggtt
1020caagtcttct cggactcgga gtaccagttg ccgtacgtcc tcggctctgc
gcaccagggc 1080tgcctccctc cgttcccggc ggacgtgttc atgattccgc
agtacggcta cctaacgctc 1140aacaatggca gccaggcagt gggacggtca
tccttttact gcctggaata tttcccatcg 1200cagatgctga gaacgggcaa
taactttacc ttcagctaca ccttcgagga cgtgcctttc 1260cacagcagct
acgcgcacag ccagagcctg gaccggctga tgaatcctct catcgaccag
1320tacctgtatt acctgaacag aactcagaat cagtccggaa gtgcccaaaa
caaggacttg 1380ctgtttagcc gggggtctcc agctggcatg tctgttcagc
ccaaaaactg gctacctgga 1440ccctgttacc ggcagcagcg cgtttctaaa
acaaaaacag acaacaacaa cagcaacttt 1500acctggactg gtgcttcaaa
atataacctt aatgggcgtg aatctataat caaccctggc 1560actgctatgg
cctcacacaa agacgacgaa gacaagttct ttcccatgag cggtgtcatg
1620atttttggaa aggagagcgc cggagcttca aacactgcat tggacaatgt
catgatcaca 1680gacgaagagg aaatcaaagc cactaacccc gtggccaccg
aaagatttgg gactgtggca 1740gtcaatctcc agagcagcag cacagaccct
gcgaccggag atgtgcatgt tatgggagcc 1800ttacctggaa tggtgtggca
agacagagac gtatacctgc agggtcctat ttgggccaaa 1860attcctcaca
cggatggaca ctttcacccg tctcctctca tgggcggctt tggacttaag
1920cacccgcctc ctcagatcct catcaaaaac acgcctgttc ctgcgaatcc
tccggcagag 1980ttttcggcta caaagtttgc ttcattcatc acccagtatt
ccacaggaca agtgagcgtg 2040gagattgaat gggagctgca gaaagaaaac
agcaaacgct ggaatcccga agtgcagtat 2100acatctaact atgcaaaatc
tgccaacgtt gatttcactg tggacaacaa tggactttat 2160actgagcctc
gccccattgg cacccgttac ctcacccgtc ccctgtaa 220819983DNAArtificial
SequenceNucleotide sequence encoding human wild type frataxin (WT
FXN) for cloning into pTRs-KS-CBh-EGFP-BGH scAAV vector
19tagaagaccg gtcgccacca tgtggactct cgggcgccgc gcagtagccg gcctcctggc
60gtcacccagc ccagcccagg cccagaccct cacccgggtc ccgcggccgg cagagttggc
120cccactctgc ggccgccgtg gcctgcgcac cgacatcgat gcgacctgca
cgccccgccg 180cgcaagttcg aaccaacgtg gcctcaacca gatttggaat
gtcaaaaagc agagtgtcta 240tttgatgaat ttgaggaaat ctggaacttt
gggccaccca ggctctctag atgagaccac 300ctatgaaaga ctagcagagg
aaacgctgga ctctttagca gagttttttg aagaccttgc 360agacaagcca
tacacgtttg aggactatga tgtctccttt gggagtggtg tcttaactgt
420caaactgggt ggagatctag gaacctatgt gatcaacaag cagacgccaa
acaagcaaat 480ctggctatct tctccatcca gtggacctaa gcgttatgac
tggactggga aaaactgggt 540gtactcccac gacggcgtgt ccctccatga
gctgctggcc gcagagctca ctaaagcctt 600aaaaaccaaa ctggacttgt
cttccttggc ctattccgga aaagatgctt gacgagcggc 660cgctcctagg
agcagtatcg atcccagccc acttttcccc aatacgacta gtactcgact
720gtgccttcta gttgccagcc atctgttgtt tgcccctccc ccgtgccttc
cttgaccctg 780gaaggtgcca ctcccactgt cctttcctaa taaaatgagg
aaattgcatc gcattgtctg 840agtaggtgtc attctattct ggggggtggg
gtggggcagg acagcaaggg ggaggattgg 900gaagacaaca gcaggcatgc
tggggatgcg gtgggctcta tggcttctga ggcggaaaga 960accagctttg
gacgcgtctt aag 98320983DNAArtificial SequenceIDT1 Codon optimized
nucleotide sequence encoding FXN for cloning into
pTRs-KS-CBh-EGFP-BGH scAAV vector 20tagaagaccg gtcgccacca
tgtggactct gggtaggcga gcggtggccg gcctgttggc 60atctcctagt cctgcacaag
ctcaaacgct gactagagtc cctcggccag cagaactggc 120gccactttgc
ggccggcgcg gtcttcgcac tgatattgat gccacttgca caccccggcg
180cgcctccagt aatcagcggg gacttaatca aatttggaat gtgaagaagc
agtctgtgta 240tcttatgaat ctgcggaaga gcgggaccct gggccaccct
ggtagccttg atgaaaccac 300ctatgagcgc ctggccgaag agacactgga
cagtcttgcc gagttttttg aggatctggc 360cgacaaacct tatacttttg
aggactatga cgtgtccttt ggatctggtg tattgaccgt 420aaaactcggg
ggagaccttg ggacgtatgt aataaataag cagaccccaa acaagcagat
480ctggctcagc tctccaagta gtggtcctaa gagatatgat tggacgggca
agaactgggt 540ctattcccat gatggcgtct ctttgcatga actccttgca
gcagagctga ccaaggcctt 600gaagaccaaa ttggatctca gcagcctcgc
ctatagtggc aaagatgcat agcgagcggc 660cgctcctagg agcagtatcg
atcccagccc acttttcccc aatacgacta gtactcgact 720gtgccttcta
gttgccagcc atctgttgtt tgcccctccc ccgtgccttc cttgaccctg
780gaaggtgcca ctcccactgt cctttcctaa taaaatgagg aaattgcatc
gcattgtctg 840agtaggtgtc attctattct ggggggtggg gtggggcagg
acagcaaggg ggaggattgg 900gaagacaaca gcaggcatgc tggggatgcg
gtgggctcta tggcttctga ggcggaaaga 960accagctttg gacgcgtctt aag
98321983DNAArtificial SequenceCodon optimized nucleotide sequence
encoding FXN IDT3 (low expresser) for cloning into
pTRs-KS-CBh-EGFP-BGH scAAV vector 21tagaagaccg gtcgccacca
tgtggacact gggaaggcgc gccgtggccg gtctgttggc 60atcaccatcc ccagcccagg
ctcagacact cacccgagtc ccaagacccg cagagctggc 120ccctctgtgc
gggcgccgag gccttcgcac cgatatcgat gctacatgca cgccacgcag
180agctagctca aatcagaggg gactcaacca gatatggaat gtcaagaagc
aaagcgtgta 240tctcatgaac ctccggaaaa gcggcaccct gggacatccc
gggtctctcg acgagaccac 300ttatgaaaga ctggcagagg agactcttga
cagtctggcg gagttcttcg aagacctcgc 360tgacaagcca tataccttcg
aagattacga cgtctccttc ggctctgggg tgctgactgt 420caagcttggc
ggcgacctgg ggacctacgt gatcaacaag cagactccaa acaagcaaat
480ctggctcagc agtccaagct ccggacccaa gagatacgat tggacaggca
agaattgggt 540ttactcccac gacggggtgt ccctccatga gctgctggcc
gctgagctga cgaaggccct 600gaagaccaag ctggatctct cctccctggc
atacagtggt aaggacgctt gacgagcggc 660cgctcctagg agcagtatcg
atcccagccc acttttcccc aatacgacta gtactcgact 720gtgccttcta
gttgccagcc atctgttgtt tgcccctccc ccgtgccttc cttgaccctg
780gaaggtgcca ctcccactgt cctttcctaa taaaatgagg aaattgcatc
gcattgtctg 840agtaggtgtc attctattct ggggggtggg gtggggcagg
acagcaaggg ggaggattgg 900gaagacaaca gcaggcatgc tggggatgcg
gtgggctcta tggcttctga ggcggaaaga 960accagctttg gacgcgtctt aag
98322983DNAArtificial SequenceCodon-optimized nucleotide sequence
encoding FXN IDT4 for cloning into pTRs-KS-CBh-EGFP-BGH scAAV
vector 22tagaagaccg gtcgccacca tgtggactct gggccggcgg gccgtagctg
gcttgctggc 60tagcccaagt cccgcccagg ctcagactct caccagggta cccaggcccg
cagagcttgc 120tccactctgc ggacgcaggg gtctgcgaac cgatatcgac
gcaacttgca cgccgcggag 180ggcctcttca aaccagagag gactcaatca
aatttggaat gtaaagaaac agagcgtgta 240tctcatgaac ctccgaaaga
gtgggactct tgggcacccc ggctccctgg acgagactac 300ttacgagcgc
ctggccgaag aaaccttgga ttccctggcg gagttttttg aagacttggc
360agacaagcct tataccttcg aggattacga cgtgagtttt ggctctggtg
ttcttacagt 420caagctcggt ggcgaccttg gcacttatgt aattaacaag
cagacaccta acaagcagat 480ctggctttct agtccgtctt ccggtcccaa
aaggtacgat tggactggaa agaactgggt 540ctacagtcac gacggtgtct
ccctgcacga attgcttgcg gctgagctga ctaaggcgct 600caaaacaaaa
ctggatctgt ccagccttgc ctatagcggg aaggacgcat gacgagcggc
660cgctcctagg agcagtatcg atcccagccc acttttcccc aatacgacta
gtactcgact 720gtgccttcta gttgccagcc atctgttgtt tgcccctccc
ccgtgccttc cttgaccctg 780gaaggtgcca ctcccactgt cctttcctaa
taaaatgagg aaattgcatc gcattgtctg 840agtaggtgtc attctattct
ggggggtggg gtggggcagg acagcaaggg ggaggattgg 900gaagacaaca
gcaggcatgc tggggatgcg gtgggctcta tggcttctga ggcggaaaga
960accagctttg gacgcgtctt aag 98323983DNAArtificial
SequenceCodon-optimized nucleotide sequence encoding FXN GenScript
for cloning into pTRs-KS-CBh-EGFP-BGH scAAV vector 23tagaagaccg
gtcgccacca tgtggacact gggccggaga gccgtcgctg ggctgctggc 60atcaccatcc
cccgcacagg cacagaccct gacaagagtc cctcggccag cagagctggc
120cccactgtgc gggcggagag gactgcgaac cgacatcgat gctacttgta
ccccaaggcg 180agcaagctcc aaccagcgag ggctgaacca gatttggaat
gtgaagaaac agtctgtcta 240cctgatgaat ctgagaaaga gcggcactct
gggacaccct ggcagcctgg acgagaccac 300ctacgagcgg ctggccgagg
aaaccctgga ttccctggcc gagttctttg aagacctggc 360tgataagcca
tacaccttcg aagactatga cgtgagcttc ggcagcggcg tgctgacagt
420caaactgggc ggggacctgg gaacatacgt gatcaacaag cagactccta
acaagcagat 480ttggctgtct agtccctcaa gcggccctaa gaggtacgac
tggacaggga aaaactgggt 540gtatagtcac gatggcgtct cactgcatga
gctgctggcc gctgaactga ctaaagccct 600gaaaactaaa ctggacctgt
cttccctggc atactctggc aaggacgcct gacgagcggc 660cgctcctagg
agcagtatcg atcccagccc acttttcccc aatacgacta gtactcgact
720gtgccttcta gttgccagcc atctgttgtt tgcccctccc ccgtgccttc
cttgaccctg 780gaaggtgcca ctcccactgt cctttcctaa taaaatgagg
aaattgcatc gcattgtctg 840agtaggtgtc attctattct ggggggtggg
gtggggcagg acagcaaggg ggaggattgg 900gaagacaaca gcaggcatgc
tggggatgcg gtgggctcta tggcttctga ggcggaaaga 960accagctttg
gacgcgtctt aag 98324983DNAArtificial SequenceCodon-optimized
nucleotide sequence encoding FXN GenScript (low CpG) for cloning
into pTRs-KS-CBh-EGFP-BGH scAAV vector 24tagaagaccg gtcgccacca
tgtggactct gggccggaga gcagtggcag gactgctggc 60aagtccatca cctgctcagg
cacagactct gacaagagtc ccaagacctg cagagctggc 120tccactgtgc
gggaggcgcg gactgagaac agacatcgat gctacatgta ctcctcgacg
180ggcaagctcc aaccagcgag ggctgaacca gatttggaat gtgaagaaac
agtccgtcta 240cctgatgaat ctgaggaagt caggcaccct ggggcaccca
ggaagtctgg acgagaccac 300atatgaacgg ctggctgagg aaacactgga
ttctctggcc gagttctttg aagacctggc 360tgataagccc tacacattcg
aagactatga tgtgagcttt ggatccggcg tgctgactgt 420caaactgggc
ggggacctgg gcacttacgt gatcaacaag cagaccccta acaagcagat
480ttggctgtct agtccttcaa gcggaccaaa gcggtacgac tggaccggca
aaaactgggt 540gtattctcac gatggggtca gtctgcatga gctgctggcc
gctgaactga ccaaggccct 600gaagacaaaa ctggacctgt cctctctggc
atatagcgga aaagatgcct gacgagcggc 660cgctcctagg agcagtatcg
atcccagccc acttttcccc aatacgacta gtactcgact 720gtgccttcta
gttgccagcc atctgttgtt tgcccctccc ccgtgccttc cttgaccctg
780gaaggtgcca ctcccactgt cctttcctaa taaaatgagg aaattgcatc
gcattgtctg 840agtaggtgtc attctattct ggggggtggg gtggggcagg
acagcaaggg ggaggattgg 900gaagacaaca gcaggcatgc tggggatgcg
gtgggctcta tggcttctga ggcggaaaga 960accagctttg gacgcgtctt aag
9832520DNAArtificial SequenceNucleic acid sequence encoding
collagen stabilizing sequence 25cccagcccac ttttccccaa
2026797DNAArtificial SequenceNucleic acid sequence of CBh promoter
26tacataactt acggtaaatg gcccgcctgg ctgaccgccc aacgaccccc gcccattgac
60gtcaatagta acgccaatag ggactttcca ttgacgtcaa tgggtggagt atttacggta
120aactgcccac ttggcagtac atcaagtgta tcatatgcca agtacgcccc
ctattgacgt 180caatgacggt aaatggcccg cctggcattg tgcccagtac
atgaccttat gggactttcc 240tacttggcag tacatctacg tattagtcat
cgctattacc atggtcgagg tgagccccac 300gttctgcttc actctcccca
tctccccccc ctccccaccc ccaattttgt atttatttat 360tttttaatta
ttttgtgcag cgatgggggc gggggggggg ggggggcgcg cgccaggcgg
420ggcggggcgg ggcgaggggc ggggcggggc gaggcggaga ggtgcggcgg
cagccaatca 480gagcggcgcg ctccgaaagt ttccttttat ggcgaggcgg
cggcggcggc ggccctataa 540aaagcgaagc gcgcggcggg cgggagtcgc
tgcgacgctg ccttcgcccc gtgccccgct 600ccgccgccgc ctcgcgccgc
ccgccccggc tctgactgac cgcgttactc ccacaggtga 660gcgggcggga
cggcccttct cctccgggct gtaattagct gagcaagagg taagggttta
720agggatggtt ggttggtggg gtattaatgt ttaattacct ggagcacctg
cctgaaatca 780ctttttttca ggttgga 79727254DNAArtificial
SequenceNucleic acid sequence of bGHpoly A signal sequence
27ctcgactgtg ccttctagtt gccagccatc tgttgtttgc ccctcccccg tgccttcctt
60gaccctggaa ggtgccactc ccactgtcct ttcctaataa aatgaggaaa ttgcatcgca
120ttgtctgagt aggtgtcatt ctattctggg gggtggggtg gggcaggaca
gcaaggggga 180ggattgggaa gacaacagca ggcatgctgg ggatgcggtg
ggctctatgg cttctgaggc 240ggaaagaacc agct 254282208DNAArtificial
SequenceNucleotide sequence encoding AAV2i8 capsid (VP1)
28atggctgccg atggttatct tccagattgg ctcgaggaca ctctctctga aggaataaga
60cagtggtgga agctcaaacc tggcccacca ccaccaaagc ccgcagagcg gcataaggac
120gacagcaggg gtcttgtgct tcctgggtac aagtacctcg gacccttcaa
cggactcgac 180aagggagagc cggtcaacga ggcagacgcc gcggccctcg
agcacgacaa agcctacgac 240cggcagctcg acagcggaga caacccgtac
ctcaagtaca accacgccga cgcggagttt 300caggagcgcc ttaaagaaga
tacgtctttt gggggcaacc tcggacgagc agtcttccag 360gcgaaaaaga
gggttcttga acctctgggc ctggttgagg aacctgttaa gacggctccg
420ggaaaaaaga ggccggtaga gcactctcct gtggagccag actcctcctc
gggaaccgga 480aaggcgggcc agcagcctgc aagaaaaaga ttgaattttg
gtcagactgg agacgcagac 540tcagtacctg acccccagcc tctcggacag
ccaccagcag ccccctctgg tctgggaact 600aatacgatgg ctacaggcag
tggcgcacca atggcagaca ataacgaggg cgccgacgga 660gtgggtaatt
cctcgggaaa ttggcattgc gattccacat ggatgggcga cagagtcatc
720accaccagca cccgaacctg ggccctgccc acctacaaca accacctcta
caaacaaatt 780tccagccaat caggagcctc gaacgacaat cactactttg
gctacagcac cccttggggg 840tattttgact tcaacagatt ccactgccac
ttttcaccac gtgactggca aagactcatc 900aacaacaact ggggattccg
acccaagaga ctcaacttca agctctttaa cattcaagtc 960aaagaggtca
cgcagaatga cggtacgacg acgattgcca ataaccttac cagcacggtt
1020caggtgttta ctgactcgga gtaccagctc ccgtacgtcc tcggctcggc
gcatcaagga 1080tgcctcccgc cgttcccagc agacgtcttc atggtgccac
agtatggata cctcaccctg 1140aacaacggga gtcaggcagt aggacgctct
tcattttact gcctggagta ctttccttct 1200cagatgctgc gtaccggaaa
caactttacc ttcagctaca cttttgagga cgttcctttc 1260cacagcagct
acgctcacag ccagagtctg gaccgtctca tgaatcctct catcgaccag
1320tacctgtatt acttgagcag aacaaacact ccaagtggaa ccaccacgca
gtcaaggctt 1380cagttttctg tggccggacc cagtaacatg gctgtccagg
gaaggaactg gcttcctgga 1440ccctgttacc gccagcagcg agtatcaaag
acatctgcgg ataacaacaa cagtgaattt 1500gcttggactg gagctaccaa
gtaccacctc aatggcagag actctctggt gaatccgggc 1560ccggccatgg
caagccacaa ggacgatgaa gaaaagtttt ttcctcagag cggggttctc
1620atctttggga agcaaggctc agagaaaaca aatgtggaca ttgaaaaggt
catgattaca 1680gacgaagagg aaatcaggac aaccaatccc gtggctacgg
agcagtatgg ttctgtatct 1740accaacctcc agcaacagaa cacagcacca
gctaccgcag atgtcaacac acaaggcgtt 1800cttccaggca tggtctggca
ggacagagat gtgtaccttc aggggcccat ctgggcaaag 1860attccacaca
cggacggaca ttttcacccc tctcccctca tgggtggatt cggacttaaa
1920caccctcctc cacagattct catcaagaac accccggtac ctgcgaatcc
ttcgaccacc 1980ttcagtgcgg caaagtttgc ttccttcatc acacagtact
ccacgggaca ggtcagcgtg 2040gagatcgagt gggagctgca gaaggaaaac
agcaaacgct ggaatcccga aattcagtac 2100acttccaact acaacaagtc
tgttaatgtg gactttactg tggacactaa tggcgtgtat 2160tcagagcctc
gccccattgg caccagatac ctgactcgta atctgtaa 220829735PRTArtificial
SequenceAmino acid sequence of AAV2i8 capsid (VP1) 29Met Ala Ala
Asp Gly Tyr Leu Pro Asp Trp Leu Glu Asp Thr Leu Ser1 5 10 15Glu Gly
Ile Arg Gln Trp Trp Lys Leu Lys Pro Gly Pro Pro Pro Pro 20 25 30Lys
Pro Ala Glu Arg His Lys Asp Asp Ser Arg Gly Leu Val Leu Pro 35 40
45Gly Tyr Lys Tyr Leu Gly Pro Phe Asn Gly Leu Asp Lys Gly Glu Pro
50 55 60Val Asn Glu Ala Asp Ala Ala Ala Leu Glu His Asp Lys Ala Tyr
Asp65 70 75 80Arg Gln Leu Asp Ser Gly Asp Asn Pro Tyr Leu Lys Tyr
Asn His Ala 85 90 95Asp Ala Glu Phe Gln Glu Arg Leu Lys Glu Asp Thr
Ser Phe Gly Gly 100 105 110Asn Leu Gly Arg Ala Val Phe Gln Ala Lys
Lys Arg Val Leu Glu Pro 115 120 125Leu Gly Leu Val Glu Glu Pro Val
Lys Thr Ala Pro Gly Lys Lys Arg 130 135 140Pro Val Glu His Ser Pro
Val Glu Pro Asp Ser Ser Ser Gly Thr Gly145 150 155 160Lys Ala Gly
Gln Gln Pro Ala Arg Lys Arg Leu Asn Phe Gly Gln Thr 165 170 175Gly
Asp Ala Asp Ser Val Pro Asp Pro Gln Pro Leu Gly Gln Pro Pro 180 185
190Ala Ala Pro Ser Gly Leu Gly Thr Asn Thr Met Ala Thr Gly Ser Gly
195 200 205Ala Pro Met Ala Asp Asn Asn Glu Gly Ala Asp Gly Val Gly
Asn Ser 210 215 220Ser Gly Asn Trp His Cys Asp Ser Thr Trp Met Gly
Asp Arg Val Ile225 230 235 240Thr Thr Ser Thr Arg Thr Trp Ala Leu
Pro Thr Tyr Asn Asn His Leu 245 250 255Tyr Lys Gln Ile Ser Ser Gln
Ser Gly Ala Ser Asn Asp Asn His Tyr 260 265 270Phe Gly Tyr Ser Thr
Pro Trp Gly Tyr Phe Asp Phe Asn Arg Phe His 275 280 285Cys His Phe
Ser Pro Arg Asp Trp Gln Arg Leu Ile Asn Asn Asn Trp 290 295 300Gly
Phe Arg Pro Lys Arg Leu Asn Phe Lys Leu Phe Asn Ile Gln Val305 310
315 320Lys Glu Val Thr Gln Asn Asp Gly Thr Thr Thr Ile Ala Asn Asn
Leu 325 330 335Thr Ser Thr Val Gln Val Phe Thr Asp Ser Glu Tyr Gln
Leu Pro Tyr 340 345 350Val Leu Gly Ser Ala His Gln Gly Cys Leu Pro
Pro Phe Pro Ala Asp 355 360 365Val Phe Met Val Pro Gln Tyr Gly Tyr
Leu Thr Leu Asn Asn Gly Ser 370 375 380Gln Ala Val Gly Arg Ser Ser
Phe Tyr Cys Leu Glu Tyr Phe Pro Ser385 390 395 400Gln Met Leu Arg
Thr Gly Asn Asn Phe Thr Phe Ser Tyr Thr Phe Glu 405 410 415Asp Val
Pro Phe His Ser Ser Tyr Ala His Ser Gln Ser Leu Asp Arg 420 425
430Leu Met Asn Pro Leu Ile Asp Gln Tyr Leu Tyr Tyr Leu Ser Arg Thr
435 440 445Asn Thr Pro Ser Gly Thr Thr Thr Gln Ser Arg Leu Gln Phe
Ser Val 450 455 460Ala Gly Pro Ser Asn Met Ala Val Gln Gly Arg Asn
Trp Leu Pro Gly465 470 475 480Pro Cys Tyr Arg Gln Gln Arg Val Ser
Lys Thr Ser Ala Asp Asn Asn 485 490 495Asn Ser Glu Phe Ala Trp Thr
Gly Ala Thr Lys Tyr His Leu Asn Gly 500 505 510Arg Asp Ser Leu Val
Asn Pro Gly Pro Ala Met Ala Ser His Lys Asp 515 520 525Asp Glu Glu
Lys Phe Phe Pro Gln Ser Gly Val Leu Ile Phe Gly Lys 530 535 540Gln
Gly Ser Glu Lys Thr Asn Val Asp Ile Glu Lys Val Met Ile Thr545 550
555 560Asp Glu Glu Glu Ile Arg Thr Thr Asn Pro Val Ala Thr Glu Gln
Tyr 565 570 575Gly Ser Val Ser Thr Asn Leu Gln Gln Gln Asn Thr Ala
Pro Ala Thr 580 585 590Ala Asp Val Asn Thr Gln Gly Val Leu Pro Gly
Met Val Trp Gln Asp 595 600 605Arg Asp Val Tyr Leu Gln Gly Pro Ile
Trp Ala Lys Ile Pro His Thr 610 615 620Asp Gly His Phe His Pro Ser
Pro Leu Met Gly Gly Phe Gly Leu Lys625 630 635 640His Pro Pro Pro
Gln Ile Leu Ile Lys Asn Thr Pro Val Pro Ala Asn 645 650 655Pro Ser
Thr Thr Phe Ser Ala Ala Lys Phe Ala Ser Phe Ile Thr Gln 660 665
670Tyr Ser Thr Gly Gln Val Ser Val Glu Ile Glu Trp Glu Leu Gln Lys
675 680 685Glu Asn Ser Lys Arg Trp Asn Pro Glu Ile Gln Tyr Thr Ser
Asn Tyr 690 695 700Asn Lys Ser Val Asn Val Asp Phe Thr Val Asp Thr
Asn Gly Val Tyr705 710 715 720Ser Glu Pro Arg Pro Ile Gly Thr Arg
Tyr Leu Thr Arg Asn Leu 725 730 735302208DNAArtificial
SequenceNucleic acid encoding AAV2-TT capsid (VP1) 30atggctgccg
atggttatct tccagattgg ctcgaggaca ctctctctga aggaataaga 60cagtggtgga
agctcaaacc tggcccacca ccaccaaagc ccgcagagcg gcataaggac
120gacagcaggg gtcttgtgct tcctgggtac aagtacctcg gacccttcaa
cggactcgac 180aagggagagc cggtcaacga ggcagacgcc gcggccctcg
agcacgacaa agcctacgac 240cggcagctcg acagcggaga caacccgtac
ctcaagtaca accacgccga cgcggagttt 300caggagcgcc ttaaagaaga
tacgtctttt gggggcaacc tcggacgagc agtcttccag 360gcgaaaaaga
ggattcttga acctctgggc ctggttgagg aacctgttaa gacggctccg
420ggaaaaaaga ggccggtaga gcactctcct gcggagccag actcctcctc
gggaaccgga 480aagtcgggcc agcagcctgc aagaaaaaga ttgaattttg
gtcagactgg agacgcagac 540tcagtacctg acccccagcc tctcggacag
ccaccagcag ccccctctgg tctgggaact 600aatacgatgg cttcaggcag
tggcgcacca atggcagaca ataacgaggg cgccgacgga 660gtgggtaatt
cctcgggaaa ttggcattgc gattccacat ggatgggcga cagagtcatc
720accaccagca cccgaacctg ggccctgccc acctacaaca accacctcta
caaacaaatt 780tccagccaat caggagcctc gaacgacaat cactactttg
gctacagcac cccttggggg 840tattttgact tcaacagatt ccactgccac
ttttcaccac gtgactggca aagactcatc 900aacaacaact ggggattccg
acccaagaga ctcagcttca agctctttaa cattcaagtc 960aaagaggtca
cgcagaatga cggtacgacg acgattgcca ataaccttac cagcacggtt
1020caggtgttta ctgactcgga gtaccagctc ccgtacgtcc tcggctcggc
gcatcaagga 1080tgcctcccgc cgttcccagc agacgtcttc atggtgccac
agtatggata cctcaccctg 1140aacaacggga gtcaggcagt aggacgctct
tcattttact gcctggagta ctttccttct 1200cagatgctgc gtaccggaaa
caactttacc ttcagctaca cttttgagga cgttcctttc 1260cacagcagct
acgctcacag ccagagtctg gaccgtctca tgaatcctct catcgaccag
1320tacctgtatt acttgagcag aacaaacact ccaagtggaa ccaccacgat
gtcaaggctt 1380cagttttctc aggccggagc gagtgacatt cgggaccagt
ctaggaactg gcttcctgga 1440ccctgttacc gccagcagcg agtatcaaag
acagctgcgg ataacaacaa cagtgattac 1500tcgtggactg gagctaccaa
gtaccacctc aatggcagag actctctggt gaatccgggc 1560ccggccatgg
caagccacaa ggacgatgaa gaaaagtatt ttcctcagag cggggttctc
1620atctttggga agcaagactc aggaaaaaca aatgtggaca ttgaaaaggt
catgattaca 1680gacgaagagg aaatcaggac aaccaatccc gtggctacgg
agcagtatgg ttctgtatct 1740accaacctcc agagcggcaa cacacaagca
gctacctcag atgtcaacac acaaggcgtt 1800cttccaggca tggtctggca
ggacagagat gtgtaccttc aggggcccat ctgggcaaag 1860attccacaca
cggacggaca ttttcacccc tctcccctca tgggtggatt cggacttaaa
1920caccctcctc cacagattct catcaagaac accccggtac ctgcgaatcc
ttcgaccacc 1980ttcagtgcgg caaagtttgc ttccttcatc acacagtact
ccacgggaca ggtcagcgtg 2040gagatcgagt gggagctgca gaaggaaaac
agcaaacgct ggaatcccga aattcagtac 2100acttccaact acaacaagtc
tgttaatgtg gactttactg tggacactaa tggcgtgtat 2160tcagagcctc
gccccattgg caccagatac ctgactcgta atctgtaa 220831735PRTArtificial
SequenceAmino acid sequence of AAV2-TT capsid (VP1) 31Met Ala Ala
Asp Gly Tyr Leu Pro Asp Trp Leu Glu Asp Thr Leu Ser1 5 10 15Glu Gly
Ile Arg Gln Trp Trp Lys Leu Lys Pro Gly Pro Pro Pro Pro 20 25 30Lys
Pro Ala Glu Arg His Lys Asp Asp Ser Arg Gly Leu Val Leu Pro 35 40
45Gly Tyr Lys Tyr Leu Gly Pro Phe Asn Gly Leu Asp Lys Gly Glu Pro
50 55 60Val Asn Glu Ala Asp Ala Ala Ala Leu Glu His Asp Lys Ala Tyr
Asp65 70 75 80Arg Gln Leu Asp Ser Gly Asp Asn Pro Tyr Leu Lys Tyr
Asn His Ala 85 90 95Asp Ala Glu Phe Gln Glu Arg Leu Lys Glu Asp Thr
Ser Phe Gly Gly 100 105 110Asn Leu Gly Arg Ala Val Phe Gln Ala Lys
Lys Arg Ile Leu Glu Pro 115 120 125Leu Gly Leu Val Glu Glu Pro Val
Lys Thr Ala Pro Gly Lys Lys Arg 130 135 140Pro Val Glu His Ser Pro
Ala Glu Pro Asp Ser Ser Ser Gly Thr Gly145 150 155 160Lys Ser Gly
Gln Gln Pro Ala Arg Lys Arg Leu Asn Phe Gly Gln Thr 165 170 175Gly
Asp Ala Asp Ser Val Pro Asp Pro Gln Pro Leu Gly Gln Pro Pro 180 185
190Ala Ala Pro Ser Gly Leu Gly Thr Asn Thr Met Ala Ser Gly Ser Gly
195 200 205Ala Pro Met Ala Asp Asn Asn Glu Gly Ala Asp Gly Val Gly
Asn Ser 210 215 220Ser Gly Asn Trp His Cys Asp Ser Thr Trp Met Gly
Asp Arg Val Ile225 230 235 240Thr Thr Ser Thr Arg Thr Trp Ala Leu
Pro Thr Tyr Asn Asn His Leu 245 250 255Tyr Lys Gln Ile Ser Ser Gln
Ser Gly Ala Ser Asn Asp Asn His Tyr 260 265 270Phe Gly Tyr Ser Thr
Pro Trp Gly Tyr Phe Asp Phe Asn Arg Phe His 275 280 285Cys His Phe
Ser Pro Arg Asp Trp Gln Arg Leu Ile Asn Asn Asn Trp 290 295 300Gly
Phe Arg Pro Lys Arg Leu Ser Phe Lys Leu Phe Asn Ile Gln Val305 310
315 320Lys Glu Val Thr Gln Asn Asp Gly Thr Thr Thr Ile Ala Asn Asn
Leu 325 330 335Thr Ser Thr Val Gln Val Phe Thr Asp Ser Glu Tyr Gln
Leu Pro Tyr 340 345 350Val Leu Gly Ser Ala His Gln Gly Cys Leu Pro
Pro Phe Pro Ala Asp 355 360 365Val Phe Met Val Pro Gln Tyr Gly Tyr
Leu Thr Leu Asn Asn Gly Ser 370 375 380Gln Ala Val Gly Arg Ser Ser
Phe Tyr Cys Leu Glu Tyr Phe Pro Ser385 390 395 400Gln Met Leu Arg
Thr Gly Asn Asn Phe Thr Phe Ser Tyr Thr Phe Glu 405 410 415Asp Val
Pro Phe His Ser Ser Tyr Ala His Ser Gln Ser Leu Asp Arg 420 425
430Leu Met Asn Pro Leu Ile Asp Gln Tyr Leu Tyr Tyr Leu Ser Arg Thr
435 440 445Asn Thr Pro Ser Gly Thr Thr Thr Met Ser Arg Leu Gln Phe
Ser Gln 450 455 460Ala Gly Ala Ser Asp Ile Arg Asp Gln Ser Arg Asn
Trp Leu Pro Gly465 470 475 480Pro Cys Tyr Arg Gln Gln Arg Val Ser
Lys Thr Ala Ala Asp Asn Asn 485 490 495Asn Ser Asp Tyr Ser Trp Thr
Gly Ala Thr Lys Tyr His Leu Asn Gly 500 505 510Arg Asp Ser Leu Val
Asn Pro Gly Pro Ala Met Ala Ser His Lys Asp 515 520 525Asp Glu Glu
Lys Tyr Phe Pro Gln Ser Gly Val Leu Ile Phe Gly Lys 530 535 540Gln
Asp Ser Gly Lys Thr Asn Val Asp Ile Glu Lys Val Met Ile Thr545 550
555 560Asp Glu Glu Glu Ile Arg Thr Thr Asn Pro Val Ala Thr Glu Gln
Tyr 565 570 575Gly Ser Val Ser Thr Asn Leu Gln Ser Gly Asn Thr Gln
Ala Ala Thr 580 585 590Ser Asp Val Asn Thr Gln Gly Val Leu Pro Gly
Met Val Trp Gln Asp 595 600 605Arg Asp Val Tyr Leu Gln Gly Pro Ile
Trp Ala Lys Ile Pro His Thr 610 615 620Asp Gly His Phe His Pro Ser
Pro Leu Met Gly Gly Phe Gly Leu Lys625 630 635 640His Pro Pro Pro
Gln Ile Leu Ile Lys Asn Thr Pro Val Pro Ala Asn 645 650 655Pro Ser
Thr Thr Phe Ser Ala Ala Lys Phe Ala Ser Phe Ile Thr Gln 660 665
670Tyr Ser Thr Gly Gln Val Ser Val Glu Ile Glu Trp Glu Leu Gln Lys
675 680 685Glu Asn Ser Lys Arg Trp Asn Pro Glu Ile Gln Tyr Thr Ser
Asn Tyr 690 695 700Asn Lys Ser Val Asn Val Asp Phe Thr Val Asp Thr
Asn Gly Val Tyr705 710 715
720Ser Glu Pro Arg Pro Ile Gly Thr Arg Tyr Leu Thr Arg Asn Leu 725
730 735322208DNAArtificial SequenceNucleic acid encoding
AAV2-TT-S312N capsid (VP1) 32atggctgccg atggttatct tccagattgg
ctcgaggaca ctctctctga aggaataaga 60cagtggtgga agctcaaacc tggcccacca
ccaccaaagc ccgcagagcg gcataaggac 120gacagcaggg gtcttgtgct
tcctgggtac aagtacctcg gacccttcaa cggactcgac 180aagggagagc
cggtcaacga ggcagacgcc gcggccctcg agcacgacaa agcctacgac
240cggcagctcg acagcggaga caacccgtac ctcaagtaca accacgccga
cgcggagttt 300caggagcgcc ttaaagaaga tacgtctttt gggggcaacc
tcggacgagc agtcttccag 360gcgaaaaaga ggattcttga acctctgggc
ctggttgagg aacctgttaa gacggctccg 420ggaaaaaaga ggccggtaga
gcactctcct gcggagccag actcctcctc gggaaccgga 480aagtcgggcc
agcagcctgc aagaaaaaga ttgaattttg gtcagactgg agacgcagac
540tcagtacctg acccccagcc tctcggacag ccaccagcag ccccctctgg
tctgggaact 600aatacgatgg cttcaggcag tggcgcacca atggcagaca
ataacgaggg cgccgacgga 660gtgggtaatt cctcgggaaa ttggcattgc
gattccacat ggatgggcga cagagtcatc 720accaccagca cccgaacctg
ggccctgccc acctacaaca accacctcta caaacaaatt 780tccagccaat
caggagcctc gaacgacaat cactactttg gctacagcac cccttggggg
840tattttgact tcaacagatt ccactgccac ttttcaccac gtgactggca
aagactcatc 900aacaacaact ggggattccg acccaagaga ctcaacttca
agctctttaa cattcaagtc 960aaagaggtca cgcagaatga cggtacgacg
acgattgcca ataaccttac cagcacggtt 1020caggtgttta ctgactcgga
gtaccagctc ccgtacgtcc tcggctcggc gcatcaagga 1080tgcctcccgc
cgttcccagc agacgtcttc atggtgccac agtatggata cctcaccctg
1140aacaacggga gtcaggcagt aggacgctct tcattttact gcctggagta
ctttccttct 1200cagatgctgc gtaccggaaa caactttacc ttcagctaca
cttttgagga cgttcctttc 1260cacagcagct acgctcacag ccagagtctg
gaccgtctca tgaatcctct catcgaccag 1320tacctgtatt acttgagcag
aacaaacact ccaagtggaa ccaccacgat gtcaaggctt 1380cagttttctc
aggccggagc gagtgacatt cgggaccagt ctaggaactg gcttcctgga
1440ccctgttacc gccagcagcg agtatcaaag acagctgcgg ataacaacaa
cagtgattac 1500tcgtggactg gagctaccaa gtaccacctc aatggcagag
actctctggt gaatccgggc 1560ccggccatgg caagccacaa ggacgatgaa
gaaaagtatt ttcctcagag cggggttctc 1620atctttggga agcaagactc
aggaaaaaca aatgtggaca ttgaaaaggt catgattaca 1680gacgaagagg
aaatcaggac aaccaatccc gtggctacgg agcagtatgg ttctgtatct
1740accaacctcc agagcggcaa cacacaagca gctacctcag atgtcaacac
acaaggcgtt 1800cttccaggca tggtctggca ggacagagat gtgtaccttc
aggggcccat ctgggcaaag 1860attccacaca cggacggaca ttttcacccc
tctcccctca tgggtggatt cggacttaaa 1920caccctcctc cacagattct
catcaagaac accccggtac ctgcgaatcc ttcgaccacc 1980ttcagtgcgg
caaagtttgc ttccttcatc acacagtact ccacgggaca ggtcagcgtg
2040gagatcgagt gggagctgca gaaggaaaac agcaaacgct ggaatcccga
aattcagtac 2100acttccaact acaacaagtc tgttaatgtg gactttactg
tggacactaa tggcgtgtat 2160tcagagcctc gccccattgg caccagatac
ctgactcgta atctgtaa 220833735PRTArtificial SequenceAmino acid
sequence of AAV2-TT-S312N capsid (VP1) 33Met Ala Ala Asp Gly Tyr
Leu Pro Asp Trp Leu Glu Asp Thr Leu Ser1 5 10 15Glu Gly Ile Arg Gln
Trp Trp Lys Leu Lys Pro Gly Pro Pro Pro Pro 20 25 30Lys Pro Ala Glu
Arg His Lys Asp Asp Ser Arg Gly Leu Val Leu Pro 35 40 45Gly Tyr Lys
Tyr Leu Gly Pro Phe Asn Gly Leu Asp Lys Gly Glu Pro 50 55 60Val Asn
Glu Ala Asp Ala Ala Ala Leu Glu His Asp Lys Ala Tyr Asp65 70 75
80Arg Gln Leu Asp Ser Gly Asp Asn Pro Tyr Leu Lys Tyr Asn His Ala
85 90 95Asp Ala Glu Phe Gln Glu Arg Leu Lys Glu Asp Thr Ser Phe Gly
Gly 100 105 110Asn Leu Gly Arg Ala Val Phe Gln Ala Lys Lys Arg Ile
Leu Glu Pro 115 120 125Leu Gly Leu Val Glu Glu Pro Val Lys Thr Ala
Pro Gly Lys Lys Arg 130 135 140Pro Val Glu His Ser Pro Ala Glu Pro
Asp Ser Ser Ser Gly Thr Gly145 150 155 160Lys Ser Gly Gln Gln Pro
Ala Arg Lys Arg Leu Asn Phe Gly Gln Thr 165 170 175Gly Asp Ala Asp
Ser Val Pro Asp Pro Gln Pro Leu Gly Gln Pro Pro 180 185 190Ala Ala
Pro Ser Gly Leu Gly Thr Asn Thr Met Ala Ser Gly Ser Gly 195 200
205Ala Pro Met Ala Asp Asn Asn Glu Gly Ala Asp Gly Val Gly Asn Ser
210 215 220Ser Gly Asn Trp His Cys Asp Ser Thr Trp Met Gly Asp Arg
Val Ile225 230 235 240Thr Thr Ser Thr Arg Thr Trp Ala Leu Pro Thr
Tyr Asn Asn His Leu 245 250 255Tyr Lys Gln Ile Ser Ser Gln Ser Gly
Ala Ser Asn Asp Asn His Tyr 260 265 270Phe Gly Tyr Ser Thr Pro Trp
Gly Tyr Phe Asp Phe Asn Arg Phe His 275 280 285Cys His Phe Ser Pro
Arg Asp Trp Gln Arg Leu Ile Asn Asn Asn Trp 290 295 300Gly Phe Arg
Pro Lys Arg Leu Asn Phe Lys Leu Phe Asn Ile Gln Val305 310 315
320Lys Glu Val Thr Gln Asn Asp Gly Thr Thr Thr Ile Ala Asn Asn Leu
325 330 335Thr Ser Thr Val Gln Val Phe Thr Asp Ser Glu Tyr Gln Leu
Pro Tyr 340 345 350Val Leu Gly Ser Ala His Gln Gly Cys Leu Pro Pro
Phe Pro Ala Asp 355 360 365Val Phe Met Val Pro Gln Tyr Gly Tyr Leu
Thr Leu Asn Asn Gly Ser 370 375 380Gln Ala Val Gly Arg Ser Ser Phe
Tyr Cys Leu Glu Tyr Phe Pro Ser385 390 395 400Gln Met Leu Arg Thr
Gly Asn Asn Phe Thr Phe Ser Tyr Thr Phe Glu 405 410 415Asp Val Pro
Phe His Ser Ser Tyr Ala His Ser Gln Ser Leu Asp Arg 420 425 430Leu
Met Asn Pro Leu Ile Asp Gln Tyr Leu Tyr Tyr Leu Ser Arg Thr 435 440
445Asn Thr Pro Ser Gly Thr Thr Thr Met Ser Arg Leu Gln Phe Ser Gln
450 455 460Ala Gly Ala Ser Asp Ile Arg Asp Gln Ser Arg Asn Trp Leu
Pro Gly465 470 475 480Pro Cys Tyr Arg Gln Gln Arg Val Ser Lys Thr
Ala Ala Asp Asn Asn 485 490 495Asn Ser Asp Tyr Ser Trp Thr Gly Ala
Thr Lys Tyr His Leu Asn Gly 500 505 510Arg Asp Ser Leu Val Asn Pro
Gly Pro Ala Met Ala Ser His Lys Asp 515 520 525Asp Glu Glu Lys Tyr
Phe Pro Gln Ser Gly Val Leu Ile Phe Gly Lys 530 535 540Gln Asp Ser
Gly Lys Thr Asn Val Asp Ile Glu Lys Val Met Ile Thr545 550 555
560Asp Glu Glu Glu Ile Arg Thr Thr Asn Pro Val Ala Thr Glu Gln Tyr
565 570 575Gly Ser Val Ser Thr Asn Leu Gln Ser Gly Asn Thr Gln Ala
Ala Thr 580 585 590Ser Asp Val Asn Thr Gln Gly Val Leu Pro Gly Met
Val Trp Gln Asp 595 600 605Arg Asp Val Tyr Leu Gln Gly Pro Ile Trp
Ala Lys Ile Pro His Thr 610 615 620Asp Gly His Phe His Pro Ser Pro
Leu Met Gly Gly Phe Gly Leu Lys625 630 635 640His Pro Pro Pro Gln
Ile Leu Ile Lys Asn Thr Pro Val Pro Ala Asn 645 650 655Pro Ser Thr
Thr Phe Ser Ala Ala Lys Phe Ala Ser Phe Ile Thr Gln 660 665 670Tyr
Ser Thr Gly Gln Val Ser Val Glu Ile Glu Trp Glu Leu Gln Lys 675 680
685Glu Asn Ser Lys Arg Trp Asn Pro Glu Ile Gln Tyr Thr Ser Asn Tyr
690 695 700Asn Lys Ser Val Asn Val Asp Phe Thr Val Asp Thr Asn Gly
Val Tyr705 710 715 720Ser Glu Pro Arg Pro Ile Gly Thr Arg Tyr Leu
Thr Arg Asn Leu 725 730 735
* * * * *
References