U.S. patent application number 16/859252 was filed with the patent office on 2020-11-26 for shared neoantigens.
The applicant listed for this patent is The Broad Institute, Inc., Dana-Farber Cancer Institute, Inc., The General Hospital Corporation. Invention is credited to Pavan Bachireddy, Edward F. Fritsch, Nir Hacohen, Michael S. Rooney, Sachet A. Shukla, Jing Sun, Catherine J. Wu.
Application Number | 20200368337 16/859252 |
Document ID | / |
Family ID | 1000005019543 |
Filed Date | 2020-11-26 |
View All Diagrams
United States Patent
Application |
20200368337 |
Kind Code |
A1 |
Fritsch; Edward F. ; et
al. |
November 26, 2020 |
SHARED NEOANTIGENS
Abstract
Disclosed herein in one aspect is a pharmaceutical composition
comprising a plurality of neoantigenic peptides and a
pharmaceutically acceptable carrier, each neoantigenic peptide
comprising a tumor-specific neoepitope capable of binding to an HLA
protein in a subject, each tumor-specific neoepitope comprising a
tumor-specific mutation present in a tumor, wherein (a) the
composition comprises neoantigenic peptides comprising
tumor-specific mutations present in at least 1% of subjects in a
population of subjects suffering from cancer; (b) the composition
comprises neoantigenic peptides comprising tumor-specific
neoepitopes which bind to HLA proteins present in at least 5% of
subjects in the population; and (c) the composition comprises at
least one neoantigenic peptide capable of eliciting an immune
response against a tumor present in at least 5% of the subjects in
the population of subjects suffering from cancer.
Inventors: |
Fritsch; Edward F.;
(Concord, MA) ; Hacohen; Nir; (Brookline, MA)
; Rooney; Michael S.; (Cambridge, MA) ; Shukla;
Sachet A.; (Natick, MA) ; Wu; Catherine J.;
(Brookline, MA) ; Bachireddy; Pavan; (Boston,
MA) ; Sun; Jing; (Brookline, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Broad Institute, Inc.
Dana-Farber Cancer Institute, Inc.
The General Hospital Corporation |
Cambridge
Boston
Boston |
MA
MA
MA |
US
US
US |
|
|
Family ID: |
1000005019543 |
Appl. No.: |
16/859252 |
Filed: |
April 27, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15575328 |
Nov 17, 2017 |
|
|
|
PCT/US2016/033452 |
May 20, 2016 |
|
|
|
16859252 |
|
|
|
|
62179877 |
May 20, 2015 |
|
|
|
62389377 |
Feb 23, 2016 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 39/001152 20180801;
C12N 2320/31 20130101; A61K 39/001106 20180801; C12Q 1/6886
20130101; A61K 39/001162 20180801; C12N 2320/34 20130101; C12Q
2600/158 20130101; C07K 14/4748 20130101; A61K 39/001151 20180801;
A61K 39/001197 20180801; G01N 2800/60 20130101; A61K 39/001104
20180801; A61K 2039/70 20130101; A61K 2039/515 20130101; G01N
2800/56 20130101; A61P 35/00 20180101; A61K 39/001164 20180801;
A61K 39/0011 20130101; G01N 2800/7028 20130101 |
International
Class: |
A61K 39/00 20060101
A61K039/00; A61P 35/00 20060101 A61P035/00; C07K 14/47 20060101
C07K014/47; C12Q 1/6886 20060101 C12Q001/6886 |
Claims
1.-93. (canceled)
94. A pharmaceutical composition comprising (i) a polypeptide
comprising at least one amino acid sequence comprising at least 8
amino contiguous acids of: TABLE-US-00010 (SEQ ID NO: 1297)
FSHSSHMLTTPTPMHPPSSLSFGPHPPLQHGHRHGLEPCSMLTGPPARVP
AVPFDLHFCRSSIMKPKRDGYMFLKAESKIMFATLQRSSLWCLCSNH,
(ii) a nucleic acid encoding the polypeptide, (iii) antigen
presenting cells (APCs) comprising (i) or (ii), or (iv) T cells
stimulated with APCs comprising (i) or (ii); and a pharmaceutically
acceptable carrier.
95. The pharmaceutical composition of claim 94, wherein the at
least one amino acid sequence binds to a protein encoded by an HLA
allele.
96. The pharmaceutical composition of claim 95, wherein the at
least one amino acid sequence binds to a protein encoded by an
HLA-A, HLA-B or HLA-C allele with a K.sub.D of less than 500
nM.
97. The pharmaceutical composition of claim 95, wherein the at
least one amino acid sequence binds to a protein encoded by a class
II HLA allele with a binding affinity of less than 1000 nM.
98. The pharmaceutical composition of claim 94, wherein the
polypeptide is from 8 to 50 amino acids in length.
99. The pharmaceutical composition of claim 94, wherein the at
least one amino acid sequence comprises at least 8 amino contiguous
acids of: TABLE-US-00011 (residues 26-97 of SEQ ID NO: 1297)
PPLQHGHRHGLEPCSMLTGPPARVPAVPFDLHFCRSSIMKPKRDGYMFLK
AESKIMFATLQRSSLWCLCSNH.
100. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence ESKIMFATL (SEQ ID NOs:
13457, 13526, 13595, 13661, 13717, 13772, 33585).
101. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence FATLQRSSL (SEQ ID NOs:
13454, 13523, 13592, 13658, 13714, 13769, 33527).
102. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence FLKAESKIM (SEQ ID NOs:
13438, 13507, 13576, 13643, 13700, 13754, 33542).
103. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence FLKAESKIMF (SEQ ID
NOs: 13488, 13559, 13628, 13687, 13741, 13796).
104. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence GPPARVPAV (SEQ ID NOs:
13452, 13521, 13590, 13656, 13712, 13767, 33554).
105. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence IMKPKRDGYM (SEQ ID
NOs: 13477, 13548, 13617, 13679, 13734, 13789).
106. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence KIMFATLQR (SEQ ID NOs:
13441, 13510, 13579, 13646, 13703, 13757, 33513).
107. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence KPKRDGYMF (SEQ ID NOs:
13453, 13522, 13591, 13657, 13713, 13768, 33555).
108. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence KPKRDGYMFL (SEQ ID
NOs: 13485, 13556, 13625, 13684, 13738, 13793, 33556).
109. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence LHFCRSSIM (SEQ ID NOs:
13456, 13525, 13594, 13660, 13716, 13771).
110. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence MFATLQRSSL (SEQ ID
NOs: 13487, 13558, 13627, 13686, 13740, 13795).
111. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence MFLKAESKI (SEQ ID NOs:
13444, 13513, 13582, 13649, 13706, 13760, 33726).
112. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence MLTGPPARV (SEQ ID NOs:
13437, 13506, 13575, 13642, 13699, 13753, 33517).
113. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence QPVLWTTPPL (SEQ ID
NOs: 13484, 13555, 13624, 33599).
114. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence SMLTGPPARV (SEQ ID
NOs: 13471, 13541, 13610, 13672, 13728, 13783, 33521).
115. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence TLQRSSLWCL (SEQ ID
NOs: 13473, 13543, 13612, 13674, 13730, 13785, 33523).
116. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence VLPEPHLAL (SEQ ID NOs:
13434).
117. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence: YMFLKAESK (SEQ ID
NOs: 13440, 13509, 13578, 13645, 13702, 13756, 33520).
118. The pharmaceutical composition of claim 94, wherein the
polypeptide comprises an amino acid sequence YMFLKAESKI (SEQ ID
NOs: 13472, 13542, 13611, 13673, 13729, 13784, 33522).
119. The pharmaceutical composition of claim 94, wherein the
pharmaceutical composition comprises (iv).
120. The pharmaceutical composition of claim 94, wherein the
pharmaceutical composition comprises (i) or (ii).
121. The pharmaceutical composition of claim 94, further comprising
an adjuvant or an immunomodulator.
122. The pharmaceutical composition of claim 121, wherein the
immunomodulator or adjuvant is poly(I:C).
123. The pharmaceutical composition of claim 94, wherein the
pharmaceutical composition is an immunogenic composition or a
vaccine composition.
Description
RELATED APPLICATIONS AND INCORPORATION BY REFERENCE
[0001] This application is a Continuation of Application U.S.
application Ser. No. 15/575,328 filed on Nov. 17, 2017, which is a
.sctn. 371 of international patent application Serial No.
PCT/US2016/033452 filed May 20, 2016, which published as PCT
Publication No. WO 2016/187508 on Nov. 24, 2016, which claims
priority and benefit of U.S. Provisional application Ser. No.
62/179,877 filed May 20, 2015 and U.S. Provisional application Ser.
No. 62/389,377 filed Feb. 23, 2016.
[0002] The foregoing applications, and all documents cited therein
or during their prosecution ("appin cited documents") and all
documents cited or referenced in the appin cited documents, and all
documents cited or referenced herein ("herein cited documents"),
and all documents cited or referenced in herein cited documents,
together with any manufacturer's instructions, descriptions,
product specifications, and product sheets for any products
mentioned herein or in any document incorporated by reference
herein, are hereby incorporated herein by reference, and may be
employed in the practice of the invention. More specifically, all
referenced documents are incorporated by reference to the same
extent as if each individual document was specifically and
individually indicated to be incorporated by reference.
SEQUENCE LISTING
[0003] The instant application contains a "lengthy" Sequence
Listing which has been submitted electronically in ASCII format and
is hereby incorporated by reference in its entirety. Said ASCII
format, created on Aug. 11, 2016, is named 47608_99_2007 SL.txt and
is 10,252,288 bytes in size.
FIELD OF THE INVENTION
[0004] The present invention relates to methods and compositions
for treating neoplasias, e.g. tumors, particularly using at least
one neoantigenic peptide which is suitable for treating a
significant proportion of subjects in a population suffering from
cancer.
BACKGROUND OF THE INVENTION
[0005] Approximately 1.6 million Americans are diagnosed with
neoplasia every year, and approximately 580,000 people in the
United States are expected to die of the disease in 2013. Over the
past few decades there been significant improvements in the
detection, diagnosis, and treatment of neoplasia, which have
significantly increased the survival rate for many types of
neoplasia. However, only about 60% of people diagnosed with
neoplasia are still alive 5 years after the onset of treatment,
which makes neoplasia the second leading cause of death in the
United States.
[0006] Currently, there are a number of different existing cancer
therapies, including ablation techniques (e.g., surgical
procedures, cryogenic/heat treatment, ultrasound, radiofrequency,
and radiation) and chemical techniques (e.g., pharmaceutical
agents, cytotoxic/chemotherapeutic agents, monoclonal antibodies,
and various combinations thereof). Unfortunately, such therapies
are frequently associated with serious risk, toxic side effects,
and extremely high costs, as well as uncertain efficacy.
[0007] There is a growing interest in cancer therapies that seek to
target cancerous cells with a patient's own immune system (e.g.,
cancer vaccines) because such therapies may mitigate/eliminate some
of the herein-described disadvantages. Cancer vaccines are
typically composed of tumor antigens and immunostimulatory
molecules (e.g., cytokines or TLR ligands) that work together to
induce antigen-specific cytotoxic T cells that target and destroy
tumor cells. Current cancer vaccines may contain shared tumor
antigens, which are native proteins (i.e. --proteins encoded by the
DNA of all the normal cells in the individual) that are selectively
expressed or over-expressed in tumors found in many individuals.
While such shared tumor antigens are useful in identifying
particular types of tumors, they are not ideal as immunogens for
targeting a T-cell response to a particular tumor type because they
are subject to the immune dampening effects of self-tolerance.
Vaccines containing tumor-specific and patient-specific neoantigens
can overcome some of the disadvantages of vaccines containing
shared tumor antigens. However, the use of patient-specific
neoantigens requires sequencing of individual subject's genomes, as
well as the production of personalized compositions comprising a
combination of neoantigens present in that individual subject.
Accordingly, there is still a need for improved methods and
compositions for delivering cancer vaccines.
[0008] Citation or identification of any document in this
application is not an admission that such document is available as
prior art to the present invention.
SUMMARY OF THE INVENTION
[0009] Preferred statements (features) and embodiments of this
invention are set herein below. Each statements and embodiments of
the invention so defined may be combined with any other statement
and/or embodiments unless clearly indicated to the contrary. In
particular, any feature indicated as being preferred or
advantageous may be combined with any other feature or features or
statements indicated as being preferred or advantageous. Hereto,
the present invention is in particular captured by any one or any
combination of one or more of the below statements and embodiments,
with any other statement and/or embodiments.
[0010] It is an objective of the invention to provide methods and
compositions for the treatment of a population of cancer patients
by eliciting an immune response targeting the cancer. In one
aspect, the present invention relates to a pharmaceutical
composition comprising at least one neoantigenic peptide and a
pharmaceutically acceptable carrier, each at least one neoantigenic
peptide comprising a tumor-specific neoepitope capable of binding
to an HLA protein in a subject, each tumor-specific neoepitope
comprising a tumor-specific mutation present in a tumor. The
composition may include one neoantigenic peptide. In other
embodiments, the composition may include more than 100 neoantigenic
peptides. Preferably, the composition includes about 20
neoantigenic peptides. The at least one neoantigenic peptide may
include a tumor-specific mutation. The mutation may be recurrent.
Preferably, the mutation is present in a large proportion of a
population. A recurrent mutation may be based on the mutation being
present in a tumor in at least 1% of subjects in a population of
subjects suffering from cancer. The composition may include at
least one neoantigenic peptide containing a tumor-specific
neoepitope which binds to an HLA protein present in at least 5% of
subjects in the population of subjects suffering from cancer.
Additionally, the composition may contain at least one neoantigenic
peptide capable of eliciting an immune response against a tumor
present in at least 5% of the subjects in the population of
subjects suffering from cancer. The ability to elicit an immune
response refers to the ability of the immune system to present an
antigen to a lymphocyte. In order for the immune system to present
an antigen, the antigen needs to be presented by a subjects HLA
proteins. In order to elicit an immune response against a tumor,
the tumor needs to contain the mutations leading to expression of
the antigen. In order for the composition to provide a benefit to a
population in need thereof, the population has to include subjects
that express an HLA allele capable of binding the at least one
neoantigenic peptide present in the composition and the population
has to include subjects containing tumors with mutations that lead
to neoantigenic epitopes present in the neoantigenic peptides.
[0011] The composition may be specific to a population of subjects
suffering from cancer that share a characteristic. The population
may have cancer or may have a specific cancer. The population may
share a common set of HLA subtypes. They may share HLA subtypes
based on ethnicity. Not being bound by a theory the percentage of
HLA types in a population can be predicted based on ethnicity
without testing. Not being bound by a theory, different populations
express different HLA types capable of binding different
neoantigenic peptides. Therefore a composition can be formulated to
provide a benefit to a large proportion of that population, whereas
the composition would not provide a benefit to another population.
Not being bound by a theory, different cancers contain different
mutations and thus compositions tailored to specific cancers can be
used to provide a greater benefit to a population with one type of
cancer as compared to a population that includes more than one
type. In one embodiment, the population is suffering from
adrenocortical carcinoma (ACC), bladder urothelial carcinoma
(BLCA), breast invasive carcinoma (BRCA), cervical squamous cell
carcinoma and endocervical adenocarcinoma (CESC), colon
adenocarcinoma (COAD), Chronic lymphocytic Leukaemia (CLL),
colorectal cancer (CRC), Diffuse large B-cell lymphoma (DLBCL),
glioblastoma multiforme (GBM), head and neck squamous cell
carcinoma (HNSC), kidney chromophobe (KICH), kidney renal clear
cell carcinoma (KIRC), kidney renal papillary cell carcinoma
(KIRP), acute myeloid leukemia (LAML), liver hepatocellular
carcinoma (LIHC), lung adenocarcinoma (LUAD), lung squamous cell
carcinoma (LUSC), multiple myeloma (MM), ovarian serous
cystadenocarcinoma (OV), pancreatic adenocarcinoma (PAAD), prostate
adenocarcinoma (PRAD), rectum adenocarcinoma (READ), skin cutaneous
melanoma (SKCM), stomach adenocarcinoma (STAD), testicular germ
cell tumors (TGCT), thyroid adenocarcinoma (THCA), uterine corpus
endometrioid carcinoma (UCEC), or uterine carcinosarcoma (UCS).
[0012] In one embodiment, the population of subjects is suffering
from CLL; the at least one tumor-specific mutation comprises any
combination of mutations in Table 8 with an exemplary disease of
"CLL"; and at least one of a set of six of the at least one
tumor-specific mutation will be found in 17.49% of subjects in the
CLL population. The population of subjects may be suffering from
BLCA, the at least one tumor-specific mutation comprises any
combination of mutations in Table 8 with an exemplary disease of
"BLCA"; and at least one of a set of six of the at least one
tumor-specific mutation will be found in 26.92% of subjects in the
population. The population of subjects may be suffering from BRCA;
the at least one tumor-specific mutation comprises any combination
of mutations in Table 8 with an exemplary disease of "BRCA"; and at
least one of a set of 18 of the at least one tumor-specific
mutation will be found in 36.04% of subjects in the population. The
population of subjects may be suffering from COAD; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of "COAD"; and at least one of a
set of three of the at least one tumor-specific mutation will be
found in 27.14% of subjects in the population. The population of
subjects may be suffering from GBM; the at least one tumor-specific
mutation comprises any combination of mutations in Table 8 with an
exemplary disease of "GBM"; and at least one of a set of 14 of the
at least one tumor-specific mutation will be found in 34.36% of
subjects in the population. The population of subjects may be
suffering from HNSC; the at least one tumor-specific mutation
comprises any combination of mutations in Table 8 with an exemplary
disease of "HNSC"; and at least one of a set of 10 of the at least
one tumor-specific mutation will be found in 21.61% of subjects in
the population. The population of subjects may be suffering from
KIRC; the at least one tumor-specific mutation comprises any
combination of mutations in Table 8 with an exemplary disease of
"KIRC"; and at least one of a set of four of the at least one
tumor-specific mutation will be found in 6% of subjects in the
population. The population of subjects may be suffering from LAML;
the at least one tumor-specific mutation comprises any combination
of mutations in Table 8 with an exemplary disease of "LAML"; and at
least one of a set of 11 of the at least one tumor-specific
mutation will be found in 47.45% of subjects in the population. The
population of subjects may be suffering from LUAD; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of "LUAD"; and at least one of a
set of 11 of the at least one tumor-specific mutation will be found
in 33.42% of subjects in the population. The population of subjects
may be suffering from LUSC; the at least one tumor-specific
mutation comprises any combination of mutations in Table 8 with an
exemplary disease of "LUSC"; and at least one of a set of two of
the at least one tumor-specific mutation will be found in 7.87% of
subjects in the population. The population of subjects may be
suffering from OV; the at least one tumor-specific mutation
comprises any combination of mutations in Table 8 with an exemplary
disease of "OV"; and at least one of a set of ten of the at least
one tumor-specific mutation will be found in 22.78% of subjects in
the population. The population of subjects may be suffering from
READ; the at least one tumor-specific mutation comprises any
combination of mutations in Table 8 with an exemplary disease of
"READ"; and at least one of a set of two of the at least one
tumor-specific mutation will be found in 20.51% of subjects in the
population. The population of subjects may be suffering from SKCM;
the at least one tumor-specific mutation comprises any combination
of mutations in Table 8 with an exemplary disease of "SKCM"; and at
least one of a set 64 of the at least one tumor-specific mutation
will be found in 90.91% of subjects in the population. The
population of subjects may be suffering from UCEC; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of "UCEC"; and at least one of a
set of 30 of the at least one tumor-specific mutation will be found
in 67.74% of subjects in the population. The population of subjects
may be suffering from ACC; the at least one tumor-specific mutation
comprises any combination of mutations in Table 8 with an exemplary
disease of"ACC"; and at least one of a set of 161 of the at least
one tumor-specific mutation will be found in 50% of subjects in the
population. The population of subjects may be suffering from CESC;
the at least one tumor-specific mutation comprises any combination
of mutations in Table 8 with an exemplary disease of"CESC"; and at
least one of a set of four of the at least one tumor-specific
mutation will be found in 23.71% of subjects in the population. The
population of subjects may be suffering from CRC; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of"CRC"; and at least one of a
set of 15 of the at least one tumor-specific mutation will be found
in 56.65% of subjects in the population. The population of subjects
may be suffering from DLBCL; the at least one tumor-specific
mutation comprises any combination of mutations in Table 8 with an
exemplary disease of"DLBCL"; and at least one of a set of 2 of the
at least one tumor-specific mutation will be found in 13.79% of
subjects in the population. The population of subjects may be
suffering from KICH; the at least one tumor-specific mutation
comprises any combination of mutations in Table 8 with an exemplary
disease of"KICH"; and at least one of a set of 24 of the at least
one tumor-specific mutation will be found in 50% of subjects in the
population. The population of subjects may be suffering from KIRP;
the at least one tumor-specific mutation comprises any combination
of mutations in Table 8 with an exemplary disease of"KIRP"; and at
least one of a set of nine of the at least one tumor-specific
mutation will be found in 42.24% of subjects in the population. The
population of subjects may be suffering from LIHC; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of"LIHC"; and at least one of a
set of 2 of the at least one tumor-specific mutation will be found
in 6.57% of subjects in the population. The population of subjects
may be suffering from MM; the at least one tumor-specific mutation
comprises any combination of mutations in Table 8 with an exemplary
disease of"MM"; and at least one of a set of 6 of the at least one
tumor-specific mutation will be found in 23.9% of subjects in the
population. The population of subjects may be suffering from PRAD;
the at least one tumor-specific mutation comprises any combination
of mutations in Table 8 with an exemplary disease of"PRAD"; and at
least one of a set of 24 of the at least one tumor-specific
mutation will be found in 39.85% of subjects in the population. The
population of subjects may be suffering from STAD; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of"STAD"; and at least one of a
set of 150 of the at least one tumor-specific mutation will be
found in 48.79% of subjects in the population. The population of
subjects may be suffering from TGCT; the at least one
tumor-specific mutation comprises any combination of mutations in
Table 8 with an exemplary disease of"TGCT"; and at least one of a
set of 14 of the at least one tumor-specific mutation will be found
in 51.61% of subjects in the population. The population of subjects
may be suffering from THCA; the at least one tumor-specific
mutation comprises any combination of mutations in Table 8 with an
exemplary disease of"THCA"; and at least one of a set of five of
the at least one tumor-specific mutation will be found in 69.88% of
subjects in the population. The population of subjects may be
suffering from UCS; the at least one tumor-specific mutation
comprises any combination of mutations in Table 8 with an exemplary
disease of"UCS"; and at least one of a set of two of the at least
one tumor-specific mutation will be found in 16.07% of subjects in
the population. The population of subjects may be suffering from
PAAD; the at least one tumor-specific mutation comprises any
combination of mutations in Table 8 with an exemplary disease
of"PAAD"; and at least one of a set of 53 of the at least one
tumor-specific mutation will be found in 50% of subjects in the
population. The population of subjects may also be suffering from a
solid tumor. The solid tumor may be clear cell Renal Cell Carcinoma
(ccRCC), melanoma, sarcoma, or a cancer of the bladder, colon,
brain, breast, head and neck, endometrium, lung, ovary, pancreas or
prostate. The population of subjects may be suffering from a liquid
tumor. The liquid tumor may be Non-Hodgkin's lymphoma or
leukemia.
[0013] In another embodiment, the at least one tumor-specific
mutation has an incidence of at least 500 patients a year in the
population of subjects suffering from cancer, and wherein the at
least one mutation may be a mutation listed for the population in
Table 9. The at least one neoantigenic peptide may be at least one
peptide listed in Table 9.
[0014] In another embodiment, the population suffering from cancer
is being treated with a drug or therapy. The population suffering
from cancer may have been previously treated with, is currently
being treated with, or is selected to treated with ibrutinib,
erlotinib, imatinib, gefitinib, crizotinib, trastuzumab,
vemurafenib, RAF/MEK or antiestrogen therapy.
[0015] In another embodiment, the composition comprises at least
one neoantigenic peptide capable of eliciting an immune response
against a tumor present in at least 5%, 10%, 20%, 30%, 40%, 50%,
60%, 70%, 80%, 90%, 95% or 99% of subjects in a population of
subjects suffering from cancer.
[0016] In another embodiment, at least 5%, 10%, 20%, 30%, 40%, 50%,
60%, 70%, 80%, 90%, 95% or 99% of subjects in the population has at
least one tumor-specific mutation present in the composition; and
at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or
99% of subjects in the population has at least one HLA protein
which binds to a tumor-specific neoepitope present in the
composition.
[0017] In one embodiment, the tumor-specific mutations comprise
splice-variant mutations, point mutations, and/or frameshift
mutations. In another embodiment, the tumor-specific mutations
comprise drug resistance mutations. In one embodiment, the
neoantigenic peptides include not only the resulting mutated
neoantigen protein sequence, but a long peptide region surrounding
and including the mutation and includes all contiguous segments
within it (see Tables 1-4). In one embodiment, the tumor-specific
mutations are present in one or more genes encoding a protein
selected from the group consisting of Programmed Death-Ligand 1
(PD-L1), androgen receptor (AR), Bruton's Tyrosine Kinase (BTK),
Epidermal Growth Factor Receptor (EGFR), BCR-Abl, c-kit, PIK3CA,
HER2, EML4-ALK, KRAS, ALK, ROS1, AKT1, BRAF, MEK1, MEK2, NRAS,
RAC1, and ESR1. In one embodiment, the tumor-specific mutations are
present in one or more genes listed in any of the Tables presented
herein. In one embodiment, the at least one tumor-specific mutation
is derived from alternative splicing of PD-L1 or AR. In one
embodiment, the at least one tumor-specific mutation is derived
from splice variant sPD-L1, AR-V1 or AR-V7. In one embodiment, the
least one tumor-specific mutation is a drug resistance mutation
selected from the group consisting of BTK/C481S, EGFR/T790M,
BCR-Abl/T315I, BCR-Abl/Y253H, BCR-Abl/E255K, BCR-Abl/E255V,
c-kit/T670I, PIK3CA/E545K, PIK3CA/E542K, HER2/G776(YVMA),
HER2/E545K, EML4-ALK/G1269A, KRAS/G12V/D, ALK/L1196M, ALK/G1202R,
ALK/S1206Y, ALK/1151T(ins), ALK/F1174C, ROS1/G2032R, AKT1/E17K,
BRAF/V600E, MEK1/Q56P, MEK1/E203K, MEK1/C121S, MEK1/V60E,
MEK1/G128V, MEK1/V154I, MEK1/P124S, MEK1/P124L, NRAS/Q61K/L/R,
NRAS/T58I, MEK2/C125S, RAC1/P29S, ESR1/S463P, AR/V534E, AR/P535H,
AR/L536Q, AR/L536R, AR/Y537C, AR/Y537S, AR/Y537N, AR/D538G and
AR/F876L. In one embodiment, the drug resistance mutation is
induced by treatment with ibrutinib, erlotinib, imatinib,
gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or
antiestrogen therapy. In another embodiment, a subject has a drug
resistance mutation before treatment.
[0018] In another embodiment, the composition comprises at least 2,
3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20
neoantigenic peptides. The composition may include 15 to 20
neoantigenic peptides. The composition may include greater than
100, 200, or 300 neoantigenic peptides. Each neoantigenic peptide
may be from about 5 to about 50 amino acids in length.
[0019] In another embodiment, the pharmaceutical composition is an
immunogenic or vaccine composition. The pharmaceutical composition
may further comprise an immunomodulator or adjuvant. The
immunodulator or adjuvant may be selected from the group consisting
of poly-ICLC, 1018 ISS, aluminum salts, Amplivax, AS15, BCG,
CP-870,893, CpG7909, CyaA, cyclic di-nucleotides such as STING,
dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch,
ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryllipid A,
Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide
ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTel.RTM., vector
system, PLGA microparticles, resiquimod, SRL172, Virosomes and
other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan,
Pam3Cys, and Aquila's QS21 stimulon.
[0020] In another embodiment, the pharmaceutical composition
comprises one or more neoantigenic peptides as defined in Table 1,
2, 3 or 4.
[0021] In one embodiment, each tumor-specific neoepitope binds to
HLA-A, -B or -C or to HLADRB, HLADBM XXXXX with a K.sub.D of less
than 500 nM.
[0022] In another aspect, the present invention relates to a method
of treating or preventing a tumor in a subject in need thereof by
administering to the subject any pharmaceutical composition as
described herein.
[0023] In one embodiment, a method of treating or preventing a
tumor in a patient in need thereof is provided, comprising
administering to a patient a composition comprising at least one
neoantigenic peptide and a pharmaceutically acceptable carrier,
each at least one neoantigenic peptide comprising a tumor-specific
neoepitope capable of binding to an HLA protein in a subject, each
tumor-specific neoepitope comprising a tumor-specific mutation
present in a tumor, wherein the composition comprises at least one
neoantigenic peptide comprising a tumor-specific mutation present
in a tumor in at least 1% of subjects in a population of subjects
suffering from cancer; the composition comprises at least one
neoantigenic peptide comprising a tumor-specific neoepitope which
binds to an HLA protein present in at least 5% of subjects in the
population of subjects suffering from cancer; and the composition
comprises at least one neoantigenic peptide capable of eliciting an
immune response against a tumor present in at least 5% of the
subjects in the population of subjects suffering from cancer.
[0024] In one embodiment, the population of subjects is suffering
from adrenocortical carcinoma (ACC), bladder urothelial carcinoma
(BLCA), breast invasive carcinoma (BRCA), cervical squamous cell
carcinoma and endocervical adenocarcinoma (CESC), colon
adenocarcinoma (COAD), Chronic lymphocytic Leukaemia (CLL),
colorectal cancer (CRC), Diffuse large B-cell lymphoma (DLBCL),
glioblastoma multiforme (GBM), head and neck squamous cell
carcinoma (HNSC), kidney chromophobe (KICH), kidney renal clear
cell carcinoma (KIRC), kidney renal papillary cell carcinoma
(KIRP), acute myeloid leukemia (LAML), liver hepatocellular
carcinoma (LIHC), lung adenocarcinoma (LUAD), lung squamous cell
carcinoma (LUSC), multiple myeloma (MM), ovarian serous
cystadenocarcinoma (OV), pancreatic adenocarcinoma (PAAD), prostate
adenocarcinoma (PRAD), rectum adenocarcinoma (READ), skin cutaneous
melanoma (SKCM), stomach adenocarcinoma (STAD), testicular germ
cell tumors (TGCT), thyroid adenocarcinoma (THCA), uterine corpus
endometrioid carcinoma (UCEC), or uterine carcinosarcoma (UCS). In
one embodiment, the population of subjects is suffering from a
solid tumor. The solid tumor may be clear cell Renal Cell Carcinoma
(ccRCC), melanoma, sarcoma, or a cancer of the bladder, colon,
brain, breast, head and neck, endometrium, lung, ovary, pancreas or
prostate. In one embodiment, the population of subjects is
suffering from a liquid tumor. The liquid tumor may be
Non-Hodgkin's lymphoma or leukemia.
[0025] In one embodiment, the population suffering from cancer was
treated with, is being treated with, or is selected to treated with
ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab,
vemurafenib, RAF/MEK or antiestrogen therapy.
[0026] In one embodiment, the at least one neoantigenic peptide is
capable of eliciting an immune response against a tumor present in
at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or
99% of subjects in the population of subjects suffering from
cancer. In one embodiment, at least 5%, 10%, 20%, 30%, 40%, 50%,
60%, 70%, 80%, 90%, 95% or 99% of subjects in the population has at
least one tumor-specific mutation present in the composition and,
at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or
99% of subjects in the population has at least one HLA protein
which binds to a tumor-specific neoepitope present in the
composition.
[0027] In another embodiment, the tumor-specific mutations comprise
splice-variant mutations, point mutations, and/or frameshift
mutations. The tumor-specific mutations may be drug resistance
mutations. The tumor-specific mutations may be present in one or
more genes encoding a protein selected from the group consisting of
Programmed Death-Ligand 1 (PD-L1), androgen receptor (AR), Bruton's
Tyrosine Kinase (BTK), Epidermal Growth Factor Receptor (EGFR),
BCR-Abl, c-kit, PIK3CA, HER2, EML4-ALK, KRAS, ALK, ROS1, AKT1,
BRAF, MEK1, MEK2, NRAS, RAC1, and ESR1. The tumor-specific
mutations may be present in one or more genes listed in any of the
Tables. The at least one tumor-specific mutation may be derived
from alternative splicing of PD-L1 or AR. The at least one
tumor-specific mutation may be derived from splice variant sPD-L1,
AR-V1 or AR-V7.
[0028] In one embodiment, the at least one tumor-specific mutation
is a drug resistance mutation selected from the group consisting of
BTK/C481S, EGFR/T790M, BCR-Abl/T315I, BCR-Abl/Y253H, BCR-Abl/E255K,
BCR-Abl/E255V, c-kit/T670I, PIK3CA/E545K, PIK3CA/E542K,
HER2/G776(YVMA), HER2/E545K, EML4-ALK/G1269A, KRAS/G12V/D,
ALK/L1196M, ALK/G1202R, ALK/S1206Y, ALK/1151T(ins), ALK/F1174C,
ROS1/G2032R, AKT1/E17K, BRAF/V600E, MEK1/Q56P, MEK1/E203K,
MEK1/C121S, MEK1/V60E, MEK1/G128V, MEK1/V154I, MEK1/P124S,
MEK1/P124L, NRAS/Q61K/L/R, NRAS/T58I, MEK2/C125S, RAC1/P29S,
ESR1/S463P, AR/V534E, AR/P535H, AR/L536Q, AR/L536R, AR/Y537C,
AR/Y537S, AR/Y537N, AR/D538G and AR/F876L. The drug resistance
mutation may be induced by treatment with ibrutinib, erlotinib,
imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK
or antiestrogen therapy.
[0029] In another embodiment, the composition comprises at least 2,
3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20
neoantigenic peptides. In a preferred embodiment, the composition
comprises 15 to 20 neoantigenic peptides.
[0030] In another embodiment, each neoantigenic peptide is from
about 5 to about 50 amino acids in length.
[0031] In another embodiment, the composition is an immunogenic or
vaccine composition. For instance, the immunogenic or vaccine
composition may comprise an immunomodulator or adjuvant. The
immunodulator or adjuvant may be selected from the group consisting
of poly-ICLC, 1018 ISS, aluminum salts, Amplivax, AS15, BCG,
CP-870,893, CpG7909, CyaA, cyclic di-nucleotides such as STING,
dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch,
ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryllipid A,
Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide
ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTel.RTM., vector
system, PLGA microparticles, resiquimod, SRL172, Virosomes and
other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan,
Pam3Cys, and Aquila's QS21 stimulon.
[0032] In one embodiment, the composition comprises one or more
neoantigenic peptides as defined in Table 1, 2, 3 or 4.
[0033] In one embodiment, each tumor-specific neoepitope binds to
HLA-A, -B or -C or to HLADRB, HLADBM XXXXX with a K.sub.D of less
than 500 nM.
[0034] In another aspect, the present invention provides a method
of prophylactic cancer treatment comprising selecting a cancer drug
for a patient in need thereof, the drug selected from the group
consisting of ibrutinib, erlotinib, imatinib, gefitinib,
crizotinib, trastuzumab, vemurafenib, RAF/MEK and antiestrogen
therapy; and administering prophylactically to the subject, before
drug resistant mutations can be detected, a pharmaceutical
composition comprising neoantigenic peptides derived from drug
resistant mutations associated with the selected cancer drug.
[0035] The shared neoantigen immunogenic composition can be
administered via subcompositions, each containing a portion of the
neoantigens, and sub-compositions can be administered to different
places on the subject or patient; for instance, a composition
comprising 20 different neoantigens, can be administered in four
(4) subcompositions, each containing 5 of the 20 different
neoantigens, and the four (4) subcompositions can be administered
so as to endeavor to deliver each subcomposition to a separate set
of draining lymph nodes of the patient, e.g., to each of the arms
and legs (e.g., thigh or upper thigh or near buttocks or lower back
on each side of the patient) so as to endeavor to deliver fewer
neoantigens to each set of draining lymph nodes of the patient or
subject and thereby limit competition between neoantigens. Of
course, the number of locations and hence number of subcompositions
can vary, e.g., the skilled practitioner could consider
administration at or near the spleen to have a fifth point of
administration, and the skilled practitioner can vary the locations
such that only one, two or three are used (e.g., each arm and a
leg, each of legs and one arm, each of the legs and no arms, or
only both arms). The shared neoantigen immunogenic composition
administered at the aforementioned various intervals can be
different formulations, and the subcompositions administered at
different places on the subject or patient during a single
administration can be different compositions. For instance, a first
administration can be of a whole shared neoantigen immunogenic
composition and a next or later administration can be of a vector
(e.g., viral vector or plasmid) that has expression of antigen(s)
in vivo. Likewise, in the administration of different
subcompositions to different locations on the patient or subject,
some of the subcompositions can comprise a whole antigen and some
of the subcompositions can comprise a vector (e.g., viral vector or
plasmid) that has expression of antigen(s) in vivo. And some
compositions and subcompositions can comprise both vector(s) (e.g.,
viral vector or plasmid) that has/have expression of antigen(s) in
vivo and whole antigens. Some vectors (e.g., poxvirus) that have
expression of antigen(s) in vivo can have an immunostimulatory or
adjuvanting effect, and hence compositions or subcompositions that
contain such vectors can be self-adjuvanting. Also, by changing up
the nature of how the antigens are presented to the immune system,
the administrations can "prime" and then "boost" the immune system.
And in this text, when there is mention of a "vaccine" it is
intended that the invention comprehends immunogenic compositions,
and when there is mention of a patient or subject it is intended
that such an individual is a patient or subject in need of the
herein disclosed treatments, administrations, compositions, and
generally the subject invention.
[0036] Moreover, the invention applies to the use of any type of
expression vector, such as a viral expression vector, e.g.,
poxvirus (e.g., orthopoxvirus or avipoxvirus such as vaccinia
virus, including Modified Vaccinia Ankara or MVA, MVA-BN, NYVAC
according to WO-A-92/15672, fowlpox, e.g., TROVAX, canarypox, e.g.,
ALVAC (WO-A-95/27780 and WO-A-92/15672) pigeonpox, swinepox and the
like), adenovirus, AAV, herpesvirus, and lentivirus; or a plasmid
or DNA or nucleic acid molecule vector. Some vectors that are
cytoplasmic, such as poxvirus vectors, may be advantageous. However
adenovirus, AAV and lentivirus can also be advantageous to use in
the practice of the invention.
[0037] In a ready-for-use, especially reconstituted, shared
neoantigen immunogenic composition, the vector, e.g., viral vector,
is present in the quantities within the ambit of the skilled person
from this disclosure and the knowledge in the art (such as in
patent and scientific literature cited herein).
[0038] Whole antigen or vector, e.g., recombinant live vaccines may
exist in a freeze-dried form allowing their storage and are
reconstituted immediately before use in a solvent or excipient,
which can include an adjuvant as herein discussed.
[0039] The subject of the invention is therefore also a vaccination
or immunization set or kit comprising, packaged separately,
freeze-dried vaccine and a solution, advantageously including an
adjuvant compound as herein discussed for the reconstitution of the
freeze-dried vaccine.
[0040] The subject of the invention is also a method of vaccination
or immunization comprising or consisting essentially of or
consisting of administering, e.g., by the parenteral, preferably
subcutaneous, intramuscular or intradermal, route or by the mucosal
route a vaccine or immunogenic composition in accordance with the
invention at the rate of one or more administrations. Optionally
this method includes a preliminary step of reconstituting the
freeze-dried shared neoantigen immunogenic composition (e.g., if
lyophilized whole antigen or vector) in a solution, advantageously
also including an adjuvant.
[0041] In one embodiment, the shared neoantigen immunogenic
composition is administered at a dose of about 10 .mu.g to 1 mg per
70 kg individual as to each neoantigenic peptide. In another
embodiment, the shared neoantigen immunogenic composition is
administered at an average weekly dose level of about 10 .mu.g to
2000 .mu.g per 70 kg individual as to each neoantigenic peptide. In
another related embodiment, the administration is intravenous. In
one embodiment, the shared neoantigen immunogenic composition is
administered intravenously or subcutaneously.
[0042] In another embodiment, the method further comprises (a)
obtaining a sample of tumor tissue from each subject; (b) detecting
one or more of the tumor-specific mutations in the sample; and (c)
selecting a subject from the population of subjects for treatment
with the at least one neoantigenic peptides if at least one of the
tumor-specific mutations are detected in the sample from the
subject.
[0043] In another embodiment, the method further comprises (a)
determining HLA allotypes present in each subject; and (b)
selecting a subject from the population of subjects for treatment
with the at least one neoantigenic peptides if one or more HLA
allotypes present in the subject binds to one or more of the
tumor-specific neoepitopes present in the at least one neoantigenic
peptides.
[0044] Embodiments of the present invention relate to compositions
and methods using shared neoantigens, which (unlike shared native
(non-mutated) antigens derived from genes differentially expressed
in tumors) have desirable properties such as not being subject to
the immune-dampening effects of central tolerance and high tumor
specificity. This is because the neoantigens are expressed only in
tumor tissue, e.g. are generated by tumor-specific mutations or
splicing defects. Such splice variants or mutations may generate
immunogenic epitopes across a variety of HLA alleles, thus covering
a significant proportion of the population. Moreover, because these
mutations may be present in a significant proportion of subjects
suffering from cancer, the compositions described herein do not
require sequencing of whole genomes of subjects and may be used as
an "off-the-shelf" product to treat multiple subjects. For
instance, the method may simply involve detecting in a tumor sample
from the subject one or more of the specific mutations present in
the composition, and administering the composition to subjects in
which at least one mutation is present. This is in contrast to
methods using patient-specific neoantigen mixtures, which require
whole genome or whole exome sequencing of each subject and the
production of personalized treatment compositions.
[0045] Other embodiments relate to a combination therapy wherein
the methods of treatment using a shared neoantigen composition of
the present invention are used in concert with a current drug
regimen. The shared neoantigen composition may be administered
prophylactically. In one embodiment, a patient in need thereof is
treated with chemotherapy and/or a targeted therapy in combination
with a shared neoantigen immunogenic composition before a drug
resistance mutation can be detected. The shared neoantigen
immunogenic composition can be tailored to include neoantigen
peptides specific to the resistance mutations associated with a
chosen therapy. In another embodiment, the shared neoantigen
composition is administered before the subject is treated with a
chemotherapy and/or a targeted therapy, to generate an immune
response to cells harboring a drug resistance mutation before such
cells develop. The administering can be serially or sequentially or
at substantially the same time or substantially simultaneously. For
example, the administering of the shared neoantigen immunogenic
composition and the administering of a cancer therapy can be at
about the same time or substantially simultaneously. Alternatively,
the administering of the shared neoantigen immunogenic composition
can be on one time schedule, e.g., weekly, biweekly, every three
weeks, monthly, bimonthly, every quarter year (every three months),
every third of a year (every four months), every five months, twice
yearly (every six months), every seven months, every eight months,
every nine months, every ten months, every eleven months, annually
or the like, and the administering of the cancer therapy can be on
a different schedule that is typical for the therapy such that the
subject or patient has two different treatment schedules running
concomitantly and the administering of the shared neoantigen
immunogenic composition and the administering of the cancer therapy
can be sequentially or serially. In preferred embodiments the
subject may be treated with ibrutinib, erlotinib, imatinib,
gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or
antiestrogen therapy.
[0046] In another aspect the present invention provides a
diagnostic method for early detection and tracking of cancer
progression by determining the presence of at least one
neoantigenic peptide of the present invention in a patient sample.
The patient sample may be derived from blood, sputum, saliva,
urine, tumor tissue, lymphatic fluid, semen or feces.
[0047] In one embodiment, the diagnostic method is used before
administering the shared neoantigen composition as described
herein. The diagnostic method may include comparing the amount of
shared neoantigen mutations in a series of at least two samples
taken during treatment with a cancer therapy and/or shared
neoantigen composition. Not being bound by a theory, an increase or
decrease in shared neoantigen mutations can be used to determine
treatment efficacy.
[0048] In one embodiment, the mutated genes can be detected using
PCR based methods or sequencing. Reverse transcription PCR (RT-PCR)
can be used to detect mutations in transcribed neoantigen genes.
Additionally, any sequencing technique can be used to determine the
presence of a mutation. In a preferred embodiment, pyrosequencing
is used. The present invention also provides for a kit that
includes primers that are specific to sequences encompassing the
neoantigen mutations.
[0049] In another embodiment the mutated genes are detected by
immunological detection methods. Antibodies specific to the shared
neoantigen mutations can be used to detect the muations. The
antibodies may be bound to an array. The array may include
antibodies to detect more than one of the shared neoantigen
mutations of the present invention. The antibodies can be
configured for use in an ELISA assay. Therefore, a composition or
kit may be provided that includes antibodies specifically
recognizing the shared neoantigens of the present invention.
[0050] In another aspect the present invention provides a method of
treating or preventing a tumor in a population of subjects in need
thereof, comprising administering to a subject an agent comprising
an extracellular ligand-binding domain recognizing a tumor-specific
neoepitope comprising a tumor-specific mutation having an incidence
of at least 1% of subjects in the population. The agent may be an
antibody, antibody fragment, antibody drug conjugate, aptamer, CAR,
or T cell receptor. The antibody or antibody fragment may be
humanized, fully humanized, or chimeric. The antibody fragment may
be a nanobody, Fab, Fab', (Fab')2, Fv, ScFv, diabody, triabody,
tetrabody, Bis-scFv, minibody, Fab2, or Fab3 fragment. The
tumor-specific mutation may be a mutation listed for any population
in Table 9. The tumor-specific mutation may be within a gene
containing an extracellular domain. The tumor-specific mutation may
be FGFR3 S249C, ERBB3 V104M, EGFR L858R, MUC4 H4205Q, PDGFRA
R483fs, TMEM52 23_26LLPL>L, or PODXL 28_30PSP>P. The
tumor-specific mutation may be within the extracellular domain. The
tumor-specific mutation comprises FGFR3 S249C or ERBB3 V104M. Not
being bound by a theory, the presence of a neoepitope in a protein
with an extracellular domain allows the neoepitope to be presented
on the surface of a cell. Not being bound by a theory, the presence
of a neoepitope in the extracellular domain allows the neoepitope
to be presented on the surface of a cell.
[0051] The invention is further described by the following numbered
paragraphs:
[0052] 1. An isolated neoantigenic peptide comprising a
tumor-specific neoepitope defined in Tables 1-9, wherein the
isolated neoantigenic peptide is not a native polypeptide.
[0053] 2. An isolated neoantigenic peptide 100 amino acids or less
in length which comprises a tumor-specific neoepitope defined in
Tables 1-9.
[0054] 3. The isolated neoantigenic peptide of paragraph 1 or 2,
which is between about 5 to about 50 amino acids in length.
[0055] 4. The isolated neoantigenic peptide of any of paragraphs
1-3, which is between about 15 to about 35 amino acids in
length.
[0056] 5. The isolated neoantigenic peptide of paragraph 4, which
is about 15 amino acids or less in length.
[0057] 6. The isolated neoantigenic peptide of paragraph 5, which
is between about 8 and about 11 amino acids in length.
[0058] 7. The isolated neoantigenic peptide of paragraph 6, which
is 9 or 10 amino acids in length.
[0059] 8. The isolated neoantigenic peptide of any of paragraphs
1-7, which binds major histocompatibility complex (MHC) class
I.
[0060] 9. The isolated neoantigenic peptide of paragraph 8, which
binds MHC class I with a binding affinity of less than about 500
nM.
[0061] 10. The isolated neoantigenic peptide of any of paragraphs
1-3, which is about 30 amino acids or less in length.
[0062] 11. The isolated neoantigenic peptide of paragraph 10, which
is between about 6 and about 25 amino acids in length.
[0063] 12. The isolated neoantigenic peptide of paragraph 11, which
is between about 15 and about 24 amino acids in length.
[0064] 13. The isolated neoantigenic peptide of paragraph 11, which
is between about 9 and about 15 amino acids in length.
[0065] 14. The isolated neoantigenic peptide of any of paragraphs
1-3 and 10-13, which binds MHC class II.
[0066] 15. The isolated neoantigenic peptide of paragraph 14, which
binds MHC class II with a binding affinity of less than about 1000
nM.
[0067] 16. The isolated neoantigenic peptide of any of paragraphs
1-15, further comprising flanking amino acids.
[0068] 17. The isolated neoantigenic peptide of paragraph 16,
wherein the flanking amino acids are not native flanking amino
acids.
[0069] 18. The isolated neoantigenic peptide of any of paragraphs
1-17, which is linked to at least a second neoantigenic
peptide.
[0070] 19. The isolated neoantigenic peptide of paragraph 18,
wherein peptides are linked using a poly-glycine or poly-serine
linker.
[0071] 20. The isolated neoantigenic peptide of paragraph 18 or 19,
wherein the second neoantigenic peptide binds MHC class I or class
II with a binding affinity of less than about 1000 nM.
[0072] 21. The isolated neoantigenic peptide of paragraph 20,
wherein the second neoantigenic peptide binds MHC class I or class
II with a binding affinity of less than about 500 nM.
[0073] 22. The isolated neoantigenic peptide of paragraph 20 or 21,
wherein both of the neoepitopes bind to human leukocyte antigen
(HLA)-A, -B, -C, -DP, -DQ, or -DR.
[0074] 23. The isolated neoantigenic peptide of any of paragraphs
20-22, wherein the isolated neoantigenic peptide and the second
neoantigenic peptide binds a class I HLA or the isolated
neoantigenic peptide and the second neoantigenic peptide binds a
class II HLA.
[0075] 24. The isolated neoantigenic peptide of any of paragraphs
20-22, wherein the isolated neoantigenic peptide binds a class II
HLA and the second neoantigenic peptide binds a class I HLA or the
isolated neoantigenic peptide binds a class I HLA and the second
neoantigenic peptide binds a class II HLA.
[0076] 25. The isolated neoantigenic peptide of any of paragraphs
1-24, further comprising modifications which increase in vivo
half-life, cellular targeting, antigen uptake, antigen processing,
MHC affinity, MHC stability, or antigen presentation.
[0077] 26. The isolated neoantigenic peptide of paragraph 25,
wherein the modification is conjugation to a carrier protein,
conjugation to a ligand, conjugation to an antibody, PEGylation,
polysialylation HESylation, recombinant PEG mimetics, Fc fusion,
albumin fusion, nanoparticle attachment, nanoparticulate
encapsulation, cholesterol fusion, iron fusion, acylation,
amidation, glycosylation, side chain oxidation, phosphorylation,
biotinylation, the addition of a surface active material, the
addition of amino acid mimetics, or the addition of unnatural amino
acids.
[0078] 27. The isolated neoantigenic peptide of paragraph 25,
wherein the cells that are targeted are antigen presenting
cells.
[0079] 28. The isolated neoantigenic peptide of paragraph 27,
wherein the antigen presenting cells are dendritic cells.
[0080] 29. The isolated neoantigenic peptide of paragraph 29,
wherein the dendritic cells are targeted using the CD141, DEC205,
or XCR1 marker.
[0081] 30. A pharmaceutical composition comprising at least one
neoantigenic peptide and a pharmaceutically acceptable carrier,
each at least one neoantigenic peptide comprising a tumor-specific
neoepitope capable of binding to an HLA protein in a subject, each
tumor-specific neoepitope comprising a tumor-specific mutation
present in a tumor, wherein: [0082] (a) the composition comprises
at least one neoantigenic peptide comprising a tumor-specific
mutation present in a tumor in at least 1% of subjects in a
population of subjects suffering from cancer; [0083] (b) the
composition comprises at least one neoantigenic peptide comprising
a tumor-specific neoepitope which binds to an HLA protein present
in at least 5% of subjects in the population of subjects suffering
from cancer; or
[0084] (c) the composition comprises at least one neoantigenic
peptide capable of eliciting an immune response against a tumor
present in at least 5% of the subjects in the population of
subjects suffering from cancer.
[0085] 31. The pharmaceutical composition of paragraph 30, wherein
the population of subjects is suffering from adrenocortical
carcinoma (ACC), bladder urothelial carcinoma (BLCA), breast
invasive carcinoma (BRCA), cervical squamous cell carcinoma and
endocervical adenocarcinoma (CESC), colon adenocarcinoma (COAD),
Chronic lymphocytic Leukaemia (CLL), colorectal cancer (CRC),
Diffuse large B-cell lymphoma (DLBCL), glioblastoma multiforme
(GBM), head and neck squamous cell carcinoma (HNSC), kidney
chromophobe (KICH), kidney renal clear cell carcinoma (KIRC),
kidney renal papillary cell carcinoma (KIRP), acute myeloid
leukemia (LAML), liver hepatocellular carcinoma (LIHC), lung
adenocarcinoma (LUAD), lung squamous cell carcinoma (LUSC),
multiple myeloma (MM), ovarian serous cystadenocarcinoma (OV),
pancreatic adenocarcinoma (PAAD), prostate adenocarcinoma (PRAD),
rectum adenocarcinoma (READ), skin cutaneous melanoma (SKCM),
stomach adenocarcinoma (STAD), testicular germ cell tumors (TGCT),
thyroid adenocarcinoma (THCA), uterine corpus endometrioid
carcinoma (UCEC), or uterine carcinosarcoma (UCS).
[0086] 32. The pharmaceutical composition of paragraph 30 or 31,
wherein the population suffering from cancer was treated with, is
being treated with, or is selected to be treated with a cancer
therapeutic, optionally ibrutinib, erlotinib, imatinib, gefitinib,
crizotinib, trastuzumab, vemurafenib, RAF/MEK inhibitor or
antiestrogen therapy.
[0087] 33. The pharmaceutical composition of any of paragraphs
30-33, wherein the tumor-specific mutations comprise splice-variant
mutations, point mutations, and/or frameshift mutations.
[0088] 34. The pharmaceutical composition of any of paragraphs
30-33, wherein the at least one neoantigenic peptide comprises at
least one neoantigenic peptide derived from a long peptide region
flanking and including the tumor specific mutation, and wherein all
contiguous segments within the long peptide are included.
[0089] 35. The pharmaceutical composition of any of paragraphs
30-34, wherein the tumor-specific mutations are present in one or
more genes listed in Tables 1-9.
[0090] 36. The pharmaceutical composition of any of paragraphs
30-35, wherein the composition comprises at least one neoantigenic
peptide as defined in any of Tables 1-9.
[0091] 37. The pharmaceutical composition of any of paragraphs
30-36, wherein the tumor-specific mutations are present in one or
more genes encoding a protein selected from the group consisting of
Programmed Death-Ligand 1 (PD-L1), androgen receptor (AR), Bruton's
Tyrosine Kinase (BTK), Epidermal Growth Factor Receptor (EGFR),
BCR-Abl, c-kit, PIK3CA, HER2, EML4-ALK, KRAS, ALK, ROS1, AKT1,
BRAF, MEK1, MEK2, NRAS, RAC1, and ESR1.
[0092] 38. The pharmaceutical composition of paragraph 37, wherein
at least one tumor-specific mutation is derived from alternative
splicing of PD-L1 or AR.
[0093] 39. The pharmaceutical composition of paragraph 38, wherein
at least one tumor-specific mutation is derived from splice variant
sPD-L1, AR-V1 or AR-V7.
[0094] 40. The pharmaceutical composition of any of paragraphs
30-39, wherein the tumor-specific mutations comprise drug
resistance mutations.
[0095] 41. The pharmaceutical composition of paragraph 40, wherein
at least one tumor-specific mutation is a drug resistance mutation
selected from the group consisting of BTK/C481S, EGFR/T790M,
BCR-Abl/T315I, BCR-Abl/Y253H, BCR-Abl/E255K, BCR-Abl/E255V,
c-kit/T670I, PIK3CA/E545K, PIK3CA/E542K, HER2/G776(YVMA),
HER2/E545K, EML4-ALK/G1269A, KRAS/G12V/D, ALK/L1196M, ALK/G1202R,
ALK/S1206Y, ALK/1151T(ins), ALK/F1174C, ROS1/G2032R, AKT1/E17K,
BRAF/V600E, MEK1/Q56P, MEK1/E203K, MEK1/C121S, MEK1/V60E,
MEK1/G128V, MEK1N154I, MEK1/P124S, MEK1/P124L, NRAS/Q61K/L/R,
NRAS/T58I, MEK2/C125S, RAC1/P29S, ESR1/S463P, AR/V534E, AR/P535H,
AR/L536Q, AR/L536R, AR/Y537C, AR/Y537S, AR/Y537N, AR/D538G and
AR/F876L.
[0096] 42. The pharmaceutical composition of any of paragraphs
30-41, wherein the at least one tumor-specific mutation has an
incidence of at least 500 patients a year in the population of
subjects suffering from cancer, and wherein the at least one
mutation comprises a mutation listed for the population in Table
9.
[0097] 43. The pharmaceutical composition of paragraph 42, wherein
the at least one neoantigenic peptide comprises at least one
peptide listed in Table 9.
[0098] 44. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0099] (a) the population of subjects is suffering
from CLL; and [0100] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of SF3B1:p.K700E, MYD88:p.L273P, NOTCH1:p.P2514fs,
ABCA11P:p.E901D, AHNAK:p.D3823E, ZNF814:p.E348D, AHNAK:p.V1220I,
AHNAK:p.H1203N, ANKRD30A:p.A232V, APOOL:p.I138L, EGR2:p.H397N,
MKI67:p.H2213D, NRAS:p.Q61R, PLIN4:p.M691V, XPO1:p.E571K,
ZCRB1:p.L76F, ZNF700:p.N652H, ZNF700:p.Q654R, ZNF844:p.D458H,
AHNAK:p.A4046V, ANKRD36:p.P337R, C1orf170:p.T203I, CAST:p.D639E,
EGR2:p.E369K, GPR123:p.L630P, IKZF3:p.L162R, MUC4:p.P4224R,
OR9Q1:p.M34L, PKD2:p.Y486F, PRAMEF11:p.R104Q, SYNE:p.I681F,
TP53:p.R248Q, TP53:p.R248W, TRPV2:p.L627del, ZNF254:p.S498A,
ZNF732:p.A459T, ZNF749:p.E530Q, ZNF845:p.M423I, ABCA11P:p.G900E,
ACRC:p.E243D, ACRC:p.A244V, ACSL3:p.T188S, ADAMTS2:p.D948N,
AGAP6:p.S127I, AHNAK:p.A2114G, ANKRD36:p.D1014Y, ARID3A:p.G550fs,
ARID4A:p.D1154E, ATP2B4:p.R183H, ATRNL1:p.L1244F, BNC1:p.Y937N,
BRAF:p.K601N, BTLA:p.Q86K, C14orf177:p.G90V, C2orf44:p.N456K,
C3orf15:p.R552Q, CACNA2D1:p.Y376N, CALD1:p.E340K, CCDC15:p.P488H,
CCDC79:p.N440T, CCNB3:p.A932T, CD109:p.L470Q, CD209:p.Q189L,
CKAP2:p.*684K, CMA1:p.I81K, CMIP:p.A230T, CNTNAP4:p.I12F,
CRYM:p.*315K, DICER1:p.E1705K, DPCR1:p.L716P, EIF3A:p.M1093L,
EIF4G3:p.R8H, ETFDH:p.I281F, EWSR1:p.Y656C, F5:p.L1332P,
F5:p.L1253F, FAM50A:p.H317R, FBXL13:p.S102R, FBXW7:p.R465H,
FHL1:p.D184E, FILIP1:p.I522K, FRG1B:p.Q39K, GNB1:p.I80T,
GPR110:p.R443G, GPR98:p.Y6152F, HDGFL1:p.188_189insA,
IGF2BP2:p.T186S, IL1R2:p.L364fs, KIAA1109:p.L4680P, KRAS:p.G13D,
KRTAP19-1:p.G61S, MAF:p.G53fs, MAGEC1:p.L609H, MAP2K1:p.K57N,
MED12:p.L36R, MED12:p.G44S, METAP2:p.Y137N, METTL9:p.Y57F,
MGP:p.V15L, MKI67:p.R2222K, MUC16:p.T11005I, MUC4:p.S3941N,
MUC4:p.S3941G, MUC4:p.V3091L, MUC4:p.S2951Y, MUC4:p.A2841S,
MUC4:p.S2760A, MUC4:p.T2335M, MUC4:p.T1627K, MUC4:p.T1547S,
MUC4:p.H1133Q, MYD88:p.M240T, NEDD4L:p.P194del, NEFH:p.S704T,
NRG4:p.G21fs, OR2A25:p.S105C, OR4C16:p.Y63F, OR4N4:p.L150fs,
PABPC1:p.K254fs, PIWIL1:p.P372fs, PLCD3:p.E499fs, PLEKHB1:p.S146P,
PPIL4:p.S382R, PRDM4:p.*802K, PRG4:p.N675H, PRKAB1:p.P104H,
R3HDM2:p.S592G, R3HDM2:p.S588N, R3HDM2:p.R206W, RPS2:p.R200G,
RPTN:p.G364S, SF3B1:p.K666E, SF3B1:p.N626Y, SF3B1:p.Y623C,
SIX3:p.I27L, SLC39A7:p.L456fs, SLC6A9:p.R94K, TFG:p.A382V,
TGOLN2:p.K83R, TGOLN2:p.T80S, TLR2:p.D327V, TNKS2:p.T619fs,
TP53:p.R273H, TP53:p.C242F, TP53:p.R175H, TWISTNB:p.H306Q,
UBXN7:p.A276V, WDR78:p.N110K, XIRP2:p.V3008E, ZNF382:p.H186Q,
ZNF578:p.R306H, ZNF578:p.G311S, ZNF578:p.H334R, ZNF700:p.S649C,
ZNF705A:p.D298N, ZNF836:p.K608Q, and ZNF836:p1571N; and
[0101] 45. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0102] (a) the population of subjects is suffering
from BLCA; and [0103] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of PIK3CA:p.E545K, FGFR3:p.S249C, TP53:p.R248Q,
PIK3CA:p.E542K, RXRA:p.S427F, ZNF814:p.D404E, FBXW7:p.R505G,
NOTCH2:p.P6fs, TP53:p.E285K, ANKRD30A:p.A353P, C3orf70:p.S6L,
EFCAB6:p.R379K, ERCC2:p.N238S, FAM47C:p.Q225E, FOXQ1:p.S135L,
HLA-A:p.Q78R, MUC4:p.H4205Q, OTUD4:p.T909I, SLAMF1:p.S277fs,
SPRED3:p.S128del, TMCO2:p.S15fs, TP53:p.R280T, TP53:p.E271K,
TP53:p.A159V, ZNF706:p.I8N, ZNF706:p.R3P, ACACB:p.E2318Q,
ACPP:p.E321K, ACRC:p.A264V, ADAMTS2:p.23_24insL, AFF3:p.E919K,
AHNAK:p.S4150F, AHNAK:p.D2889H, AHNAK:p.V1940A, ALX4:p.R126Q,
ANKRD12:p.E627K, ANKRD32:p.T999N, ARID1A:p.S614L,
ASXL2:p.117_118SS>S, ATP12A:p.R858C, ATP9A:p.R519Q,
BCAS3:p.T214M, BPI:p.M2551, CACNG8:p.V146G, CAMSAP1:p.T466fs,
CDC27:p.I91fs, CDKN1A:p.E44fs, CEP192:p.S2058L, CGB8:p.T18A,
CHRNA3:p.L23del, CHST4:p.D352N, CLIP1:p.S1018fs, COX6A1:p.S8L,
CREBBP:p.D1435H, CRIPAK:p.M48fs, CSPGS:p.D119N, CUL1:p.E485K,
DLC1:p.S741T, DLL3:p.D318H, DOPEY2:p.E1196K, ECM1:p.E266K,
EEF1A2:p.Y418S, EEF2K:p.E673K, EMILIN1:p.R27G, ERBB2:p.S310F,
ERBB3:p.M91I, ERBB3:p.V104L, ERBB3:p.D297Y, ERCC2:p.Y14C,
FAM155A:p.Q86del, FAM43B:p.E272del, FASTKD3:p.Q625E, FBW7:p.S546L,
FGFR3:p.R248C, FGFR3:p.G380R, FGFRL1:p.H479fs, GBE1:p.M587I,
GIMAP1-GIMAP5:p.S311C, GNA13:p.R200G, H1FOO:p.A214fs,
HEATR7B2:p.E1109K, HIST1H1D:p.I81M, HRAS:p.G12D, HRCT1:p.H92P,
ILF3:p.E484K, KCNK2:p.S6W, KIAA0907:p.Q446P, KIF23:p.E350K,
KLF5:p.S118L, KLHL15:p.D185G, LAMA4:p.E639K, LILRA1:p.H410Y,
LILRB1:p.L479del, LLGL2:p.P955fs, LPIN1:p.5974L, LRRC16A:p.D227N,
LRTM2:p.S139L, LURAP1L:p.55_56insGGG, MAGEC1:p.P553del,
MCL1:p.E171del, MN1:p.S472L, MUC7:p.A191V, MVP:p.E412K,
NBPF10:p.E3455K, NFE2L2:p.E79K, NFE2L2:p.R34G, NOS1AP:p.Q306del,
OR2T35:p.V319fs, OR4N2:p.L150fs, PABPC3:p.K333fs, PAX3:p.S197L,
PBX2:p.E70K, PBXIP1:p.H729del, PCDP1:p.E537K, PEX1:p.I370fs,
PHLDA3:p.E82K, PLEKHM2:p.S459L, PLVAP:p.A321V, POLR3B:p.L372F,
POTEC:p.R477Q, PPL:p.H326Y, PPP1R15A:p.E196K, PRDM16:p.E271Q,
PRIC285:p.E1289Q, PRMT8:p.S31P, PUF60:p.S396L, RAB11FIP4:p.S596L,
RADS 1C:p.D167N, RAD51C:p.Y224H, RALGPS1:p.R381Q, RARS2:p.R6C,
RBM26:p.P644A, RERE:p.K176N, RXRA:p.S427Y, SERPINA12:p.R211G,
SF3B1:p.E902K, SLC6A9:p.R243W, SLC9A5:p.L447F, SPESP1:p.F121L,
SRPRB:p.G14S, SYN2:p.A34del, SYTL2:p.I440M, TAB3:p.R211T,
TAF1B:p.R292C, TAOK2:p.L981del, TAS1R3:p.E525K, TAS2R9:p.E163Q,
TBC1D1:p.S71F, TBC1D2B:p.R920Q, TFPI2:p.R222C, TM6SF1:p.S15W,
TMEM131:p.K640fs, TMEM19:p.G331fs, TP53:p.R273C, TP53:p.R248W,
TP53:p.R175H, TP53:p.K132N, TRAM1:p.E41Q, TSKS:p.E513K,
TTN:p.C20935G, UBOX5:p.S417L, UGP2:p.D262H, VGF:p.E433K,
XAB2:p.E782K, XYLB:p.S87F, ZC3H4:p.E798K, ZNF208:p.K852E,
ZNF208:p.I647S, ZNF626:p.G198E, ZNF749:p.Q457E, ZNF761:p.H373R,
ZNF799:p.T43A, ZNF799:p.W41G, ZNF799:p.E589G, ZNF844:p.P503R,
ZNF845:p.M423T, ZNF845:p.T479M, ZNF860:p.H464R, ZNF878:p.S181R,
ZNF91:p.R333H, and ZNF91:p.H305R.
[0104] 46. The pharmaceutical composition of any of paragraphs
30-43, wherein: [0105] (a) the population of subjects is suffering
from BRCA; and [0106] (b) the at least one tumor-specific mutation
comprises any combination of frameshift mutations selected from the
group consisting of GATA3:p.L328fs, GATA3:p.N334fs, GATA3:p.L344fs,
GATA3:p.H400fs, GATA3:p.S408fs, GATA3:p.S430fs, GATA3:p.H434fs,
GATA3:p.H435fs, and GATA3:p.S408fs.
[0107] 47. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0108] (a) the population of subjects is suffering
from BRCA; and [0109] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of PIK3CA:p.H1047R, PIK3CA:p.E545K, PIK3CA:p.E542K,
AKT1:p.E17K, TP53:p.R175H, PIK3CA:p.N345K, PIK3CA:p.H1047L,
SF3B1:p.K700E, GATA3:p.S408fs, PIK3CA:p.E726K, TP53:p.Y220C,
TP53:p.H193R, PIK3CA:p.Q546R, TP53:p.R273C, TP53:p.R248W,
TP53:p.R273H, TP53:p.I195T, TP53:p.H179R, FGFR2:p.N549K,
NUP93:p.E14K, PIK3CA:p.C420R, PIK3CA:p.E453K, PIK3CA:p.Q546K,
TP53:p.V216M, TP53:p.C176F, CDH1:p.E243K, ERBB2:p.L755S,
KRAS:p.G12V, PIK3CA:p.E545A, TBL1XR1:p.I141fs, TP53:p.G266E,
TP53:p.R248Q, TP53:p.Y163C, TP53:p.C141Y, TP53:p.G108fs,
ACPP:p.R43W, AKT2:p.I289M, ARHGAP9:p.R137C, C9orf174:p.R136W,
CDC42BPA:p.P675T, COL12A1:p.S395L, CRISPLD1:p.R222W,
CT47B1:p.234_243EKLTEEATEE>E, CYP1A2:p.V483M, DAB2IP:p.E161K,
DGKB:p.S13L, DMD:p.K1772N, DPEP1:p.V11L, ERBB2:p.S310F,
ERBB2:p.D769Y, ERBB3:p.E928G, ESYT1:p.R816W, FAM179A:p.A831T,
FAM58BP:p.A70T, FMN2:p.S751F, GALNTL6:p.K567del, GATA3:p.L328fs,
GATA3:p.N334fs, GATA3:p.L344fs, GATA3:p.H400fs, GATA3:p.S408fs,
GATA3:p.S430fs, GATA3:p.H434fs, GATA3:p.H435fs, GDAP1:p.T307A,
GRB14:p.A300T, GUCY2C:p.G549C, IL17B:p.R34W, KCNB2:p.R231H,
KIF1B:p.R1320W, KIF26B:p.V1113M, KLF4:p.K434Q, LY9:p.I69L,
MAP2K4:p.S184L, MAP2K4:p.S251I, MAP2K4:p.T261fs, MAP3K1:p.L318fs,
MAP3K1:p.I761fs, MAP3K1:p.V1346del, MAP3K1:p.L1384fs,
MAPK13:p.E315K, MAPK4:p.V100M, MARCH5:p.R170C, MBP:p.E120K,
MEFV:p.R377H, METTL15:p.Q53E, MS4A4A:p.V99M, MUC17:p.R4415H,
MYH6:p.T847M, MYOSB:p.A405V, NARS2:p.P240R, NLGN4X:p.D382N,
NLRC4:p.R288W, OR13G1:p.R258H, OR2AK2:p.V45I, OTOF:p.T388M,
PACSIN2:p.Q331H, PALM2-AKAP2:p.A299T, PCDH19:p.R286C,
PCDHGC5:p.D664N, PIK3CA:p.R88Q, PIK3CA:p.E110del, PIK3CA:p.K111del,
PIK3CA:p.PVPHGLEDL447del, PIK3CA:p.L455fs, PIK3CA:p.M1004I,
PIK3CA:p.M1043I, PIK3CA:p.N1044Y, PIK3R1:p.KPDL567del,
PREX2:p.R363Q, PRRX1:p.A196V, PTEN:p.V317fs, RGSL1:p.V222I,
RUNX1:p.R142fs, RUNX1:p.D96fs, SCN2A:p.R36K, SLC25A32:p.Q83E,
SLC25A45:p.G106C, STRA6:p.Q68R, STX6:p.H153D, TBX3:p.H187Y,
TFPT:p.S252C, TINAG:p.R332W, TMEM71:p.R63Q, TP53:p.E286K,
TP53:p.R282W, TP53:p.V272M, TP53:p.S241fs, TP53:p.C238fs,
TP53:p.C238F, TP53:p.C238Y, TP53:p.Y234C, TP53:p.Y220S,
TP53:p.R209fs, TP53:p.G199V, TP53:p.L194R, TP53:p.H193L,
TP53:p.H193Y, TP53:p.V173L, TP53:p.V173M, TP53:p.K132N,
TP53:p.R110fs, TUBD1:p.A200V, VLDLR:p.R231H, VWA3A:p.V955I,
VWF:p.K1720N, XPO1:p.E571K, and ZNF268:p.F901del.
[0110] 48. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0111] (a) the population of subjects is suffering
from COAD; and [0112] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting ofKRAS:p.G12D, BRAF:p.V600E, KRAS:p.G12V,
ACVR2A:p.K435fs, GRB14:p.KKK295del, SEC63:p.L532fs,
TGFBR2:p.E125fs, ATR:p.K771fs, ICAl:p.N204fs, KRAS:p.G12C,
TP53:p.R175H, ABCA8:p.R842Q, ACTL7B:p.R354H, ACVR2A:p.K435fs,
AIM2:p.K340fs, ALG2:p.S302Y, ANKIB1:p.K144fs, ARSG:p.V131I,
ATP10D:p.R311H, AXIN2:p.W663fs, C5orf30:p.D4N, CACNG3:p.V134I,
CASP5:p.K78fs, CC2D2A:p.R1284C, CDH10:p.E349K, DNMT1:p.E432K,
DOCK2:p.G170R, DOCKS:p.E177K, EGR2:p.R390H, ERBB3:p.V104M,
FAM135B:p.R884H, FBXW7:p.R505C, FBXW7:p.R465H, FHDC1:p.R254W,
FOXL1:p.N89K, HCN4:p.R525H, HLA-DMA:p.E84K, HTR3B:p.R236C,
ITGA4:p.T673M, KIF18A:p.R17C, KIF20B:p.E991K, KLHL5:p.R326C,
KRAS:p.A146T, KRAS:p.G13D, LPHN3:p.R1183Q, MAP2K4:p.R287H,
MAPK8IP1:p.L217fs, MFSD5:p.R280Q, MUC16:p.R8606H, MYO6:p.D1180N,
NAA25:p.S807Y, NBPF14:p.V44L, NRAS:p.Q61K, NRAS:p.G13R,
PAX3:p.T424M, PGAM1:p.R240H, PHF3:p.R1410I, PIK3CA:p.R88Q,
PIK3CA:p.E545K, PIK3CA:p.H1047R, PLXNA3:p.V14fs, POSTN:p.R508C,
PTPRU:p.D1434N, PYGO2:p.Q150fs, RBBP7:p.E274K, SFPQ:p.R611Q,
SGSM1:p.F1117L, SLC25A40:p.R96Q, SLC8A1:p.R431H, SLITRK3:p.S298L,
SPATA22:p.S150L, SUN3:p.E128K, TGFBR1:p.S241L, TP53:p.R273H,
TP53:p.R273C, TP53:p.R248W, TRPVS:p.R492H, USP40:p.S851L,
VPS13C:p.D1359Y, ZBTB24:p.L607I, ZNF434:p.R306C, ZNF443:p.R301I,
ZNF484:p.R138C, and ZNF770:p.S441P.
[0113] 49. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0114] (a) the population of subjects is suffering
from GBM; and [0115] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of HSD17B7P2:p.N175S, IDH1:p.R132H, EGFR:p.A289V,
EGFR:p.G598V, WASH3P:p.G175S, ZNF814:p.D404E, RPSA:p.Q111E,
NBPF10:p.E3455K, TP53:p.R248Q, BRAF:p.V600E, EGFR:p.A289T,
PRB2:p.N230del, RGPD5:p.P1760A, TP53:p.R175H, CHEK2:p.K373E,
EGFR:p.R108K, EGFR:p.R222C, PIK3CA:p.E545K, PIK3R1:p.G376R,
POTEC:p.K507E, SDHAP2:p.V195E, SLC6A10P:p.K88N, TP53:p.R282W,
TP53:p.R273H, CD3EAP:p.K219del, DST:p.R146C, EGFR:p.A289D,
EGFR:p.H304Y, FRG1B:p.S71N, GOLGA8DP:p.A116E, KRTAP4-11:p.R121K,
KRTAP4-11:p.S48R, MAP3K1:p.P324L, OGDH:p.I78fs, PODXL:p.S162fs,
PSPH:p.V145I, SPINT1:p.A316V, TP53:p.R248W, TP53:p.G245S,
TP53:p.Y220C, TP53:p.R158H, TSHZ2:p.A222T, UBC:p.L149R,
ZDHHC4:p.R300H, ZNF844:p.R447P, AASS:p.T878fs, ABCC10:p.R570W,
ADAM29:p.V205I, ADAMTS8:p.V524M, AGAP3:p.R766W, AICDA:p.Y144F,
AK7:p.A159V, AK8:p.D243A, ANO2:p.R334C, AOX1:p.A507V,
ARHGAP5:p.M691L, CALN1:p.V231I, CARM1:p.A202V, CD163L1:p.V721M,
CD1D:p.L25fs, CD209:p.A283T, CDH18:p.A195T, CILP2:p.V553M,
CIZ1:p.L89P, CLOCK:p.L123fs, COL6A5:p.T2224M, CSF2RB:p.G298S,
CSMD3:p.E171K, CYP2D6:p.H352R, DCAF12L1:p.R335H, DCAF12L2:p.R246H,
DPP10:p.V183I, DPY19L2P1:p.R378Q, DQX1:p.R505H, DRD5:p.S275R,
DVL2:p.V66G, EFCAB6:p.R379K, EGFR:p.L62R, EGFR:p.R252C,
EGFR:p.P596S, EGFR:p.P596L, EGFR:p.G598A, EGFR:p.E709K,
EPHA1:p.A184T, ERC2:p.R20H, ESPNP:p.R627Q, FAM126B:p.R382H,
FBN3:p.V886I, FGF14:p.T229M, FLG2:p.H1901fs, FLG:p.R2886H,
FLNA:p.V1240M, FOXG1:p.H57del, FPR2:p.R54Q, FRG1B:p.K13N,
FRG1B:p.A53T, GABRA6:p.V314I, GJB3:p.R160H, GLT8D2:p.A178V,
GRM3:p.R183C, HERC1:p.R2330H, HNF1B:p.T417M, HTRA3:p.Q403R,
IDH1:p.R132G, IFNA10:p.L80F, IFNA10:p.V79A, JHDM1D:p.R313H,
JPH1:p.A395T, KEL:p.V411M, KIAA0907:p.R516fs, KIAA1704:p.D88del,
KLK6:p.R120H, KRAS:p.G12D, KRTAP4-7:p.L121V, KRTAP4-7:p.L148V,
KRTAP5-4:p.S131C, LAT2:p.L18W, LIMK2:p.R203H, LUM:p.R330C,
MCOLN3:p.V141I, MGAT4B:p.T444P, MUC17:p.V77M,
MUC17:p.3204_3205insP, MYO1D:p.T109M, MYO6:p.Q914fs,
NAP1L5:p.140_141EE>E, NF1:p.F1658fs, NHP2L1:p.R84C,
NLRP5:p.R737W, NPTX1:p.A263T, NUFIP2:p.Q29del, ODF4:p.R61C,
OR11H12:p.H154P, OR2A7:p.V18I, OR2H1:p.V287I, OR2T12:p.R184H,
OR5D13:p.R236C, OR5P2:p.A100V, OR6N2:p.R293C, PASD1:p.A236del,
PCDH11X:p.T486M, PCDHB13:p.P221L, PDGFRA:p.E229K, PDGFRB:p.S650L,
PHC3:p.T35del, PIK3C2B:p.R287fs, PIK3CA:p.M1V, PIK3CA:p.R88Q,
PIK3CA:p.M1043V, PIK3CA:p.H1047R, PIK3R1:p.K379N, PODNL1:p.A150V,
POTEE:p.V166M, POTEG:p.R136H, PRKCD:p.G432fs, PROKR2:p.V297I,
PTEN:p.C136Y, PTEN:p.S170N, PTEN:p.R173H, PTEN:p.T277I,
PTEN:p.V317fs, PTPN14:p.E716del, R3HDM2:p.412_413QQ>Q,
RAB11FIP5:p.R170H, RASAL3:p.R82H, RB1:p.N316fs, RDH8:p.A198V,
REN:p.15_16LL>L, RIMBP2:p.R830H, SCAF11:p.E926fs,
SCN7A:p.R1358H, SCNN1G:p.R564H, SDHAP2:p.R31C, SDHAP3:p.A66T,
SEMG2:p.R292C, SH3RF2:p.R318C, SHB:p.A460T, SIGLEC10:p.T250M,
SLC13A5:p.Q273P, SLC17A9:p.V324I, SLC22A9:p.R407Q, SLC26A3:p.V88I,
SLC5A3:p.A302fs, SLC9A4:p.R631H, SPAM1:p.R346Q, SPEN:p.E803fs,
SPTA1:p.A2011V, SUSD5:p.T513M, SYNE1:p.R8468H, TARSL2:p.G366D,
TAS2R41:p.A255T, TAT:p.R367H, TFPI2:p.R206C, THSD7B:p.R90C,
TMEM147:p.A92V, TMEM156:p.R81C, TMPRSS6:p.V3021, TNFSF9:p.A232T,
TP53:p.C238F, TP53:p.C238Y, TP53:p.Y234C, TP53:p.V216M,
TP53:p.H179R, TP53:p.T155N, TRAPPC10:p.K133fs, TTN:p.R21402W,
TTN:p.V16403M, TUBBP5:p.V102M, TYRP1:p.T352fs, UBC:p.R73L,
UGT2B28:p.P289H, USH2A:p.R3719H, WASH6P:p.L211V, ZFP42:p.V2271,
ZFP42:p.T264M, ZNF181:p.V305G, ZNF280B:p.E400K, ZNF534:p.N583K,
ZNF563:p.W208fs, ZNF844:p.F487L, and ZPBP:p.R154C.
[0116] 50. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0117] (a) the population of subjects is suffering
from HNSC; and [0118] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting ofPIK3CA:p.E545K, PIK3CA:p.E542K, TP53:p.R175H,
PIK3CA:p.H1047R, TP53:p.R282W, TP53:p.R248Q, TP53:p.R273H,
TP53:p.R248W, TP53:p.G245S, RHOA:p.E40Q, EP300:p.D1399N,
HRAS:p.G13V, MB21D2:p.Q311E, NFE2L2:p.E79Q, TP53:p.H179Y,
FBXW7:p.R505G, HIST1H2BF:p.E77K, HRAS:p.G12D, MAPK1:p.E322K,
NFE2L2:p.D29H, TP53:p.P278S, TP53:p.C242F, TP53:p.Y220C,
TP53:p.H193L, TP53:p.H179R, TP53:p.V157F, TP53:p.R110L,
AKNAD1:p.K620R, ANXA6:p.R231Q, AP1G2:p.D243N, ATAD5:p.D441N,
ATP6AP2:p.E119Q, B2M:p.M1I, BCL11A:p.E579K, C1orf172:p.Y30fs,
C7orf57:p.E30K, CCDC135:p.E313K, CDH12:p.P706T, CDH7:p.Q225K,
CDK11B:p.E79del, CDKN2A:p.H83Y, CHCHD4:p.T79M, CIRH1A:p.S250I,
CLSTN2:p.P759L, CRB1:p.L628fs, DENNDSB:p.G1023E, DNAH5:p.Q1797E,
DSP:p.R160G, EDA:p.L58F, EFCAB6:p.E1002K, ELF4:p.S415L,
EP300:p.C1164Y, EPHA3:p.T802R, EPHA6:p.D952H, ERBB2:p.M9161,
ESRRA:p.D219N, FAM101A:p.I89del, FBXO24:p.M553V, FCAR:p.V233M,
GPANK1:p.Y351fs, GPR20:p.V300I, GPRASP1:p.S706L, GPRIN3:p.R633fs,
GRID2:p.T649fs, GRM3:p.F682L, GUCY2F:p.S404L, HCRTR2:p.D100Y,
HIST1H3C:p.K37M, HIST1H4C:p.R68P, HLX:p.S12T, HOXD10:p.Y151C,
HPS3:p.K812N, HRAS:p.G12A, HRAS:p.G12S, IFT140:p.E664K,
INPPL1:p.T493M, ITGA10:p.R669Q, ITGB1:p.D158N, KIAA1429:p.D1526N,
KIAA1429:p.S138F, KPRP:p.E553fs, KSR2:p.T555M, LINGO2:p.P410T,
LPCAT1:p.V187del, MAGEB3:p.V75A, MAP3K7:p.E524Q, MAP4K3:p.P657fs,
MAP9:p.K485N, MARS2:p.R481Q, MBOAT7:p.R424W, MUC16:p.R12774H,
MUCSB:p.T4388M, MYH11:p.E993K, MYOCD:p.T493M, MYOM1:p.R63Q,
NANOS3:p.S183L, NCOR1:p.R1561Q, NCOR1:p.Q169E, NCR1:p.D213N,
NFE2L2:p.E79K, ODZ1:p.R366M, OPN1MW:p.A285T, OR2M2:p.A95fs,
OR2M3:p.M273I, OR2T33:p.R120S, OR6V1:p.I248fs, PABPC5:p.P58L,
PACSIN1:p.E359K, PIK3CA:p.M1043V, PIK3CA:p.H1047L, PIWIL1:p.V699M,
PLIN5:p.430_431insNG, PLXNA3:p.P58S, PRB1:p.R274fs, PRSS1:p.D107N,
RAC1:p.A159V, RGS7:p.L21fs, RPA1:p.R31H, RPL18:p.R178fs,
SFI1:p.R821Q, SLC35D3:p.*417S, SLC5A7:p.G336C, SMARCA4:p.P913L,
STAT3:p.D661V, SYCP2:p.K474N, SYT6:p.R249H, TBX21:p.E494K,
THSD7A:p.R1046C, THSD7A:p.C728F, TMC3:p.R934S, TMTC2:p.T409R,
TP53:p.E285K, TP53:p.C275F, TP53:p.R273C, TP53:p.G266E,
TP53:p.G262V, TP53:p.R249S, TP53:p.G245V, TP53:p.C238F,
TP53:p.M237I, TP53:p.Y236C, TP53:p.Y236D, TP53:p.R196P,
TP53:p.PHHERC177del, TP53:p.V173L, TP53:p.V173M, TP53:p.Y163C,
TP53:p.P151T, TP53:p.V143M, TP53:p.P58fs, URI1:p.S13fs,
ZNF177:p.K384N, ZNF750:p.S96fs, and ZZZ3:p.R5Q.
[0119] 51. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0120] (a) the population of subjects is suffering
from KIRC; and [0121] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of WASH3P:p.G175S, VHL:p.L89H, VHL:p.S111N,
WDR52:p.V1227G, KRT1:p.552_559YGSGGSSY>Y, KRTAP1-1:p.S34C,
PALM2-AKAP2:p.1075_1076insEA, ZNF814:p.D404E, DOPEY2:p.Y2048S,
KAT2B:p.W111fs, PABPC1:p.E156fs, PCDHGC5:p.G599V, PIK3CA:p.E545K,
RRAD:p.A278E, SIRPA:p.D131del, UQCRFS1:p.I83V, VHL:p.P45L,
VHL:p.V74D, VHL:p.R82P, VHL:p.L116fs, VHL:p.L158V, VHL:p.L169P,
WDR73:p.DGTRSQ315del, ABCA3:p.E95D, ABCC5:p.L1090fs, ACADS:p.R330H,
ACAN:p.G952E, ACSM2A:p.L402fs, ADAM23:p.K380M, ADH1A:p.D154V,
AFF3:p.SA620del, AGAP6:p.D69fs, AGAP7:p.E71fs, AHNAK:p.5_6insE,
AIDA:p.K247M, ALAS1:p.G302R, ANAPC16:p.R95fs, ANK2:p.N453S,
ANKRD36:p.K378R, ARHGEF5:p.E487G, ARSD:p.AGV234del, ARSD:p.A234G,
ATP2A1:p.G704C, ATP7A:p.Q990fs, AVIL:p.G299fs, AXDND1:p.EQ991del,
BAP1:p.N78S, BAP1:p.M1I, BLM:p.H660Q, BMPER:p.RIAL444del,
BRK1:p.K70Q, BTRC:p.I416M, C16orf55:p.D118A, C19orf33:p.K102E,
C20orf132:p.E382D, C2orf71:p.1225_1226insS,
C6orf132:p.173_182PPPLLLEPPP>P, CASP5:p.R23fs, CATSPER4:p.T425M,
CCDC120:p.I8V, CCR5:p.S185I, CCZ1:p.E214D, CD7:p.P174fs,
CDAN1:p.L646fs, CDH23:p.F1132Y, CDK5RAP2:p.H1592Q, CENPB:p.E410V,
CERCAM:p.A85fs, CHEK2:p.K373E, CHIT1:p.P284fs,
CLCN2:p.645_645R>RR, CLUL1:p.G463R, CNTNAP4:p.Y436S,
CUL9:p.D1726E, CWC25:p.K364E, CXorf51B:p.V43I, DDX39B:p.F149fs,
DIRAS1:p.G79C, DISP2:p.F1021S, DNMBP:p.T78P, DOCK8:p.A177fs,
DPCR1:p.H383N, DPCR1:p.L768del, EGFR:p.L838M, ENPEP:p.F289C,
ESPNP:p.W122fs, FAM105A:p.H126N, FAM186A:p.IPPQAQELEIPL1556del,
FAM194B:p.EEEEYL135del, FAM22F:p.S691del, FAM22F:p.P690fs,
FAM47A:p.LRPEPPETGVSH235del, FAM47C:p.P388S, FAM78A:p.W192L,
FBXO34:p.Q294fs, FGFR3:p.R571fs, FGFR3:p.P716H,
FMN2:p.AIPPPPPLPGA956del, FOXD4L4:p.C405fs, FUT6:p.S140fs,
GJA1:p.A311fs, GOLGA5:p.L492I, GPM6A:p.A50V,
GPRIN1:p.231_239RKEDPGSLR>R, GRAMD1B:p.P356H, GREB1:p.S344Y,
GRM6:p.A718fs, GUSB:p.L501V, GUSB:p.C500R, HBB:p.F86C,
HDAC6:p.G977D, HEXDC:p.T482P, HNF1B:p.N302K, HNRPLL:p.M327V,
HRC:p.P439fs, HSFX2:p.D92E, IL1RAP:p.F50C, IVL:p.EQQEGQLKHP167del,
KANK4:p.S253P, KCNJ18:p.E378K, KIAA1751:p.K97N,
KRT1:p.SSYGSGG557del, KRT2:p.L299W, KRT4:p.F154fs,
KRTAP10-6:p.49_49P>PSCCAP, KRTAP5-7:p.C120Y,
KRTAP9-2:p.CCQP140del, LARS:p.P185fs, LCP1:p.P445fs,
LOC338651:p.PHRSHSPPWS102del, LRCH2:p.D717G, LTA4H:p.F107L,
LYST:p.Q710H, MAFA:p.207_208HH>H, MAGEC1:p.P239del,
MAP2K5:p.Q445R, MAPKAPK2:p.T214fs, MARCKS:p.K152fs,
MED12L:p.P2071S, MEGF6:p.A582fs, MGST3:p.G143fs, MLXIPL:p.S790R,
MOCOS:p.S849P, MST1R:p.M464V, MTOR:p.C1483F, MTOR:p.L1460P,
MUC16:p.P11260A, MUC17:p.R1227fs, MUC17:p.H1228fs, MUC2:p.1480_1481
insI, MUC6:p.P1569fs, MYO3A:p.N525S, NBPF3:p.D491V, NCOR1P1:p.L52P,
NDUFA4L2:p.G3fs, NEFH:p.651_651K>KAKSPEK, NES:p.V611L,
NFAT5:p.Q906E, NOXO1:p.G3fs, NR2C1:p.S270I, NSMCE2:p.Q31fs,
NUDT21:p.W13fs, ODZ2:p.W628fs, ONECUT1:p.L424M, OR10A3:p.F73V,
OR4F4:p.E15G, OR4N2:p.L150fs, OR51B5:p.A66fs, OR7C1:p.F104fs,
PABPC1:p.Y408F, PABPC1:p.K333fs, PABPC1:p.A181T, PABPC3:p.P191T,
PALLD:p.A996T, PALM2-AKAP2:p.G1118fs, PARD6A:p.G84fs, PASK:p.T62I,
PCDH15:p.C1713F, PCNT:p.G136S, PGM5:p.G426fs, PGPEP1L:p.R164fs,
PIK3C2B:p.F1473L, PIK3CA:p.N1044K, PIK3R5:p.L371R, PITRM1:p.P816T,
PLIN4:p.T3471, PODXL:p.28_30PSP>P, POLR1C:p.K332Q,
POTED:p.I214V, PPM1E:p.R311W, PRKCE:p.Q157fs, PROX1:p.V225D,
PRRC2C:p.P1883T, PRX:p.P549L, PSD3:p.T563P, PTCH1:p.P689H,
RANBP3:p.L386W, RASGEF1C:p.A188T, RGPD6:p.F946L, RHEB:p.Y35N,
RIMBP3:p.A396del, RIN3:p.L449V, RLIM:p.S501L, RNF17:p.S351C,
RUNX2:p.P466H, SCAF1:p.P208fs, SDK1:p.K508fs, SECISBP2:p.D608E,
SERPINB3:p.S209C, SESTD1:p.I306M, SFRP4:p.P325fs, SH3KBP1:p.P563fs,
SIPA1L3:p.G777A, SLC13A2:p.L493fs, SLC16A9:p.CVLLGG470del,
SLC25A5:p.A118T, SLC44A5:p.V70F, SLC4A8:p.N229K, SLC52A1:p.G370del,
SLC52A2:p.G399fs, SLC6A10P:p.K88N, SLC6A14:p.A85fs,
SLC9B1:p.V446fs, SON:p.VLESSAVT1359del, SP8:p.G165del,
SPAG1:p.353_354insD, SPATA9:p.C189F, SPEG:p.A992fs, SPTB:p.T1864I,
SRA1:p.V110L, STAT6:p.P354fs, STK11IP:p.A155E, STXBP3:p.E279G,
SVIL:p.M93T, SYNE1:p.R8468S, SYNJ2:p.K832T, SYNPO:p.G619fs,
TAOK2:p.Q899fs, TAS2R38:p.I311T, TBC1D12:p.F608Y, TBC1D1:p.H277R,
TBC1D3:p.A556fs, TBC1D3C:p.A495fs, TBC1D3F:p.A556fs, TCF7:p.H140P,
TDRD10:p.W276C, THRAP3:p.K551R, TMEM102:p.A110P, TMEM161B:p.L142P,
TMEM230:p.D140G, TMEM47:p.G87S, TRDN:p.*730Y, TTBK1:p.T1065S,
UBE2O:p.R1118fs, UBR5:p.T1306fs, UPK3A:p.G272fs, VHL:p.G39S,
VHL:p.S65L, VHL:p.N78D, VHL:p.R79P, VHL:p.W88L, VHL:p.L89P,
VHL:p.R107P, VHL:p.S111R, VHL:p.H115N, VHL:p.D121Y, VHL:p.G123fs,
VHL:p.D126fs, VHL:p.L128H, VHL:p.L135F, VHL:p.I151T, VHL:p.L153P,
VHL:p.L158P, VHL:p.Q164fs, VHL:p.L184P, VHL:p.L188P,
WASH6P:p.315_316insAPP, WASH6P:p.T201M, WWP2:p.G458A,
ZCCHC6:p.K937N, ZFAND2B:p.I149T, ZFR2:p.Y107N, ZNF273:p.N319K,
ZNF462:p.S650T, ZNF516:p.A256D, ZNF519:p.H431Y, ZNF687:p.F858C,
ZNF732:p.E227Q, ZNF880:p.Q406R, ZP3:p.V362fs, and
ZRANB1:p.*735fs.
[0122] 52. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0123] (a) the population of subjects is suffering
from LAME; and [0124] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of NPM1:p.W288fs, DNMT3A:p.R882H, NPM1:p.L287fs,
IDH2:p.R140Q, IDH1:p.R132C, FLT3:p.D835Y, DNMT3A:p.R882C,
FLT3:p.600_601insFREYEYD, IDH1:p.R132H, NRAS:p.G13D, U2AF1:p.S34F,
KIT:p.D816V, FLT3:p.D835E, IDH2:p.R172K, NRAS:p.G12D, WT1:p.S381fs,
ABTB1:p.L249fs, DNMT3A:p.R736H, FLT3:p.D835H, KRAS:p.G12D,
NPM1:p.L287fs, NRAS:p.Q61H, NRAS:p.Q61K, PHACTR1:p.V251fs,
RBBP4:p.E330K, RUNX1:p.R135G, and U2AF1:p.S34Y.
[0125] 53. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0126] (a) the population of subjects is suffering
from LUAD; and [0127] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of KRAS:p.G12C, KRAS:p.G12V, EGFR:p.L858R, U2AF1:p.S34F,
KRAS:p.G12A, TP53:p.R158L, KRAS:p.G12D, PIK3CA:p.E545K,
TP53:p.R273L, EGFR:p.ELREA746del, KRAS:p.G13D, A2ML1:p.S654fs,
BRAF:p.G469V, CTNNB1:p.S37F, EGFR:p.G719A, KRAS:p.G13C,
MYOF:p.G165fs, EGFR:p.S768I, FAM47C:p.G948W, KRAS:p.Q61L,
MYH10:p.L1091fs, NRAS:p.Q61L, OR4C3:p.H130fs, PI15:p.V22F,
RAD50:p.D69Y, RIT1:p.M90I, TP53:p.C275F, TP53:p.R249M,
TP53:p.R249G, TP53:p.R248P, TP53:p.R175H, TP53:p.Y163C,
TP53:p.A159P, TP53:p.V157F, TP53:p.G154V, ABCB1:p.R467L,
ACBD3:p.R224L, ACTA1:p.G275C, ACTN2:p.D893Y, ADAM30:p.Q741H,
ADAMTS14:p.G238C, ADAMTS20:p.R1251S, ADAMTS20:p.R541L,
ADAMTS5:p.L549M, ADAMTS9:p.G659W, ADCY2:p.P1016T, ADCY5:p.G623C,
AFP:p.A182G, AHDC1:p.P155Q, AKAP1:p.LDRNEEG317del, ALKBH1:p.K137E,
ANK2:p.Q3076L, ANKRD44:p.G339C, ANO3:p.A41S, AP1G1:p.R723L,
APBB2:p.T243fs, APOB:p.L973M, APOBR:p.R840L, AQP10:p.Q261L,
ARAP3:p.R1226L, ARFIP2:p.R86L, ARHGAP36:p.P16H, ARL13B:p.R358L,
ASCC2:p.R365L, ASPM:p.S240F, ASXL3:p.P1470Q, ATRN:p.P197Q,
AVIL:p.G64W, AXDND1:p.W101R, B3GAT1:p.R125L, BARX2:p.R68P,
BCL9L:p.G980C, BCOR:p.N1459S, BEND2:p.P536Q, BMS1:p.G455V,
BRAF:p.V600E, BRAF:p.G466V, BRD9:p.G330W, BRF1:p.V469L,
BRWD3:p.H160N, BTRC:p.G260W, C11orf68:p.V135L, C15orf2:p.V753F,
C15orf2:p.G906W, C18orf8:p.M61I, C1GALT1:p.G299V,
C1orf173:p.G1454S, C1orf173:p.S688Y, C1orf87:p.R541L,
C2orf53:p.P272H, C3orf20:p.R740L, C7:p.R687S, C7orf58:p.G140W,
C7orf58:p.R238L, CACNA1A:p.S772Y, CACNA1D:p.R1073L,
CACNA1E:p.R2089Q, CACNA2D1:p.A352E, CACNG3:p.R232W, CADPS:p.R959S,
CALB2:p.R258C, CAMK2B:p.G131V, CARD11:01065M, CCDC111:p.R417L,
CCDC141:p.E1204V, CCDC19:p.R279L, CCDC19:p.R207L, CCKAR:p.L271M,
CD1B:p.W41L, CDH10:p.S577R, CDH10:p.R472C, CDH10:p.R128S,
CDH18:p.A721S, CDH20:p.P433H, CDH6:p.Q237K, CDK13:p.R880S,
CDK4:p.R24L, CELF4:p.A309P, CFDP1:p.P129fs, CHN1:p.K264N,
CHRNA4:p.S396R, CHRNA9:p.P361Q, CLCNKA:p.P124Q, CLEC12B:p.W217L,
CLK4:p.R68L, CNTFR:p.D252Y, CNTN6:p.R807M, CNTNAP2:p.F395L,
COL19A1:p.P538Q, COL5A2:p.G612W, COL5A2:p.G516W, COL9A1:p.P211Q,
CPE:p.P290Q, CPNE8:p.Q127H, CPSF4:p.P219Q, CRIPAK:p.S180fs,
CROT:p.Q580H, CRTC3:p.S363L, CSMD2:p.P1855Q, CSMD3:p.T2810N,
CSMD3:p.P2727T, CSMD3:p.Q174H, CUBN:p.G596C, CUL4B:p.R91S,
CUL7:p.L371F, CXCL9:p.K122N, CXCR4:p.E345Q, CXorf59:p.R198M,
CYP11B1:p.R498G, CYP27A1:p.P112Q, CYP2B6:p.A444E, DACH2:p.R539L,
DCC:p.R446H, DDX56:p.R329L, DEFA1:p.W90C, DENND2A:p.R688Q,
DENND2A:p.R499L, DMBT1:p.R1521L, DNAH5:p.R3822L, DNAH9:p.52993R,
DNAI2:p.V231L, DPP6:p.L757F, DSG4:p.R128L, DST:p.A44105,
DZIP3:p.M322L, EBF3:p.R2315, EFCAB4B:p.E265Q, EHHADH:p.Q704H,
ELAVL2:p.L263F, EMR1:p.R493H, ENAH:p.R514L, ENPP1:p.G738E,
EPB41L3:p.A896S, EPG5:p.R2289L, EPHA1:p.G111V, EPHB6:p.R337H,
EPRS:p.V1151L, ERBB2:p.S310Y, ERBB2:p.774_775insAYVM,
ERBB2:p.776_776G>VC, ERN2:p.T295K, FAM120B:p.P467H,
FAM127C:p.F52L, FAM135B:p.W240C, FAM210B:p.L112F, FAM47A:p.R690L,
FAM47B:p.W163C, FAM47B:p.L567F, FAMSC:p.R457G, FAM70B:p.P277T,
FAM71B:p.L583M, FAM75A6:p.R304S, FAM75A6:p.P54L, FAM75D1:p.R1265S,
FARP1:p.R299L, FAT1:p.R4359L, FAT3:p.R1266H, FAT3:p.G1899V,
FAT3:p.H3574N, FBXO18:p.M144I, FBXO31:p.G443fs, FCGBP:p.A1022S,
FCRL2:p.V505L, FERD3L:p.P92H, FGB:p.E339Q, FGFR2:p.E116K,
FGFRL1:p.R243L, FGFRL1:p.V274L, FKBPL:p.R320L, FLG2:p.G1545V,
FLG2:p.L572F, FLG:p.P3254H, FLG:p.P2466Q, FMN2:p.P992T,
FOLH1:p.A643S, FOXRED1:p.R136L, FRAS1:p.C382F, FRG2B:p.D142Y,
FRMPD1:p.E1093Q, FSHB:p.T43N, GABRA5:p.Q224K, GADL1:p.L352I, GAL3
ST3:p.A271S, GALNT14:p.D234E, GAS8:p.R313S, GATA3:p.M443I,
GCDH:p.R82C, GEM:p.R268L, GFRAL:p.Q308K, GIT2:p.R123L, GJB4:p.R225,
GLB1L2:p.I407M, GLOD4:p.Q223fs, GNAO1:p.P283Q, GPNMB:p.I174M,
GPR137B:p.G240C, GPR158:p.P762T, GPR98:p.G4307W, GRB7:p.R239L,
GRHL1:p.G608W, GRID1:p.R683L, GRIK1:p.R368Q, GRM5:p.P895fs,
GTF2E1:p.R192L, H3F3C:p.R131L, HAO2:p.H12N, HCN1:p.P231Q,
HECW1:p.A183S, HGF:p.M686T, HIP1:p.R940L, HIST1H1E:p.R25P,
HLA-DMA:p.A236fs, HOXA5:p.G11C, HS3 ST3A1:p.G399W, HSD17B6:p.F209L,
HSPA13:p.V85L, HSPBAP1:p.R282L, HTRSA:p.W298C, IGHMBP2:p.R615S,
IL2:p.R103M, IL2RA:p.G61W, IL32:p.P215T, ING1:p.A220S, INMT:p.G56V,
ITGA8:p.G616C, ITGAD:p.L528fs, ITGAX:p.R283H, ITIH1:p.G254W,
ITIH2:p.L842V, ITK:p.R29L, ITPR2:p.P358Q, JMJD1C:p.R1198S,
KCNA1:p.G376C, KCNH8:p.M455I, KCNJ3:p.L430F, KCNK18:p.G23V,
KCNK2:p.R166L, KEAP1:p.G603W, KEAP1:p.R260L, KEAP1:p.S144F,
KHDRBS2:p.S203L, KIAA1211:p.P1203Q, KIAA1549:p.L1272F,
KIAA1755:p.Q108H, KIF15:p.E252Q, KIF9:p.G480R, KIRREL:p.G604C,
KLF5:p.E419Q, KRAS:p.Q61H, KRTAP10-12:p.R64P, KRTAP27-1:p.M124I,
KRTAP4-5:p.C91F, KRTAP5-1:p.S193Y, L1CAM:p.R632S, L3MBTL4:p.W162L,
LAMA1:p.D1030Y, LAMB1:p.T1610fs, LAMB4:p.G1239W, LAMB4:p.G588W,
LEF1:p.I53V, LEKR1:p.Q450K, LIM2:p.S150T, LIPJ:p.P236Q,
LPHN3:p.E740D, LPPR4:p.R527S, LRFNS:p.N132K, LRP1B:p.G3563C,
LRP2:p.M4039I, LRRC4C:p.Q10L, LRRIQ1:p.W792L, LRRTM4:p.S243Y,
MAGEA10:p.R7H, MAGEC2:p.W109C, MAGI1:p.G1156V, MAGI2:p.P1044T,
MAK:p.P373Q, MAP2K1:p.K57N, MARCH11:p.R193L, MEPE:p.G142C,
MKI67:p.R10815, MKRN3:p.P448H, MLL3:p.N393K, MLL3:p.Q356K,
MMRN1:p.A1013S, MOGAT2:p.Q66fs, MXRAS:p.D324Y, MYH4:p.T790M,
MYH8:p.R1117C, MYH8:p.H1006N, MYO5B:p.R708L, MYO7B:p.P2040H,
MYO9B:p.R94L, MYT1L:p.P351Q, NAA11:p.T184K, NAB1:p.L72F,
NAV1:p.R938L, NBPF15:p.G665E, NCAM2:p.G698C, NCAPD2:p.R220L,
NDST3:p.V427I, NEK2:p.R239S, NFIA:p.L294F, NLRP3:p.R157C,
NOTCH2:p.R2105L, NR4A2:p.R314L, NRG1:p.V481L, NRXN1:p.R813S,
NRXN1:p.A660S, NRXN3:p.P23H, NRXN3:p.R103C, NTM:p.G333C,
NUAK1:p.G173C, NYAP2:p.P437L, ODZ3:p.P218Q, OIT3:p.R508S,
OOEP:p.R101C, OPN1LW:p.P283H, OR10H4:p.M199I, OR10J1:p.L157Q,
OR10X1:p.L298I, OR10Z1:p.L205F, OR14A16:p.G160C, OR2A25:p.M80I,
OR2AG2:p.G249W, OR2AK2:p.W37C, OR2H2:p.L205F, OR2J2:p.G234W,
OR2L13:p.M106I, OR2L13:p.T242A, OR2L3:p.M1I, OR2L3:p.L67I,
OR2L8:p.R121C, OR2L8:p.R171S, OR2M2:p.F177L, OR2M2:p.F323L,
OR2M5:p.V205L, OR2T12:p.M258L, OR2T27:p.D11Y, OR2T33:p.P165Q,
OR2T34:p.C246F, OR2T6:p.V213L, OR4C12:p.D309Y, OR4C12:p.M279I,
OR4C16:p.L162M, OR4M2:p.A119S, OR4M2:p.A161S, OR51V1:p.P298T,
OR5AS1:p.M39I, OR5B12:p.S289C, OR5B17:p.M266I, OR5D14:p.H246N,
OR5D16:p.P264T, OR5D18:p.R123H, OR5F1:p.G44V, OR5J2:p.A36S,
OR5L1:p.T275N, OR6C65:p.I154fs, OR6C75:p.G94W, OR6K2:p.P79Q,
OR8D2:p.R306M, OR9A2:p.R289W, OR9G9:p.R169L, P2RX7:p.P142Q,
P2RY10:p.T10K, P2RY10:p.V196L, PABPC5:p.R99S, PAPPA2:p.P917T,
PAPPA2:p.P1706H, PBLD:p.P55Q, PCDH10:p.R587S, PCDH10:p.V986L,
PCDH11X:p.R1010I, PCDHAC2:p.A742V, PCDHB5:p.P649S, PCDHGC5:p.K12N,
PCDHGC5:p.P684H, PCLO:p.P3946T, PCMTD1:p.R271M, PDPR:p.G793W,
PDYN:p.G191W, PDZD2:p.R565S, PDZD8:p.S980G, PFKM:p.R118S,
PIGM:p.R225L, PIK3CA:p.E542K, PIK3CG:p.V165I, PILRA:p.S291fs,
PLCE1:p.G564C, PLCL1:p.M564I, PLEKHA6:p.R110L, PNKP:p.G174W,
POGZ:p.G75W, POLE:p.R573L, POM121L12:p.P231T, POM121L12:p.P242H,
POTEE:p.V288M, POTEM:p.S78R, POU3F3:p.D321Y, PPT2:p.R265L,
PRDM16:p.P1036L, PRELP:p.D201Y, PRPF40B:p.R160S, PRPF6:p.R763L,
PTEN:p.R234L, PTPN11:p.G503V, PTPN13:p.E2067K, PTPRJ:p.G334W,
PTPRT:p.R928L, PTPRU:p.P559S, PXDNL:p.P1456T, QSOX1:p.R401L,
QSOX2:p.R683L, RAB13:p.R167L, RAB8A:p.G20W, RAPGEFL1:p.R356L,
RBM19:p.G390W, RCL1:p.P112Q, REG1B:p.W57L, REG3A:p.S150L,
REG4:p.G110V, RIMS2:p.R55L, RIT2:p.R85L, RLN2:p.S138C,
RNF20:p.P529Q, RORB:p.G94W, RPL10L:p.K187T, RPRD2:p.R97S,
RTN1:p.S103W, RUNX2:p.R337M, RYR2:p.K2413N, RYR2:p.M4334I,
RYR3:p.P1670T, S100PBP:p.R5L, S1PR1:p.L104F, SAGE1:p.H298Q,
SALL1:p.E965K, SALL1:p.R898W, SALL4:p.R187L, SBSPON:p.G133W,
SCAF8:p.G740C, SCG2:p.P252Q, SCML4:p.L261F, SCN2A:p.T155K,
SEC24D:p.A50fs, SEC61A2:p.G126V, SERPINA12:p.D253Y,
SERPINA9:p.M414I, SERPINC1:p.R45L, SGIP1:p.R502L, SH3GL3:p.R174L,
SH3PXD2A:p.S759L, SI:p.V1217F, SKOR1:p.Y883C, SLC1A2:p.F348fs,
SLC24A5:p.R35S, SLC25A48:p.R101S, SLC35E2:p.R201L,
SLC39A12:p.C628S, SLC39A6:p.R53L, SLC4A5:p.I533V, SLC5A1:p.G53W,
SLC5A7:p.G442V, SLC6A11:p.W299L, SLC6A2:p.S354C, SLC8A1:p.G433C,
SLIT1:p.R1460L, SLITRK5:p.R68L, SLITRK5:p.R468M, SLITRK6:p.N741K,
SORL1:p.R205L, SOS1:p.N233Y, SOX9:p.E75K, SPAG16:p.V439L,
SPIN4:p.Y171C, SPRR2D:p.P30fs, SPTA1:p.G2367C, SPTA1:p.D2243Y,
SSX3:p.P127T, ST18:p.H778Q, STAC3:p.G117W, STOML3:p.D86Y,
STX2:p.R107L, SUMF2:p.G110E, SUN3:p.P339Q, SV2C:p.P60Q,
SYNDIG1:p.D135Y, SYNE1:p.K8632E, TARS2:p.E199K, TAS2R16:p.Q177H,
TCOF1:p.K264R, TCTE1:p.S127I, TDO2:p.Q197H, THSD7A:p.G810W,
THSD7A:p.R801L, TIFAB:p.D43E, TIGD4:p.S312F, TLL1:p.P53Q,
TMPRSS11E:p.G259C, TMTC1:p.A864D, TMTC1:p.G212V, TMX3:p.R151C,
TNNI1:p.R67L, TNR:p.L692I, TOP2A:p.R736L, TP53:p.R337L,
TP53:p.E285K, TP53:p.R283P, TP53:p.D281N, TP53:p.C277F,
TP53:p.V274F, TP53:p.R273H, TP53:p.I255F, TP53:p.R249S,
TP53:p.M237I, TP53:p.S215I, TP53:p.C176F, TP53:p.R110L,
TP53:p.G105C, TP53:p.P72fs, TPO:p.E558K, TRAF6:p.R502S,
TRIM42:p.Q127K, TRIM48:p.A93D, TRIM4:p.R398L, TRIM51:p.W131C,
TRIM9:p.R337S, TRIML1:p.H399Q, TRPM3:p.G298W, TSC1:p.G378C,
TSG101:p.R276S, TSHZ1:p.K501N, TSHZ3:p.G677V, TTF2:p.R761S,
TUBA3C:p.Q176fs, UBAC1:p.K330N, UBE2J2:p.G193W, UBR1:p.G1647W,
UGT2B7:p.M214I, VMP1:p.E369Q, VPS13B:p.G2575W, VSTM2A:p.G75V,
VWA3B:p.R557L, WBP11:p.P227fs, WDR52:p.G612C, WDR59:p.R837S,
WDR75:p.P287Q, WDR88:p.G100W, ZCCHC5:p.G335W, ZFHX4:p.L811F,
ZFHX4:p.T1663N, ZFHX4:p.H2511Q, ZFP14:p.Q17L, ZIC1:p.A112E,
ZNF154:p.T408N, ZNF223:p.G23W, ZNF295:p.S732C, ZNF322:p.K106N,
ZNF385D:p.T226S, ZNF454:p.S190I, ZNF492:p.P392H, ZNF521:p.G640C,
ZNF521:p.P270H, ZNF536:p.G186C, ZNF536:p.G663W, ZNF644:p.G21W,
ZNF716:p.H263L, ZNF71:p.V411L, ZNF782:p.G484W, ZNF831:p.Q617K,
ZNF98:p.C492F, and ZSWIM2:p.S214Y.
[0128] 54. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0129] (a) the population of subjects is suffering
from LUSC; and [0130] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of PIK3CA:p.E545K, TP53:p.R158L, KRTAP5-5:p.GCG47del,
NFE2L2:p.E79Q, CDKN2A:p.D108Y, DHX9:p.V40G, MAFA:p.207_208HH>H,
NFE2L2:p.R34Q, PBX2:p.Y262F, PIK3CA:p.E542K, TP53:p.R273L,
TP53:p.C242F, TP53:p.R175G, TP53:p.Y163C, TP53:p.V157F,
AICDA:p.R131G, ALPK2:p.D53N, ANKFN1:p.M2801, ARPC1A:p.F212L,
ASXL2:p.S1081L, C1orf74:p.D254N, C3orf30:p.D227E, CCDC121:p.W397L,
CHN2:p.I43M, CLEC4C:p.R179L, CLN3:p.G206S, CNTN5:p.T178N,
COL12A1:p.G2753C, CPS1:p.T855K, CSMD3:p.T1094K, CSMD3:p.Q691K,
DDX11:p.R167T, EGFR:p.L861Q, EME1:p.D570H, EP300:p.D1399N,
ESYT3:p.S574F, FAM135B:p.L648M, FAM135B:p.Q285H, FAM47A:p.G372W,
FBXW7:p.R505G, FGFR3:p.S249C, GALNT13:p.G358C, GNL3L:p.K20N,
GPCS:p.R347L, HCN1:p.A714S, HCN1:p.R659L, HCN1:p.G499V,
HCN1:p.P326T, HERC2P3:p.A803V, HEXDC:p.T482P, HIST1H3B:p.E74K,
HIST2H2BE:p.G54D, IFNA10:p.V79A, IL7R:p.S54L, INADL:p.P1340A,
ISX:p.C2F, ITGAX:p.R685H, ITPR1:p.E1883Q, KCNN3:p.80_81insQQ,
KEAP1:p.G480W, KEAP1:p.R470C, KEAP1:p.V155F, KIAA1751:p.L63F,
KIAA2022:p.C345F, KIR3DL2:p.K229E, KLF5:p.E419Q, LAMA4:p.M12931,
LMLN:p.G199C, LRP2:p.A516V, LRRC66:p.F458L, LSG1:p.R517L,
LUM:p.R310L, MB21D2:p.Q311E, MCHR1:p.S306F, MKRN3:p.G270V,
MUC16:p.N11594K, NFE2L2:p.G81S, NFE2L2:p.G31A, NFE2L2:p.L30F,
NFE2L2:p.D29H, OR2B11:p.G10V, OR2T2:p.F13V, OR4K2:p.C254F,
OR51F2:p.R67P, OR51 S1:p.R159Q, OR5D18:p.T271K, OR8H2:p.L166F,
OR8J3:p.S160L, OR8K3:p.K235N, PCDHB1:p.N568K, PHIP:p.I1681M,
PIK3CA:p.E726K, PIK3CA:p.H1047R, PLCE1:p.G439C, PRSS57:p.E39Q,
PYHIN1:p.G148A, RANBP6:p.I984L, RBMXL1:p.G305C, REG1B:p.M671,
RGS6:p.W366L, RNF5:p.T1361, RP1:p.S1771L, RRP15:p.L214F,
RYR2:p.E711K, SAMD3:p.Q206H, SLITRK3:p.R214L, SON:p.S908L,
SP4:p.E11del, STK11:p.G279fs, TARBP1:p.L782V, TBCD:p.R476C,
TMPRSS11F:p.R274Q, TP53:p.R337L, TP53:p.E271K, TP53:p.R267P,
TP53:p.G245V, TP53:p.Y234C, TP53:p.Y220C, TP53:p.H214R,
TP53:p.H193L, TP53:p.H179L, TPTE:p.M541I, TRIM7:p.L3321,
TTN:p.T32425M, ZFP36L2:p.D240N, ZNF208:p.H883Q, ZNF48:p.R235H,
ZNF626:p.K473R, ZNF676:p.P43T, ZZZ3:p.R162Q.
[0131] 55. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0132] (a) the population of subjects is suffering
from OV; and [0133] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of TP53:p.R273H, TP53:p.Y220C, TP53:p.R248Q,
TP53:p.R175H, TP53:p.R273C, TP53:p.I195T, TP53:p.R248W,
TP53:p.R282W, TP53:p.C176Y, TP53:p.V157F, TP53:p.S241F,
TP53:p.H179R, TP53:p.G245S, TP53:p.H193R, ADCY2:p.V888I, B2M:p.M1V,
BAP1:p.R227C, CYP4A11:p.V185F, DNAH5:p.R3197Q, GART:p.K807fs,
GRIN2B:p.R519Q, HRNR:p.M1fs, KLHL29:p.L716fs, KRAS:p.G12V,
MGA:p.R2435Q, MYO3A:p.N525S, NPAS2:p.Q201R, NRAS:p.Q61R,
PDAP1:p.K55fs, PGAP1:p.F565C, TP53:p.S315fs, TP53:p.C275Y,
TP53:p.R273L, TP53:p.V272M, TP53:p.G266V, TP53:p.G266R,
TP53:p.D259Y, TP53:p.P250L, TP53:p.G245D, TP53:p.G245V,
TP53:p.G244C, TP53:p.C238fs, TP53:p.Y236C, TP53:p.Y234C,
TP53:p.V216M, TP53:p.S215R, TP53:p.Y205C, TP53:p.L194R,
TP53:p.P191del, TP53:p.Y163C, TP53:p.A159V, TP53:p.K132N,
TRPC7:p.D210V, UXS1:p.V100L, WNT11:p.C344Y, and ZNF295:p.E885A.
[0134] 56. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0135] (a) the population of subjects is suffering
from READ; and [0136] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of KRAS:p.G12V, TP53:p.R273H, KRAS:p.A146T, KRAS:p.G12D,
TP53:p.R175H, AKAP9:p.L3482I, APBA1:p.E624K, BAG5:p.D439N,
C17orf97:p.E230D, CDH23:p.F177L, CERS3:p.E95D, DNAH5:p.R982H,
ERBB2:p.V842I, GABRB3:p.D500N, KRAS:p.G13D, KRAS:p.G12C,
KRAS:p.G12S, LRP6:p.R675Q, MACF1:p.F722L, MBOAT2:p.R43Q,
MYO1D:p.E246K, NLRC4:p.E409K, NRAP:p.E327K, NRAS:p.Q61K,
PCDH15:p.R1552I, PIK3CA:p.N345K, PIK3CA:p.E545K, POLE:p.S459F,
PPP2R2B:p.P326L, SMAD4:p.R361H, TP53:p.R248W, ZFP2:p.R150I, and
ZNF563:p.K26N.
[0137] 57. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0138] (a) the population of subjects is suffering
from SKCM; and [0139] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of BRAF:p.V600E, NRAS:p.Q61R, NRAS:p.Q61K,
HSD17B7P2:p.N175S, BRAF:p.V600K, DISP1:p.G732L, IDH1:p.R132C,
NRAS:p.Q61L, MUC16:p.P5119S, RAC1:p.P29S, WASH3P:p.G175S,
AGAP9:p.M248V, C15orf23:p.S24F, DNAH5:p.D3236N, SPTLC3:p.R97K,
TMC5:p.R276C, CFB:p.R314M, FRG1B:p.A50P, INMT:p.S212F,
LOC649330:p.G93E, MAP2K1:p.P124S, RGS7:p.R44C, STK19:p.D89N,
ADAM30:p.G97L, ARL16:p.G6R, ARMC4:p.E22K, BRAF:p.K601E,
CAPN13:p.P405S, CD1C:p.R89C, CLCC1:p.P406Q, CNTN5:p.S379F,
DNAH5:p.R742Q, EEF1B2:p.S43G, FRG1B:p.I59V, GABRG1:p.E205K,
IARS2:p.R832C, IL32:p.D218fs, ISX:p.R86C, KLHDC7A:p.E635K,
NAP1L4:p.P285Q, NBPF10:p.Q908E, OR2A5:p.S71L, OR4E2:p.R226Q,
OR4M1:p.G41E, OR4M2:p.S268F, OR4N2:p.G41E, OR51B2:p.S163L,
PCDHGCS:p.R293C, PCLO:p.R4133C, PHGDH:p.G173L, POTEG:p.D51N,
PPP6C:p.R301C, PRAMEF11:p.C84S, PSG9:p.E404K, PTPRB:p.D1560N,
RNF152:p.P95S, SPAG16:p.P488S, SPATA8:p.E18K, TAF1A:p.R172M,
TCEB3C:p.E308K, THSD7B:p.E126K, TTN:p.E12129K, XIRP2:p.D2439N, and
ZNF831:p.R1393Q.
[0140] 58. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0141] (a) the population of subjects is suffering
from UCEC; and [0142] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of RPL22:p.K15fs, PTEN:p.R130G, PTEN:p.R130Q,
KRAS:p.G12D, KRAS:p.G12V, PIK3CA:p.H1047R, PIK3CA:p.R88Q,
PIK3CA:p.E545K, PTEN:p.V317fs, FGFR2:p.S252W, PIK3CA:p.E542K,
CTNNB1:p.S37F, POLE:p.P286R, PPP2R1A:p.P179R, CTNNB1:p.S37C,
KRAS:p.G13D, CTNNB1:p.D32N, CTNNB1:p.S33F, CTNNB1:p.G34R,
KIAA2026:p.R574C, LIMCH1:p.R806fs, PIK3CA:p.H1047L, ALPK2:p.K523fs,
CTNNB1:p.S33C, FBXW7:p.R505C, HPD:p.R284fs, KRAS:p.G12A,
PIK3CA:p.R93Q, POLE:p.V411L, TP53:p.R248W, ABCA11P:p.R385I,
ABI1:p.K445N, ACSM2B:p.K195N, APOB:p.F3102L, ASCC3:p.R136Q,
C12orf4:p.R335Q, CCDC132:p.R838C, CHD4:p.R975H, CSDE1:p.R220C,
CTNNB1:p.D32Y, CTNNB1:p.S33Y, CTNNB1:p.T41I, EXOC1:p.R588C,
FBXW7:p.R465H, FGFR2:p.N549K, FUBP1:p.R430C, GEN1:p.S509L,
IK:p.E90fs, KIF20B:p.E54K, MAX:p.H28R, MBOAT2:p.R43Q,
METTL14:p.R298P, MFGE8:p.D170N, MS4A8B:p.S3L, NSMCE1:p.D244N,
OXR1:p.E122K, PCDH19:p.E530K, PIK3CA:p.R108H, PIK3CA:p.N345K,
PIK3CA:p.C420R, PIK3CA:p.Q546P, PIK3CA:p.Q546R, PTEN:p.R130L,
RBL2:p.E127K, RXFP1:p.S223Y, SF3B1:p.R957Q, SLC20A1:p.P328fs,
SOX17:p.S403I, TNS1:p.Q659del, TP53:p.R273H, TP53:p.R273C,
TP53:p.R248Q, TTN:p.D16823N, TXNL1:p.R234C, ZFHX3:p.R1893fs,
ZNF180:p.R625I, ZNF257:p.R392I, ZNF354B:p.D609N, ZNF43:p.R280C,
ZNF709:p.R468I, ZNF765:p.S254L, ABCAS:p.R1476Q, ACVR1:p.R206H,
ADAD1:p.S11L, ADAM9:p.R256Q, ADD3:p.E570K, ADGB:p.S1124L,
AGXT2:p.R502C, AMBN:p.S225Y, ANKDD1A:p.R24H, ARHGEF33:p.R46I,
ATP10B:p.L1304I, ATP2C1:p.E724K, ATP9A:p.R290Q, ATR:p.R1814fs,
AVL9:p.F34L, BMPER:p.R241Q, BTN3A2:p.E153K, C14orf118:p.R279I,
C14orf166B:p.F230L, C3orf23:p.R217C, C3orf62:p.R185Q,
CACNA1C:p.S710L, CAGE1:p.E539K, CARD10:p.KE272del,
CCDC144A:p.S1264L, CCDC168:p.D5020Y, CCDC36:p.R209I, CD55:p.E156K,
CEP44:p.S253L, CIITA:p.E728K, CREBBP:p.P2094L, CTNNB1:p.S37A,
CTTNBP2:p.S420L, DCT:p.R532Q, DIAPH2:p.E121K, DLG2:p.S624L,
DNAH10:p.R1888Q, DNAH14:p.R1367C, DNAH7:p.R2961Q, DNAH8:p.R1347H,
DNAJC13:p.E1248K, DNMT1:p.E51K, DST:p.S1767Y, DYNC2H1:p.E883D,
EMR1:p.R631Q, EPHX4:p.R282Q, ERCC6L2:p.L445I, F10:p.E117K,
FAM155B:p.E158K, FAM83B:p.R206Q, FARP1:p.S383L, FAT3:p.A4159T,
FBXW7:p.R689W, FBXW7:p.R465C, FBXW7:p.G423V, FN1:p.R290C,
FZD6:p.R416Q, GABRA3:p.R73H, GABRA4:p.R460Q, GALNTL2:p.E395K,
GFAP:p.A233T, GGA2:p.A63V, GIGYF2:p.R227H, GNPTAB:p.R1189Q,
GPR112:p.S1283Y, GPR98:p.R4142W, GRIA3:p.S646Y, GRM6:p.E363D,
HMCN1:p.S133Y, HSPA4L:p.R483C, HTR2A:p.S219L, INTS7:p.R940C,
INTS7:p.R106I, ITM2C:p.E167K, JAKMIP2:p.R283I, KCND3:p.S438L,
KCNS2:p.D211N, KDM1B:p.F361L, KIAA0556:p.L330I, KIAA1147:p.A149V,
KIF23:p.R150Q, KIF27:p.K925N, KIF9:p.R594Q, KLHL13:p.E213K,
KLHL28:p.E33K, LIN9:p.R183W, LRBA:p.E2103K, LRP2:p.R2432I,
MAGI2:p.L450M, MC5R:p.A109T, MEGF10:p.S1053L, MKI67:p.T1664fs,
MKLN1:p.F485L, MMRN1:p.F917L, MSH4:p.E730K, MTOR:p.S2215Y,
MUC7:p.S336L, MYBPC2:p.R646H, N4BP2L2:p.R506C, NAPSA:p.R121Q,
NCOA7:p.E369D, NCR1:p.R258W, NEK11:p.R374Q, NHEJ1:p.R109Q,
NNMT:p.E233K, NOTCH4:p.15_16LL>L, NPY1R:p.A371T, NRAS:p.Q61R,
OGDHL:p.R57C, OMA1:p.R445Q, OPRM1:p.R462C, OR4C12:p.F248L,
OR5AK2:p.K89N, OSBPL6:p.R577Q, PCDHAC2:p.K138N, PCDHB12:p.R289C,
PCDHGC5:p.A70T, PIK3CA:p.R38H, PIK3CA:p.E39K, PIK3CA:p.E110del,
PIK3CA:p.K111E, PIK3CA:p.Q546K, PIK3CA:p.M1043V, PIK3CA:p.M1043I,
PLA2G3:p.R201Q, PLXNA1:p.E1295K, PON1:p.R306Q, POTEE:p.R303I,
POTEF:p.K674N, PPP2R1A:p.S256F, PPP2R3B:p.F310L, PRAM1:p.A268T,
PREX1:p.E1246K, PRKCQ:p.A324V, PTEN:p.R130P, PVRL4:p.A358T,
RAI2:p.S385Y, RBM39:p.T353I, RELNp F2722L, RFPL1:p.R148Q,
ROBO2:p.D1018N, ROS1:p.R245I, RPS6KA6:p.S394Y, RSBN1:p.E572K,
RYR1:p.A2576T, SACS:p.R2906Q, SCAPER:p.R366Q, SELP:p.R429W,
SENP7:p.S673Y, SEPHS1:p.E13K, SFRP4:p.R232Q, SGK1:p.K367del,
SIX1:p.E191K, SLC10A7:p.S261L, SLC12A2:p.R828Q, SLC16A14:p.R495Q,
SLC7A2:p.R322W, SMCR8:p.E175K, SOS1:p.N233Y, SPOP:p.E50K,
STRN3:p.K218N, STXBP6:p.D92N, SULT1E1:p.R77Q, SUN3:p.L124I,
SUSD1:p.R343C, SYNM:p.R516Q, TAF1:p.R843W, TDRD3:p.R322Q,
THADA:p.S1941L, TLN2:p.S208L, TMEM161B:p.R315Q, TMPRSS3:p.R16Q,
TP53:p.Y220C, TPTE:p.S423L, TRANK1:p.E846K, TRPC5:p.S490L,
TRPM3:p.R429W, TSSK1B:p.E301K, TTLL7:p.R751H, TTN:p.S20317L,
TTN:p.E6404K, TTN:p.R4434Q, TTN:p.R2506Q, UGT8:p.E102K,
USF1:p.R52Q, USP16:p.R455Q, USP25:p.R873H, USP33:p.R36Q,
VPRBP:p.R802Q, VPS13B:p.R692Q, WDR65:p.F110C, YTHDC2:p.E185K,
ZFYVE1:p.R266Q, ZKSCAN1:p.R541fs, ZNF117:p.R157I, ZNF180:p.R569I,
ZNF195:p.R59Q, ZNF254:p.K179N, ZNF263:p.R510I, ZNF333:p.R554Q,
ZNF354B:p.R402I, ZNF442:p.R309Q, ZNF454:p.R376I, ZNF485:p.R374I,
ZNF488:p.R206Q, ZNF559:p.E284K, ZNF594:p.R287I, ZNF611:p.R390I,
ZNF645:p.R154C, ZNF649:p.R338Q, ZNF649:p.R198I, ZNF674:p.R405I,
ZNF675:p.R220I, ZNF678:p.R564I, ZNF732:p.R354I, ZNF780A:p.R466Q,
ZNF823:p.R547I, ZNF836:p.R854I, ZNF836:p.R630I, ZNF841:p.R757I, and
ZNF98:p.R370I.
[0143] 59. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0144] (a) the population of subjects is suffering
from ACC; and [0145] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of ZFPM1:p.EPL444del, GARS:p.P42A, ZNF517:p.V349A,
LRIG1:p.L24V, CCDC102A:p.R96W, OPRD1:p.C27F, SOWAHA:p.R124P,
LACTB:p.MSL, TOR3A:p.F13L, ZFPM1:p.E444fs, ZNF787:p.D367del,
LRIG1:p.L26V, IRX3:p.L422P, TRIOBP:p.H1300R, TUBA1C:p.L146F,
ZFPM1:p.P445fs, ZFPM1:p.446_447LA>P, TPO:p.S398T, USP42:p.R779P,
ERCC2:p.D312N, GLTPD2:p.D209E, OTOP1:p.LLW104del, RINL:p.P402L,
AMDHD1:p.S3G, ASPDH:p.Q266R, KCNK17:p.S21G, TMEM247:p.Q128E,
MUC5B:p.D682G, OBSCN:p.R4516W, FAM184B:p.R784W, SEMA5B:p.V840D,
ZNF598:p.E25G, ADAD2:p.G44E, C1orf106:p.R538C, ZAR1:p.Q42H,
PANK2:p.G126A, PODXL:p.28_30PSP>P, SALL3:p.L593V, THEM4:p.L17R,
C2orf81:p.T315P, CLDN23:p.V210M, FAM109A:p.GGG156del, FPGS:p.I22V,
HHIPL1:p.V692A, MUCSB:p.M2869T, PLEC:p.R1386Q, SYT8:p.R373W,
TAF5:p.S130A, TMEM189-UBE2V1:p.N6D, UQCRFS1:p.S6A, B3GNT6:p.L316fs,
CCDC105:p.P499T, CLIC6:p.Q298E, IDUA:p.T374P, NOTCH2:p.C19W,
RGS9BP:p.A96S, RREB1:p.G783V, SP8:p.G165del, WDR34:p.W60G,
C19orf10:p.G12R, CELSR2:p.16_17insP, FAM75C1:p.71_71H>HLVSQRH,
GPRIN2:p.R446H, KBTBD13:p.A81V, OGFR:p.S557T,
PODXL:p.30_30P>PSP, BHLHE22:p.L62Q, C4orf32:p.G32E,
C5orf65:p.Q245R, KNDC1:p.V806D, KRTAP10-6:p.49_49P>PSCCAP,
LRP11:p.P92R, MAP1S:p.S411C, NOL9:p.S58A, RASIP1:p.R601C,
RGMB:p.S63R, SARM1:p.R23P, TSC22D2:p.A419T, ZNF628:p.T230A,
ZNF814:p.A337V, AATK:p.A541T, BTBD11:p.G265A, CRIPAK:p.C143R,
KCTD3:p.F9V, KRT8:p.S59A, MUC5B:p.S681G, NCOR2:p.1846_1847insSSG,
OGFR:p.E556K, APOE:p.C130R, C10orf95:p.A85S, C13orf33:p.R59G,
CRIPAK:p.C174R, FAM18B2:p.C51Y, GLI3:p.P998L, GLTSCR2:p.Q389R,
HECTD2:p.P19A, IRF2BPL:p.123_125QQQ>Q, MEX3C:p.179_182AAAA>A,
NEFH:p.EE658del, RNF149:p.S9G, RNF222:p.A133T, SEZ6L2:p.R74P,
TNIP2:p.R73G, ARRDC4:p.T79A, B3GNT6:p.P330fs, BAG1:p.G45R,
C22orf26:p.P28L, CHDH:p.E40A, COQ2:p.V66L, CTGF:p.H83D,
DLEU7:p.A83V, EPPK1:p.D2378H, FAM86C1:p.R30P, FZD1:p.93_94insP,
GPRIN2:p.V241M, GPX1:p.11_13AAA>A, HES3:p.P96T, JMJD4:p.A11V,
KANK3:p.R359H, LPPR2:p.A186S, NEFH:p.665_666insEE, NOM1:p.R24G,
RNF39:p.G263C, SCRT1:p.S133A, SNED1:p.L1228P,
TTLL11:p.122_123insKA, ZCCHC3:p.A159del, ZNF219:p.QP233del,
ASB16:p.T249A, ASB2:p.H515P, ATP9B:p.S39G, AVL9:p.G7fs,
C17orf96:p.L63V, C19orf29:p.A499V, CRB2:p.T1110M, CRIPAK:p.P173R,
CRIPAK:p.I190L, CSGALNACT2:p.L362F, CTBS:p.LAL31del, CTNNB1:p.S45P,
DMRT1:p.S45T, DOK7:p.G461D, FBRSL1:p.A836V, FEZ2:p.P50L,
FRG1:p.S169N, HSD17B1:p.G313S, IBA57:p.S130R, KIF1A:p.E917D,
KRTAP9-1:p.160_160Q>QPSCGSSCCQ, LURAP1L:p.55_56insGGG,
NMU:p.A19E, NMU:p.A18E, NOXA1:p.D6E, NPTX1:p.G100D, PUNS:p.R306W,
TBP:p.95_96insQ, TMEM200C:p.S498G, TNXB:p.V706fs, VARS:p.P51S,
ZC3H12D:p.P405S, and ZZEF1:p.V30A.
[0146] 60. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0147] (a) the population of subjects is suffering
from CESC; and [0148] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of PIK3CA:p.E545K, PIK3CA:p.E542K, MAPK1:p.E322K,
EP300:p.D1399N, ERBB2:p.S310F, ERBB3:p.V104M, KRAS:p.G12D,
ANKRD12:p.E721Q, ANKRD36:p.M1144T, MICA:p.G318fs, PIK3CA:p.E726K,
PTEN:p.R130Q, ABCD1:p.S606P, ACTL7B:p.E211K, ADAM21:p.F129C,
ADAMTS12:p.P1053A, AKT1:p.E17K, ANKLE1:p.V643L, ANO3:p.M956I,
AOAH:p.R326T, APOD:p.S115L, ASCC1:p.H207Y, ATM:p.S800F,
AURKA:p.S387L, BAG5:p.M286I, C12orf43:p.E28Q, C16orf3:p.G65S,
C3orf70:p.S6L, C4orf21:p.E800Q, CALB2:p.K60N, CALCB:p.R81T,
CCDC152:p.E153Q, CCDC153:p.R58C, CDC27:p.P242S, CFHRS:p.R441H,
CLOCK:p.L123fs, CMYAS:p.E2733K, CNTRL:p.P185S, CSHL1:p.R117Q,
CSMD3:p.H952Y, CTNNB1:p.D32G, CTSH:p.E254Q, DHPS:p.F49L,
DMPK:p.R44H, DNAH14:p.F622fs, DNAH3:p.E3367Q, DNAH8:p.E587D,
DNASE1L1:p.D212N, ECE2:p.D254N, FAM71B:p.H445D, FAM73A:p.G23V,
FAS:p.E261K, FBW7:p.R505G, FBXW7:p.R465C, FEZF2:p.E82K,
FKBPL:p.E161Q, FMNL1:p.E927Q, GPATCH3:p.E275Q, GPR142:p.R304T,
GPRIN2:p.T100P, GRAMD2:p.I123M, HERC2:p.S329F, HGF:p.G229A,
HIF3A:p.A72T, HIST1H1B:p.K188N, HIST1H2AL:p.R30P, HIST2H2AC:p.R30P,
HLA-C:p.N104K, HLA-DPB1:p.G114fs, HRNR:p.G2539S, INVS:p.R799K,
JPH3:p.Q433H, JUP:p.S627L, KIAA1211:p.R308fs, KIAA1211:p.E309fs,
KLK2:p.E161K, KRAS:p.G13D, KRAS:p.G12V, LIN9:p.E231K,
LOC151174:p.P90S, LRRC37A3:p.A406D, LRTM2:p.L176V, MEPE:p.S30T,
MUC12:p.R2634C, MUC4:p.S2936L, MYOM2:p.D988N, NFE2L2:p.D29H,
NOTCH2:p.R2298W, NPIPL1:p.P250L, NR5A2:p.E80K, NYAP2:p.R197Q,
OBSL1:p.E1642K, OR13C2:p.L9V, OSBP:p.Q721H, PAOX:p.H107Y,
PDILT:p.E500K, PIAS3:p.D460N, PLEKHO2:p.E351Q, PNRC1:p.R73C,
PPP4R1:p.L597F, PREP:p.F469L, PRKDC:p.Q3568E, PSME3:p.R231W,
RANBP6:p.R915W, RCAN2:p.D440N, RNPC3:p.E116fs, SDHAP1:p.H66Y,
SDHAP2:p.S37fs, SERPINA3:p.K158N, SERPINA4:p.R98C, SF1:p.R255W,
SGSM1:p.E818K, SIM1:p.V213M, SLC10A4:p.F281L, SLC25A5:p.I79F,
SLC35G2:p.K62fs, SLC4A9:p.R617C, SLCO2A1:p.M479I, SND1:p.Q38E,
SPATA17:p.R72K, SRSF12:p.S150C, TADA2B:p.E67K, TCTEX1D2:p.S74L,
TEDDM1:p.M166I, TEX15:p.E1652Q, TMC2:p.E92D, TMEM131:p.E1319Q,
TNKS2:p.T619fs, TNS1:p.Q659del, TP53:p.E285K, TRAF3:p.S9F,
TRIM61:p.K98N, TRPM1:p.M996I, TUFT1:p.L101F, U2AF1:p.S34F,
UNC93B1:p.V498M, USP4:p.L259V, VCAN:p.S1308C, WDR17:p.P278S,
ZBED4:p.S385L, ZEB2:p.E1094K, ZFYVE9:p.M1147I, ZNF16:p.R452W,
ZNF677:p.R131T, and ZSWIM4:p.E407K.
[0149] 61. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0150] (a) the population of subjects is suffering
from CRC; and [0151] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of KRAS:p.G12D, KRAS:p.G12V, BRAF:p.V600E, KRAS:p.G13D,
TP53:p.R175H, PIK3CA:p.E545K, FBXW7:p.R465H, KRAS:p.A146T,
PIK3CA:p.H1047R, TP53:p.R248W, CDC27:p.D555E, SMAD4:p.R361H,
TP53:p.R273H, KRAS:p.G12C, NRAS:p.Q61K, ERBB2:p.V842I,
ERBB3:p.V104M, FBXW7:p.R465C, PIK3CA:p.R88Q, PIK3CA:p.E542K,
TP53:p.R273C, TP53:p.G245S, AXIN2:p.G665fs, C16orf45:p.T106N,
C20orf26:p.R1088Q, DNMT1:p.E432K, FBXW7:p.R505C, HLCS:p.E362K,
HPSE2:p.K58N, KIF14:p.R598Q, KIF18A:p.R17C, KIF20B:p.E991K,
KLHL5:p.R326C, KLK2:p.P57T, KRAS:p.G12A, KRAS:p.G12S,
LPHN3:p.R1183Q, LRP6:p.R675Q, MYH8:p.R1048Q, NRAP:p.E327K,
NRAS:p.G12C, PIK3CA:p.N345K, POSTN:p.R508C, PPP2R1A:p.R183W,
PTEN:p.R130Q, RAF1:p.S257L, SDK1:p.T1181M, SGSM1:p.F1117L,
TCF7L2:p.R482fs, TP53:p.R282W, TRIM23:p.R289Q, UGT8:p.E102K,
ZNF491:p.R343Q, A2M:p.R732Q, AADACL4:p.A266T, ABCA8:p.E1158K,
ABCA8:p.R842Q, ABCA8:p.A696T, ABCB8:p.R345H, ACACA:p.R1731C,
ACADM:p.F48C, ACOT9:p.R50Q, ACPP:p.R105Q, ACTL7B:p.R354H,
ACTL9:p.R331H, ACVR1:p.S290L, ADAM30:p.S314Y, ADAM32:p.R559Q,
ADAMTS16:p.D817N, ADAMTS4:p.R156W, ADCY5:p.R661H, AGMAT:p.V313M,
AGPAT4:p.A212T, AKAP12:p.E1282K, AKAP9:p.L3482I, ALB:p.S294L,
ALDH1L1:p.A870T, ALG2:p.S302Y, AMOTL1:p.R676Q, AMPD1:p.K502N,
AMPH:p.R292W, ANKRD6:p.R479C, APBA1:p.K730N, APBA1:p.E624K,
APC:p.E847fs, APC:p.F1354fs, APC:p.M1413fs, APOB:p.R3136C,
APOB:p.A43V, APPL1:p.R668W, AQPEP:p.A309T, ARF4:p.R149H,
ARFGEF1:p.D1632N, ARHGAP32:p.E1253K, ARHGAP36:p.R128C,
ARHGAP36:p.A147V, ARHGAP5:p.D890fs, ARNTL:p.T395M, ARPP21:p.R338H,
ARSG:p.V131I, ASCC3:p.R1197Q, ATP10D:p.R311H, ATP6V0A4:p.R191Q,
ATP9B:p.R265Q, AXDND1:p.E930D, AXIN2:p.W663fs, B2M:p.L13fs,
B3GALNT1:p.R145Q, BACH1:p.R538Q, BAG5:p.D439N, BBOX1:p.F176V,
BCL2L11:p.R91Q, BCL7A:p.T52M, BCLAF1:p.R37fs, BEND5:p.R198C,
BICD2:p.R162H, BLVRA:p.S44L, BMP3:p.R344W, BNC2:p.R512W,
BRPF1:p.R66C, BRWD3:p.R787C, BTBD7:p.S436L, BUB1B:p.F996L,
BZRAP1:p.V1627I, C11orf30:p.R1111C, C14orf101:p.E295K,
C14orf102:p.D115N, C14orf105:p.R100I, C15orf2:p.V488I,
C15orf33:p.D340N, C16orfK:p.R151I, C1RL:p.L351fs, C22orf40:p.P32fs,
C3orf39:p.R333W, C5orf30:p.D4N, C5orf4:p.R114Q, C6orf170:p.K724T,
C7orf63:p.A10T, CACHD1:p.S720Y, CACNA1A:p.T665M, CACNA2D3:p.A332T,
CACNB2:p.R608H, CACNG3:p.V134I, CACNG3:p.A138V, CACNGS:p.G121R,
CADM1:p.S190L, CADPS:p.A1073T, CAPRIN2:p.E13K, CARD11:p.R423Q,
CASC1:p.R54Q, CASP14:p.R5W, CBFB:p.E152K, CC2D2A:p.R1284C,
CCDC18:p.K615N, CCDC60:p.R230H, CCDC81:p.R259I, CCDC188C:p.P1851fs,
CCKBR:p.V236M, CD101:p.D283Y, CD101:p.R594Q, CD180:p.N228T,
CDC14B:p.R375C, CDCA7L:p.P405fs, CDH10:p.E349K, CDH12:p.D674N,
CDH20:p.A134V, CDH23:p.F177L, CDH2:p.D547Y, CDH9:p.F523L,
CDK16:p.R108C, CEACAM5:p.L640I, CEP152:p.E21K, CERS3:p.E95D,
CHD4:p.R975H, CHD5:p.A801T, CIZ1:p.V668A, CLEC18A:p.R423H,
CLTCL1:p.R481W, CMAS:p.R110Q, CNRIP1:p.R102W, COBLL1:p.K732N,
COL14A1:p.R1082I, COL17A1:p.P1004L, COL4A6:p.L550I,
COL6A3:p.D2792N, COPB1:p.R425C, CORO2A:p.*526R, COX15:p.L86I,
CSMD1:p.S781Y, CTCFL:p.E423K, CTDNEP1:p.E126K, CTTNBP2:p.R164C,
CYP4B1:p.E434D, DACH2:p.R539C, DBC1:p.V216I, DBF4B:p.S254Y,
DCHS2:p.F2149L, DCLK2:p.S549Y, DDI1:p.R275Q, DENND4A:p.P357H,
DENND4C:p.R1081Q, DHTKD1:p.R410Q, DISP1:p.R763C, DKK2:p.R230H,
DKK4:p.R203Q, DLC1:p.A350V, DLC1:p.E222D, DMD:p.R3195H,
DNAH5:p.R982H, DNAH5:p.R224Q, DNAH9:p.D1547N, DNAJC24:p.E61K,
DNM1:p.A251T, DNMT1:p.E1531Q, DNMT3B:p.R92W, DOCK10:p.A1830V,
DOCK1:p.E864K, DOCK2:p.G170R, DOCK3:p.R1183C, DOCKS:p.E177K,
DOK5:p.R274W, DPP8:p.G165R, DPY19L1:p.F378L, DUOX2:p.F880L,
DVL2:p.A601fs, EBAG9:p.E187K, EBF3:p.G255fs, EDNRB:p.L450R,
EGR2:p.R390H, EHD3:p.E44K, EIF2C1:p.R139Q, ELF3:p.F305fs,
ELMOD2:p.T141M, EMR2:p.S75L, ENAM:p.R373H, ENOX2:p.R356W,
ENTPD7:p.E327K, EPG5:p.D369N, EPHB2:p.R392H, ERCC6:p.V780I,
ERCC6L:p.R505Q, ERRFI1:p.A421T, ESCO1:p.R300Q, ETV6:p.R369W,
F8:p.S2269Y, FAM123B:p.F173fs, FAM135B:p.R884H, FAM169B:p.K165N,
FAM170A:p.E56K, FAM171B:p.D459N, FAM181A:p.R109H, FAMSB:p.R402C,
FBXO11:p.A432V, FBXW7:p.R689W, FBXW7:p.S582L, FBW7:p.R14Q,
FGF14:p.A236V, FHDC1:p.R254W, FHOD3:p.A225T, FHOD3:p.E813K,
FMO3:p.F510L, FNDC1:p.R652H, FOXK1:p.R354W, FOXN3:p.P96fs,
FPGT-TNNI3K:p.R455H, FZD3:p.D367N, GABRA4:p.R460Q, GABRA5:p.S126N,
GABRB3:p.D500N, GALNTL5:p.R262I, GJA1:p.R362Q, GLRA3:p.L454I,
GLRA3:p.F132L, GOLGA4:p.Q1536H, GP2:p.S41L, GPC6:p.A214T,
GPLD1:p.R717Q, GPR125:p.R113Q, GPR156:p.F754L, GPR158:p.D566N,
GPR21:p.R216H, GPR61:p.A62T, GPR98:p.R4142W, GPRCSA:p.V301,
GRAP2:p.E69D, GRIA1:p.R218C, GRIA2:p.R845Q, GRM7:p.R679Q,
GTF3A:p.K306N, HAO1:p.R172C, HARS2:p.R168H, HBB:p.F42L,
HCN4:p.R525H, HDAC5:p.A1044T, HGF:p.S467Y, HIPK4:p.R280H,
HLA-DMA:p.E84K, HMG20A:p.E248D, HPS3:p.S468L, HRSP12:p.R120Q, HS3
ST1:p.E287K, HTR3B:p.R236C, HTR5A:p.R152C, HTT:p.D1548N,
HYDIN:p.R1187C, HYDIN:p.R939Q, HYDIN:p.R451Q, HYOU1:p.R158C,
IFT172:p.A944V, IGJ:p.R77Q, IL17RA:p.Q803fs, IL1RAPL2:p.T647M,
IL3:p.A90T, IL5RA:p.L47I, INPP5D:p.R523Q, INPP5K:p.R263C,
IRAK3:p.R267Q, IREB2:p.R419Q, ITGA4:p.T673M, ITGA4:p.F900L,
ITIH5:p.A912T, ITK:p.E196K, JAG1:p.A462T, JAK1:p.V310I,
KAL1:p.V303I, KBTBD8:p.V549I, KCNA3:p.A415V, KCND3:p.S438L,
KCNMB4:p.F209L, KCTD20:p.L314fs, KDELC1:p.L447I, KIAA0528:p.R181Q,
KIAA0556:p.R1082W, KIAA1109:p.S4937Y, KIAA1804:p.V474M,
KIAA1804:p.R477W, KIF16B:p.R145Q, KIF26B:p.A1114V, KPNA4:p.R29Q,
KRAS:p.K117N, KRAS:p.Q61L, KRAS:p.Q61K, KRT6B:p.L197P,
L1CAM:p.T186M, LALBA:p.A41T, LAMA4:p.A558V, LBX1:p.R176W,
LPAR4:p.R145Q, LRP1B:p.K2623N, LRP2:p.R3043C, LRP2:p.S737L,
LRRC18:p.R218W, LRRC31:p.K23T, LRRC7:p.R1389H, LZT52:p.P100fs,
MACF1:p.5292L, MACF1:p.F722L, MAEL:p.R345C, MAGEE1:p.V380M,
MAGI1:p.R1198C, MAP1B:p.E2046D, MAP2:p.K530N, MAP2K4:p.R287H,
MAP3K4:p.R275Q, MAP7D2:p.R487C, MAPK8IP1:p.L217fs, MBOAT2:p.R43Q,
MCF2L2:p.R926Q, MECOM:p.R969C, METTL16:p.R200Q, METTL21A:p.R174Q,
METTL6:p.F56L, MFF:p.R162C, MFSD5:p.R280Q, MIA3:p.Q356H,
MMAA:p.R326C, MORC1:p.D113Y, MORC2:p.R740H, MPDZ:p.L804I,
MR1:p.S46L, MRPL47:p.L234I, MS4A8B:p.S3L, MSH4:p.K464N,
MSH6:p.T1085fs, MSH6:p.R1095H, MUC16:p.R8606H, MYH13:p.D311N,
MYH7:p.R1689C, MYO1D:p.E246K, MYO3A:p.N525H, MYO6:p.D1180N,
MYO9A:p.R2179Q, MYO9A:p.R167Q, MYOZ2:p.E251K, MYT1:p.E226K,
NAA25:p.S807Y, NCAM1:p.R474W, NCOA4:p.R562Q, NEB:p.D5434N,
NEB:p.L15911, NEB:p.E1214K, NEDD9:p.A798T, NEDD9:p.A316T,
NEK1:p.R608C, NFASC:p.V256I, NINL:p.R1366C, NLRC4:p.D593N,
NLRC4:p.E409K, NLRP4:p.V229I, NLRP5:p.R392H, NME9:p.E75K,
NOLC1:p.T428M, NPC1:p.E451K, NPSR1:p.R235Q, NRAS:p.Q61L,
NRAS:p.G13R, NRAS:p.G12D, NRG2:p.T246M, NTN4:p.E59K, NUB1:p.R373Q,
NUDT15:p.S83Y, NUF2:p.S340L, NUP88:p.A302V, ODZ1:p.R2556W,
OGDHL:p.A427T, OGFRL1:p.E427K, OLFM4:p.K132N, OPRM1:p.R353H,
OR10A3:p.S93Y, OR2M3:p.R235H, OR52W1:p.R133C, OR5AU1:p.R312H,
OR5B17:p.R163H, OR8S1:p.A99V, OSTN:p.R115Q, OTOL1:p.V431I,
OTUD3:p.R277I, PAN3:p.S580N, PANK3:p.R260I, PAX3:p.T424M,
PCBP1:p.L102Q, PCDH10:p.V477M, PCDH15:p.R1552I, PCDHAC2:p.A519T,
PCDHAC2:p.E190K, PCDHAC2:p.A266T, PCDHAC2:p.A156V, PCDHAC2:p.E271K,
PCDHAC2:p.A736V, PCDHB5:p.D51Y, PCDHB8:p.D235N, PCDHGC5:p.S289L,
PCDHGC5:p.V662M, PCNXL2:p.R135Q, PCOLCE2:p.A348V, PCOLCE2:p.R87H,
PDE4B:p.S417L, PGAM1:p.R240H, PHF3:p.R1410I, PIAS2:p.S519L,
PIGR:p.A580T, PIK3CA:p.D350G, PIK3CA:p.E545A, PIK3CA:p.E545G,
PIK3CA:p.Q546K, PIP4K2C:p.R204H, PKHD1L1:p.F1856L, PLA2G4A:p.E443K,
PLCG2:p.E544K, PLCG2:p.D973N, PLEKHA6:p.V328fs, PLEKHG4B:p.E384K,
PLK1:p.D233G, PLOD3:p.R297fs, PLSCR3:p.E77K, PLXNC1:p.S462L,
PLXNC1:p.R819C, POLA1:p.E603D, POLE:p.S459F, POLE:p.V411L,
POLQ:p.R860Q, PPP2R2B:p.P326L, PPP2R5C:p.S259Y, PRAMEF4:p.R248H,
PREX1:p.V731I, PRKAA2:p.R407Q, PRKAR2B:p.S309L, PRKCI:p.R480C,
PRKRA:p.K122N, PSG8:p.R397C, PSG8:p.R320C, PSMD12:p.R201Q,
PTPDC1:p.R430W, PTPN12:p.R765Q, PTPN13:p.S887L, PTPRD:p.L1053I,
PTPRU:p.D1434N, PXDN:p.P856fs, PXDNL:p.T1312M, QRSL1:p.S226L,
RAB7L1:p.R79W, RALGAPA1:p.R398C, RANBP2:p.R1231C, RBBP7:p.E313K,
RBBP7:p.E274K, RBFOX2:p.A340T, RBMXL1:p.R331Q, RHOBTB1:p.T464M,
RIMS2:p.R599Q, RIN3:p.S708L, RLBP1:p.D281N, RLBP1:p.A72V,
RNASET2:p.A127V, RNF113B:p.A172V, RNF150:p.R236Q, RNF150:p.S208L,
RNF43:p.S216L, ROR2:p.D672N, RPL6:p.F193C, RPS6KA5:p.E166K,
RSPO2:p.R28C, RUVBL1:p.E431K, RUVBL1:p.R117C, RWDD2B:p.R254H,
RXFP3:p.R113C, RYR3:p.R2705Q, SAGE1:p.R229C, SCFD2:p.R545W,
SCML4:p.R194Q, SCN10A:p.T1570M, SCN11A:p.A1688T, SCN11A:p.V1289I,
SCN11A:p.V566I, SCUBE2:p.V342M, SEMA3A:p.D81N, SEMA4D:p.R252Q,
SEPHS1:p.R371Q, SEZ6L:p.S207L, SFPQ:p.R611Q, SFSWAP:p.S617Y,
SGCG:p.A220V, SGCZ:p.I41M, SH3TC2:p.R89C, SIGLEC11:p.S363F,
SIPA1L1:p.R1063Q, SIPA1L1:p.S1227Y, SLC12A1:p.S292L,
SLC22A15:p.S201L, SLC24A2:p.A134V, SLC25A40:p.R96Q, SLC2A7:p.A65T,
SLC30A9:p.R194H, SLC33A1:p.S542L, SLC35F3:p.A280T, SLC39A7:p.R382C,
SLC43A1:p.P133L, SLC43A3:p.R216H, SLC44A5:p.R185H, SLC6A2:p.A562T,
SLC8A1:p.R431H, SLFN12L:p.F232fs, SLITRK1:p.R52H, SLITRK3:p.S298L,
SMAD2:p.R321Q, SMARCA4:p.R381Q, SOCSS:p.S464L, SORBS1:p.V1156M,
SORBS1:p.F570L, SORCS2:p.R320W, SOX6:p.R719W, SPATA22:p.S150L,
SPEG:p.A944V, SPTB:p.R86C, SPTBN4:p.A1993V, STIM2:p.R572Q,
STT3B:p.D583Y, SULT1C4:p.R85Q, SUN3:p.E128K, SUPT6H:p.A957T,
SYNE1:p.I1249L, SYNE1:p.R170W, SYNE2:p.K3103N, SYNGR4:p.R169Q,
SYT7:p.T349M, TANK:p.S380L, TAS1R2:p.R270C, TAS2R1:p.F183L,
TCF7L2:p.R488C, TDRD10:p.S322L, TECTB:p.L29I, TEKTS:p.R401H,
TGFBR1:p.S241L, THAP5:p.S287Y, THSD7B:p.R90H, TLL1:p.T153M,
TLL2:p.S872L, TM9SF2:p.R91H, TMCC3:p.R110H, TMEM132A:p.R481C,
TMEM132D:p.R578W, TMEM55A:p.R189Q, TMEM74:p.R125Q,
TMPRSS11A:p.S288L, TNIP2:p.A139T, TOP2B:p.R656H, TOX:p.S354L,
TP53:p.G244D, TP53:p.R175C, TPO:p.A826T, TPR:p.S2155L,
TPTE2:p.R258Q, TPTE:p.S423L, TRAK1:p.D627N, TRAPPC11:p.R568Q,
TRIM23:p.R396Q, TRIM44:p.D331N, TRIO:p.R661W, TRPA1:p.K54N,
TRPC5:p.S490L, TRPM6:p.R995H, TRPM7:p.R1862C, TRPM7:p.R843Q,
TRPS1:p.R1125W, TRPVS:p.R492H, TRRAP:p.R3515W, TSHZ1:p.R881M,
TTC21A:p.S270Y, TTN:p.R22795C, TTN:p.R3193Q, TTN:p.R328H,
TUBA3D:p.R243Q, TUFT1:p.A340T, TXNDC15:p.R343Q, UBE2NL:p.R86I,
UBIAD1:p.A97T, UGT2A1:p.N97fs, USH2A:p.F2369L, USP11:p.A286T,
USP25:p.R1119Q, USP26:p.R861Q, USP29:p.F81L, USP31:p.D391N,
USP40:p.S851L, UTP14A:p.V148I, VAV3:p.E685K, VCAN:p.R1125H,
VPS13C:p.D1359Y, WBSCR17:p.R228C, WDR3:p.E841K, WDR52:p.A157T,
XKR6:p.R268Q, XPOT:p.R541W, YTHDC1:p.R267Q, YTHDC2:p.E634K,
ZBBX:p.R596I, ZBTB24:p.L607I, ZC3H13:p.R103Q, ZCWPW2:p.D144N,
ZEB2:p.R156H, ZFHX4:p.E237D, ZFP14:p.R386C, ZFP28:p.R525I,
ZFP2:p.R150I, ZFP3:p.R273I, ZFP90:p.R330Q, ZHX2:p.V790I,
ZIC4:p.S305L, ZIM3:p.D352N, ZKSCAN4:p.R319Q, ZMYM4:p.R1446Q,
ZNF117:p.R185I, ZNF167:p.R683I, ZNF180:p.R401I, ZNF19:p.R349I,
ZNF205:p.R384C, ZNF236:p.S1480L, ZNF248:p.R568I, ZNF259:p.R174I,
ZNF266:p.R512Q, ZNF266:p.R344Q, ZNF280B:p.E363K, ZNF283:p.R392Q,
ZNF32:p.S62L, ZNF345:p.R82Q, ZNF345:p.R334I, ZNF350:p.R310Q,
ZNF434:p.R306C, ZNF439:p.E239D, ZNF439:p.R262I, ZNF443:p.R301I,
ZNF445:p.L682M, ZNF470:p.R641I, ZNF471:p.R282I, ZNF484:p.R138C,
ZNF528:p.R279Q, ZNF563:p.K26N, ZNF573:p.R350I, ZNF583:p.R344I,
ZNF585A:p.E638K, ZNF585A:p.E491D, ZNF625:p.R235Q, ZNF652:p.K327N,
ZNF677:p.R451I, ZNF678:p.R368I, ZNF699:p.R41I, ZNF70:p.R244I,
ZNF770:p.S441P, ZNF774:p.R423Q, ZNF782:p.K247T, ZNF7:p.R337I, and
ZNF831:p.E949D.
[0152] 62. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0153] (a) the population of subjects is suffering
from DLBCL; and [0154] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of EZH2:p.Y641F, MYD88:p.L273P, BCL2:p.G33R,
CARD11:p.E626K, ADCY2:p.A87V, BCL2:p.N172S, BCL2:p.H20Q,
BRAF:p.K601E, BTG1:p.L31F, CACNA1E:p.R1458C, CARD11:p.E93D,
CD79B:p.Y197D, CD79B:p.Y197H, CREBBP:p.R1446H, GRID1:p.E622K,
HIST1H1C:p.A65V, HIST1H1E:p.G133A, HIST1H3B:p.A48S, KRAS:p.G13D,
MYD88:p.S251N, PABPC1:p.R94C, PIM1:p.L164F, PIM1:p.L184F,
POU2F2:p.T239A, POU2F2:p.T239S, RELN:p.R2971Q, SLC25A48:p.A67T,
STAT6:p.D468H, TNF:p.L47F, and TRAF7:p.R11H.
[0155] 63. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0156] (a) the population of subjects is suffering
from KICH; and [0157] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of ACR:p.W279C, AGRN:p.1284_1285VT>A,
C7orf25:p.R384fs, CAMSAP1:p.T466fs, CBWD6:p.E102fs,
DOCK8:p.L1111fs, EBPL:p.Q196P, EBPL:p.L189V, GFM1:p.A17fs,
GOLGA6L6:p.D570E, ITGA5:p.A48D, LUZP2:p.S154fs, MTMR9:p.K193fs,
MUC16:p.P10452fs, MUC4:p.S2832P, ODF2L:p.K407fs, RHBDD3:p.G34fs,
RILPL1:p.S358R, TAS2R30:p.L236fs, TRRAP:p.A973S, UBR5:p.K2120fs,
URGCP:p.G639fs, ZNF98:p.A222T, and ZSWIM6:p.Q610fs.
[0158] 64. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0159] (a) the population of subjects is suffering
from KIRP; and [0160] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of FAM18B2:p.C51Y, ZNF598:p.E25G, NEFH:p.E645K,
EEF1B2:p.S43G, NEFH:p.AKSPEKEE652del, OBP2B:p.K61N, SKI:p.A62G,
C14orf126:p.R6W, KRT8:p.S59A, ACSBG2:p.I250M, ASIC2:p.R46L,
CSGALNACT2:p.L362F, FRG1B:p.A50P, IDUA:p.H33Q, KRTAP4-5:p.S74C,
SCAF11:p.E926fs, SYN2:p.A34del, ZNF814:p.R322K, BMS1:p.E878D,
JMY:p.P822T, KIF1A:p.E917D, KRTAP4-7:p.S57P, LAMA5:p.L2223R,
LRP1:p.P1058T, MED16:p.H449Q, MUC2:p.T1488P, MUC5B:p.D682G,
NACA2:p.R75K, NEFH:p.665_666insEE, OR2L8:p.S201fs, RGPD5:p.P1760A,
RRN3:p.P11S, RRN3:p.R9C, STAG3L2:p.L81fs, ZNF814:p.G320E,
ACP6:p.V29G, AHNAK2:p.S2166F, AHNAK2:p.P1215S, AP1G1:p.I782fs,
AQP2:p.N68T, BAIAP2L2:p.V396M, BMP6:p.Q118L, BST1:p.G36A,
CDR1:p.V31A, CLDN7:p.S172A, CLIP1:p.S1018fs, COL18A1:p.G884fs,
CROCC:p.A355P, CTAGE15P:p.A364V, CUBN:p.I2816M, DMRT2:p.T106S,
DPY19L1:p.V249L, DSPP:p.D1047N, EBPL:p.L189V, EIF4G1:p.E465del,
EXOSC2:p.R11P, FAM216A:p.P36S, FCGR2A:p.V222G, FMOD:p.S331R,
FOLR2:p.Q112R, FRG1B:p.L20P, GAGE2B:p.9_10insY, GDPD5:p.G593fs,
GIMAP8:p.A544S, GLUD2:p.R300G, GLUD2:p.S496R, GPR135:p.Q5P,
HOXD8:p.Q67H, IER5:p.R194G, IL25:p.C168fs, JSRP1:p.V92A,
KRAS:p.G12D, KRTAP1-1:p.Y86C, KRTAP4-11:p.L161V, LTBP1:p.L163P,
MAML2:p.Q591K, MAPK7:p.A501D, MEF2A:p.P99S, MET:p.H1094Y,
MET:p.M1250T, MST1:p.N435fs, MUC2:p.T1582R, MUC2:p.T1722I,
MUC4:p.A4222T, MUC4:p.T2335M, MUC4:p.P1138L, MUCSB:p.S1098A,
MUC5B:p.S3431N, MYH7:p.A1487T, NBPF10:p.R39fs, NBPF10:p.Y638S,
NEFH:p.654_654S>SPEKAKS, PARG:p.A584T, PBX2:p.Y262F,
PIP4K2A:p.R219K, RLIM:p.S471P, RUNX2:p.Q71E, SGK223:p.R63S,
SMARCB1:p.L365fs, SRCAP:p.Q1875fs, TBC1D2B:p.R920Q,
TCF7L2:p.R482fs, TMEM131:p.K640fs, TMEM60:p.K77fs, TPPP:p.R30K,
TRPV3:p.A218E, TTBK2:p.C83W, UBXN11:p.S510G, UGT1A1:p.T4A,
UTS2R:p.A289E, YBX1:p.P250L, ZNF514:p.V81G, ZNF516:p.A256D,
ZNF681:p.K405Q, ZNF814:p.D404E, ZNF814:p.P323H, ZXDB:p.G206R.
[0161] 65. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0162] (a) the population of subjects is suffering
from LIHC; and [0163] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of TP53:p.R249S, CTNNB1:p.D32V, CTNNB1:p.D32G,
CTNNB1:p.S33P, CTNNB1:p.K335I, CTNNB1:p.H36P, EEF1A1:p.T432L,
GNAS:p.R844C, OR2T4:p.V137L, TP53:p.H193R, ATXN1:p.Q217H,
CSMD3:p.F2383fs, CTNNB1:p.D32N, CTNNB1:p.S33C, CTNNB1:p.G34V,
CTNNB1:p.S45P, CTNNB1:p.N387K, DHRS4:p.I218T, DNM2:p.E378D,
F5:p.Q426L, GALNTL5:p.A45T, GPX1:p.P77R, GRM8:p.R852C,
IDH1:p.R132C, KIF26B:p.A2033T, KRT8:p.S59A, LOC100132247:p.T532P,
NEB:p.D3854H, PIK3CA:p.H1047R, SOLH:p.R714H, TP53:p.R158H,
TP53:p.V157F, and ZNF638:p.D400N.
[0164] 66. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0165] (a) the population of subjects is suffering
from MM; and [0166] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of NRAS:p.Q61R, KRAS:p.Q61H, KRAS:p.G13D, NRAS:p.Q61K,
BRAF:p.V600E, NRAS:p.Q61H, NRAS:p.G13R, ZNF717:p.W315C,
ATP13A4:p.V431G, DNAJC12:p.R135K, IRF4:p.K123R, KRAS:p.A146T,
KRAS:p.Q61R, KRAS:p.G12A, KRAS:p.G12D, ZNF717:p.N594I,
ACTG1:p.A22P, ARL61P1:p.M75L, BEND2:p.E630K, BRAF:p.G469A,
CDHR1:p.R218G, DIS3:p.R780K, DMXL2:p.D2412E, DNAJC10:p.I80K,
EGR1:p.Q9H, FGFR3:p.*807S, IDH1:p.R132C, IL6ST:p.P216H,
INTS12:p.M1V, KRAS:p.K117N, KRAS:p.A59G, KRAS:p.G12R, MAX:p.R36W,
MLL5:p.G492E, NBPF1:p.E810K, NRAS:p.Q61L, NRAS:p.G12D,
ODF2L:p.E294K, PADI2:p.T114P, PNLIP:p.T37M, PRDM1:p.S588C,
PTPN11:p.E76K, PTPN14:p.E286K, RBM6:p.V675G, SCN10A:p.R1142H,
SRGAP1:p.T61M, SUSD1:p.T168P, TAS2R16:p.V231I, TINAG:p.E403K,
TRIP12:p.L1775P, and ZNF717:p.C844S.
[0167] 67. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0168] (a) the population of subjects is suffering
from PRAD; and [0169] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of HSD17B7P2:p.N175S, RGPD5:p.P1760A, FRG1B:p.L52S,
EEF1B2:p.S43G, FRG1B:p.I10T, FRG1B:p.A53T, LRRC37A2:p.T102S,
NBPF10:p.E3455K, PTH2:p.L22V, CYP2D7P1:p.S32A, FAM47C:p.N648D,
MAP3K9:p.E38del, MUC4:p.H4205Q, CHEK2:p.K373E, FRG1B:p.A11T,
FRG1B:p.A50P, HLA-J:p.R124W, KRTAP1-5:p.I88T, KRTAP4-9:p.D18V,
NPIP:p.A271V, PDGFRA:p.R483fs, ZNF780A:p.Q600H, ZNF845:p.R925H,
ZNF91:p.R333H, ARFGAP3:p.N299fs, BTN2A3P:p.P3S, FNBP4:p.TT58del,
HLA-A:p.Q78R, L00554223:p.RAPWMEQ147del, PODXL:p.28_30PSP>P,
POLI:p.D17del, SPOP:p.F133L, SYN2:p.A34del,
TMEM52:p.23_26LLPL>L, UBC:p.L149R, ZNF208:p.I647S,
ZNF799:p.E589G, ZNF814:p.D404E, ASTN2:p.L221del, B4GALNT1:p.G88fs,
C16orf74:p.S21del, CCDC15:p.H458P, CD209:p.R129W, CNTNAP1:p.S10291,
DBR1:p.541_542DD>D, FAM22F:p.S691del, FRG1B:p.D32V,
FRG1B:p.I34T, FRG1B:p.N55D, FRG1B:p.I59V, FRG1B:p.S71N,
KIF25:p.W3R, KRTAP4-11:p.L161V, KRTAP4-11:p.M93V, KRTAP4-11:p.R51K,
KRTAP4-6:p.S153Y, LILRBS:p.S598P, LMOD2:p.E124del,
LOC645752:p.L40P, LRP1:p.P1058T, LRRIQ3:p.K244fs,
LURAP1L:p.55_56insGGG, MLLT10:p.V463E, MYOCD:p.Q310del,
NBPF10:p.N1369D, OTUD4:p.T909I, PARG:p.A584T, PEX1:p.I370fs,
POTEC:p.K507E, POTEC:p.R477Q, POU4F2:p.68_69insG, PRG4:p.T417P,
SDHAP2:p.R31C, SPOP:p.F133C, SPOP:p.W131G, TIMD4:p.T152del,
TMEM121:p.P299del, TP53:p.G245S, UBC:p.R73L, UBC:p.I191T,
WASH3P:p.G175S, ZMIZ1:p.D1048fs, ZNF709:p.T413I, ACADS:p.R330H,
ADAMTS7:p.K1357fs, AFF2:p.R597H, AGAP6:p.S127I, AK302238:p.A44T,
AK302879:p.Q191R, ALDH1A2:p.R85C, ANAPC1:p.T537A, ANKRD36C:p.H438R,
AP4B1:p.R276W, ARFGAP2:p.S38N, BBS9:p.F268fs, BC139719:p.L133R,
BRAF:p.G469A, C22orf43:p.D171del, CANT1:p.K131R, CHD3:p.E35del,
CLEC4A:p.R209H, CNOT3:p.E20K, CNPY3:p.17_18LL>L,
CNTNAP3B:p.S317T, CNTNAP3B:p.M12471, CTNNB1:p.T41A,
DDX10:p.D788del, DLC1:p.S741T, DPY19L2:p.M210V, EDC4:p.S617del,
EFCAB6:p.R379K, ERC2:p.927_928HH>H, FAM111B:p.S269fs,
FEM1A:p.L620M, FHOD3:p.A632fs, FLJ43860:p.L850fs, FMN2:p.G59del,
FNBP4:p.914_915PP>P, FRG1:p.E86del, FRG1B:p.K13N, FRG1B:p.P42Q,
GABRB1:p.R416C, GABRR2:p.A368V, GAGE2B:p.9_10insY, GOLGA8DP:p.N84H,
GOT2:p.R355W, GPATCH4:p.K210fs, HDGFL1:p.188_189insA,
HLA-DQB2:p.G250S, HLA-DQB2:p.R247H, IDH1:p.R132H, IL27:p.E176del,
IRF2BPL:p.123_125QQQ>Q, KANK3:p.DGDS489del,
KIAA1462:p.858_859SS>S, KRTAP4-11:p.S48R, KRTAP4-7:p.S57P,
KRTAP4-8:p.C95S, LPHN3:p.R826H, LRP10:p.L11del, LRP5:p.S1609P,
LRRC16B:p.R787W, MAS1L:p.R324G, MECOM:p.R915Q, MED12:p.L1224F,
MED12L:p.Q2115del, MESP2:p.GQGQGQGQ195del, MGAT4C:p.T345M,
MLEC:p.E238del, MSLNL:p.T68P, MUC7:p.S173P, MYC:p.Q37del,
NBPF10:p.N440D, NLRP6:p.E611del, NOX3:p.C404fs, OR1M1:p.V691,
OR7E24:p.L7fs, OTUD4:p.A153del, PANK2:p.T417fs, PCLO:p.S496P,
PCNT:p.S162G, PCSK9:p.23_24insL, PHOSPHO1:p.S32del,
POU4F1:p.H108del, PRAMEF8:p.R319H, PRDM7:p.M387L, PRG4:p.T597P,
PTPRD:p.R1323C, PTPRF:p.R1174Q, ROBO3:p.RS1367del, ROCK1:p.T518S,
RPTN:p.G296S, RTL1:p.152_152E>EE, SIRPA:p.V2331, SLC2A6:p.A230D,
SLC8A2:p.E710del, SMG7:p.E846fs, SNAPC4:p.S542del, SP8:p.G165del,
SPOP:p.F133I, SPOP:p.F133V, SPOP:p.F102C, SPOP:p.F102V,
SRSF11:p.G17fs, SRSF4:p.K396del, SSPO:p.S4198fs, STAG3L2:p.L81fs,
STK19:p.R18fs, TBC1D2B:p.R920Q, TBC1D9:p.P1233T, TCHH:p.P1158R,
TCOF1:p.K1366del, TNRC18:p.2664_2665SS>S, TP53:p.R248Q,
TP53:p.R175H, TP53:p.C141G, TSPAN4:p.L92V, UBXN11:p.GPGPGPSP504del,
UTP3:p.E81del, WASH3P:p.L187V, ZAN:p.P717L, ZAN:p.L878P,
ZFP90:p.R591fs, ZNF761:p.H373R, and ZNF91:p.H305R.
[0170] 68. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0171] (a) the population of subjects is suffering
from STAD; and [0172] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of RNF43:p.G659fs, BZRAP1:p.P1416fs, XYLT2:p.Y526fs,
LARP4B:p.T163fs, PGM5:p.I98V, ZBTB20:p.P692fs, ARID1A:p.G1848fs,
FHOD3:p.P334fs, KIAA0182:p.T120fs, ATP6V1B1:p.Y383fs,
PIK3CA:p.H1047R, FRMD4A:p.P1005fs, PIK3CA:p.E545K, CDC14A:p.N123fs,
KRAS:p.G13D, MLL2:p.T172fs, BCORL1:p.S1679fs, PLEKHA6:p.V328fs,
C9orf131:p.P342fs, CD4:p.Q164fs, FBXW7:p.R465C, GNG12:p.T68fs,
IRS4:p.G591fs, JARID2:p.V422fs, KIAA0195:p1902fs, MBD6:p.P732fs,
MVK:p.P138fs, PAMR1:p.G101fs, WNT16:p.W165fs, ZNF43:p.N251fs,
ABCA6:p.L306fs, ADAM28:p.K73fs, AOC3:p.L79fs, ATP2A1:p.R819fs,
B2M:p.L13fs, C6orf89:p.P58fs, CNTLN:p.K1305fs, CR2:p.V206fs,
DYRK4:p.K468fs, ERBB3:p.V104M, GLI1:p.W272fs, KRAS:p.G12D,
MLL2:p.T172fs, MSH6:p.T1085fs, NLK:p.C190fs, OR5M3:p.T89fs,
PAX6:p.P375fs, PTEN:p.L265fs, RABGAP1:p.K928fs, RADS 1AP2:p.T316fs,
SVIL:p.G1862fs, TP53:p.R273H, WNK4:p.G606fs, ARID1A:p.P2139fs,
AXIN2:p.G665fs, C13orf33:p.R67fs, C1QTNF5:p.P308fs,
CELSR1:p.G614fs, CRYGD:p.G159fs, DCHS1:p.R235fs, DDC:p.I433fs,
EDNRB:p.Y383fs, EPHA2:p.P460fs, FOXN3:p.P96fs, HDAC4:p.P901fs,
INF2:p.S527fs, KIRREL2:p.V649fs, KLF3:p.I104fs, KLHL14:p.P231fs,
MAP7D3:p.Q308fs, OTX2:p.R44fs, PAFAH1B1:p.K302fs, PLAGL2:p.P10fs,
POLM:p.P97fs, PRPF40B:p.I31fs, RALGAPB:p.T379fs, SBNO1:p.N1139fs,
SERPINI1:p.L81fs, SH3KBP1:p.L574fs, SLC12A7:p.H686fs,
SLC27A3:p.P643fs, TBX4:p.S370fs, TP53:p.R273C, TP53:p.R175H,
TRAM1L1:p.R345fs, WBP1:p.P138fs, ABCC4:p.L883fs, AKAP13:p.K2785fs,
ALDH3A1:p.P562fs, ALPK2:p.L356fs, ARFGEF1:p.P1552fs,
ARID1A:p.G1848fs, AVPR1A:p.F351fs, BAX:p.M38fs, C14orf43:p.P313fs,
C1QTNF5:p.G194fs, C7orf50:p.L179fs, CDC25C:p.K322fs, CETN3:p.K63fs,
CHD3:p.P597fs, CTCF:p.K202fs, CTSC:p.F105fs, DDX17:p.G163fs,
DLGAP3:p.G377fs, EBF3:p.G255fs, FHDC1:p.F100fs, FILIP1L:p.K749fs,
FLNB:p.W529fs, GBP7:p.G431fs, GCC2:p.E700fs, GPR161:p.G517fs,
IWS1:p.S802fs, KIAA0240:p.K895fs, KIAA1967:p.P415fs,
LRRC43:p.D558fs, MACF1:p.R707fs, MBD6:p.G780fs, MLL3:p.F4496fs,
MPRIP:p.A351fs, MUC6:p.2129_2130SS>S, NOX5:p.P467fs,
OPTN:p.P24fs, OR4K5:p.F177fs, PIK3CA:p.N345K, PIK3CA:p.E542K,
PLXNA1:p.P1016fs, PNPLA7:p.P1199fs, PODN:p.I301fs,
PPP2R3B:p.T389fs, PRSS36:p.L680fs, RGL2:p.G203fs, RHOQ:p.V190fs,
RNF111:p.R771fs, RTN2:p.P313fs, SALL4:p.V995fs, SBF1:p.P1076fs,
SETDB2:p.R715fs, SNAPC2:p.T292fs, SPG20:p.F232fs, SRCAP:p.P1876fs,
STAT2:p.P489fs, TCHP:p.E172fs, TP53:p.R282W, TP53:p.R248Q,
USP21:p.K474fs, WDR7:p.G262fs, ZBTB7C:p.E157fs, ZFC3H1:p.K385fs,
ZNF124:p.T339fs, ZNF626:p.K115fs, ADNP2:p.S322fs, AGAP1:p.G127fs,
ALDH2:p.L286fs, ARHGAP5:p.D890fs, ARHGEF17:p.A615fs,
ARID1A:p.Y1324fs, ART1:p.I243fs, ASCL4:p.D35fs, ATXN2L:p.G998fs,
B3GNT5:p.F30fs, BCKDHA:p.H37fs, BCL9L:p.P1127fs, BEND3:p.D265fs,
BNC2:p.S575R, BRD3:p.P24fs, C12orf51:p.P4235fs, C1R:p.P216fs,
C7orf49:p.G130fs, CA2:p.I145fs, CABP5:p.R145fs, CASD1:p.F781fs,
CASP8:p.R471fs, CCDC153:p.P200fs, CD93:p.D280fs, CROT:p.L32fs,
CSF3R:p.P468fs, CTCF:p.K202fs, ERBB2:p.S310F, FAM46D:p.S69R,
FBN3:p.G601fs, FBXO21:p.F144fs, GAS6:p.G150fs, GLYR1:p.G380fs,
GXYLT1:p.L223fs, HAUS6:p.S530fs, IGF2R:p.T1314fs, ITGB1:p.L378I,
KDM3B:p.P1316fs, KIF13A:p.K1115fs, KLF3:p.S224fs, LARP1:p.A223fs,
LRP1:p.G1488fs, LRP1:p.G1488fs, MAGEE2:p.Q45fs, MAMSTR:p.P162fs,
MAPK15:p.Q511fs, MLL2:p.P647fs, MOCS2:p.P22fs, MTG1:p.L105fs,
MTG1:p.H327fs, MTIF2:p.N109fs, NID2:p.R1035fs, PAX2:p.P395fs,
PCCA:p.R230H, PDZD2:p.R101fs, PFKP:p.M593fs, PIK3CA:p.R88Q,
PLA2G1B:p.L53fs, PLAU:p.R201fs, PMEPA1:p.P208fs, POP1:p.K750fs,
PTCH1:p.P1307fs, PTPRT:p.P1075fs, RDBP:p.P6fs, RNMT:p.K392fs,
ROBO2:p.P1080fs, RUNDC3B:p.L6fs, SDAD1:p.K275fs, SLC10A6:p.G109fs,
SNAPC1:p.D211fs, SPATA5L1:p.C685fs, SPTA1:p.K1732T,
STATSB:p.P367fs, SYT4:p.M1fs, TAF1L:p.K851fs, TAP2:p.L75fs,
TBL1XR1:p.N126fs, THEMIS:p.K406fs, TMEM79:p.P161fs, TP53:p.C176F,
TP53BP2:p.K69fs, TP53RK:p.L174fs, UBQLN2:p.A523fs,
UHRF1BP1:p.I1330fs, VPRBP:p.K939fs, VPS13B:p.T56fs, WASF3:p.P305fs,
YLPM1:p.E1178fs, ZC3H13:p.K1006fs, ZC3H18:p.P825fs, ZC3H4:p.E779Q,
ZNF48:p.P247fs, ZNF608:p.A465fs, ZNF878:p.S238fs, ZSCAN18:p.P225fs,
ABCB1:p.R527fs, ABCB6:p.G318fs, ACACB:p.G255fs, ACP1:p.Q123fs,
ACTL6A:p.L88fs, ADAMTSL4:p.G778fs, AGBL5:p.I420fs, AHI1:p.K303fs,
AKAP9:p.M3743fs, AKD1:p.R1209fs, ANKRD40:p.D99E, ARHGEF5:p.S1512fs,
ARID1A:p.K1071fs, ARID3A:p.S557G, ARPP21:p.I130fs, ASPN:p.F67fs,
ASXL3:p.E873fs, ATP6V1C2:p.R312fs, BEST3:p.P444fs, BRAF:p.P403fs,
BRMS1:p.G107fs, BTBD11:p.T45 ifs, BTBD11:p.A561V, C11orf9:p.S261fs,
C14orf102:p.R90fs, C14orf43:p.Q36fs, C15orf52:p.G98fs,
C19orf21:p.R262C, C19orf70:p.P50fs, C20orf160:p.P46fs, C3:p.P890fs,
CADPS2:p.N468fs, CASC3:p.S232F, CASC3:p.P603L, CASC3:p.P645L,
CASC3:p.S658L, CASKIN2:p.P727fs, CBLL1:p.E138fs, CBLN3:p.P69fs,
CCDC108:p.P1164fs, CCDC148:p.K420fs, CCDC153:p.P200fs,
CCDC169-SOHLH2:p.K162R, CCDC88A:p.K677fs, CD1E:p.F85V,
CD3EAP:p.K218fs, CDH11:p.K357T, CDH1:p.D254Y, CDH23:p.V403I,
CFI:p.K37fs, CHPF2:p.D645fs, CIC:p.R507fs, CIC:p.A1114fs,
CIC:p.A1114fs, CLSTN1:p.T615M, CNBD1:p.L396P, CNGA4:p.K510T,
CNOT6:p.S248fs, CNTROB:p.R920fs, COL9A1:p.P283fs, CPAMD8:p.P784fs,
CR1L:p.L79fs, CRB1:p.F630V, CSMD1:p.L3410V, CTNNA3:p.K856fs,
CTNND1:p.I447fs, CTSD:p.P89fs, CUX1:p.A439fs, CYP7B1:p.K332T,
DAB2IP:p.D994fs, DNAH11:p.T871fs, DNAH8:p.K1688fs, DNAJC1:p.K193fs,
DNM2:p.P791fs, DSTN:p.F101fs, DYRK1B:p.Q545fs, EAF2:p.V109fs,
EDNRB:p.A104V, EEA1:p.N570fs, EFHA1:p.F290fs, EGR1:p.P332fs,
EIF4G3:p.K563fs, ELK3:p.S173fs, ENTPD2:p.G204fs, EOMES:p.G332fs,
EPHA10:p.P868fs, EPHB6:p.G54fs, EPHX1:p.P132fs, EPPK1:p.G2015fs,
ERBB4:p.M1fs, ESF1:p.T99fs, EXOSC8:p.L160fs, FAM113B:p.R51fs,
FAM116A:p.L441fs, FAM135B:p.S645R, FAM151A:p.P117fs,
FAM193A:p.D428fs, FAM193A:p.D428fs, FAM214B:p.A42fs,
FAM40B:p.R740C, FAM70B:p.S19L, FASTKD1:p.K3fs, FBXW7:p.R479Q,
FBXW9:p.G298fs, FER:p.L474fs, FERMT2:p.K152fs, FGGY:p.G138fs,
FIGNL1:p.K309fs, FLG:p.K159fs, FLNB:p.W529fs, FOLH1:p.S501fs,
FYB:p.G324fs, GABRD:p.Q412fs, GALNTL1:p.W317fs, GANAB:p.L23fs,
GCDH:p.L389fs, GIMAP7:p.V276fs, GIPC3:p.G227fs, GLI3:p.P1033fs,
GLIPR1L2:p.G92fs, GNPNAT1:p.F54fs, GON4L:p.M134fs,
GPATCH4:p.K210fs, GRK4:p.K22fs, GTF3C1:p.S767fs, GTF3C4:p.E562fs,
H2AFY2:p.K144fs, HCFC1R1:p.P83fs, HCRTR2:p.S9fs, HCRTR2:p.S9fs,
HDLBP:p.G747fs, HECA:p.R333fs, HIVEP3:p.H554fs, HIVEP3:p.P534fs,
HLA-C:p.P209fs, HOOK1:p.L361fs, HOXD8:p.P122fs, HTT:p.G697fs,
IBTK:p.K1213fs, IDE:p.K37fs, IFT172:p.A837T, INPPL1:p.A974fs,
INPPL1:p.P1154fs, INSM2:p.T533fs, INTS12:p.L14fs, INVS:p.R815fs,
IPO11:p.S844fs, IRX6:p.A425V, ISG20L2:p.P288fs, ITGB8:p.A7fs,
JARID2:p.G394fs, JHDM1D:p.R97fs, KBTBD6:p.G442fs, KCNC1:p.K455fs,
KCNH2:p.G149A, KCNJ10:p.P102fs, KCNMB2:p.N151K, KCTD21:p.T6M,
KIAA0586:p.A1592fs, KIAA1009:p.F406fs, KIAA1109:p.E1588fs,
KIAA2026:p.K690fs, KIF26B:p.S1065fs, KIF6:p.L204fs,
KIRREL:p.P335fs, KLC2:p.T568fs, KRAS:p.Q61H, KRAS:p.G12S,
MAN1C1:p.G431fs, MAP1A:p.P2063fs, MAP2:p.K1472fs,
MAP3K12:p.R449del, MAP7D1:p.A80fs, MGST2:p.K102fs, MKI67:p.T1664fs,
MKL1:p.P307fs, MLL2:p.P2354fs, MLL2:p.L656fs, MLL2:p.P647fs,
MLL2:p.L1877fs, MMP3:p.I64fs, MPDZ:p.K1582fs, MTUS2:p.R1005W,
MUC16:p.A6156T, MYB:p.R481fs, MYEOV:p.L269fs, MYH11:p.K1263del,
MYO18A:p.P209fs, MYO7A:p.I539fs, MYOCD:p.G226fs, NAA16:p.H514fs,
NBEA:p.V2247fs, NCAPD3:p.Q909fs, NCAPH:p.T466fs, NCOR2:p.P1308fs,
NEFM:p.A213V, NEK8:p.V690fs, NF1:p.T676fs, NHLRC1:p.F204fs,
NKD1:p.P286fs, NPR3:p.Y138H, NTSM:p.P206fs, NUFIP2:p.R224fs,
NUP210:p.L135fs, NYNRIN:p.G113fs, OBSCN:p.G997fs, OGDH:p.Y948fs,
OR4C16:p.S135R, OR51A7:p.L124R, OR7C1:p.C179fs, OSBP2:p.H627fs,
OTOF:p.E1304K, P2RX1:p.R20fs, PALB2:p.M296fs, PALB2:p.N280fs,
PANK1:p.K400fs, PAPD4:p.C225fs, PAPPA2:p.I1683fs, PARP15:p.K461fs,
PARP4:p.K847fs, PCDH10:p.N118fs, PCDH10:p.P225fs, PCGF3:p.H63fs,
PELI2:p.G197fs, PHACTR1:p.V251fs, PHACTR2:p.S237fs,
PHACTR4:p.S354fs, PHKB:p.K642fs, PIAS3:p.H116fs, PIGO:p.P787fs,
PIGT:p.A346fs, PIK3R3:p.M341fs, PITPNM1:p.P295fs, PKN2:p.K76fs,
PLA2G15:p.W230fs, PLAG1:p.K184fs, PLEKHO1:p.T254fs, PLOD3:p.R297fs,
PLOD3:p.P296fs, PLXNA2:p.P464fs, POLQ:p.L1430fs, PPARGC1B:p.P135fs,
PPL:p.P454fs, PPM1H:p.P226fs, PPP1R12C:p.P372fs, PREX2:p.R562fs,
PRICKLE4:p.Q109fs, PRKAR1B:p.P87fs, PRKCG:p.R345C, PRMT8:p.S28fs,
PROX1:p.F592fs, PRRG3:p.R163fs, PSD2:p.G256fs, PTCHD3:p.F588fs,
PTPN4:p.N319fs, PTPRC:p.Q895H, PWWP2B:p.S84fs, PYGO2:p.Q150fs,
RABGAP1:p.K928fs, RB1CC1:p.N1171fs, RBM6:p.R96fs, RHOA:p.Y42C,
RIMS1:p.R71G, RIMS2:p.V401fs, RING1:p.G171fs, RINT1:p.L107fs,
RNF43:p.P116fs, ROBO2:p.K1293fs, RPS6KA6:p.K109fs, RRS1:p.N45fs,
RSF1:p.K386fs, RUSC2:p.P486fs, RXFP3:p.A60V, SAFB:p.W798fs,
SCARF1:p.R614Q, SCLT1:p.K109fs, SERPINB12:p.Q168fs, SGK3:p.L61fs,
SGOL2:p.E407fs, SIGLEC1:p.P318fs, SIK1:p.Q678fs, SLC16A6:p.G98fs,
SLC25A17:p.F28fs, SLC26A7:p.I629fs, SLC32A1:p.V494I,
SLC4A3:p.L1061fs, SLC7A10:p.P157fs, SLC9A2:p.T746fs,
SLITRK1:p.K45fs, SND1:p.H721fs, SOAT1:p.F64fs, SORBS2:p.E1158fs,
SOX7:p.L309fs, SPAG17:p.Q1264fs, SPTY2D1:p.P485fs, SRCIN1:p.P865fs,
SREBF2:p.H763fs, SRRT:p.G102fs, STAB 1:p.P1120fs, STRADA:p.R333fs,
STX2:p.K252fs, SV2A:p.E138fs, SYCP2:p.M176fs, SYNJ2:p.P1111fs,
TAS2R10:p.L196fs, TBC1D22B:p.A175fs, TEAD2:p.P298fs, TFE3:p.G482fs,
TGM6:p.T358fs, TIMM44:p.K83fs, TIMP3:p.A199fs, TLR4:p.L498V,
TMEM132D:p.P206fs, TMEM41A:p.F156fs, TMEM41B:p.F230fs,
TMTC4:p.R611C, TNK2:p.P632fs, TOPBP1:p.I1381fs, TP53:p.E286K,
TP53:p.P152fs, TRIP11:p.K541fs, TRPA1:p.T673fs, TRPM8:p.H765fs,
TTF1:p.K336fs, TTI1:p.R707H, TTN:p.E15192D, U2AF2:p.L175fs,
UBC:p.G684fs, UBR4:p.P2802fs, UPF2:p.E1033D, UPK2:p.P49fs,
USP13:p.I116fs, USP15:p.K782fs, VASH1:p.G3fs, VEZF1:p.355_356insN,
VPS13A:p.F2883fs, WAPAL:p.R522fs, WDFY3:p.L1842fs, WDR59:p.N160fs,
WDR5:p.N214fs, WDR60:p.Q412fs, WDTC1:p.M287fs, WHSC1L1:p.K418fs,
WNT1:p.W167fs, XIRP2:p.E1007D, YBX2:p.P226fs, YIF1A:p.R131fs,
ZBBX:p.E151del, ZBTB40:p.L262fs, ZBTB7C:p.G342fs, ZBTB7C:p.D154fs,
ZC3H18:p.T701fs, ZDHHC5:p.E651del, ZDHHC7:p.P316fs,
ZFHX3:p.R1893fs, ZFHX3:p.E763fs, ZFHX4:p.L408fs, ZHX3:p.N249K,
ZIM3:p.I384fs, ZKSCAN5:p.D13fs, ZMYM4:p.K345fs, ZNF236:p.T1410M,
ZNF23:p.F122fs, ZNF334:p.K426fs, ZNF358:p.T130fs, ZNF701:p.L296fs,
ZNF711:p.L737fs, and ZNF831:p.A49fs.
[0173] 69. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0174] (a) the population of subjects is suffering
from TGCT; and [0175] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of FAM18B2:p.C51Y, BTN2A3P:p.P3S, MUC2:p.G1715S,
NBPF10:p.L44V, SP8:p.G156S, DCP1B:p.Q252H, DEK:p.E41D,
ERC1:p.K692R, FAM104B:p.D75H, FRG1B:p.M49V, KRTAP10-10:p.V234M,
LRRCC1:p.A6V, NRAS:p.Q61R, PNPLA4:p.L223P, ANKLE1:p.C644fs,
ANKLE1:p.C644fs, KIT:p.D816H, KIT:p.D816Y, MUC2:p.T1597I,
PSMD11:p.A5V, RHPN2:p.V73M, RUNX2:p.Q71E, SP4:p.E7K,
TUBA1C:p.L146F, ZNF814:p.Y324H, ADAMTS17:p.N572T, ATRX:p.K1936R,
BCL11B:p.E535D, BMP2K:p.Q460H, BMP2K:p.H487Q, C12orf32:p.D60V,
C22orf43:p.K19E, CDC27:p.N571I, CDC27:p.P242S, DDX11:p.K208fs,
EBPL:p.L189V, EZH2:p.K510R, FAM86A:p.A141T, GAS2L2:p.D189A,
GRID2IP:p.LS754del, HGC6.3:p.E171G, KIT:p.D816V, KIT:p.N822Y,
KIT:p.N822K, KRAS:p.Q61R, KRAS:p.G12V, KRTAP1-1:p.I116V,
LRRC37BP1:p.Y166D, MEF2A:p.R127Q, MFF:p.S7F, MST1:p.R347W,
MUC4:p.S3048L, MUC6:p.H2000Q, MUC6:p.P1977H, NAT10:p.I393T,
OPLAH:p.A900D, PIEZO1:p.Q749E, PRAMEF4:p.F300V, RBM10:p.E184D,
SERINC2:p.T121P, SPIN2A:p.M150V, SRRM2:p.A2257S, SSBP3:p.K6R,
ZNF680:p.R501W, ABCC8:p.Y512C, ABCC9:p.L466P, ABCD1:p.H169Q,
ABL2:p.P19T, ACVR2B:p.R48C, AHDC1:p.P33fs, AHNAK2:p.L1640M,
ALPPL2:p.W31S, AMMECR1:p.G77C, ANK3:p.D1322E,
ANKHD1-EIF4EBP3:p.G60S, ANKRD11:p.Y2015S, ANKRD11:p.K369R,
ANKRD50:p.V637M, APBB3:p.L450P, ARHGAP24:p.T35A, ARID4B:p.G1076A,
ARMC3:p.A514T, ARRB2:p.T99P, ATAD5:p.I305V,
ATXN3:p.305_306insQQQQQQQ, AVPR1B:p.G39R, AXDND1:p.E994Q,
BAI2:p.A231G, BEST3:p.P383L, BIRC6:p.V414L, BIRC8:p.A225M,
BRWD1:p.K1319R, BTN2A2:p.L15F, C12orf51:p.A2644T, C12orf65:p.K143T,
C16orf62:p.L244I, C1QBP:p.T225I, C1orf167:p.S123G, C5orf25:p.Y4F,
CACNA1E:p.G2080S, CAPNS1:p.LV303del, CCDC159:p.A332S,
CDKAL1:p.P409L, CDYL:p.V48A, CDYL:p.A60G, CELSR2:p.L17P,
CHD4:p.E138D, CKAP5:p.G576A, CLCC1:p.K52R, CMTM8:p.S26T,
CNKSR2:p.P249L, CNTN5:p.I501T, COG5:p.H617R, COL15A1:p.K708R,
COL6A3:p.A2378D, CRYGB:p.R143G, CSGALNACT2:p.L362F, CUL4A:p.I438F,
CXXC1:p.Q156H, CYP19A1:p.F406L, DCLRE1B:p.F28I, DDX11:p.A376T,
DDX11:p.E680D, DEPDC5:p.R1525Q, DLC1:p.S741T, DNMT1:p.R995Q,
DOCK11:p.Q169E, DSPP:p.D1047N, E2F7:p.I91S, EBF1:p.D353G,
ECI2:p.K55R, EEF1A2:p.Y418S, EIF3J:p.A8G, EML6:p.K805R,
EPAS1:p.S474T, EPRS:p.L1335I, ERICH1:p.E327K, FAM101B:p.LSP,
FAM104A:p.M1R, FAM110D:p.R71H, FAM155A:p.Q95R, FAM186A:p.G1492E,
FAM194B:p.Y139H, FAM21B:p.P1231S, FAM32A:p.K9R, FAM46B:p.H416R,
FAM48B1:p.I499V, FAM48B1:p.A516P, FAM5C:p.S425W, FAM86C2P:p.C120Y,
FBXL14:p.V48G, FRMPD3:p.Q832del, FRS2:p.L47S, GDF5:p.E105fs,
GPNMB:p.C3fs, GPT2:p.R10P, H2AFV:p.Q125R, HDLBP:p.R503C,
HERC2:p.R2129C, HIST1H2BJ:p.K13R, HLX:p.N231K, HMGB3:p.E198D,
HSF4:p.R169W, HSF4:p.S491P, HYAL4:p.D222N, INO80E:p.P206fs,
INTS4:p.S460A, IQCF6:p.R3H, ITPR1:p.M15691, ITPR3:p.R1698G,
KANSL3:p.G376E, KCNA4:p.E627del, KDM5A:p.P423S, KDM6A:p.Y362fs,
KIAA0020:p.K63R, KIDINS220:p.N8515, KIT:p.W557G, KLHDC2:p.W3215,
KRAS:p.A146T, KRAS:p.Q61H, KRAS:p.Q61L, KRAS:p.G12A, KRAS:p.G12R,
KRBA1:p.R839G, KRTAP4-8:p.T63S, L2HGDH:p.P441del, LAMC3:p.P174Q,
LHCGR:p.L16Q, LOC401296:p.L144M, LPHN2:p.F906I, LRP12:p.G310C,
LTB4R:p.F73L, LTBP3:p.L35del, LUC7L3:p.S148T, LYPD4:p.T64K,
MAMLD1:p.Q572L, MAP4K2:p.R341G, MAPK7:p.A501D, MAT2A:p.E166G,
MED12L:p.C1292Y, MESP2:p.Q182E, MEX3C:p.R534S, MIER2:p.L131F,
MLL5:p.Y66C, MLLT3:p.177_178SS>S, MMS19:p.D1005N,
MRPS25:p.E119del, MSH6:p.D576A, MTIF3:p.G65E, MUC17:p.M1807T,
MUC17:p.T2279N, MUC17:p.G2474S, MUC2:p.TTPSPP1475del,
MUC2:p.T1568M, MUC2:p.T1580N, MUC2:p.T1704I, MUC2:p.T1706M,
MUC4:p.H1117D, MUCSB:p.R1097H, MYEF2:p.K323E, MYEOV:p.L302H,
MYH8:p.A785V, MYO1A:p.N584K, NAP1L3:p.P353R, NAV1:p.I1433M,
NCAM1:p.E131G, NEB:p.D3107N, NEFH:p.V670E, NELL2:p.G170D,
NHS:p.D1561N, NKD2:p.H447del, NSD1:p.T461R, NT5C3:p.A3P,
NYAP1:p.P480S, OBSCN:p.A908T, OR10J1:p.R244Q, OR1S2:p.M2981,
OR2L3:p.K294R, OR6K6:p.F311L, PABPC3:p.V325fs, PBX2:p.Y262F,
PCDHB4:p.P255F, PCMTD1:p.V281A, PCP4L1:p.K64R, PDE3A:p.A98E,
PDIA6:p.N56K, PDSSA:p.L1309F, PHLDA2:p.R28S, PIGR:p.V183G,
PIK3CA:p.E545K, PIK3CD:p.C381R, PKD1:p.T938M, PLEKHM1:p.A895V,
PLEKHN1:p.A600D, PLXND1:p.R367L, PMS2:p.K651R, PNMA3:p.E200G,
POTEF:p.S112G, PRAMEF8:p.I448V, PRDM2:p.E278D, PRODH:p.L527V,
PRPF31:p.R289W, PSME4:p.N495D, PTGR1:p.E40A, PTPRB:p.Q726H,
RABGEF1:p.N207D, RAC1:p.P34R, RANBP17:p.M900I, REV3L:p.A30S,
RFC3:p.I82N, RFC3:p.K296N, RIMBP3:p.Q1154R, RPL19:p.R151C,
RPLS:p.R58fs, RPTN:p.M538I, RRAD:p.A278E, RYR1:p.D668Y,
RYR2:p.L2023F, SAFB:p.G799V, SCRIB:p.G332V, SDK1:p.Y2146C,
SEC16A:p.T443K, SEC31B:p.P905S, SELO:p.R565Q, SELP:p.A297T,
SI:p.I1681K, SLC2A7:p.H268Q, SLC37A1:p.V5281, SLC38A1:p.G100R,
SMARCA2:p.D1158A, SMARCA5:p.T156fs, SMC3:p.E970Q, SMG1:p.P2696H,
SNRNP200:p.A2129G, SPIN2B:p.M150V, ST6GALNAC1:p.S354N,
STAMBPL1:p.Y143H, STARD8:p.G662A, STON1-GTF2A1L:p.N451S,
SYMPK:p.A336G, TAS2R8:p.W98C, TCHH:p.W1016R, TET1:p.T1472S,
TIAM1:p.G247M, TNS1:p.P183S, TOR1AIP2:p.G146R, TPRX1:p.S216P,
TPRX1:p.S200P, TRMT61A:p.S244I, TSPAN4:p.L92V, TTF1:p.Q530R,
UBE2M:p.G131D, UBR5:p.R2517S, UGT2B11:p.R4471, UMODL1:p.M5591,
UNC93A:p.V445A, USP46:p.Q137R, VWA2:p.G317D, VWA7:p.V792G,
WASH3P:p.L187V, WNTSB:p.K327E, WRN:p.E510D, XDH:p.P410S,
ZAN:p.S755P, ZC3H11A:p.I777T, ZC3H7A:p.C575S, ZDHHC11:p.H250Q,
ZFHX4:p.D3239N, ZKSCAN3:p.K200A, ZMYM4:p.T367I, ZNF174:p.P353T,
ZNF322:p.Y353C, ZNF592:p.K324Q, ZNF592:p.P500T, ZNF782:p.C145F,
ZNF799:p.C453R, ZNF804B:p.P644S, and ZNRF3:p.R889W.
[0176] 70. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0177] (a) the population of subjects is suffering
from THCA; and [0178] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of BRAF:p.V600E, NRAS:p.Q61R, HRAS:p.Q61R, NRAS:p.Q61K,
OTUD4:p.T909I, HRAS:p.Q61K, NLRP6:p.E611G, AKT1:p.E17K,
ANKMY1:p.N3021, ATP6V1A:p.L237P, CYP19A1:p.S1131, DCUN1D4:p.L275P,
DGCR8:p.E518K, DLC1:p.S741T, DNAH10:p.C1853F, EIF1AX:p.G9D,
FAM75D5:p.L222P, FCGRT:p.P40A, KRAS:p.Q61K, LMX1B:p.Q285del,
MAS1L:p.R324G, MED15:p.S35I, MEGF6:p.Y393C, ODZ2:p.A1529V,
OR5L1:p.R122H, OR6K6:p.F311L, OTX1:p.D315N, POTEE:p.S75G,
SCN5A:p.D1978H, TOP2A:p.K1199E, and TSG101:p.K265R.
[0179] 71. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0180] (a) the population of subjects is suffering
from UCS; and [0181] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of TP53:p.R248Q, ZNF814:p.D404E, BTN2A3P:p.P3S,
FBXW7:p.R465C, FRG1B:p.G65E, MUC4:p.H4205Q, NBPF10:p.V99F,
PIK3CA:p.E545K, PIK3CA:p.H1047R, PPP2R1A:p.P179R, DDX11L2:p.*128Q,
FBXW7:p.R479Q, FRG1B:p.K13N, FRG1B:p.L52S, HSD17B7P2:p.N175S,
KRAS:p.G12V, LOC283788:p.S37G, TP53:p.R273H, TP53:p.S241Y,
ADAMTS12:p.E359K, BCL2L11:p.L187fs, CDC27:p.L460fs, CHEK2:p.K373E,
ESPNP:p.W122fs, FBXW7:p.R689W, FBXW7:p.R505G, FBXW7:p.R465H,
FCGBP:p.V4019M, FRG1B:p.I10T, FRG1B:p.D32V, FRG1B:p.R37K,
KRAS:p.G12D, LOC100233156:p.R21C, LOC283788:p.I46M, LRP1B:p.L1392F,
MAMLD1:p.Q572L, MST1P9:p.L319P, MUC4:p.A2390T, MUC4:p.G2172S,
NBPF10:p.E3455K, PIK3CA:p.G106V, PODXL:p.28_30PSP>P,
POTEC:p.R477Q, PPP2R1A:p.R183W, PPP2R1A:p.S219L, PTPN18:p.TG378del,
RGPD3:p.N756D, RPL13AP20:p.G107R, SAMD4B:p.R477W, SMAP1:p.E169fs,
TP53:p.H193R, TP53:p.H179R, TP53:p.R175H, TUBBP5:p.R119H, and
U2AF1:p.S34F.
[0182] 72. The pharmaceutical composition of any of paragraphs
30-36, wherein: [0183] (a) the population of subjects is suffering
from PAAD; and [0184] (b) the at least one tumor-specific mutation
comprises any combination of mutations selected from the group
consisting of RBM14:p.AAAAAAA286del, KRAS:p.G12D,
JMY:p.PPPPPPPPPPPP811del, RIOK1:p.D69del,
LCE2A:p.SSGGCCGSSSGGCC47del, KRAS:p.G12V,
C1QB:p.GPKGPMGPKGGPGAPGAP90del, ZFHX3:p.V777del,
DBR1:p.541_542DD>D, AEBP1:p.K1133del, KRAS:p.G12R,
RBM47:p.495_502AAAAAAAA>A, AP3S1:p.K41fs,
MLL2:p.AEGPHLSPQPEELHLSPQ792del,
RFX1:p.386_401GGGGGGGGGGGGGGSG>G, AXDND1:p.EQ991del,
HERC2P3:p.A803V, RGPD3:p.N756D, FNDC1:p.D1180del, ANAPC1:p.T537A,
IRS4:p.21_22AA>A, GIGYF2:p.Q1005del, NCOA3:p.Q1253fs,
SIK3:p.950_951QQ>Q, GPR6:p.AAAAATAAGGPDTGEWGPPA36del,
NBPF12:p.D1323fs, SHROOM4:p.1156_1157EE>E, ZMIZ2:p.
VAAAAATATATATAT153del, DGKK:p.PAPP41del,
LZTS1:p.RTQDLEGALRTKGLEL432del, CASQ2:p.395_396DD>D,
DCP1B:p.251_252insH, ESPNP:p.296_317PPPPSFPPPPPPPGTQLPPPPP>P,
KBTBD6:p.T403K, NBPF16:p.D449fs, ANKRD36C:p.H438R,
ESPN:p.PPPPPPSFPPPPPPPGTQLPP430del, FCGBP:p.A2493V, KRAS:p.Q61H,
NCOA3:p.Q1276del, OR2T2:p.C203fs, TMCC1:p.Q565L, BCKDHA:p.G129fs,
ESPNP:p.H64fs, GNAS:p.R844H, NBPF14:p.R25C, OGFOD1:p.G477fs,
RBM12:p.P693S, SLC38A10:p.1071_1072II>I, SORBS2:p.P866S,
TP53:p.R248W, TP53:p.R175H, and UBAC1:p.E269del.
[0185] 73. The pharmaceutical composition of any of paragraphs
30-72, wherein the composition comprises at least 2, at least 3, at
least 4, at least 5, at least 6, at least 7, at least 8, at least
9, at least 10, at least 11, at least 12, at least 13, at least 14,
at least 15, at least 16, at least 17, at least 18, at least 19, at
least 20, at least 21, at least 22, at least 23, at least 24, at
least 25, at least 26, at least 27, at least 28, at least 29, or at
least 30 neoantigenic peptides.
[0186] 74. The pharmaceutical composition of paragraph 73, wherein
the composition comprises 15 to 20 neoantigenic peptides.
[0187] 75. The pharmaceutical composition of paragraphs 73 or 74,
further comprising at least one additional neoantigenic peptide
which is specific for an individual patient's tumor.
[0188] 76. The pharmaceutical composition of paragraph 75, wherein
the patient specific neoantigenic peptide is selected by
identifying sequence differences between the genome, exome, and/or
transcriptome of the patient's tumor sample and the genome, exome,
and/or transcriptome of a non-tumor sample.
[0189] 77. The pharmaceutical composition of paragraph 75, wherein
the samples are fresh or formalin-fixed paraffin embedded tumor
tissues, freshly isolated cells, or circulating tumor cells.
[0190] 78. The pharmaceutical composition of paragraph 75, wherein
the sequence differences are determined by Next Generation
Sequencing.
[0191] 79. The pharmaceutical composition of any of paragraphs
30-78, wherein each neoantigenic peptide is from about 5 to about
50 amino acids in length.
[0192] 80. The pharmaceutical composition of paragraph 79, wherein
each neoantigenic peptide is between about 15 to about 35 amino
acids in length; is about 15 amino acids or less in length; is
about 8 and about 11 amino acids in length; or is 9 or 10 amino
acids in length.
[0193] 81. The pharmaceutical composition of paragraph 79 or 80,
wherein each neoantigenic peptide binds major histocompatibility
complex (MHC) class I.
[0194] 82. The pharmaceutical composition of any one of paragraphs
30-81, wherein each neoantigenic peptide binds to MHC class I with
a binding affinity of less than about 500 nM, or optionally each
neoantigenic peptide binds to HLA-A, -B or -C with a K.sub.D of
less than 500 nM.
[0195] 83. The pharmaceutical composition of paragraph 79, wherein
each neoantigenic peptide is about 30 amino acids or less in
length; is between about 6 and about 25 amino acids in length; is
between about 15 and about 24 amino acids in length; or is between
about 9 and about 15 amino acids in length.
[0196] 84. The pharmaceutical composition of paragraph 79, 82 or
83, wherein each neoantigenic peptide binds major
histocompatibility complex (MHC) class II.
[0197] 85. The pharmaceutical composition of paragraph 84, wherein
each neoantigenic peptide binds to MEW class I with a binding
affinity of less than about 500 nM, or optionally each neoantigenic
peptide binds to HLA-A, -B or -C with a K.sub.D of less than 500
nM.
[0198] 86. The pharmaceutical composition of any of paragraphs
30-85, wherein at least one neoantigenic peptide further comprises
flanking amino acids.
[0199] 87. The pharmaceutical composition of paragraph 86, wherein
the flanking amino acids are not native flanking amino acids.
[0200] 88. The pharmaceutical composition of any of paragraphs
30-87, which at least one neoantigenic peptide is linked to at
least a second neoantigenic peptide.
[0201] 89. The pharmaceutical composition of paragraph 88, wherein
peptides are linked using a poly-glycine or poly-serine linker.
[0202] 90. The pharmaceutical composition of paragraph 88 or 89,
wherein the second neoantigenic peptide binds MEW class I or class
II with a binding affinity of less than about 1000 nM.
[0203] 91. The pharmaceutical composition of any of paragraphs
88-90, wherein the second neoantigenic peptide binds MHC class I or
class II with a binding affinity of less than about 500 nM.
[0204] 92. The pharmaceutical composition of any of paragraphs
88-91, wherein both of the neoepitopes bind to human leukocyte
antigen (HLA)-A, -B, -C, -DP, -DQ, or -DR.
[0205] 93. The pharmaceutical composition of any of paragraphs
88-92, wherein the isolated neoantigenic peptide and the second
neoantigenic peptide binds a class I HLA or the isolated
neoantigenic peptide and the second neoantigenic peptide binds a
class II HLA.
[0206] 94. The pharmaceutical composition of any of paragraphs
88-92, wherein the isolated neoantigenic peptide binds a class II
HLA and the second neoantigenic peptide binds a class I HLA or the
isolated neoantigenic peptide binds a class I HLA and the second
neoantigenic peptide binds a class II HLA.
[0207] 95. The pharmaceutical composition of any of paragraphs
30-94, wherein at least one neoantigenic peptide further comprises
modifications which increase in vivo half-life, cellular targeting,
antigen uptake, antigen processing, MHC affinity, MHC stability, or
antigen presentation.
[0208] 96. The pharmaceutical composition of paragraph 95, wherein
the modification is conjugation to a carrier protein, conjugation
to a ligand, conjugation to an antibody, PEGylation,
polysialylation HESylation, recombinant PEG mimetics, Fc fusion,
albumin fusion, nanoparticle attachment, nanoparticulate
encapsulation, cholesterol fusion, iron fusion, acylation,
amidation, glycosylation, side chain oxidation, phosphorylation,
biotinylation, the addition of a surface active material, the
addition of amino acid mimetics, or the addition of unnatural amino
acids.
[0209] 97. The pharmaceutical composition of paragraph 95, wherein
the cells that are targeted are antigen presenting cells.
[0210] 98. The pharmaceutical composition of paragraph 97, wherein
the antigen presenting cells are dendritic cells.
[0211] 99. The pharmaceutical composition of paragraph 98, wherein
the dendritic cells are targeted using DEC205, XCR1, CD197, CD80,
CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85j,
CD85k, CD85d, CD85g, CD85a, CD141, CD11c, CD83, TSLP receptor, or
CD1a marker.
[0212] 100. The pharmaceutical composition of paragraph 99, wherein
the dendritic cells are targeted using the CD141, DEC205, or XCR1
marker.
[0213] 101. The pharmaceutical composition of any of paragraphs
30-100, which is an immunogenic or vaccine composition.
[0214] 102. The pharmaceutical composition of paragraph 101,
further comprising an immunomodulator or adjuvant.
[0215] 103. The pharmaceutical composition of paragraph 102,
wherein the immunodulator or adjuvant is selected from the group
consisting of Poly(I:C), Poly-ICLC, STING agonist, 1018 ISS,
aluminium salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA,
dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch,
ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A,
Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2,
Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP-EC, ISA-TLR2
agonist, ONTAK, PepTel.RTM.. vector system, PLG microparticles,
resiquimod, SRL172, virosomes and other virus-like particles,
YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Pam3CSK4, acrylic or
methacrylic polymers, copolymers of maleic anhydride, and QS21
stimulon.
[0216] 104. An isolated polynucleotide encoding the isolated
neoantigenic peptide of any of paragraphs 1-24.
[0217] 105. The isolated polynucleotide of paragraph 104, which is
RNA.
[0218] 106. The isolated polynucleotide of paragraph 105, wherein
the RNA is modified to increase stability, increase cellular
targeting, increase translation efficiency, adjuvanticity, cytosol
accessibility, and/or decrease cytotoxicity.
[0219] 107. The isolated polynucleotide of paragraph 106, wherein
the modification is conjugation to a carrier protein, conjugation
to a ligand, conjugation to an antibody, codon optimization,
increased GC-content, incorporation of modified nucleosides,
incorporation of 5'-cap or cap analog, and/or incorporation of an
unmasked poly-A sequence.
[0220] 108. A cell comprising the polynucleotide of any of
paragraphs 104-107.
[0221] 109. A vector comprising the polynucleotide of any one of
paragraphs 104-107.
[0222] 110. The vector of paragraph 110, in which the
polynucleotide is operably linked to a promoter.
[0223] 111. The vector of paragraphs 109 or 110, which is a
plasmid, phage, transposon, cosmid, virus, or virion.
[0224] 112. The vector of paragraph 111, which is an
adeno-associated virus, herpesvirus, lentivirus, or pseudotypes
thereof.
[0225] 113. An in vivo delivery system comprising the isolated
polynucleotide of any of paragraphs 104-107.
[0226] 114. The delivery system of paragraph 113, wherein the
delivery system includes spherical nucleic acids, viruses,
virus-like particles, plasmids, bacterial plasmids, or
nanoparticles.
[0227] 115. A cell comprising the vector or delivery system of any
of paragraphs 109-114.
[0228] 116. The cell of paragraph 115, which is an antigen
presenting cell.
[0229] 117. The cell of paragraph 116, which is a dendritic
cell.
[0230] 118. The cell of paragraph 117, which is an immature
dendritic cell.
[0231] 119. A composition comprising at least one polynucleotide of
any of paragraphs 104-107.
[0232] 120. The composition of paragraph 119, wherein the
composition comprises at least 2, at least 3, at least 4, at least
5, at least 6, at least 7, at least 8, at least 9, at least 10, at
least 11, at least 12, at least 13, at least 14, at least 15, at
least 16, at least 17, at least 18, at least 19, at least 20, at
least 21, at least 22, at least 23, at least 24, at least 25, at
least 26, at least 27, at least 28, at least 29, or at least 30 of
the isolated polynucleotides.
[0233] 121. The composition of paragraph 120, wherein the
composition comprises between about 2 and about 20
polynucleotides.
[0234] 122. The composition of any one of paragraphs 119-121,
wherein the composition further comprises at least 1, at least 2,
at least 3, at least 4, at least 5, at least 6, at least 7, at
least 8, at least 9, at least 10, at least 11, at least 12, at
least 13, at least 14, at least 15, at least 16, at least 17, at
least 18, at least 19, at least 20, at least 21, at least 22, at
least 23, at least 24, at least 25, at least 26, at least 27, at
least 28, at least 29, or at least 30 additional neoantigenic
polynucleotides encoding for additional neoantigenic peptides.
[0235] 123. The composition of paragraph 122, wherein the
composition comprises between about 4 and about 20 additional
neoantigenic polynucleotides.
[0236] 124. The composition of paragraph 122, wherein the isolated
polynucleotides and the additional neoantigenic polynucleotides are
linked.
[0237] 125. The composition of paragraph 124, wherein the
polynucleotides are linked using nucleic acids that encode a
poly-glycine or poly-serine linker.
[0238] 126. The composition of any of paragraphs 122-125, wherein
at least one of the additional neoantigenic peptide is specific for
an individual patient's tumor.
[0239] 127. The composition of paragraph 126, wherein the patient
specific neoantigenic peptide is selected by identifying sequence
differences between the genome, exome, and/or transcriptome of the
patient's tumor sample and the genome, exome, and/or transcriptome
of a non-tumor sample.
[0240] 128. The composition of paragraph 127, wherein the samples
are fresh or formalin-fixed paraffin embedded tumor tissues,
freshly isolated cells, or circulating tumor cells.
[0241] 129. The composition of paragraphs 127 or 128, wherein the
sequence differences are determined by Next Generation
Sequencing.
[0242] 130. A T cell receptor (TCR) capable of binding at least one
neoantigenic peptide listed in any of paragraphs 1-27, optionally a
neoantigenic peptide comprising FGFR3 S249C, ERBB3 V104M, EGFR
L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL
28_30PSP>P.
[0243] 131. The TCR of paragraph 130, which is capable of binding
the isolated neoantigenic peptide in the context of MHC class I or
class II.
[0244] 132. A chimeric antigen receptor comprising: (i) a T cell
activation molecule; (ii) a transmembrane region; and (iii) an
antigen recognition moiety capable of binding an isolated
neoantigenic peptide of any one of paragraphs 1-27.
[0245] 133. The chimeric antigen receptor of paragraph 132, wherein
CD3-zeta is the T cell activation molecule.
[0246] 134. The chimeric antigen receptor of paragraph 132 or 133,
further comprising at least one costimulatory signaling domain.
[0247] 135. The chimeric antigen receptor of any of paragraphs
132-134, wherein the signaling domain is CD28, 4-1BB, ICOS, OX40,
ITAM, or Fc epsilon RI-gamma.
[0248] 136. The chimeric antigen receptor of any of paragraphs
132-135, wherein the antigen recognition moiety is capable of
binding the isolated neoantigenic peptide in the context of MHC
class I or class II.
[0249] 137. The chimeric antigen receptor of any of paragraphs
132-136, comprising the CD3-zeta, CD28, CTLA-4, ICOS, BTLA, KIR,
LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR, or PD-1 transmembrane
region.
[0250] 138. The chimeric antigen receptor of any of paragraphs
132-137, wherein the tumor-specific epitope is located in the
extracellular domain of a tumor associated polypeptide, optionally
the tumor-specific epitope comprises FGFR3 S249C, ERBB3 V104M, EGFR
L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL
28_30PSP>P.
[0251] 139. A T cell comprising the T cell receptor or chimeric
antigen receptor of any of paragraphs 130-138.
[0252] 140. The T cell of paragraph 139, which is a helper or
cytotoxic T cell.
[0253] 141. A nucleic acid comprising a promoter operably linked to
a polynucleotide encoding the T cell receptor of paragraph 130 or
131.
[0254] 142. The nucleic acid of paragraph 141, wherein the TCR is
capable of binding the at least one neoantigenic peptide in the
context of major histocompatibility complex (WIC) class I or class
II.
[0255] 143. A nucleic acid comprising a promoter operably linked to
a polynucleotide encoding the chimeric antigen receptor of any of
paragraphs 132-138.
[0256] 144. The nucleic acid of paragraph 143, wherein the antigen
recognition moiety is capable of binding the at least one
neoantigenic peptide in the context of major histocompatibility
complex (MHC) class I or class II.
[0257] 145. The nucleic acid of paragraphs 143 or 144, wherein the
tumor-specific epitope is located in the extracellular domain of a
tumor associated polypeptide.
[0258] 146. The nucleic acid of any of paragraphs 143-145,
comprising the CD3-zeta, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3,
CD137, OX40, CD27, CD40L, Tim-3, A2aR, or PD-1 transmembrane
region.
[0259] 147. An antibody capable of binding at least one
neoantigenic peptide listed in Tables 1-9.
[0260] 148. A modified cell transfected or transduced with the
nucleic acid of any one of paragraphs 141-146.
[0261] 149. The modified cell of paragraph 148, wherein the
modified cell is a T cell, tumor infiltrating lymphocyte, NK-T
cell, TCR-expressing cell, CD4+ T cell, CD8+ T cell, or NK
cell.
[0262] 150. A composition comprising the T cell receptor or
chimeric antigen receptor of any of paragraphs 130-138.
[0263] 151. A composition comprising autologous patient T cells
containing the T cell receptor or chimeric antigen receptor of any
of paragraphs 130-138.
[0264] 152. The composition of paragraph 150 or 151, further
comprising an immune checkpoint inhibitor.
[0265] 153. The composition of paragraph 150 of 151, further
comprising at least two immune checkpoint inhibitors.
[0266] 154. The composition of paragraph 152 or 153, wherein the
immune checkpoint inhibitor inhibits a checkpoint protein selected
from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4,
BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049,
CHK 1, CHK2, A2aR, and B-7 family ligands or a combination
thereof.
[0267] 155. The composition of paragraph 154, wherein the immune
checkpoint inhibitor interacts with a ligand of a checkpoint
protein selected from the group consisting of CTLA-4, PDL1, PDL2,
PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4,
CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a
combination thereof.
[0268] 156. The composition of any of paragraphs 119-129 or
150-156, further comprising an immune modulator or adjuvant.
[0269] 157. The composition of paragraph 156, wherein the immune
modulator is a co-stimulatory ligand, a TNF ligand, an Ig
superfamily ligand, CD28, CD80, CD86, ICOS, CD40L, OX40, CD27,
GITR, CD30, DR3, CD69, or 4-1BB.
[0270] 158. The composition of paragraph 156, wherein the immune
modulator is at least one cancer cell or cancer cell extract.
[0271] 159. The composition of paragraph 158, wherein the cancer
cell is autologous to the subject in need of the composition.
[0272] 160. The composition of paragraph 159, wherein the cancer
cell has undergone lysis or been exposed to UV radiation.
[0273] 161. The composition of paragraph 156, wherein the
composition further comprises an adjuvant.
[0274] 162. The composition of paragraph 161, wherein the adjuvant
is selected from the group consisting of: Poly(I:C), Poly-ICLC,
STING agonist, 1018 ISS, aluminium salts, Amplivax, AS15, BCG,
CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod,
ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac,
MF59, monophosphoryl lipid A, Montanide IMS 1312 VG, Montanide ISA
206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174,
OM-197-MP-EC, ISA-TLR2 agonist, ONTAK, PepTel.RTM.. vector system,
PLG microparticles, resiquimod, SRL172, virosomes and other
virus-like particles, YF-17D, VEGF trap, R848, beta-glucan,
Pam3Cys, Pam3CSK4, acrylic or methacrylic polymers, copolymers of
maleic anhydride, and QS21 stimulon.
[0275] 163. The composition of paragraph 161 or 162, wherein the
adjuvant induces a humoral immune response when administered to a
subject.
[0276] 164. The composition of paragraph 162, wherein the adjuvant
induces a T helper cell type 1 response when administered to a
subject.
[0277] 165. An in vivo delivery system comprising the
pharmaceutical composition of any of paragraphs 30-103.
[0278] 166. The delivery system of paragraph 165, wherein the
delivery system includes cell-penetrating peptides, nanoparticulate
encapsulation, virus like particles, or liposomes.
[0279] 167. The delivery system of paragraph 166, wherein the
cell-penetrating peptide is TAT peptide, herpes simplex virus VP22,
transportan, or Antp.
[0280] 168. A cell comprising the isolated neoantigenic peptide of
any of paragraphs 1-29.
[0281] 169. The cell of paragraph 168, which is an antigen
presenting cell.
[0282] 170. The cell of paragraph 169, which is a dendritic
cell.
[0283] 171. A method of treating cancer or initiating, enhancing,
or prolonging an anti-tumor responses in a subject in need thereof
comprising administering to the subject the peptide,
polynucleotide, vector, composition, antibody, or cells of any of
paragraphs 1-164.
[0284] 172. A method of prophylactic cancer treatment comprising:
[0285] (a) selecting a cancer drug for a patient in need thereof,
the drug selected from the group consisting of ibrutinib,
erlotinib, imatinib, gefitinib, crizotinib, trastuzumab,
vemurafenib, RAF/MEK inhibitors, and antiestrogen therapy; and
[0286] (b) administering prophylactically to the subject, a
pharmaceutical composition according to any of paragraphs 30-103
wherein the at least one neoantigenic peptide is derived from drug
resistant mutations associated with the selected cancer drug.
[0287] 173. A method of treating or preventing a tumor in a
population of subjects in need thereof, comprising administering to
a subject an agent comprising an extracellular ligand-binding
domain recognizing a tumor-specific neoepitope comprising a
tumor-specific mutation having an incidence of at least 1% of
subjects in the population.
[0288] 174. The method according to any of paragraphs 171-173,
wherein the tumor-specific mutation comprises a mutation listed for
any population in Table 9.
[0289] 175. The method according to any of paragraphs 171-173,
wherein the tumor-specific mutation is within a gene containing an
extracellular domain.
[0290] 176. The method according to paragraph 175, wherein the
tumor-specific mutation comprises FGFR3 S249C, ERBB3 V104M, EGFR
L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL
28_30PSP>P.
[0291] 177. The method according to paragraph 176, wherein the
tumor-specific mutation is within the extracellular domain.
[0292] 178. The method according to paragraph 177, wherein the
tumor-specific mutation comprises FGFR3 S249C or ERBB3 V104M.
[0293] 179. The method of any of paragraph 171-178, wherein the
subject is a human.
[0294] 180. The method of paragraph 179, wherein the subject has
cancer.
[0295] 181. The method of paragraph 180, wherein the cancer is
selected from the group consisting of urogenital, gynecological,
lung, gastrointestinal, head and neck cancer, malignant
glioblastoma, malignant mesothelioma, non-metastatic or metastatic
breast cancer, malignant melanoma, Merkel Cell Carcinoma or bone
and soft tissue sarcomas, haematologic neoplasias, multiple
myeloma, acute myelogenous leukemia, chronic myelogenous leukemia,
myelodysplastic syndrome and acute lymphoblastic leukemia,
non-small cell lung cancer (NSCLC), breast cancer, metastatic
colorectal cancers, hormone sensitive or hormone refractory
prostate cancer, colorectal cancer, ovarian cancer, hepatocellular
cancer, renal cell cancer, pancreatic cancer, gastric cancer,
oesophageal cancers, hepatocellular cancers, cholangiocellular
cancers, head and neck squamous cell cancer soft tissue sarcoma,
and small cell lung cancer.
[0296] 182. The method of any of paragraphs 171-181, wherein the
subject has undergone surgical removal of the tumor.
[0297] 183. The method of any of paragraphs 171-182, wherein the
peptide, polynucleotide, vector, composition, or cells is
administered via intravenous, intraperitoneal, intratumoral,
intradermal, or subcutaneous administration.
[0298] 184. The method of paragraph 183, wherein the peptide,
polynucleotide, vector, composition, or cells is administered into
an anatomic site that drains into a lymph node basin.
[0299] 185. The method of paragraph 184, wherein administration is
into multiple lymph node basins.
[0300] 186. The method of any one of paragraphs 183-185, wherein
administration is by a subcutaneous or intradermal route.
[0301] 187. The method of paragraph 183, wherein peptide is
administered.
[0302] 188. The method of paragraph 187, wherein administration is
intratumorally.
[0303] 189. The method of paragraph 183, wherein polynucleotide,
optionally RNA, is administered.
[0304] 190. The method of paragraph 189, wherein the polynucleotide
is administered intravenously.
[0305] 191. The method of paragraph 183, wherein the cell is a T
cell or dendritic cell.
[0306] 192. The method of paragraph 191, wherein the peptide or
polynucleotide comprises an antigen presenting cell targeting
moiety.
[0307] 193. The method of any of paragraphs 171-192, further
comprising administering at least one immune checkpoint inhibitor
to the subject.
[0308] 194. The method of paragraph 193, wherein the checkpoint
inhibitor is a biologic therapeutic or a small molecule.
[0309] 195. The method of paragraph 193 or 194, wherein the
checkpoint inhibitor is selected from the group consisting of a
monoclonal antibody, a humanized antibody, a fully human antibody
and a fusion protein or a combination thereof.
[0310] 196. The method of any of paragraphs 193-195, wherein the
checkpoint inhibitor inhibits a checkpoint protein selected from
the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4,
BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049,
CHK 1, CHK2, A2aR, and B-7 family ligands or a combination
thereof.
[0311] 197. The method of any of paragraphs 193-196, wherein the
checkpoint inhibitor interacts with a ligand of a checkpoint
protein selected from the group consisting of CTLA-4, PDL1, PDL2,
PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4,
CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a
combination thereof.
[0312] 198. The method of any of paragraphs 193-197, wherein two or
more checkpoint inhibitors are administered.
[0313] 199. The method of paragraph 198, wherein the checkpoint
inhibitors are: (i) ipilimumab or tremelimumab, and (ii)
nivolumab.
[0314] 200. The method of any of paragraphs 193-199, wherein the
checkpoint inhibitor and the composition are administered
simultaneously or sequentially in any order.
[0315] 201. The method of paragraph 200, wherein the peptide,
polynucleotide, vector, composition, or cells is administered prior
to the checkpoint inhibitor.
[0316] 202. The method of paragraph 200, wherein the peptide,
polynucleotide, vector, composition, or cells is administered after
the checkpoint inhibitor.
[0317] 203. The method of paragraph 200, wherein administration of
the checkpoint inhibitor is continued throughout neoantigen
peptide, polynucleotide, vector, composition, or cell therapy.
[0318] 204. The method of any of paragraphs 193-203, wherein the
neoantigen peptide, polynucleotide, vector, composition, or cell
therapy is administered to subjects that only partially respond or
do not respond to checkpoint inhibitor therapy.
[0319] 205. The method of any one of paragraphs 193-204, wherein
the checkpoint inhibitor is administered intravenously or
subcutaneously.
[0320] 206. The method of paragraph 205, wherein the checkpoint
inhibitor is administered subcutaneously within about 2 cm of the
site of administration of the composition.
[0321] 207. The method of paragraph 206, wherein the composition is
administered into the same draining lymph node as the checkpoint
inhibitor.
[0322] 208. The method of any of paragraphs 171-207, further
comprising administering an additional therapeutic agent to the
subject either prior to, simultaneously with, or after treatment
with the peptide, polynucleotide, vector, composition, or
cells.
[0323] 209. The method of paragraph 208, wherein the additional
agent is a chemotherapeutic agent, an immunomodulatory drug, an
immune metabolism modifying drug, a targeted therapy, radiation an
anti-angiogenesis agent, or an agent that reduces
immune-suppression.
[0324] 210. The method of paragraph 209, wherein the
chemotherapeutic agent is an alkylating agent, a topoisomerase
inhibitor, an anti-metabolite, or an anti-mitotic agent.
[0325] 211. The method of paragraph 208, wherein the additional
agent is an anti-glucocorticoid induced tumor necrosis factor
family receptor (GITR) agonistic antibody or antibody fragment,
ibrutinib, docetaxeol, cisplatin, or cyclophosphamide.
[0326] 212. The method of any of paragraphs 171-211, which elicits
a CD4+ T cell immune response.
[0327] 213. The method of any of paragraphs 171-212, which elicits
a CD4+ T cell immune response and a CD8+ T cell immune
response.
[0328] 214. A method for stimulating an immune response in a
subject, comprising administering an effective amount of modified
cells or composition of any of paragraphs 30-103, 108, 115-129,
139, 140, 148-164, and 168-170.
[0329] 215. The method of paragraph 214, wherein the immune
response is cytotoxic and/or humoral immune response.
[0330] 216. The method of paragraph 214, wherein the method
stimulates a T cell-mediated immune response in a subject.
[0331] 217. The method of paragraph 216, wherein the T
cell-mediated immune response is directed against a target
cell.
[0332] 218. The method of paragraph 217, wherein the target cell is
a tumor cell.
[0333] 219. The method of any of paragraphs 214-218, wherein the
modified cells are transfected or transduced in vivo.
[0334] 220. The method of any of paragraphs 214-219, wherein the
modified cells are transfected or transduced ex vivo.
[0335] 221. The method of any of paragraphs 214-220, wherein the
modified cells are autologous patient T cells.
[0336] 222. The method of paragraph 221, wherein the autologous
patient T cells are obtained from a patient that has received a
neoantigen peptide or nucleic acid vaccine.
[0337] 223. The method of paragraph 222, wherein the neoantigen
peptide or nucleic acid vaccine comprises at least one personalized
neoantigen.
[0338] 224. The method of paragraph 223, wherein the neoantigen
peptide or nucleic acid vaccine comprises at least one additional
neoantigenic peptide listed in Tables 1-9.
[0339] 225. The method of paragraph 224, wherein the patient
received a chemotherapeutic agent, an immunomodulatory drug, an
immune metabolism modifying drug, targeted therapy or radiation
prior to and/or during receipt of the neoantigen peptide or nucleic
acid vaccine.
[0340] 226. The method of any of paragraphs 222-225, wherein the
patient receives treatment with at least one checkpoint
inhibitor.
[0341] 227. The method of any of paragraphs 222-226, wherein the
autologous T cells are obtained from a patient that has already
received at least one round of T cell therapy containing a
neoantigen.
[0342] 228. The method of any of paragraphs 222-227, wherein the
method further comprises adoptive T cell therapy.
[0343] 229. The method of paragraph 228, wherein the adoptive T
cell therapy comprises autologous T-cells.
[0344] 230. The method of paragraph 229, wherein the autologous
T-cells are targeted against tumor antigens.
[0345] 231. The method of paragraph 228 or 229 wherein the adoptive
T cell therapy further comprises allogenic T-cells.
[0346] 232. The method of paragraph 231, wherein the allogenic
T-cells are targeted against tumor antigens.
[0347] 233. The method of any of paragraphs 227-231, wherein the
adoptive T cell therapy is administered before the checkpoint
inhibitor.
[0348] 234. A method for evaluating the efficacy of any of
paragraphs 171-213, comprising: (i) measuring the number or
concentration of target cells in a first sample obtained from the
subject before administering the modified cell, (ii) measuring the
number concentration of target cells in a second sample obtained
from the subject after administration of the modified cell, and
(iii) determining an increase or decrease of the number or
concentration of target cells in the second sample compared to the
number or concentration of target cells in the first sample.
[0349] 235. The method of paragraph 234, wherein treatment efficacy
is determined by monitoring a clinical outcome; an increase,
enhancement or prolongation of anti-tumor activity by T cells; an
increase in the number of anti-tumor T cells or activated T cells
as compared with the number prior to treatment; B cell activity;
CD4 T cell activity; or a combination thereof.
[0350] 236. The method of paragraph 235, wherein treatment efficacy
is determined by monitoring a biomarker.
[0351] 237. The method of paragraph 236, wherein the biomarker is
selected from the group consisting of CEA, Her-2/neu, bladder tumor
antigen, thyroglobulin, alpha-fetoprotein, PSA, CA 125, CA19.9, CA
15.3, leptin, prolactin, osteopontin, IGF-II, CD98, fascin, sPIgR,
14-3-3 eta, troponin I, and b-type natriuretic peptide.
[0352] 238. The method of paragraph 235, wherein clinical outcome
is selected from the group consisting of tumor regression; tumor
shrinkage; tumor necrosis; anti-tumor response by the immune
system; tumor expansion, recurrence or spread; or a combination
thereof.
[0353] 239. The method of paragraph 235, wherein the treatment
effect is predicted by presence of T cells or by presence of a gene
signature indicating T cell inflammation or a combination
thereof.
[0354] 240. A kit comprising a neoantigen therapeutic of any of
paragraphs 1-164.
[0355] Accordingly, it is an object of the invention not to
encompass within the invention any previously known product,
process of making the product, or method of using the product such
that Applicants reserve the right and hereby disclose a disclaimer
of any previously known product, process, or method. It is further
noted that the invention does not intend to encompass within the
scope of the invention any product, process, or making of the
product or method of using the product, which does not meet the
written description and enablement requirements of the USPTO (35 U.
S.C. .sctn. 112, first paragraph) or the EPO (Article 83 of the
EPC), such that Applicants reserve the right and hereby disclose a
disclaimer of any previously described product, process of making
the product, or method of using the product. It may be advantageous
in the practice of the invention to be in compliance with Art.
53(c) EPC and Rule 28(b) and (c) EPC. All rights to explicitly
disclaim any embodiments that are the subject of any granted
patent(s) of applicant in the lineage of this application or in any
other lineage or in any prior filed application of any third party
is explicitly reserved Nothing herein is to be construed as a
promise.
[0356] It is noted that in this disclosure and particularly in the
claims and/or paragraphs, terms such as "comprises", "comprised",
"comprising" and the like can have the meaning attributed to it in
U.S. Patent law; e.g., they can mean "includes", "included",
"including", and the like; and that terms such as "consisting
essentially of" and "consists essentially of" have the meaning
ascribed to them in U.S. Patent law, e.g., they allow for elements
not explicitly recited, but exclude elements that are found in the
prior art or that affect a basic or novel characteristic of the
invention. Nothing herein is intended as a promise.
[0357] These and other embodiments are disclosed or are obvious
from and encompassed by, the following Detailed Description.
DETAILED DESCRIPTION OF THE INVENTION
[0358] To facilitate an understanding of the present invention, a
number of terms and phrases are defined herein:
[0359] Unless specifically stated or obvious from context, as used
herein, the term "about" is understood as within a range of normal
tolerance in the art, for example within 2 standard deviations of
the mean. About can be understood as within 50%, 45%, 40%, 35%,
30%, 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%,
0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear
from context, all numerical values provided herein are modified by
the term about.
[0360] Unless specifically stated or obvious from context, as used
herein, the term "or" is understood to be inclusive. Unless
specifically stated or obvious from context, as used herein, the
terms "a," "an," and "the" are understood to be singular or
plural.
[0361] All gene name symbols refer to the gene as commonly known in
the art. Gene symbols may be those refered to by the HUGO Gene
Nomenclature Committee (HGNC). Any reference to the gene symbol is
a reference made to the entire gene or variants of the gene. The
HUGO Gene Nomenclature Committee is responsible for providing human
gene naming guidelines and approving new, unique human gene names
and symbols. All human gene names and symbols can be searched at
www.genenames.org, the HGNC website, and the guidelines for their
formation are available there (www.genenames.org/guidelines).
[0362] By "agent" is meant any small molecule chemical compound,
antibody, nucleic acid molecule, or polypeptide, or fragments
thereof.
[0363] By "ameliorate" is meant decrease, suppress, attenuate,
diminish, arrest, or stabilize the development or progression of a
disease (e.g., a neoplasia, tumor, etc.).
[0364] By "alteration" is meant a change (increase or decrease) in
the expression levels oractivity of a gene or polypeptide as
detected by standard art known methods such as those described
herein. As used herein, an alteration includes a 10% change in
expression levels, preferably a 25% change, more preferably a 40%
change, and most preferably a 50% or greater change in expression
levels.
[0365] By "analog" is meant a molecule that is not identical, but
has analogous functional or structural features. For example, a
tumor specific neo-antigen polypeptide analog retains the
biological activity of a corresponding naturally-occurring tumor
specific neo-antigen polypeptide, while having certain biochemical
modifications that enhance the analog's function relative to a
naturally-occurring polypeptide. Such biochemical modifications
could increase the analog's protease resistance, membrane
permeability, or half-life, without altering, for example, ligand
binding. An analog may include an unnatural amino acid.
[0366] "Combination therapy" is intended to embrace administration
of therapeutic agents (e.g. neoantigenic peptides described herein)
in a sequential manner, that is, wherein each therapeutic agent is
administered at a different time, as well as administration of
these therapeutic agents, or at least two of the therapeutic
agents, in a substantially simultaneous manner. Substantially
simultaneous administration can be accomplished, for example, by
administering to the subject a single capsule having a fixed ratio
of each therapeutic agent or in multiple, single capsules for each
of the therapeutic agents. For example, one combination of the
present invention may comprise a pooled sample of neoantigenic
peptides administered at the same or different times, or they can
be formulated as a single, co-formulated pharmaceutical composition
comprising the peptides. As another example, a combination of the
present invention (e.g., a pooled sample of tumor specific
neoantigens) may be formulated as separate pharmaceutical
compositions that can be administered at the same or different
time. As used herein, the term "simultaneously" is meant to refer
to administration of one or more agents at the same time. For
example, in certain embodiments, the neoantigenic peptides are
administered simultaneously. Simultaneously includes administration
contemporaneously, that is during the same period of time. In
certain embodiments, the one or more agents are administered
simultaneously in the same hour, or simultaneously in the same day.
Sequential or substantially simultaneous administration of each
therapeutic agent can be effected by any appropriate route
including, but not limited to, oral routes, intravenous routes,
sub-cutaneous routes, intramuscular routes, direct absorption
through mucous membrane tissues (e.g., nasal, mouth, vaginal, and
rectal), and ocular routes (e.g., intravitreal, intraocular, etc.).
The therapeutic agents can be administered by the same route or by
different routes. For example, one component of a particular
combination may be administered by intravenous injection while the
other component(s) of the combination may be administered orally.
The components may be administered in any therapeutically effective
sequence. The phrase "combination" embraces groups of compounds or
non-drug therapies useful as part of a combination therapy.
[0367] The term "neoantigen" or "neoantigenic" means a class of
tumor antigens that arises from a tumor-specific mutation(s) which
alters the amino acid sequence of genome encoded proteins.
[0368] By "neoplasia" is meant any disease that is caused by or
results in inappropriately high levels of cell division,
inappropriately low levels of apoptosis, or both. For example,
cancer is an example of a neoplasia. Examples of cancers include,
without limitation, leukemia (e.g., acute leukemia, acute
lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic
leukemia, acute promyelocytic leukemia, acute myelomonocytic
leukemia, acute monocytic leukemia, acute erythroleukemia, chronic
leukemia, chronic myelocytic leukemia, chronic lymphocytic
leukemia), polycythemia vera, lymphoma (e.g., Hodgkin's disease,
non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy
chain disease, and solid tumors such as sarcomas and carcinomas
(e.g., fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma,
osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma,
lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma,
mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma,
colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer,
prostate cancer, squamous cell carcinoma, basal cell carcinoma,
adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma,
papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma,
medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma,
hepatoma, nile duct carcinoma, choriocarcinoma, seminoma, embryonal
carcinoma, Wilm's tumor, cervical cancer, uterine cancer,
testicular cancer, lung carcinoma, small cell lung carcinoma,
bladder carcinoma, epithelial carcinoma, glioma, astrocytoma,
medulloblastoma, craniopharyngioma, ependymoma, pinealoma,
hemangioblastoma, acoustic neuroma, oligodenroglioma, schwannoma,
meningioma, melanoma, neuroblastoma, and retinoblastoma).
Lymphoproliferative disorders are also considered to be
proliferative diseases.
[0369] The term "vaccine" is meant to refer in the present context
to a pooled sample of tumor-specific neoantigenic peptides, for
example at least two, at least three, at least four, at least five,
or more neoantigenic peptides. A "vaccine" is to be understood as
meaning a composition for generating immunity for the prophylaxis
and/or treatment of diseases (e.g., neoplasia/tumor). Accordingly,
vaccines are medicaments which comprise antigens and are intended
to be used in humans or animals for generating specific defense and
protective substance by vaccination. A "vaccine composition" can
include a pharmaceutically acceptable excipient, carrier or
diluent.
[0370] The term "pharmaceutically acceptable" refers to approved or
approvable by a regulatory agency of the Federal or a state
government or listed in the U.S. Pharmacopeia or other generally
recognized pharmacopeia for use in animals, including humans.
[0371] A "pharmaceutically acceptable excipient, carrier or
diluent" refers to an excipient, carrier or diluent that can be
administered to a subject, together with an agent, and which does
not destroy the pharmacological activity thereof and is nontoxic
when administered in doses sufficient to deliver a therapeutic
amount of the agent.
[0372] A "pharmaceutically acceptable salt" of pooled tumor
specific neoantigens as recited herein may be an acid or base salt
that is generally considered in the art to be suitable for use in
contact with the tissues of human beings or animals without
excessive toxicity, irritation, allergic response, or other problem
or complication. Such salts include mineral and organic acid salts
of basic residues such as amines, as well as alkali or organic
salts of acidic residues such as carboxylic acids. Specific
pharmaceutical salts include, but are not limited to, salts of
acids such as hydrochloric, phosphoric, hydrobromic, malic,
glycolic, fumaric, sulfuric, sulfamic, sulfanilic, formic,
toluenesulfonic, methanesulfonic, benzene sulfonic, ethane
disulfonic, 2-hydroxyethylsulfonic, nitric, benzoic,
2-acetoxybenzoic, citric, tartaric, lactic, stearic, salicylic,
glutamic, ascorbic, pamoic, succinic, fumaric, maleic, propionic,
hydroxymaleic, hydroiodic, phenylacetic, alkanoic such as acetic,
HOOC--(CH2)n-COOH where n is 0-4, and the like. Similarly,
pharmaceutically acceptable cations include, but are not limited to
sodium, potassium, calcium, aluminum, lithium and ammonium. Those
of ordinary skill in the art will recognize from this disclosure
and the knowledge in the art that further pharmaceutically
acceptable salts for the pooled tumor specific neoantigens provided
herein, including those listed by Remington's Pharmaceutical
Sciences, 17th ed., Mack Publishing Company, Easton, Pa., p. 1418
(1985). In general, a pharmaceutically acceptable acid or base salt
can be synthesized from a parent compound that contains a basic or
acidic moiety by any conventional chemical method. Briefly, such
salts can be prepared by reacting the free acid or base forms of
these compounds with a stoichiometric amount of the appropriate
base or acid in an appropriate solvent.
[0373] By a "polypeptide" or "peptide" is meant a polypeptide that
has been separated from components that naturally accompany it.
Typically, the polypeptide is isolated when it is at least 60%, by
weight, free from the proteins and naturally-occurring organic
molecules with which it is naturally associated. Preferably, the
preparation is at least 75%, more preferably at least 90%, and most
preferably at least 99%, by weight, a polypeptide. An isolated
polypeptide may be obtained, for example, by extraction from a
natural source, by expression of a recombinant nucleic acid
encoding such a polypeptide; or by chemically synthesizing the
protein. Purity can be measured by any appropriate method, for
example, column chromatography, polyacrylamide gel electrophoresis,
or by HPLC analysis.
[0374] As used herein, the terms "prevent," "preventing,"
"prevention," "prophylactic treatment," and the like, refer to
reducing the probability of developing a disease or condition in a
subject, who does not have, but is at risk of or susceptible to
developing a disease or condition.
[0375] The term "prime/boost" or "prime/boost dosing regimen" is
meant to refer to the successive administrations of a vaccine or
immunogenic or immunological compositions. The priming
administration (priming) is the administration of a first vaccine
or immunogenic or immunological composition type and may comprise
one, two or more administrations. The boost administration is the
second administration of a vaccine or immunogenic or immunological
composition type and may comprise one, two or more administrations,
and, for instance, may comprise or consist essentially of annual
administrations. In certain embodiments, administration of the
neoplasia vaccine or immunogenic composition is in a prime/boost
dosing regimen.
[0376] Ranges provided herein are understood to be shorthand for
all of the values within the range. For example, a range of 1 to 50
is understood to include any number, combination of numbers, or
sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26,
27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43,
44, 45, 46, 47, 48, 49, or 50, as well as all intervening decimal
values between the aforementioned integers such as, for example,
1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, and 1.9. With respect to
sub-ranges, "nested sub-ranges" that extend from either end point
of the range are specifically contemplated. For example, a nested
sub-range of an exemplary range of 1 to 50 may comprise 1 to 10, 1
to 20, 1 to 30, and 1 to 40 in one direction, or 50 to 40, 50 to
30, 50 to 20, and 50 to 10 in the other direction.
[0377] A "receptor" is to be understood as meaning a biological
molecule or a molecule grouping capable of binding a ligand. A
receptor may serve, to transmit information in a cell, a cell
formation or an organism. The receptor comprises at least one
receptor unit and frequently contains two or more receptor units,
where each receptor unit may consist of a protein molecule, in
particular a glycoprotein molecule. The receptor has a structure
that complements the structure of a ligand and may complex the
ligand as a binding partner. Signaling information may be
transmitted by conformational changes of the receptor following
binding with the ligand on the surface of a cell. According to the
invention, a receptor may refer to particular proteins of MHC
classes I and II capable of forming a receptor/ligand complex with
a ligand, in particular a peptide or peptide fragment of suitable
length.
[0378] The term "subject" refers to an animal which is the object
of treatment, observation, or experiment. By way of example only, a
subject includes, but is not limited to, a mammal, including, but
not limited to, a human or a non-human mammal, such as a non-human
primate, bovine, equine, canine, ovine, or feline.
[0379] The terms "treat," "treated," "treating," "treatment," and
the like are meant to refer to reducing or ameliorating a disorder
and/or symptoms associated therewith (e.g., a neoplasia or tumor).
"Treating" may refer to administration of the therapy to a subject
after the onset, or suspected onset, of a cancer. "Treating"
includes the concepts of "alleviating", which refers to lessening
the frequency of occurrence or recurrence, or the severity, of any
symptoms or other ill effects related to a cancer and/or the side
effects associated with cancer therapy. The term "treating" also
encompasses the concept of "managing" which refers to reducing the
severity of a particular disease or disorder in a patient or
delaying its recurrence, e.g., lengthening the period of remission
in a patient who had suffered from the disease. It is appreciated
that, although not precluded, treating a disorder or condition does
not require that the disorder, condition, or symptoms associated
therewith be completely eliminated.
[0380] The term "therapeutic effect" refers to some extent of
relief of one or more of the symptoms of a disorder (e.g., a
neoplasia or tumor) or its associated pathology. "Therapeutically
effective amount" as used herein refers to an amount of an agent
which is effective, upon single or multiple dose administration to
the cell or subject, in prolonging the survivability of the patient
with such a disorder, reducing one or more signs or symptoms of the
disorder, preventing or delaying, and the like beyond that expected
in the absence of such treatment. "Therapeutically effective
amount" is intended to qualify the amount required to achieve a
therapeutic effect. A physician or veterinarian having ordinary
skill in the art can readily determine and prescribe the
"therapeutically effective amount" (e.g., ED50) of the
pharmaceutical composition required. For example, the physician or
veterinarian could start doses of the compounds of the invention
employed in a pharmaceutical composition at levels lower than that
required in order to achieve the desired therapeutic effect and
gradually increase the dosage until the desired effect is
achieved.
[0381] The terms "spacer" or "linker" as used in reference to a
fusion protein refers to a peptide that joins the proteins
comprising a fusion protein. Generally, a spacer has no specific
biological activity other than to join or to preserve some minimum
distance or other spatial relationship between the proteins or RNA
sequences. However, in certain embodiments, the constituent amino
acids of a spacer may be selected to influence some property of the
molecule such as the folding, net charge, or hydrophobicity of the
molecule.
[0382] Suitable linkers for use in an embodiment of the present
invention are well known to those of skill in the art and include,
but are not limited to, straight or branched-chain carbon linkers,
heterocyclic carbon linkers, or peptide linkers. The linker is used
to separate two neoantigenic peptides by a distance sufficient to
ensure that, in a preferred embodiment, each neoantigenic peptide
properly folds. Preferred peptide linker sequences adopt a flexible
extended conformation and do not exhibit a propensity for
developing an ordered secondary structure. Typical amino acids in
flexible protein regions include Gly, Asn and Ser. Virtually any
permutation of amino acid sequences containing Gly, Asn and Ser
would be expected to satisfy the above criteria for a linker
sequence. Other near neutral amino acids, such as Thr and Ala, also
may be used in the linker sequence. Still other amino acid
sequences that may be used as linkers are disclosed in Maratea et
al. (1985), Gene 40: 39-46; Murphy et al. (1986) Proc. Nat'l. Acad.
Sci. USA 83: 8258-62; U.S. Pat. Nos. 4,935,233; 4,751,180.
[0383] The recitation of a listing of chemical groups in any
definition of a variable herein includes definitions of that
variable as any single group or combination of listed groups. The
recitation of an embodiment for a variable or aspect herein
includes that embodiment as any single embodiment or in combination
with any other embodiments or portions thereof.
[0384] Any compositions or methods provided herein can be combined
with one or more of any of the other compositions and methods
provided herein.
[0385] The therapy disclosed herein constitutes a new method for
treating various types of cancer. The therapy described herein also
provides a method of therapy for achieving clinical benefit without
an unacceptable level of side effects.
[0386] In one aspect the present invention relates to methods for
the treatment of neoplasia, and more particularly tumors, by
administering to a subject a vaccine or immunogenic composition
comprising a plurality of tumor specific neoantigenic peptides. As
described in more detail herein, in some embodiments the
composition provides a specific, optimized subset of tumor-specific
neoantigens suitable for the treatment of tumors in a high
proportion of subjects suffering from cancer. In some embodiments,
the tumor specific neoantigens may together bind to a high overall
proportion of HLA allotypes present in the subject population.
[0387] The immune system can be classified into two functional
subsystems: the innate and the acquired immune system. The innate
immune system is the first line of defense against infections, and
most potential pathogens are rapidly neutralized by this system
before they can cause, for example, a noticeable infection. The
acquired immune system reacts to molecular structures, referred to
as antigens, of the intruding organism. There are two types of
acquired immune reactions, which include the humoral immune
reaction and the cell-mediated immune reaction. In the humoral
immune reaction, antibodies secreted by B cells into bodily fluids
bind to pathogen-derived antigens, leading to the elimination of
the pathogen through a variety of mechanisms, e.g.
complement-mediated lysis. In the cell-mediated immune reaction,
T-cells capable of destroying other cells are activated. For
example, if proteins associated with a disease are present in a
cell, they are fragmented proteolytically to peptides within the
cell. Specific cell proteins then attach themselves to the antigen
or peptide formed in this manner and transport them to the surface
of the cell, where they are presented to the molecular defense
mechanisms, in particular T-cells, of the body. Cytotoxic T cells
recognize these antigens and kill the cells that harbor the
antigens.
[0388] The molecules that transport and present peptides on the
cell surface are referred to as proteins of the major
histocompatibility complex (MEW). MHC proteins are classified into
two types, referred to as MEW class I and MEW class II. The
structures of the proteins of the two MEW classes are very similar;
however, they have very different functions. Proteins of MHC class
I are present on the surface of almost all cells of the body,
including most tumor cells. MEW class I proteins are loaded with
antigens that usually originate from endogenous proteins or from
pathogens present inside cells, and are then presented to naive or
cytotoxic T-lymphocytes (CTLs). MHC class II proteins are present
on dendritic cells, B-lymphocytes, macrophages and other
antigen-presenting cells. They mainly present peptides, which are
processed from external antigen sources, i.e. outside of the cells,
to T-helper (Th) cells. Most of the peptides bound by the MHC class
I proteins originate from cytoplasmic proteins produced in the
healthy host cells of an organism itself, and do not normally
stimulate an immune reaction. Accordingly, cytotoxic T-lymphocytes
that recognize such self-peptide-presenting MHC molecules of class
I are deleted in the thymus (central tolerance) or, after their
release from the thymus, are deleted or inactivated, i.e. tolerized
(peripheral tolerance). MHC molecules are capable of stimulating an
immune reaction when they present peptides to non-tolerized
T-lymphocytes. Cytotoxic T-lymphocytes have both T-cell receptors
(TCR) and CD8 molecules on their surface. T-Cell receptors are
capable of recognizing and binding peptides complexed with the
molecules of MHC class I. Each cytotoxic T-lymphocyte expresses a
unique T-cell receptor which is capable of binding specific
MHC/peptide complexes.
[0389] The peptide antigens attach themselves to the molecules of
MHC class I by competitive affinity binding within the endoplasmic
reticulum, before they are presented on the cell surface. Here, the
affinity of an individual peptide antigen is directly linked to its
amino acid sequence and the presence of specific binding motifs in
defined positions within the amino acid sequence. If the sequence
of such a peptide is known, it is possible to manipulate the immune
system against diseased cells using, for example, peptide
vaccines.
[0390] One of the critical barriers to developing curative and
tumor-specific immunotherapy is the identification and selection of
highly specific and restricted tumor antigens to avoid
autoimmunity. Tumor neoantigens, which arise as a result of genetic
change (e.g., inversions, translocations, deletions, missense
mutations, splice site mutations, etc.) within malignant cells,
represent the most tumor-specific class of antigens. Neoantigens
have rarely been used in cancer vaccine or immunogenic compositions
due to technical difficulties in identifying them, selecting
optimized neoantigens, and producing neoantigens for use in a
vaccine or immunogenic composition. These problems may be addressed
by: [0391] identifying mutations in neoplasias/tumors which are
present at the DNA level in tumor but not in matched germline
samples from a high proportion of subjects having cancer; [0392]
analyzing the identified mutations with one or more peptide-MHC
binding prediction algorithms to generate a plurality of neoantigen
T cell epitopes that are expressed within the neoplasia/tumor and
that bind to a high proportion of patient HLA alleles; and [0393]
synthesizing the plurality of neoantigenic peptides selected from
the sets of all neoantigen peptides and predicted binding peptides
for use in a cancer vaccine or immunogenic composition suitable for
treating a high proportion of subjects having cancer.
[0394] For example, translating sequencing information into a
therapeutic vaccine may include:
[0395] (1) Prediction of Mutated Peptides that can Bind to HLA
Molecules of a High Proportion of Individuals.
[0396] Efficiently choosing which particular mutations to utilize
as immunogen requires the ability to predict which mutated peptides
would efficiently bind to a high proportion of patient's HLA
alleles. Recently, neural network based learning approaches with
validated binding and non-binding peptides have advanced the
accuracy of prediction algorithms for the major HLA-A and -B
Alleles.
[0397] (2) Formulating the drug as a multi-epitope vaccine of long
peptides.
[0398] Targeting as many mutated epitopes as practically possible
takes advantage of the enormous capacity of the immune system,
prevents the opportunity for immunological escape by
down-modulation of a particular immune targeted gene product, and
compensates for the known inaccuracy of epitope prediction
approaches. Synthetic peptides provide a particularly useful means
to prepare multiple immunogens efficiently and to rapidly translate
identification of mutant epitopes to an effective vaccine. Peptides
can be readily synthesized chemically and easily purified utilizing
reagents free of contaminating bacteria or animal substances. The
small size allows a clear focus on the mutated region of the
protein and also reduces irrelevant antigenic competition from
other components (unmutated protein or viral vector antigens).
[0399] (3) Combination with a Strong Vaccine Adjuvant.
[0400] Effective vaccines require a strong adjuvant to initiate an
immune response. As described below, poly-ICLC, an agonist of TLR3
and the RNA helicase-domains of MIDAS and RIG3, has shown several
desirable properties for a vaccine adjuvant. These properties
include the induction of local and systemic activation of immune
cells in vivo, production of stimulatory chemokines and cytokines,
and stimulation of antigen-presentation by DCs. Furthermore,
poly-ICLC can induce durable CD4+ and CD8+ responses in humans.
Importantly, striking similarities in the upregulation of
transcriptional and signal transduction pathways were seen in
subjects vaccinated with poly-ICLC and in volunteers who had
received the highly effective, replication-competent yellow fever
vaccine. Furthermore, >90% of ovarian carcinoma patients
immunized with poly-ICLC in combination with a NYES0-1 peptide
vaccine (in addition to Montanide) showed induction of CD4+ and
CD8+ T cell, as well as antibody responses to the peptide in a
recent phase 1 study. At the same time, polyICLC has been
extensively tested in more than 25 clinical trials to date and
exhibited a relatively benign toxicity profile.
[0401] The Above-Described Advantages of the Invention are
Described Further Herein.
[0402] As described herein, there is a large body of evidence in
both animals and humans that mutated epitopes are effective in
inducing an immune response and that cases of spontaneous tumor
regression or long term survival correlate with CD8+ T-cell
responses to mutated epitopes (Buckwalter and Srivastava PK. "It is
the antigen(s), stupid" and other lessons from over a decade of
vaccitherapy of human cancer. Seminars in immunology 20:296-300
(2008); Karanikas et al, High frequency of cytolytic T lymphocytes
directed against a tumor-specific mutated antigen detectable with
HLA tetramers in the blood of a lung carcinoma patient with long
survival. Cancer Res. 61:3718-3724 (2001); Lennerz et al, The
response of autologous T cells to a human melanoma is dominated by
mutated neoantigens. Proc Natl Acad Sci USA.102:16013 (2005)) and
that "immunoediting" can be tracked to alterations in expression of
dominant mutated antigens in mice and man (Matsushita et al, Cancer
exome analysis reveals a T-cell-dependent mechanism of cancer
immunoediting Nature 482:400 (2012); DuPage et al, Expression of
tumor-specific antigens underlies cancer immunoediting Nature
482:405 (2012); and Sampson et al, Immunologic escape after
prolonged progression-free survival with epidermal growth factor
receptor variant III peptide vaccination in patients with newly
diagnosed glioblastoma J Clin Oncol. 28:4722-4729 (2010)).
[0403] Sequencing technology has revealed that each tumor contains
multiple, patient-specific mutations that alter the protein coding
content of a gene. Such mutations create altered proteins, ranging
from single amino acid changes (caused by missense mutations) to
addition of long regions of novel amino acid sequence due to frame
shifts, read-through of termination codons or translation of intron
regions (novel open reading frame mutations; neoORFs). These
mutated proteins are valuable targets for the host's immune
response to the tumor as, unlike native proteins, they are not
subject to the immune-dampening effects of self-tolerance.
Therefore, mutated proteins are more likely to be immunogenic and
are also more specific for the tumor cells compared to normal cells
of the patient.
[0404] In one embodiment, the neoantigenic peptides in the
composition together have affinity to a plurality of MHC molecules,
e.g. which together cover a large proportion of the target
population. Efficiently choosing which particular mutations to
utilize as immunogen requires the ability to predict which mutated
peptides would efficiently bind to the HLA alleles present in the
patient population. Recently, neural network based learning
approaches with validated binding and non-binding peptides have
advanced the accuracy of prediction algorithms for the major HLA-A
and -B alleles. Utilizing the recently improved algorithms for
predicting which missense mutations create strong binding peptides
to cognate MHC molecules, a set of peptides representative of
optimal mutated epitopes (both neoORF and missense) for the patient
population may be identified and prioritized (Zhang et al, Machine
learning competition in immunology--Prediction of HLA class I
binding peptides J Immunol Methods 374:1 (2011); Lundegaard et al
Prediction of epitopes using neural network based methods J Immunol
Methods 374:26 (2011)).
[0405] Targeting as many mutated epitopes as practically possible
takes advantage of the enormous capacity of the immune system,
prevents the opportunity for immunological escape by
down-modulation of a particular immune targeted gene product, and
compensates for the known inaccuracy of epitope prediction
approaches. Synthetic peptides provide a particularly useful means
to prepare multiple immunogens efficiently and to rapidly translate
identification of mutant epitopes to an effective vaccine or
immunogenic composition. Peptides can be readily synthesized
chemically and easily purified utilizing reagents free of
contaminating bacteria or animal substances. The small size allows
a clear focus on the mutated region of the protein and also reduces
irrelevant antigenic competition from other components (unmutated
protein or viral vector antigens).
[0406] In one embodiment the drug formulation is a multi-epitope
vaccine or immunogenic composition of long peptides. Such "long"
peptides undergo efficient internalization, processing and
cross-presentation in professional antigen-presenting cells such as
dendritic cells, and have been shown to induce CTLs in humans
(Melief and van der Burg, Immunotherapy of established (pre)
malignant disease by synthetic long peptide vaccines Nature Rev
Cancer 8:351 (2008)). In one embodiment at least 2 peptides are
prepared for immunization. In some embodiments 20 or more peptides
are prepared for immunization. In one embodiment the neoantigenic
peptide ranges from about 5 to about 50 amino acids in length. In
another embodiment peptides from about 15 to about 35 amino acids
in length is synthesized. In preferred embodiment the neoantigenic
peptide ranges from about 20 to about 35 amino acids in length.
Production of Tumor Specific Neoantigens
[0407] The present invention is based, at least in part, on the
ability to present the immune system of the patient with a pool of
tumor specific neoantigens. One of skill in the art from this
disclosure and the knowledge in the art will appreciate that there
are a variety of ways in which to produce such tumor specific
neoantigens. In general, such tumor specific neoantigens may be
produced either in vitro or in vivo. Tumor specific neoantigens may
be produced in vitro as peptides or polypeptides, which may then be
formulated into a neoplasia vaccine or immunogenic composition and
administered to a subject. As described in further detail herein,
such in vitro production may occur by a variety of methods known to
one of skill in the art such as, for example, peptide synthesis or
expression of a peptide/polypeptide from a DNA or RNA molecule in
any of a variety of bacterial, eukaryotic, or viral recombinant
expression systems, followed by purification of the expressed
peptide/polypeptide. Alternatively, tumor specific neoantigens may
be produced in vivo by introducing molecules (e.g., DNA, RNA, viral
expression systems, and the like) that encode tumor specific
neoantigens into a subject, whereupon the encoded tumor specific
neoantigens are expressed. The methods of in vitro and in vivo
production of neoantigens is also further described herein as it
relates to pharmaceutical compositions and methods of delivery of
the therapy.
[0408] In certain embodiments the present invention includes
modified neoantigenic peptides. As used herein in reference to
neoantigenic peptides, the terms "modified", "modification" and the
like refer to one or more changes that enhance a desired property
of the neoantigenic peptide, where the change does not alter the
primary amino acid sequence of the neoantigenic peptide.
"Modification" includes a covalent chemical modification that does
not alter the primary amino acid sequence of the neoantigenic
peptide itself. Such desired properties include, for example,
prolonging the in vivo half-life, increasing the stability,
reducing the clearance, altering the immunogenicity or
allergenicity, enabling the raising of particular antibodies,
cellular targeting, antigen uptake, antigen processing, MHC
affinity, MHC stability, or antigen presentation. Changes to a
neoantigenic peptide that may be carried out include, but are not
limited to, conjugation to a carrier protein, conjugation to a
ligand, conjugation to an antibody, PEGylation, polysialylation
HESylation, recombinant PEG mimetics, Fc fusion, albumin fusion,
nanoparticle attachment, nanoparticulate encapsulation, cholesterol
fusion, iron fusion, acylation, amidation, glycosylation, side
chain oxidation, phosphorylation, biotinylation, the addition of a
surface active material, the addition of amino acid mimetics, or
the addition of unnatural amino acids.
[0409] The clinical effectiveness of protein therapeutics is often
limited by short plasma half-life and susceptibility to protease
degradation. Studies of various therapeutic proteins (e.g.,
filgrastim) have shown that such difficulties may be overcome by
various modifications, including conjugating or linking the
polypeptide sequence to any of a variety of non-proteinaceous
polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or
polyoxyalkylenes (see, for example, typically via a linking moiety
covalently bound to both the protein and the nonproteinaceous
polymer, e.g., a PEG). Such PEG-conjugated biomolecules have been
shown to possess clinically useful properties, including better
physical and thermal stability, protection against susceptibility
to enzymatic degradation, increased solubility, longer in vivo
circulating half-life and decreased clearance, reduced
immunogenicity and antigenicity, and reduced toxicity.
[0410] PEGs suitable for conjugation to a polypeptide sequence are
generally soluble in water at room temperature, and have the
general formula R(0-CH.sub.2--CH.sub.2).sub.nO--R, where R is
hydrogen or a protective group such as an alkyl or an alkanol
group, and where n is an integer from 1 to 1000. When R is a
protective group, it generally has from 1 to 8 carbons. The PEG
conjugated to the polypeptide sequence can be linear or branched.
Branched PEG derivatives, "star-PEGs" and multi-armed PEGs are
contemplated by the present disclosure. A molecular weight of the
PEG used in the present disclosure is not restricted to any
particular range, but certain embodiments have a molecular weight
between 500 and 20,000 while other embodiments have a molecular
weight between 4,000 and 10,000.
[0411] The present disclosure also contemplates compositions of
conjugates wherein the PEGs have different n values and thus the
various different PEGs are present in specific ratios. For example,
some compositions comprise a mixture of conjugates where n=1, 2, 3
and 4. In some compositions, the percentage of conjugates where n=1
is 18-25%, the percentage of conjugates where n=2 is 50-66%, the
percentage of conjugates where n=3 is 12-16%, and the percentage of
conjugates where n=4 is up to 5%. Such compositions can be produced
by reaction conditions and purification methods know in the art.
For example, cation exchange chromatography may be used to separate
conjugates, and a fraction is then identified which contains the
conjugate having, for example, the desired number of PEGs attached,
purified free from unmodified protein sequences and from conjugates
having other numbers of PEGs attached.
[0412] PEG may be bound to a polypeptide of the present disclosure
via a terminal reactive group (a "spacer"). The spacer is, for
example, a terminal reactive group which mediates a bond between
the free amino or carboxyl groups of one or more of the polypeptide
sequences and polyethylene glycol. The PEG having the spacer which
may be bound to the free amino group includes
N-hydroxysuccinylimide polyethylene glycol which may be prepared by
activating succinic acid ester of polyethylene glycol with
N-hydroxy succinylimide. Another activated polyethylene glycol
which may be bound to a free amino group is
2,4-bis(0-methoxypolyethyleneglycol)-6-chloro-s-triazine which may
be prepared by reacting polyethylene glycol monomethyl ether with
cyanuric chloride. The activated polyethylene glycol which is bound
to the free carboxyl group includes polyoxyethylenediamine.
[0413] Conjugation of one or more of the polypeptide sequences of
the present disclosure to PEG having a spacer may be carried out by
various conventional methods. For example, the conjugation reaction
can be carried out in solution at a pH of from 5 to 10, at
temperature from 4.degree. C. to room temperature, for 30 minutes
to 20 hours, utilizing a molar ratio of reagent to protein of from
4:1 to 30:1. Reaction conditions may be selected to direct the
reaction towards producing predominantly a desired degree of
substitution. In general, low temperature, low pH (e.g., pH=5), and
short reaction time tend to decrease the number of PEGs attached,
whereas high temperature, neutral to high pH (e.g., pH>7), and
longer reaction time tend to increase the number of PEGs attached.
Various means known in the art may be used to terminate the
reaction. In some embodiments the reaction is terminated by
acidifying the reaction mixture and freezing at, e.g., -20.degree.
C.
[0414] The present disclosure also contemplates the use of PEG
Mimetics. Recombinant PEG mimetics have been developed that retain
the attributes of PEG (e.g., enhanced serum half-life) while
conferring several additional advantageous properties. By way of
example, simple polypeptide chains (comprising, for example, Ala,
Glu, Gly, Pro, Ser and Thr) capable of forming an extended
conformation similar to PEG can be produced recombinantly already
fused to the peptide or protein drug of interest (e.g., Amunix`
XTEN technology; Mountain View, Calif.). This obviates the need for
an additional conjugation step during the manufacturing process.
Moreover, established molecular biology techniques enable control
of the side chain composition of the polypeptide chains, allowing
optimization of immunogenicity and manufacturing properties.
[0415] For purposes of the present disclosure, "glycosylation" is
meant to broadly refer to the enzymatic process that attaches
glycans to proteins, lipids or other organic molecules. The use of
the term "glycosylation" in conjunction with the present disclosure
is generally intended to mean adding or deleting one or more
carbohydrate moieties (either by removing the underlying
glycosylation site or by deleting the glycosylation by chemical
and/or enzymatic means), and/or adding one or more glycosylation
sites that may or may not be present in the native sequence. In
addition, the phrase includes qualitative changes in the
glycosylation of the native proteins involving a change in the
nature and proportions of the various carbohydrate moieties
present. Glycosylation can dramatically affect the physical
properties of proteins and can also be important in protein
stability, secretion, and subcellular localization. Proper
glycosylation can be essential for biological activity. In fact,
some genes from eucaryotic organisms, when expressed in bacteria
(e.g., E. coli) which lack cellular processes for glycosylating
proteins, yield proteins that are recovered with little or no
activity by virtue of their lack of glycosylation.
[0416] Addition of glycosylation sites can be accomplished by
altering the amino acid sequence. The alteration to the polypeptide
may be made, for example, by the addition of, or substitution by,
one or more serine or threonine residues (for O-linked
glycosylation sites) or asparagine residues (for N-linked
glycosylation sites). The structures of N-linked and O-linked
oligosaccharides and the sugar residues found in each type may be
different. One type of sugar that is commonly found on both is
N-acetylneuraminic acid (hereafter referred to as sialic acid).
Sialic acid is usually the terminal residue of both N-linked and
O-linked oligosaccharides and, by virtue of its negative charge,
may confer acidic properties to the glycoprotein. A particular
embodiment of the present disclosure comprises the generation and
use of N-glycosylation variants.
[0417] The polypeptide sequences of the present disclosure may
optionally be altered through changes at the DNA level,
particularly by mutating the DNA encoding the polypeptide at
preselected bases such that codons are generated that will
translate into the desired amino acids. Another means of increasing
the number of carbohydrate moieties on the polypeptide is by
chemical or enzymatic coupling of glycosides to the
polypeptide.
[0418] Removal of carbohydrates may be accomplished chemically or
enzymatically, or by substitution of codons encoding amino acid
residues that are glycosylated. Chemical deglycosylation techniques
are known, and enzymatic cleavage of carbohydrate moieties on
polypeptides can be achieved by the use of a variety of endo- and
exo-glycosidases.
[0419] Dihydrofolate reductase (DHFR)--deficient Chinese Hamster
Ovary (CHO) cells are a commonly used host cell for the production
of recombinant glycoproteins. These cells do not express the enzyme
beta-galactoside alpha-2,6-sialyltransferase and therefore do not
add sialic acid in the alpha-2,6 linkage to N-linked
oligosaccharides of glycoproteins produced in these cells.
[0420] The present disclosure also contemplates the use of
polysialylation, the conjugation of peptides and proteins to the
naturally occurring, biodegradable a-(2.fwdarw.8) linked polysialic
acid ("PSA") in order to improve their stability and in vivo
pharmacokinetics. PSA is a biodegradable, non-toxic natural polymer
that is highly hydrophilic, giving it a high apparent molecular
weight in the blood which increases its serum half-life. In
addition, polysialylation of a range of peptide and protein
therapeutics has led to markedly reduced proteolysis, retention of
activity in vivo activity, and reduction in immunogenicity and
antigenicity (see, e.g., G. Gregoriadis et al., Int. J.
Pharmaceutics 300(1-2): 125-30). As with modifications with other
conjugates (e.g., PEG), various techniques for site-specific
polysialylation are available (see, e.g., T. Lindhout et al., PNAS
108(18)7397-7402 (2011)).
[0421] Additional suitable components and molecules for conjugation
include, for example, thyroglobulin; albumins such as human serum
albumin (HAS); tetanus toxoid; Diphtheria toxoid; polyamino acids
such as poly(D-lysine:D-glutamic acid); VP6 polypeptides of
rotaviruses; influenza virus hemaglutinin, influenza virus
nucleoprotein; Keyhole Limpet Hemocyanin (KLH); and hepatitis B
virus core protein and surface antigen; or any combination of the
foregoing.
[0422] Fusion of albumin to one or more polypeptides of the present
disclosure can, for example, be achieved by genetic manipulation,
such that the DNA coding for HSA, or a fragment thereof, is joined
to the DNA coding for the one or more polypeptide sequences.
Thereafter, a suitable host can be transformed or transfected with
the fused nucleotide sequences in the form of, for example, a
suitable plasmid, so as to express a fusion polypeptide. The
expression may be effected in vitro from, for example, prokaryotic
or eukaryotic cells, or in vivo from, for example, a transgenic
organism. In some embodiments of the present disclosure, the
expression of the fusion protein is performed in mammalian cell
lines, for example, CHO cell lines. Transformation is used broadly
herein to refer to the genetic alteration of a cell resulting from
the direct uptake, incorporation and expression of exogenous
genetic material (exogenous DNA) from its surroundings and taken up
through the cell membrane(s). Transformation occurs naturally in
some species of bacteria, but it can also be effected by artificial
means in other cells.
[0423] Furthermore, albumin itself may be modified to extend its
circulating half-life. Fusion of the modified albumin to one or
more Polypeptides can be attained by the genetic manipulation
techniques described above or by chemical conjugation; the
resulting fusion molecule has a half-life that exceeds that of
fusions with non-modified albumin. (See WO2011/051489).
[0424] Several albumin-binding strategies have been developed as
alternatives for direct fusion, including albumin binding through a
conjugated fatty acid chain (acylation). Because serum albumin is a
transport protein for fatty acids, these natural ligands with
albumin-binding activity have been used for half-life extension of
small protein therapeutics. For example, insulin determir
(LEVEMIR), an approved product for diabetes, comprises a myristyl
chain conjugated to a genetically-modified insulin, resulting in a
long-acting insulin analog.
[0425] Another type of modification is to conjugate (e.g., link)
one or more additional components or molecules at the N- and/or
C-terminus of a polypeptide sequence, such as another protein
(e.g., a protein having an amino acid sequence heterologous to the
subject protein), or a carrier molecule. Thus, an exemplary
polypeptide sequence can be provided as a conjugate with another
component or molecule.
[0426] A conjugate modification may result in a polypeptide
sequence that retains activity with an additional or complementary
function or activity of the second molecule. For example, a
polypeptide sequence may be conjugated to a molecule, e.g., to
facilitate solubility, storage, in vivo or shelf half-life or
stability, reduction in immunogenicity, delayed or controlled
release in vivo, etc. Other functions or activities include a
conjugate that reduces toxicity relative to an unconjugated
polypeptide sequence, a conjugate that targets a type of cell or
organ more efficiently than an unconjugated polypeptide sequence,
or a drug to further counter the causes or effects associated with
a disorder or disease as set forth herein (e.g., diabetes).
[0427] A Polypeptide may also be conjugated to large, slowly
metabolized macromolecules such as proteins; polysaccharides, such
as sepharose, agarose, cellulose, cellulose beads; polymeric amino
acids such as polyglutamic acid, polylysine; amino acid copolymers;
inactivated virus particles; inactivated bacterial toxins such as
toxoid from diphtheria, tetanus, cholera, leukotoxin molecules;
inactivated bacteria; and dendritic cells.
[0428] Additional candidate components and molecules for
conjugation include those suitable for isolation or purification.
Particular non-limiting examples include binding molecules, such as
biotin (biotin-avidin specific binding pair), an antibody, a
receptor, a ligand, a lectin, or molecules that comprise a solid
support, including, for example, plastic or polystyrene beads,
plates or beads, magnetic beads, test strips, and membranes.
[0429] Purification methods such as cation exchange chromatography
may be used to separate conjugates by charge difference, which
effectively separates conjugates into their various molecular
weights. For example, the cation exchange column can be loaded and
then washed with -20 mM sodium acetate, pH -4, and then eluted with
a linear (0 M to 0.5 M) NaCl gradient buffered at a pH from about 3
to 5.5, e.g., at pH -4.5. The content of the fractions obtained by
cation exchange chromatography may be identified by molecular
weight using conventional methods, for example, mass spectroscopy,
SDS-PAGE, or other known methods for separating molecular entities
by molecular weight.
[0430] In certain embodiments, the amino- or carboxyl-terminus of a
polypeptide sequence of the present disclosure can be fused with an
immunoglobulin Fc region (e.g., human Fc) to form a fusion
conjugate (or fusion molecule). Fc fusion conjugates have been
shown to increase the systemic half-life of biopharmaceuticals, and
thus the biopharmaceutical product may require less frequent
administration.
[0431] Fc binds to the neonatal Fc receptor (FcRn) in endothelial
cells that line the blood vessels, and, upon binding, the Fc fusion
molecule is protected from degradation and re-released into the
circulation, keeping the molecule in circulation longer. This Fc
binding is believed to be the mechanism by which endogenous IgG
retains its long plasma half-life. More recent Fc-fusion technology
links a single copy of a biopharmaceutical to the Fc region of an
antibody to optimize the pharmacokinetic and pharmacodynamic
properties of the biopharmaceutical as compared to traditional
Fc-fusion conjugates.
[0432] The present disclosure contemplates the use of other
modifications, currently known or developed in the future, of the
Polypeptides to improve one or more properties. One such method for
prolonging the circulation half-life, increasing the stability,
reducing the clearance, or altering the immunogenicity or
allergenicity of a polypeptide of the present disclosure involves
modification of the polypeptide sequences by hesylation, which
utilizes hydroxyethyl starch derivatives linked to other molecules
in order to modify the molecule's characteristics. Various aspects
of hesylation are described in, for example, U.S. Patent Appln.
Nos. 2007/0134197 and 2006/0258607.
In Vitro Peptide/Polypeptide Synthesis
[0433] Proteins or peptides may be made by any technique known to
those of skill in the art, including the expression of proteins,
polypeptides or peptides through standard molecular biological
techniques, the isolation of proteins or peptides from natural
sources, in vitro translation, or the chemical synthesis of
proteins or peptides. The nucleotide and protein, polypeptide and
peptide sequences corresponding to various genes have been
previously disclosed, and may be found at computerized databases
known to those of ordinary skill in the art. One such database is
the National Center for Biotechnology Information's Genbank and
GenPept databases located at the National Institutes of Health
website. The coding regions for known genes may be amplified and/or
expressed using the techniques disclosed herein or as would be
known to those of ordinary skill in the art. Alternatively, various
commercial preparations of proteins, polypeptides and peptides are
known to those of skill in the art.
[0434] Peptides can be readily synthesized chemically utilizing
reagents that are free of contaminating bacterial or animal
substances (Merrifield RB: Solid phase peptide synthesis. I. The
synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-54, 1963).
In certain embodiments, neoantigenic peptides are prepared by (1)
parallel solid-phase synthesis on multi-channel instruments using
uniform synthesis and cleavage conditions; (2) purification over a
RP-HPLC column with column stripping; and re-washing, but not
replacement, between peptides; followed by (3) analysis with a
limited set of the most informative assays. The Good Manufacturing
Practices (GMP) footprint can be defined around the set of peptides
for an individual patient, thus requiring suite changeover
procedures only between syntheses of peptides for different
patients.
[0435] Alternatively, a nucleic acid (e.g., a polynucleotide)
encoding a neoantigenic peptide of the invention may be used to
produce the neoantigenic peptide in vitro. The polynucleotide may
be, e.g., DNA, cDNA, PNA, CNA, RNA, either single- and/or
double-stranded, or native or stabilized forms of polynucleotides,
such as e.g. polynucleotides with a phosphorothiate backbone, or
combinations thereof and it may or may not contain introns so long
as it codes for the peptide. In one embodiment in vitro translation
is used to produce the peptide. Many exemplary systems exist that
one skilled in the art could utilize (e.g., Retic Lysate IVT Kit,
Life Technologies, Waltham, Mass.).
[0436] An expression vector capable of expressing a polypeptide can
also be prepared. Expression vectors for different cell types are
well known in the art and can be selected without undue
experimentation. Generally, the DNA is inserted into an expression
vector, such as a plasmid, in proper orientation and correct
reading frame for expression. If necessary, the DNA may be linked
to the appropriate transcriptional and translational regulatory
control nucleotide sequences recognized by the desired host (e.g.,
bacteria), although such controls are generally available in the
expression vector. The vector is then introduced into the host
bacteria for cloning using standard techniques (see, e.g., Sambrook
et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring
Harbor Laboratory, Cold Spring Harbor, N.Y.).
[0437] Expression vectors comprising the isolated polynucleotides,
as well as host cells containing the expression vectors, are also
contemplated. The neoantigenic peptides may be provided in the form
of RNA or cDNA molecules encoding the desired neoantigenic
peptides. One or more neoantigenic peptides of the invention may be
encoded by a single expression vector.
[0438] The term "polynucleotide encoding a polypeptide" encompasses
a polynucleotide which includes only coding sequences for the
polypeptide as well as a polynucleotide which includes additional
coding and/or non-coding sequences. Polynucleotides can be in the
form of RNA or in the form of DNA. DNA includes cDNA, genomic DNA,
and synthetic DNA; and can be double-stranded or single-stranded,
and if single stranded can be the coding strand or non-coding
(anti-sense) strand.
[0439] In embodiments, the polynucleotides may comprise the coding
sequence for the tumor specific neoantigenic peptide fused in the
same reading frame to a polynucleotide which aids, for example, in
expression and/or secretion of a polypeptide from a host cell
(e.g., a leader sequence which functions as a secretory sequence
for controlling transport of a polypeptide from the cell). The
polypeptide having a leader sequence is a preprotein and can have
the leader sequence cleaved by the host cell to form the mature
form of the polypeptide.
[0440] In embodiments, the polynucleotides can comprise the coding
sequence for the tumor specific neoantigenic peptide fused in the
same reading frame to a marker sequence that allows, for example,
for purification of the encoded polypeptide, which may then be
incorporated into the personalized neoplasia vaccine or immunogenic
composition. For example, the marker sequence can be a
hexa-histidine tag (SEQ ID NO: 33733) supplied by a pQE-9 vector to
provide for purification of the mature polypeptide fused to the
marker in the case of a bacterial host, or the marker sequence can
be a hemagglutinin (HA) tag derived from the influenza
hemagglutinin protein when a mammalian host (e.g., COS-7 cells) is
used. Additional tags include, but are not limited to, Calmodulin
tags, FLAG tags, Myc tags, S tags, SBP tags, Softag 1, Softag 3, V5
tag, Xpress tag, Isopeptag, SpyTag, Biotin Carboxyl Carrier Protein
(BCCP) tags, GST tags, fluorescent protein tags (e.g., green
fluorescent protein tags), maltose binding protein tags, Nus tags,
Strep-tag, thioredoxin tag, TC tag, Ty tag, and the like.
[0441] In embodiments, the polynucleotides may comprise the coding
sequence for one or more of the tumor specific neoantigenic
peptides fused in the same reading frame to create a single
concatamerized neoantigenic peptide construct capable of producing
multiple neoantigenic peptides.
[0442] In certain embodiments, isolated nucleic acid molecules
having a nucleotide sequence at least 60% identical, at least 65%
identical, at least 70% identical, at least 75% identical, at least
80% identical, at least 85% identical, at least 90% identical, at
least 95% identical, or at least 96%, 97%, 98% or 99% identical to
a polynucleotide encoding a tumor specific neoantigenic peptide of
the present invention, can be provided.
[0443] By a polynucleotide having a nucleotide sequence at least,
for example, 95% "identical" to a reference nucleotide sequence is
intended that the nucleotide sequence of the polynucleotide is
identical to the reference sequence except that the polynucleotide
sequence can include up to five point mutations per each 100
nucleotides of the reference nucleotide sequence. In other words,
to obtain a polynucleotide having a nucleotide sequence at least
95% identical to a reference nucleotide sequence, up to 5% of the
nucleotides in the reference sequence can be deleted or substituted
with another nucleotide, or a number of nucleotides up to 5% of the
total nucleotides in the reference sequence can be inserted into
the reference sequence. These mutations of the reference sequence
can occur at the amino- or carboxy-terminal positions of the
reference nucleotide sequence or anywhere between those terminal
positions, interspersed either individually among nucleotides in
the reference sequence or in one or more contiguous groups within
the reference sequence.
[0444] As a practical matter, whether any particular nucleic acid
molecule is at least 80% identical, at least 85% identical, at
least 90% identical, and in some embodiments, at least 95%, 96%,
97%, 98%, or 99% identical to a reference sequence can be
determined conventionally using known computer programs such as the
Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for
Unix, Genetics Computer Group, University Research Park, 575
Science Drive, Madison, Wis. 53711). Bestfit uses the local
homology algorithm of Smith and Waterman, Advances in Applied
Mathematics 2:482-489 (1981), to find the best segment of homology
between two sequences. When using Bestfit or any other sequence
alignment program to determine whether a particular sequence is,
for instance, 95% identical to a reference sequence according to
the present invention, the parameters are set such that the
percentage of identity is calculated over the full length of the
reference nucleotide sequence and that gaps in homology of up to 5%
of the total number of nucleotides in the reference sequence are
allowed.
[0445] The isolated tumor specific neoantigenic peptides described
herein can be produced in vitro (e.g., in the laboratory) by any
suitable method known in the art. Such methods range from direct
protein synthetic methods to constructing a DNA sequence encoding
isolated polypeptide sequences and expressing those sequences in a
suitable transformed host. In some embodiments, a DNA sequence is
constructed using recombinant technology by isolating or
synthesizing a DNA sequence encoding a wild-type protein of
interest. Optionally, the sequence can be mutagenized by
site-specific mutagenesis to provide functional analogs thereof.
See, e.g. Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81:5662-5066
(1984) and U.S. Pat. No. 4,588,585.
[0446] In embodiments, a DNA sequence encoding a polypeptide of
interest would be constructed by chemical synthesis using an
oligonucleotide synthesizer. Such oligonucleotides can be designed
based on the amino acid sequence of the desired polypeptide and
selecting those codons that are favored in the host cell in which
the recombinant polypeptide of interest is produced. Standard
methods can be applied to synthesize an isolated polynucleotide
sequence encoding an isolated polypeptide of interest. For example,
a complete amino acid sequence can be used to construct a
back-translated gene. Further, a DNA oligomer containing a
nucleotide sequence coding for the particular isolated polypeptide
can be synthesized. For example, several small oligonucleotides
coding for portions of the desired polypeptide can be synthesized
and then ligated. The individual oligonucleotides typically contain
5' or 3' overhangs for complementary assembly.
[0447] Once assembled (e.g., by synthesis, site-directed
mutagenesis, or another method), the polynucleotide sequences
encoding a particular isolated polypeptide of interest is inserted
into an expression vector and optionally operatively linked to an
expression control sequence appropriate for expression of the
protein in a desired host. Proper assembly can be confirmed by
nucleotide sequencing, restriction mapping, and expression of a
biologically active polypeptide in a suitable host. As well known
in the art, in order to obtain high expression levels of a
transfected gene in a host, the gene can be operatively linked to
transcriptional and translational expression control sequences that
are functional in the chosen expression host.
[0448] Recombinant expression vectors may be used to amplify and
express DNA encoding the tumor specific neoantigenic peptides.
Recombinant expression vectors are replicable DNA constructs which
have synthetic or cDNA-derived DNA fragments encoding a tumor
specific neoantigenic peptide or a bioequivalent analog operatively
linked to suitable transcriptional or translational regulatory
elements derived from mammalian, microbial, viral or insect genes.
A transcriptional unit generally comprises an assembly of (1) a
genetic element or elements having a regulatory role in gene
expression, for example, transcriptional promoters or enhancers,
(2) a structural or coding sequence which is transcribed into mRNA
and translated into protein, and (3) appropriate transcription and
translation initiation and termination sequences, as described in
detail herein. Such regulatory elements can include an operator
sequence to control transcription. The ability to replicate in a
host, usually conferred by an origin of replication, and a
selection gene to facilitate recognition of transformants can
additionally be incorporated. DNA regions are operatively linked
when they are functionally related to each other. For example, DNA
for a signal peptide (secretory leader) is operatively linked to
DNA for a polypeptide if it is expressed as a precursor which
participates in the secretion of the polypeptide; a promoter is
operatively linked to a coding sequence if it controls the
transcription of the sequence; or a ribosome binding site is
operatively linked to a coding sequence if it is positioned so as
to permit translation. Generally, operatively linked means
contiguous, and in the case of secretory leaders, means contiguous
and in reading frame. Structural elements intended for use in yeast
expression systems include a leader sequence enabling extracellular
secretion of translated protein by a host cell. Alternatively,
where recombinant protein is expressed without a leader or
transport sequence, it can include an N-terminal methionine
residue. This residue can optionally be subsequently cleaved from
the expressed recombinant protein to provide a final product.
[0449] Useful expression vectors for eukaryotic hosts, especially
mammals or humans include, for example, vectors comprising
expression control sequences from SV40, bovine papilloma virus,
adenovirus and cytomegalovirus. Useful expression vectors for
bacterial hosts include known bacterial plasmids, such as plasmids
from Escherichia coli, including pCR 1, pBR322, pMB9 and their
derivatives, wider host range plasmids, such as M13 and filamentous
single-stranded DNA phages.
[0450] Suitable host cells for expression of a polypeptide include
prokaryotes, yeast, insect or higher eukaryotic cells under the
control of appropriate promoters. Prokaryotes include gram negative
or gram positive organisms, for example E. coli or bacilli. Higher
eukaryotic cells include established cell lines of mammalian
origin. Cell-free translation systems could also be employed.
Appropriate cloning and expression vectors for use with bacterial,
fungal, yeast, and mammalian cellular hosts are well known in the
art (see Pouwels et al., Cloning Vectors: A Laboratory Manual,
Elsevier, N.Y., 1985).
[0451] Various mammalian or insect cell culture systems are also
advantageously employed to express recombinant protein. Expression
of recombinant proteins in mammalian cells can be performed because
such proteins are generally correctly folded, appropriately
modified and completely functional. Examples of suitable mammalian
host cell lines include the COS-7 lines of monkey kidney cells,
described by Gluzman (Cell 23:175, 1981), and other cell lines
capable of expressing an appropriate vector including, for example,
L cells, C127, 3T3, Chinese hamster ovary (CHO), 293, HeLa and BHK
cell lines. Mammalian expression vectors can comprise
nontranscribed elements such as an origin of replication, a
suitable promoter and enhancer linked to the gene to be expressed,
and other 5' or 3' flanking nontranscribed sequences, and 5' or 3'
nontranslated sequences, such as necessary ribosome binding sites,
a polyadenylation site, splice donor and acceptor sites, and
transcriptional termination sequences. Baculovirus systems for
production of heterologous proteins in insect cells are reviewed by
Luckow and Summers, Bio/Technology 6:47 (1988).
[0452] The proteins produced by a transformed host can be purified
according to any suitable method. Such standard methods include
chromatography (e.g., ion exchange, affinity and sizing column
chromatography, and the like), centrifugation, differential
solubility, or by any other standard technique for protein
purification. Affinity tags such as hexahistidine (SEQ ID NO:
33733), maltose binding domain, influenza coat sequence,
glutathione-S-transferase, and the like can be attached to the
protein to allow easy purification by passage over an appropriate
affinity column. Isolated proteins can also be physically
characterized using such techniques as proteolysis, nuclear
magnetic resonance and x-ray crystallography.
[0453] For example, supernatants from systems which secrete
recombinant protein into culture media can be first concentrated
using a commercially available protein concentration filter, for
example, an Amicon or Millipore Pellicon ultrafiltration unit.
Following the concentration step, the concentrate can be applied to
a suitable purification matrix. Alternatively, an anion exchange
resin can be employed, for example, a matrix or substrate having
pendant diethylaminoethyl (DEAE) groups. The matrices can be
acrylamide, agarose, dextran, cellulose or other types commonly
employed in protein purification. Alternatively, a cation exchange
step can be employed. Suitable cation exchangers include various
insoluble matrices comprising sulfopropyl or carboxymethyl groups.
Finally, one or more reversed-phase high performance liquid
chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media,
e.g., silica gel having pendant methyl or other aliphatic groups,
can be employed to further purify a cancer stem cell protein-Fc
composition. Some or all of the foregoing purification steps, in
various combinations, can also be employed to provide a homogeneous
recombinant protein.
[0454] Recombinant protein produced in bacterial culture can be
isolated, for example, by initial extraction from cell pellets,
followed by one or more concentration, salting-out, aqueous ion
exchange or size exclusion chromatography steps. High performance
liquid chromatography (HPLC) can be employed for final purification
steps. Microbial cells employed in expression of a recombinant
protein can be disrupted by any convenient method, including
freeze-thaw cycling, sonication, mechanical disruption, or use of
cell lysing agents.
In Vivo Peptide/Polypeptide Synthesis
[0455] The present invention also contemplates the use of nucleic
acid molecules as vehicles for delivering neoantigenic
peptides/polypeptides to the subject in need thereof, in vivo, in
the form of, e.g., DNA/RNA vaccines (see, e.g., WO2012/159643, and
WO2012/159754, hereby incorporated by reference in their
entirety).
[0456] In one embodiment neoantigens may be administered to a
patient in need thereof by use of a plasmid. These are plasmids
which usually consist of a strong viral promoter to drive the in
vivo transcription and translation of the gene (or complementary
DNA) of interest (Mor, et al., (1995). The Journal of Immunology
155 (4): 2039-2046). Intron A may sometimes be included to improve
mRNA stability and hence increase protein expression (Leitner et
al. (1997).The Journal of Immunology 159 (12): 6112-6119). Plasmids
also include a strong polyadenylation/transcriptional termination
signal, such as bovine growth hormone or rabbit beta-globulin
polyadenylation sequences (Alarcon et al., (1999). Adv. Parasitol.
Advances in Parasitology 42: 343-410; Robinson et al., (2000). Adv.
Virus Res. Advances in Virus Research 55: 1-74; Bohmet al., (1996).
Journal of Immunological Methods 193 (1): 29-40.). Multicistronic
vectors are sometimes constructed to express more than one
immunogen, or to express an immunogen and an immunostimulatory
protein (Lewis et al., (1999). Advances in Virus Research (Academic
Press) 54: 129-88).
[0457] Because the plasmid is the "vehicle" from which the
immunogen is expressed, optimising vector design for maximal
protein expression is essential (Lewis et al., (1999). Advances in
Virus Research (Academic Press) 54: 129-88). One way of enhancing
protein expression is by optimising the codon usage of pathogenic
mRNAs for eukaryotic cells. Another consideration is the choice of
promoter. Such promoters may be the SV40 promoter or Rous Sarcoma
Virus (RSV).
[0458] Plasmids may be introduced into animal tissues by a number
of different methods. The two most popular approaches are injection
of DNA in saline, using a standard hypodermic needle, and gene gun
delivery. A schematic outline of the construction of a DNA vaccine
plasmid and its subsequent delivery by these two methods into a
host is illustrated at Scientific American (Weiner et al., (1999)
Scientific American 281 (1): 34-41). Injection in saline is
normally conducted intramuscularly (IM) in skeletal muscle, or
intradermally (ID), with DNA being delivered to the extracellular
spaces. This can be assisted by electroporation by temporarily
damaging muscle fibres with myotoxins such as bupivacaine; or by
using hypertonic solutions of saline or sucrose (Alarcon et al.,
(1999). Adv. Parasitol. Advances in Parasitology 42: 343-410).
Immune responses to this method of delivery can be affected by many
factors, including needle type, needle alignment, speed of
injection, volume of injection, muscle type, and age, sex and
physiological condition of the animal being injected(Alarcon et
al., (1999). Adv. Parasitol. Advances in Parasitology 42:
343-410).
[0459] Gene gun delivery, the other commonly used method of
delivery, ballistically accelerates plasmid DNA (pDNA) that has
been adsorbed onto gold or tungsten microparticles into the target
cells, using compressed helium as an accelerant (Alarcon et al.,
(1999). Adv. Parasitol. Advances in Parasitology 42: 343-410; Lewis
et al., (1999). Advances in Virus Research (Academic Press) 54:
129-88).
[0460] Alternative delivery methods may include aerosol
instillation of naked DNA on mucosal surfaces, such as the nasal
and lung mucosa, (Lewis et al., (1999). Advances in Virus Research
(Academic Press) 54: 129-88) and topical administration of pDNA to
the eye and vaginal mucosa (Lewis et al., (1999) Advances in Virus
Research (Academic Press) 54: 129-88). Mucosal surface delivery has
also been achieved using cationic liposome-DNA preparations,
biodegradable microspheres, attenuated Shigella or Listeria vectors
for oral administration to the intestinal mucosa, and recombinant
adenovirus vectors. DNA or RNA may also be delivered to cells
following mild mechanical disruption of the cell membrane,
temporarily permeabilizing the cells. Such a mild mechanical
disruption of the membrane can be accomplished by gently forcing
cells through a small aperture (Ex Vivo Cytosolic Delivery of
Functional Macromolecules to Immune Cells, Sharei et al, PLOS
ONE|DOI:10.1371/journal.pone.0118803 Apr. 13, 2015).
[0461] The method of delivery determines the dose of DNA required
to raise an effective immune response. Saline injections require
variable amounts of DNA, from 10 .mu.g-1 mg, whereas gene gun
deliveries require 100 to 1000 times less DNA than intramuscular
saline injection to raise an effective immune response. Generally,
0.2 .mu.g-20 .mu.g are required, although quantities as low as 16
ng have been reported. These quantities vary from species to
species, with mice, for example, requiring approximately 10 times
less DNA than primates. Saline injections require more DNA because
the DNA is delivered to the extracellular spaces of the target
tissue (normally muscle), where it has to overcome physical
barriers (such as the basal lamina and large amounts of connective
tissue, to mention a few) before it is taken up by the cells, while
gene gun deliveries bombard DNA directly into the cells, resulting
in less "wastage" (See e.g., Sedegah et al., (1994). Proceedings of
the National Academy of Sciences of the United States of America 91
(21): 9866-9870; Daheshiaet al., (1997). The Journal of Immunology
159 (4): 1945-1952; Chen et al., (1998). The Journal of Immunology
160 (5): 2425-2432; Sizemore (1995) Science 270 (5234): 299-302;
Fynan et al., (1993) Proc. Natl. Acad. Sci. U.S.A. 90 (24):
11478-82).
[0462] In one embodiment, a neoplasia vaccine or immunogenic
composition may include separate DNA plasmids encoding, for
example, one or more neoantigenic peptides/polypeptides as
identified in according to the invention. As discussed herein, the
exact choice of expression vectors can depend upon the
peptide/polypeptides to be expressed, and is well within the skill
of the ordinary artisan. The expected persistence of the DNA
constructs (e.g., in an episomal, non-replicating, non-integrated
form in the muscle cells) is expected to provide an increased
duration of protection.
[0463] One or more neoantigenic peptides of the invention may be
encoded and expressed in vivo using a viral based system (e.g., an
adenovirus system, an adeno associated virus (AAV) vector, a
poxvirus, or a lentivirus). In one embodiment, the neoplasia
vaccine or immunogenic composition may include a viral based vector
for use in a human patient in need thereof, such as, for example,
an adenovirus (see, e.g., Baden et al. First-in-human evaluation of
the safety and immunogenicity of a recombinant adenovirus serotype
26 HIV-1 Env vaccine (IPCAVD 001). J Infect Dis. 2013 Jan. 15;
207(2):240-7, hereby incorporated by reference in its entirety).
Plasmids that can be used for adeno associated virus, adenovirus,
and lentivirus delivery have been described previously (see e.g.,
U.S. Pat. Nos. 6,955,808 and 6,943,019, and U.S. Patent application
No. 20080254008, hereby incorporated by reference).
[0464] The peptides and polypeptides of the invention can also be
expressed by a vector, e.g., a nucleic acid molecule as
herein-discussed, e.g., RNA or a DNA plasmid, a viral vector such
as a poxvirus, e.g., orthopox virus, avipox virus, or adenovirus,
AAV or lentivirus. This approach involves the use of a vector to
express nucleotide sequences that encode the peptide of the
invention. Upon introduction into an acutely or chronically
infected host or into a noninfected host, the vector expresses the
immunogenic peptide, and thereby elicits a host CTL response.
[0465] Among vectors that may be used in the practice of the
invention, integration in the host genome of a cell is possible
with retrovirus gene transfer methods, often resulting in long term
expression of the inserted transgene. In a preferred embodiment the
retrovirus is a lentivirus. Additionally, high transduction
efficiencies have been observed in many different cell types and
target tissues. The tropism of a retrovirus can be altered by
incorporating foreign envelope proteins, expanding the potential
target population of target cells. A retrovirus can also be
engineered to allow for conditional expression of the inserted
transgene, such that only certain cell types are infected by the
lentivirus. Cell type specific promoters can be used to target
expression in specific cell types. Lentiviral vectors are
retroviral vectors (and hence both lentiviral and retroviral
vectors may be used in the practice of the invention). Moreover,
lentiviral vectors are preferred as they are able to transduce or
infect non-dividing cells and typically produce high viral titers.
Selection of a retroviral gene transfer system may therefore depend
on the target tissue. Retroviral vectors are comprised of
cis-acting long terminal repeats with packaging capacity for up to
6-10 kb of foreign sequence. The minimum cis-acting LTRs are
sufficient for replication and packaging of the vectors, which are
then used to integrate the desired nucleic acid into the target
cell to provide permanent expression. Widely used retroviral
vectors that may be used in the practice of the invention include
those based upon murine leukemia virus (MuLV), gibbon ape leukemia
virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno
deficiency virus (HIV), and combinations thereof (see, e.g.,
Buchscher et al., (1992) J. Virol. 66:2731-2739; Johann et al.,
(1992) J. Virol. 66:1635-1640; Sommnerfelt et al., (1990) Virol.
176:58-59; Wilson et al., (1998) J. Virol. 63:2374-2378; Miller et
al., (1991) J. Virol. 65:2220-2224; PCT/US94/05700).
[0466] Also useful in the practice of the invention is a minimal
non-primate lentiviral vector, such as a lentiviral vector based on
the equine infectious anemia virus (EIAV) (see, e.g., Balagaan,
(2006) J Gene Med; 8: 275-285, Published online 21 Nov. 2005 in
Wiley InterScience (www.interscience.wiley.com). DOI:
10.1002/jgm.845). The vectors may have cytomegalovirus (CMV)
promoter driving expression of the target gene. Accordingly, the
invention contemplates amongst vector(s) useful in the practice of
the invention: viral vectors, including retroviral vectors and
lentiviral vectors.
[0467] Lentiviral vectors have been disclosed as in the treatment
for Parkinson's Disease, see, e.g., US Patent Publication No.
20120295960 and U.S. Pat. Nos. 7,303,910 and 7,351,585. Lentiviral
vectors have also been disclosed for delivery to the Brain, see,
e.g., US Patent Publication Nos. US20110293571; US20040013648,
US20070025970, US20090111106 and U.S. Pat. No. 7,259,015. In
another embodiment lentiviral vectors are used to deliver vectors
to the brain of those being treated for a disease.
[0468] As to lentivirus vector systems useful in the practice of
the invention, mention is made of U.S. Pat. Nos. 6,428,953,
6,165,782, 6,013,516, 5,994,136, 6,312,682, and 7,198,784, and
documents cited therein.
[0469] In an embodiment herein the delivery is via an lentivirus.
Zou et al. administered about 10 .mu.l of a recombinant lentivirus
having a titer of 1.times.10.sup.9 transducing units (TU)/ml by an
intrathecal catheter. These sort of dosages can be adapted or
extrapolated to use of a retroviral or lentiviral vector in the
present invention. For transduction in tissues such as the brain,
it is necessary to use very small volumes, so the viral preparation
is concentrated by ultracentrifugation. The resulting preparation
should have at least 10.sup.8 TU/ml, preferably from 10.sup.8 to
10.sup.9 TU/ml, more preferably at least 10.sup.9 TU/ml. Other
methods of concentration such as ultrafiltration or binding to and
elution from a matrix may be used.
[0470] In other embodiments the amount of lentivirus administered
may be 1..times..10.sup.5 or about 1..times..10.sup.5 plaque
forming units (PFU), 5..times..10.sup.5 or about 5..times..10.sup.5
PFU, 1..times..10.sup.6 or about 1..times.10.sup.6 PFU,
5..times..10.sup.6 or about 5..times..10.sup.6 PFU,
1..times..10.sup.7 or about 1..times..10.sup.7PFU,
5..times..10.sup.7 or about 5..times..10.sup.7PFU,
1..times..10.sup.8 or about 1..times..10.sup.8 PFU,
5..times..10.sup.8 or about 5..times..10.sup.8 PFU,
1..times..10.sup.9 or about 1..times..10.sup.9PFU,
5..times..10.sup.9 or about 5..times..10.sup.9PFU,
1..times..10.sup.10 or about 1..times..10.sup.10 PFU or
5..times..10.sup.10 or about 5..times..10.sup.10 PFU as total
single dosage for an average human of 75 kg or adjusted for the
weight and size and species of the subject. One of skill in the art
can determine suitable dosage. Suitable dosages for a virus can be
determined empirically.
[0471] Also useful in the practice of the invention is an
adenovirus vector. One advantage is the ability of recombinant
adenoviruses to efficiently transfer and express recombinant genes
in a variety of mammalian cells and tissues in vitro and in vivo,
resulting in the high expression of the transferred nucleic acids.
Further, the ability to productively infect quiescent cells,
expands the utility of recombinant adenoviral vectors. In addition,
high expression levels ensure that the products of the nucleic
acids will be expressed to sufficient levels to generate an immune
response (see e.g., U.S. Pat. No. 7,029,848, hereby incorporated by
reference).
[0472] As to adenovirus vectors useful in the practice of the
invention, mention is made of U.S. Pat. No. 6,955,808. The
adenovirus vector used can be selected from the group consisting of
the Ad5, Ad35, Ad11, C6, and C7 vectors. The sequence of the
Adenovirus 5 ("Ad5") genome has been published. (Chroboczek, J.,
Bieber, F., and Jacrot, B. (1992) The Sequence of the Genome of
Adenovirus Type 5 and Its Comparison with the Genome of Adenovirus
Type 2, Virology 186, 280-285; the contents if which is hereby
incorporated by reference). Ad35 vectors are described in U.S. Pat.
Nos. 6,974,695, 6,913,922, and 6,869,794. Ad11 vectors are
described in U.S. Pat. No. 6,913,922. C6 adenovirus vectors are
described in U.S. Pat. Nos. 6,780,407; 6,537,594; 6,309,647;
6,265,189; 6,156,567; 6,090,393; 5,942,235 and 5,833,975. C7
vectors are described in U.S. Pat. No. 6,277,558. Adenovirus
vectors that are E1-defective or deleted, E3-defective or deleted,
and/or E4-defective or deleted may also be used. Certain
adenoviruses having mutations in the E1 region have improved safety
margin because E1-defective adenovirus mutants are
replication-defective in non-permissive cells, or, at the very
least, are highly attenuated. Adenoviruses having mutations in the
E3 region may have enhanced the immunogenicity by disrupting the
mechanism whereby adenovirus down-regulates MHC class I molecules.
Adenoviruses having E4 mutations may have reduced immunogenicity of
the adenovirus vector because of suppression of late gene
expression. Such vectors may be particularly useful when repeated
re-vaccination utilizing the same vector is desired. Adenovirus
vectors that are deleted or mutated in E1, E3, E4, E1 and E3, and
E1 and E4 can be used in accordance with the present invention.
Furthermore, "gutless" adenovirus vectors, in which all viral genes
are deleted, can also be used in accordance with the present
invention. Such vectors require a helper virus for their
replication and require a special human 293 cell line expressing
both E1a and Cre, a condition that does not exist in natural
environment. Such "gutless" vectors are non-immunogenic and thus
the vectors may be inoculated multiple times for re-vaccination.
The "gutless" adenovirus vectors can be used for insertion of
heterologous inserts/genes such as the transgenes of the present
invention, and can even be used for co-delivery of a large number
of heterologous inserts/genes.
[0473] In an embodiment herein the delivery is via an adenovirus,
which may be at a single booster dose containing at least
1.times.10.sup.5 particles (also referred to as particle units, pu)
of adenoviral vector. In an embodiment herein, the dose preferably
is at least about 1.times.10.sup.6 particles (for example, about
1.times.10.sup.6-1.times.10.sup.12 particles), more preferably at
least about 1.times.10.sup.7 particles, more preferably at least
about 1.times.10.sup.8 particles (e.g., about
1.times.10.sup.8-1.times.10.sup.11 particles or about
1.times.10.sup.8-1.times.10.sup.12 particles), and most preferably
at least about 1.times.10.sup.9 particles (e.g., about
1.times.10.sup.9-1.times.10.sup.10 particles or about
1.times.10.sup.9-1.times.10.sup.12 particles), or even at least
about 1.times.10.sup.10 particles (e.g., about
1.times.10.sup.10-1.times.10.sup.12 particles) of the adenoviral
vector. Alternatively, the dose comprises no more than about
1.times.10.sup.14 particles, preferably no more than about
1.times.10.sup.13 particles, even more preferably no more than
about 1.times.10.sup.12 particles, even more preferably no more
than about 1.times.10.sup.11 particles, and most preferably no more
than about 1.times.10.sup.10 particles (e.g., no more than about
1.times.10.sup.9 articles). Thus, the dose may contain a single
dose of adenoviral vector with, for example, about 1.times.10.sup.6
particle units (pu), about 2.times.10.sup.6 pu, about
4.times.10.sup.6 pu, about 1.times.10.sup.7 pu, about
2.times.10.sup.7 pu, about 4.times.10.sup.7 pu, about
1.times.10.sup.8 pu, about 2.times.10.sup.8 pu, about
4.times.10.sup.8 pu, about 1.times.10.sup.9 pu, about
2.times.10.sup.9 pu, about 4.times.10.sup.9 pu, about
1.times.10.sup.10 pu, about 2.times.10.sup.10 pu, about
4.times.10.sup.10 pu, about 1.times.10.sup.11 pu, about
2.times.10.sup.11 pu, about 4.times.10.sup.11 pu, about
1.times.10.sup.12 pu, about 2.times.10.sup.12 pu, or about
4.times.10.sup.12 pu of adenoviral vector. See, for example, the
adenoviral vectors in U.S. Pat. No. 8,454,972 B2 to Nabel, et. al.,
granted on Jun. 4, 2013; incorporated by reference herein, and the
dosages at col 29, lines 36-58 thereof. In an embodiment herein,
the adenovirus is delivered via multiple doses.
[0474] In terms of in vivo delivery, AAV is advantageous over other
viral vectors due to low toxicity and low probability of causing
insertional mutagenesis because it doesn't integrate into the host
genome. AAV has a packaging limit of 4.5 or 4.75 Kb. Constructs
larger than 4.5 or 4.75 Kb result in significantly reduced virus
production. There are many promoters that can be used to drive
nucleic acid molecule expression. AAV ITR can serve as a promoter
and is advantageous for eliminating the need for an additional
promoter element. For ubiquitous expression, the following
promoters can be used: CMV, CAG, CBh, PGK, SV40, Ferritin heavy or
light chains, etc. For brain expression, the following promoters
can be used: SynapsinI for all neurons, CaMKIIalpha for excitatory
neurons, GAD67 or GAD65 or VGAT for GABAergic neurons, etc.
Promoters used to drive RNA synthesis can include: Pol III
promoters such as U6 or H1. The use of a Pol II promoter and
intronic cassettes can be used to express guide RNA (gRNA).
[0475] With regard to AAV vectors useful in the practice of the
invention, mention is made of U.S. Pat. Nos. 5,658,785, 7,115,391,
7,172,893, 6,953,690, 6,936,466, 6,924,128, 6,893,865, 6,793,926,
6,537,540, 6,475,769 and 6,258,595, and documents cited
therein.
[0476] As to AAV, the AAV can be AAV1, AAV2, AAV5 or any
combination thereof. One can select the AAV with regard to the
cells to be targeted; e.g., one can select AAV serotypes 1, 2, 5 or
a hybrid capsid AAV1, AAV2, AAV5 or any combination thereof for
targeting brain or neuronal cells; and one can select AAV4 for
targeting cardiac tissue. AAV8 is useful for delivery to the liver.
The above promoters and vectors are preferred individually.
[0477] In an embodiment herein, the delivery is via an AAV. A
therapeutically effective dosage for in vivo delivery of the AAV to
a human is believed to be in the range of from about 20 to about 50
ml of saline solution containing from about 1.times.10.sup.10 to
about 1.times.10.sup.50 functional AAV/ml solution. The dosage may
be adjusted to balance the therapeutic benefit against any side
effects. In an embodiment herein, the AAV dose is generally in the
range of concentrations of from about 1.times.10.sup.5 to
1.times.10.sup.50 genomes AAV, from about 1.times.10.sup.8 to
1.times.10.sup.20 genomes AAV, from about 1.times.10.sup.10 to
about 1.times.10.sup.16 genomes, or about 1.times.10.sup.11 to
about 1.times.10.sup.16 genomes AAV. A human dosage may be about
1.times.10.sup.13 genomes AAV. Such concentrations may be delivered
in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml,
or about 10 to about 25 ml of a carrier solution. In a preferred
embodiment, AAV is used with a titer of about 2.times.10.sup.13
viral genomes/milliliter, and each of the striatal hemispheres of a
mouse receives one 500 nanoliter injection. Other effective dosages
can be readily established by one of ordinary skill in the art
through routine trials establishing dose response curves. See, for
example, U.S. Pat. No. 8,404,658 B2 to Hajjar, et al., granted on
Mar. 26, 2013, at col. 27, lines 45-60.
[0478] In another embodiment effectively activating a cellular
immune response for a neoplasia vaccine or immunogenic composition
can be achieved by expressing the relevant neoantigens in a vaccine
or immunogenic composition in a non-pathogenic microorganism.
Well-known examples of such microorganisms are Mycobacterium bovis
BCG, Salmonella and Pseudomona (See, U.S. Pat. No. 6,991,797,
hereby incorporated by reference in its entirety).
[0479] In another embodiment a Poxvirus is used in the neoplasia
vaccine or immunogenic composition. These include orthopoxvirus,
avipox, vaccinia, MVA, NYVAC, canarypox, ALVAC, fowlpox, TROVAC,
etc. (see e.g., Verardiet al., Hum Vaccin Immunother. 2012 July;
8(7):961-70; and Moss, Vaccine. 2013; 31(39): 4220-4222). Poxvirus
expression vectors were described in 1982 and quickly became widely
used for vaccine development as well as research in numerous
fields. Advantages of the vectors include simple construction,
ability to accommodate large amounts of foreign DNA and high
expression levels.
[0480] Information concerning poxviruses that may be used in the
practice of the invention, such as Chordopoxvirinae subfamily
poxviruses (poxviruses of vertebrates), for instance,
orthopoxviruses and avipoxviruses, e.g., vaccinia virus (e.g.,
Wyeth Strain, WR Strain (e.g., ATCC.RTM. VR-1354), Copenhagen
Strain, NYVAC, NYVAC.1, NYVAC.2, MVA, MVA-BN), canarypox virus
(e.g., Wheatley C93 Strain, ALVAC), fowlpox virus (e.g., FP9
Strain, Webster Strain, TROVAC), dovepox, pigeonpox, quailpox, and
raccoon pox, inter alia, synthetic or non-naturally occurring
recombinants thereof, uses thereof, and methods for making and
using such recombinants may be found in scientific and patent
literature, such as: [0481] U.S. Pat. Nos. 4,603,112, 4,769,330,
5,110,587, 5,174,993, 5,364,773, 5,762,938, 5,494,807, 5,766,597,
7,767,449, 6,780,407, 6,537,594, 6,265,189, 6,214,353, 6,130,066,
6,004,777, 5,990,091, 5,942,235, 5,833,975, 5,766,597, 5,756,101,
7,045,313, 6,780,417, 8,470,598, 8,372,622, 8,268,329, 8,268,325,
8,236,560, 8,163,293, 7,964,398, 7,964,396, 7,964,395, 7,939,086,
7,923,017, 7,897,156, 7,892,533, 7,628,980, 7,459,270, 7,445,924,
7,384,644, 7,335,364, 7,189,536, 7,097,842, 6,913,752, 6,761,893,
6,682,743, 5,770,212, 5,766,882, and 5,989,562, and [0482]
Panicali, D. Proc. Natl. Acad. Sci. 1982; 79; 4927-493, Panicali D.
Proc. Natl. Acad. Sci. 1983; 80(17): 5364-8, Mackett, M. Proc.
Natl. Acad. Sci. 1982; 79: 7415-7419, Smith G L. Proc. Natl. Acad.
Sci. 1983; 80(23): 7155-9, Smith G L. Nature 1983; 302: 490-5,
Sullivan V J. Gen. Vir. 1987; 68: 2587-98, Perkus M Journal of
Leukocyte Biology 1995; 58:1-13, Yilma T D. Vaccine 1989; 7:
484-485, Brochier B. Nature 1991; 354: 520-22, Wiktor, T J. Proc.
Natl Acd. Sci. 1984; 81: 7194-8, Rupprecht, C E. Proc. Natl Acd.
Sci. 1986; 83: 7947-50, Poulet, H Vaccine 2007; 25(July): 5606-12,
Weyer J. Vaccine 2009; 27(November): 7198-201, Buller, R M Nature
1985; 317(6040): 813-5, Buller R M. J. Virol. 1988; 62(3):866-74,
Flexner, C. Nature 1987; 330(6145): 259-62, Shida, H. J. Virol.
1988; 62(12): 4474-80, Kotwal, G J. J. Virol. 1989; 63(2): 600-6,
Child, S J. Virology 1990; 174(2): 625-9, Mayr A. Zentralbl
Bakteriol 1978; 167(5,6): 375-9, Antoine G. Virology. 1998; 244(2):
365-96, Wyatt, L S. Virology 1998; 251(2): 334-42, Sancho, M C. J.
Virol. 2002; 76(16); 8313-34, Gallego-Gomez, J C. J. Virol. 2003;
77(19); 10606-22), Goebel S J. Virology 1990; (a,b) 179: 247-66,
Tartaglia, J. Virol. 1992; 188(1): 217-32, Najera J L. J. Virol.
2006; 80(12): 6033-47, Najera, J L. J. Virol. 2006; 80: 6033-6047,
Gomez, C E. J. Gen. Virol. 2007; 88: 2473-78, Mooij, P. Jour. Of
Virol. 2008; 82: 2975-2988, Gomez, C E. Curr. Gene Ther. 2011; 11:
189-217, Cox,W. Virology 1993; 195: 845-50, Perkus, M. Jour. Of
Leukocyte Biology 1995; 58: 1-13, Blanchard T J. J Gen Virology
1998; 79(5): 1159-67, Amara R. Science 2001; 292: 69-74, Hel, Z.,
J. Immunol. 2001; 167: 7180-9, Gherardi M M. J. Virol. 2003; 77:
7048-57, Didierlaurent, A. Vaccine 2004; 22: 3395-3403, Bissht H.
Proc. Nat. Aca. Sci. 2004; 101: 6641-46, McCurdy L H. Clin. Inf.
Dis 2004; 38: 1749-53, Earl P L. Nature 2004; 428: 182-85, Chen Z.
J. Virol. 2005; 79: 2678-2688, Najera J L. J. Virol. 2006; 80(12):
6033-47, Nam J H. Acta. Virol. 2007; 51: 125-30, Antonis A F.
Vaccine 2007; 25: 4818-4827,B Weyer J. Vaccine 2007; 25: 4213-22,
Ferrier-Rembert A. Vaccine 2008; 26(14): 1794-804, Corbett M. Proc.
Natl. Acad. Sci. 2008; 105(6): 2046-51, Kaufman H L., J. Clin.
Oncol. 2004; 22: 2122-32, Amato, R J. Clin. Cancer Res. 2008;
14(22): 7504-10, Dreicer R. Invest New Drugs 2009; 27(4): 379-86,
Kantoff P W.J. Clin. Oncol. 2010, 28, 1099-1105, Amato R J. J.
Clin. Can. Res. 2010; 16(22): 5539-47, Kim, D W. Hum. Vaccine.
2010; 6: 784-791, Oudard, S. Cancer Immunol. Immunother. 2011; 60:
261-71, Wyatt, L S. Aids Res. Hum. Retroviruses. 2004; 20: 645-53,
Gomez, C E. Virus Research 2004; 105: 11-22, Webster, D P. Proc.
Natl. Acad. Sci. 2005; 102: 4836-4, Huang, X. Vaccine 2007; 25:
8874-84, Gomez, C E. Vaccine 2007a; 25: 2863-85, Esteban M. Hum.
Vaccine 2009; 5: 867-871, Gomez, C E. Curr. Gene therapy 2008;
8(2): 97-120, Whelan, K T. Plos one 2009; 4(6): 5934, Scriba, T J.
Eur. Jour. Immuno. 2010; 40(1): 279-90, Corbett, M. Proc. Natl.
Acad. Sci. 2008; 105: 2046-2051, Midgley, C M. J. Gen. Virol. 2008;
89: 2992-97, Von Krempelhuber, A. Vaccine 2010; 28: 1209-16,
Perreau, M. J. Of Virol. 2011; October: 9854-62, Pantaleo, G. Curr
Opin HIV-AIDS. 2010; 5: 391-396, each of which is incorporated
herein by reference.
[0483] In another embodiment the vaccinia virus is used in the
neoplasia vaccine or immunogenic composition to express a
neoantigen. (Rolph et al., Recombinant viruses as vaccines and
immunological tools. Curr Opin Immunol 9:517-524, 1997). The
recombinant vaccinia virus is able to replicate within the
cytoplasm of the infected host cell and the polypeptide of interest
can therefore induce an immune response. Moreover, Poxviruses have
been widely used as vaccine or immunogenic composition vectors
because of their ability to target encoded antigens for processing
by the major histocompatibility complex class I pathway by directly
infecting immune cells, in particular antigen-presenting cells, but
also due to their ability to self-adjuvant.
[0484] In another embodiment ALVAC is used as a vector in a
neoplasia vaccine or immunogenic composition. ALVAC is a canarypox
virus that can be modified to express foreign transgenes and has
been used as a method for vaccination against both prokaryotic and
eukaryotic antigens (Honig H, Lee D S, Conkright W, et al. Phase I
clinical trial of a recombinant canarypoxvirus (ALVAC) vaccine
expressing human carcinoembryonic antigen and the B7.1
co-stimulatory molecule. Cancer Immunol Immunother 2000; 49:504-14;
von Mehren M, Arlen P, Tsang K Y, et al. Pilot study of a dual gene
recombinant avipox vaccine containing both carcinoembryonic antigen
(CEA) and B7.1 transgenes in patients with recurrent CEA-expressing
adenocarcinomas. Clin Cancer Res 2000; 6:2219-28; Musey L, Ding Y,
Elizaga M, et al. HIV-1 vaccination administered intramuscularly
can induce both systemic and mucosal T cell immunity in
HIV-1-uninfected individuals. J Immunol 2003; 171:1094-101;
Paoletti E. Applications of pox virus vectors to vaccination: an
update. Proc Natl Acad Sci USA 1996; 93:11349-53; U.S. Pat. No.
7,255,862). In a phase I clinical trial, an ALVAC virus expressing
the tumor antigen CEA showed an excellent safety profile and
resulted in increased CEA-specific T-cell responses in selected
patients; objective clinical responses, however, were not observed
(Marshall J L, Hawkins M J, Tsang K Y, et al. Phase I study in
cancer patients of a replication-defective avipox recombinant
vaccine that expresses human carcinoembryonic antigen. J Clin Oncol
1999; 17:332-7).
[0485] In another embodiment a Modified Vaccinia Ankara (MVA) virus
may be used as a viral vector for a neoantigen vaccine or
immunogenic composition. MVA is a member of the Orthopoxvirus
family and has been generated by about 570 serial passages on
chicken embryo fibroblasts of the Ankara strain of Vaccinia virus
(CVA) (for review see Mayr, A., et al., Infection 3, 6-14, 1975).
As a consequence of these passages, the resulting MVA virus
contains 31 kilobases less genomic information compared to CVA, and
is highly host-cell restricted (Meyer, H. et al., J. Gen. Virol.
72, 1031-1038, 1991). MVA is characterized by its extreme
attenuation, namely, by a diminished virulence or infectious
ability, but still holds an excellent immunogenicity. When tested
in a variety of animal models, MVA was proven to be avirulent, even
in immuno-suppressed individuals. Moreover, MVA-BN.RTM.-HER2 is a
candidate immunotherapy designed for the treatment of
HER-2-positive breast cancer and is currently in clinical trials.
(Mandl et al., Cancer Immunol Immunother. January 2012; 61(1):
19-29). Methods to make and use recombinant MVA has been described
(e.g., see U.S. Pat. Nos. 8,309,098 and 5,185,146 hereby
incorporated in its entirety).
[0486] In another embodiment the modified Copenhagen strain of
vaccinia virus, NYVAC and NYVAC variations are used as a vector
(see U.S. Pat. No. 7,255,862; PCT WO 95/30018; U.S. Pat. Nos.
5,364,773 and 5,494,807, hereby incorporated by reference in its
entirety).
[0487] In one embodiment recombinant viral particles of the vaccine
or immunogenic composition are administered to patients in need
thereof. Dosages of expressed neoantigen can range from a few to a
few hundred micrograms, e.g., 5 to 500. mu.g. The vaccine or
immunogenic composition can be administered in any suitable amount
to achieve expression at these dosage levels. The viral particles
can be administered to a patient in need thereof or transfected
into cells in an amount of about at least 10.sup.3.5 pfu; thus, the
viral particles are preferably administered to a patient in need
thereof or infected or transfected into cells in at least about
10.sup.4 pfu to about 10.sup.6 pfu; however, a patient in need
thereof can be administered at least about 10.sup.8 pfu such that a
more preferred amount for administration can be at least about
10.sup.7 pfu to about 10.sup.9 pfu. Doses as to NYVAC are
applicable as to ALVAC, MVA, MVA-BN, and avipoxes, such as
canarypox and fowlpox.
Vaccine or Immunogenic Composition Adjuvant
[0488] Effective vaccine or immunogenic compositions advantageously
include a strong adjuvant to initiate an immune response. As
described herein, poly-ICLC, an agonist of TLR3 and the RNA
helicase-domains of MDA5 and RIG3, has shown several desirable
properties for a vaccine or immunogenic composition adjuvant. These
properties include the induction of local and systemic activation
of immune cells in vivo, production of stimulatory chemokines and
cytokines, and stimulation of antigen-presentation by DCs.
Furthermore, poly-ICLC can induce durable CD4+ and CD8+ responses
in humans. Importantly, striking similarities in the upregulation
of transcriptional and signal transduction pathways were seen in
subjects vaccinated with poly-ICLC and in volunteers who had
received the highly effective, replication-competent yellow fever
vaccine. Furthermore, >90% of ovarian carcinoma patients
immunized with poly-ICLC in combination with a NY-ESO-1 peptide
vaccine (in addition to Montanide) showed induction of CD4+ and
CD8+ T cell, as well as antibody responses to the peptide in a
recent phase 1 study. At the same time, poly-ICLC has been
extensively tested in more than 25 clinical trials to date and
exhibited a relatively benign toxicity profile. In addition to a
powerful and specific immunogen the neoantigen peptides may be
combined with an adjuvant (e.g., poly-ICLC) or another
anti-neoplastic agent. Without being bound by theory, these
neoantigens are expected to bypass central thymic tolerance (thus
allowing stronger anti-tumor T cell response), while reducing the
potential for autoimmunity (e.g., by avoiding targeting of normal
self-antigens). An effective immune response advantageously
includes a strong adjuvant to activate the immune system (Speiser
and Romero, Molecularly defined vaccines for cancer immunotherapy,
and protective T cell immunity Seminars in Immunol 22:144 (2010)).
For example, Toll-like receptors (TLRs) have emerged as powerful
sensors of microbial and viral pathogen "danger signals",
effectively inducing the innate immune system, and in turn, the
adaptive immune system (Bhardwaj and Gnjatic, TLR AGONISTS: Are
They Good Adjuvants? Cancer J. 16:382-391 (2010)). Among the TLR
agonists, poly-ICLC (a synthetic double-stranded RNA mimic) is one
of the most potent activators of myeloid-derived dendritic cells.
In a human volunteer study, poly-ICLC has been shown to be safe and
to induce a gene expression profile in peripheral blood cells
comparable to that induced by one of the most potent live
attenuated viral vaccines, the yellow fever vaccine YF-17D (Caskey
et al, Synthetic double-stranded RNA induces innate immune
responses similar to a live viral vaccine in humans J Exp Med
208:2357 (2011)). In a preferred embodiment Hiltonol.RTM., a GMP
preparation of poly-ICLC prepared by Oncovir, Inc, is utilized as
the adjuvant. In other embodiments, other adjuvants described
herein are envisioned. For instance oil-in-water, water-in-oil or
multiphasic W/O/W; see, e.g., U.S. Pat. No. 7,608,279 and
Aucouturier et al, Vaccine 19 (2001), 2666-2672, and documents
cited therein.
Indications
[0489] Examples of cancers and cancer conditions that can be
treated with the therapy of this document include, but are not
limited to a patient in need thereof that has been diagnosed as
having cancer, or at risk of developing cancer. The subject may
have a solid tumor such as breast, ovarian, prostate, lung, kidney,
gastric, colon, testicular, head and neck, pancreas, brain,
melanoma, and other tumors of tissue organs and hematological
tumors, such as lymphomas and leukemias, including acute
myelogenous leukemia, chronic myelogenous leukemia, chronic
lymphocytic leukemia, T cell lymphocytic leukemia, and B cell
lymphomas, tumors of the brain and central nervous system (e.g.,
tumors of the meninges, brain, spinal cord, cranial nerves and
other parts of the CNS, such as glioblastomas or medulla
blastomas); head and/or neck cancer, breast tumors, tumors of the
circulatory system (e.g., heart, mediastinum and pleura, and other
intrathoracic organs, vascular tumors, and tumor-associated
vascular tissue); tumors of the blood and lymphatic system (e.g.,
Hodgkin's disease, Non-Hodgkin's disease lymphoma, Burkitt's
lymphoma, AIDS-related lymphomas, malignant immunoproliferative
diseases, multiple myeloma, and malignant plasma cell neoplasms,
lymphoid leukemia, myeloid leukemia, acute or chronic lymphocytic
leukemia, monocytic leukemia, other leukemias of specific cell
type, leukemia of unspecified cell type, unspecified malignant
neoplasms of lymphoid, hematopoietic and related tissues, such as
diffuse large cell lymphoma, T-cell lymphoma or cutaneous T-cell
lymphoma); tumors of the excretory system (e.g., kidney, renal
pelvis, ureter, bladder, and other urinary organs); tumors of the
gastrointestinal tract (e.g., esophagus, stomach, small intestine,
colon, colorectal, rectosigmoid junction, rectum, anus, and anal
canal); tumors involving the liver and intrahepatic bile ducts,
gall bladder, and other parts of the biliary tract, pancreas, and
other digestive organs; tumors of the oral cavity (e.g., lip,
tongue, gum, floor of mouth, palate, parotid gland, salivary
glands, tonsil, oropharynx, nasopharynx, puriform sinus,
hypopharynx, and other sites of the oral cavity); tumors of the
reproductive system (e.g., vulva, vagina, Cervix uteri, uterus,
ovary, and other sites associated with female genital organs,
placenta, penis, prostate, testis, and other sites associated with
male genital organs); tumors of the respiratory tract (e.g., nasal
cavity, middle ear, accessory sinuses, larynx, trachea, bronchus
and lung, such as small cell lung cancer and non-small cell lung
cancer); tumors of the skeletal system (e.g., bone and articular
cartilage of limbs, bone articular cartilage and other sites);
tumors of the skin (e.g., malignant melanoma of the skin,
non-melanoma skin cancer, basal cell carcinoma of skin, squamous
cell carcinoma of skin, mesothelioma, Kaposi's sarcoma); and tumors
involving other tissues including peripheral nerves and autonomic
nervous system, connective and soft tissue, retroperitoneoum and
peritoneum, eye, thyroid, adrenal gland, and other endocrine glands
and related structures, secondary and unspecified malignant
neoplasms of lymph nodes, secondary malignant neoplasm of
respiratory and digestive systems and secondary malignant neoplasm
of other sites. Thus the population of subjects described herein
may be suffering from one of the above cancer types. In other
embodiments, the population of subjects may be all subjects
suffering from solid tumors, or all subjects suffering from liquid
tumors.
[0490] Of special interest is the treatment of Non-Hodgkin's
Lymphoma (NHL), clear cell Renal Cell Carcinoma (ccRCC), metastatic
melanoma, sarcoma, leukemia or a cancer of the bladder, colon,
brain, breast, head and neck, endometrium, lung, ovary, pancreas or
prostate. In certain embodiments, the melanoma is high risk
melanoma.
[0491] Cancers that can be treated using the therapy described
herein may include among others cases which are refractory to
treatment with other chemotherapeutics. The term "refractory, as
used herein refers to a cancer (and/or metastases thereof), which
shows no or only weak antiproliferative response (e.g., no or only
weak inhibition of tumor growth) after treatment with another
chemotherapeutic agent. These are cancers that cannot be treated
satisfactorily with other chemotherapeutics. Refractory cancers
encompass not only (i) cancers where one or more chemotherapeutics
have already failed during treatment of a patient, but also (ii)
cancers that can be shown to be refractory by other means, e.g.,
biopsy and culture in the presence of chemotherapeutics.
[0492] The therapy described herein is also applicable to the
treatment of patients in need thereof who have not been previously
treated.
[0493] The therapy described herein is also applicable where the
subject has no detectable neoplasia but is at high risk for disease
recurrence.
[0494] Also of special interest is the treatment of patients in
need thereof who have undergone Autologous Hematopoietic Stem Cell
Transplant (AHSCT), and in particular patients who demonstrate
residual disease after undergoing AHSCT. The post-AHSCT setting is
characterized by a low volume of residual disease, the infusion of
immune cells to a situation of homeostatic expansion, and the
absence of any standard relapse-delaying therapy. These features
provide a unique opportunity to use the claimed neoplastic vaccine
or immunogenic composition compositions to delay disease
relapse.
Pharmaceutical Compositions/Methods of Delivery
[0495] The present invention is also directed to pharmaceutical
compositions comprising an effective amount of one or more
neoantigenic peptides as described herein (including a
pharmaceutically acceptable salt, thereof), optionally in
combination with a pharmaceutically acceptable carrier, excipient
or additive.
[0496] When administered as a combination, the therapeutic agents
(i.e. the neoantigenic peptides) can be formulated as separate
compositions that are given at the same time or different times, or
the therapeutic agents can be given as a single composition.
[0497] The compositions may be administered once daily, twice
daily, once every two days, once every three days, once every four
days, once every five days, once every six days, once every seven
days, once every two weeks, once every three weeks, once every four
weeks, once every two months, once every six months, or once per
year. The dosing interval can be adjusted according to the needs of
individual patients. For longer intervals of administration,
extended release or depot formulations can be used.
[0498] The compositions of the invention can be used to treat
diseases and disease conditions that are acute, and may also be
used for treatment of chronic conditions. In particular, the
compositions of the invention are used in methods to treat or
prevent a neoplasia. In certain embodiments, the compounds of the
invention are administered for time periods exceeding two weeks,
three weeks, one month, two months, three months, four months, five
months, six months, one year, two years, three years, four years,
or five years, ten years, or fifteen years; or for example, any
time period range in days, months or years in which the low end of
the range is any time period between 14 days and 15 years and the
upper end of the range is between 15 days and 20 years (e.g., 4
weeks and 15 years, 6 months and 20 years). In some cases, it may
be advantageous for the compounds of the invention to be
administered for the remainder of the patient's life. In preferred
embodiments, the patient is monitored to check the progression of
the disease or disorder, and the dose is adjusted accordingly. In
preferred embodiments, treatment according to the invention is
effective for at least two weeks, three weeks, one month, two
months, three months, four months, five months, six months, one
year, two years, three years, four years, or five years, ten years,
fifteen years, twenty years, or for the remainder of the subject's
life.
[0499] Surgical resection uses surgery to remove abnormal tissue in
cancer, such as mediastinal, neurogenic, or germ cell tumors, or
thymoma. In certain embodiments, administration of the composition
is initiated following tumor resection. In other embodiments,
administration of the neoplasia vaccine or immunogenic composition
is initiated 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or
more weeks after tumor resection. Preferably, administration of the
neoplasia vaccine or immunogenic composition is initiated 4, 5, 6,
7, 8, 9, 10, 11 or 12 weeks after tumor resection.
[0500] Prime/boost regimens refer to the successive administrations
of a vaccine or immunogenic or immunological compositions. In
certain embodiments, administration of the neoplasia vaccine or
immunogenic composition is in a prime/boost dosing regimen, for
example administration of the neoplasia vaccine or immunogenic
composition at weeks 1, 2, 3 or 4 as a prime and administration of
the neoplasia vaccine or immunogenic composition is at months 2, 3
or 4 as a boost. In another embodiment heterologous prime-boost
strategies are used to ellicit a greater cytotoxic T-cell response
(see Schneider et al., Induction of CD8+ T cells using heterologous
prime-boost immunisation strategies, Immunological Reviews Volume
170, Issue 1, pages 29-38, August 1999). In another embodiment DNA
encoding neoantigens is used to prime followed by a protein boost.
In another embodiment protein is used to prime followed by boosting
with a virus encoding the neoantigen. In another embodiment a virus
encoding the neoantigen is used to prime and another virus is used
to boost. In another embodiment protein is used to prime and DNA is
used to boost. In a preferred embodiment a DNA vaccine or
immunogenic composition is used to prime a T-cell response and a
recombinant viral vaccine or immunogenic composition is used to
boost the response. In another preferred embodiment a viral vaccine
or immunogenic composition is coadministered with a protein or DNA
vaccine or immunogenic composition to act as an adjuvant for the
protein or DNA vaccine or immunogenic composition. The patient can
then be boosted with either the viral vaccine or immunogenic
composition, protein, or DNA vaccine or immunogenic composition
(see Hutchings et al., Combination of protein and viral vaccines
induces potent cellular and humoral immune responses and enhanced
protection from murine malaria challenge. Infect Immun. 2007
December; 75(12):5819-26. Epub 2007 Oct. 1).
[0501] The pharmaceutical compositions can be processed in
accordance with conventional methods of pharmacy to produce
medicinal agents for administration to patients in need thereof,
including humans and other mammals.
[0502] Modifications of the neoantigenic peptides can affect the
solubility, bioavailability and rate of metabolism of the peptides,
thus providing control over the delivery of the active species.
Solubility can be assessed by preparing the neoantigenic peptide
and testing according to known methods well within the routine
practitioner's skill in the art.
[0503] In certain embodiments of the pharmaceutical composition the
pharmaceutically acceptable carrier comprises water. In certain
embodiments, the pharmaceutically acceptable carrier further
comprises dextrose. In certain embodiments, the pharmaceutically
acceptable carrier further comprises dimethylsulfoxide. In certain
embodiments, the pharmaceutical composition further comprises an
immunomodulator or adjuvant. In certain embodiments, the
immunodulator or adjuvant is selected from the group consisting of
poly-ICLC, STING agonist, 1018 ISS, aluminum salts, Amplivax, AS15,
BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31,
Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune,
LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312,
Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432,
OM-174, OM-197-MP-EC, ONTAK, PEPTEL, vector system, PLGA
microparticles, resiquimod, SRL172, Virosomes and other Virus-like
particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, and
Aquila's QS21 stimulon. In certain embodiments, the immunomodulator
or adjuvant comprises poly-ICLC.
[0504] Xanthenone derivatives such as, for example, Vadimezan or
AsA404 (also known as 5,6-dimethylaxanthenone-4-acetic acid
(DMXAA)), may also be used as adjuvants according to embodiments of
the invention. Alternatively, such derivatives may also be
administered in parallel to the vaccine or immunogenic composition
of the invention, for example via systemic or intratumoral
delivery, to stimulate immunity at the tumor site. Without being
bound by theory, it is believed that such xanthenone derivatives
act by stimulating interferon (IFN) production via the stimulator
of IFN gene ISTING) receptor (see e.g., Conlon et al. (2013) Mouse,
but not Human STING, Binds and Signals in Response to the Vascular
Disrupting Agent 5,6-Dimethylxanthenone-4-Acetic Acid, Journal of
Immunology, 190:5216-25 and Kim et al. (2013) Anticancer Flavonoids
are Mouse-Selective STING Agonists, 8:1396-1401).
[0505] The vaccine or immunological composition may also include an
adjuvant compound chosen from the acrylic or methacrylic polymers
and the copolymers of maleic anhydride and an alkenyl derivative.
It is in particular a polymer of acrylic or methacrylic acid
cross-linked with a polyalkenyl ether of a sugar or polyalcohol
(carbomer), in particular cross-linked with an allyl sucrose or
with allylpentaerythritol. It may also be a copolymer of maleic
anhydride and ethylene cross-linked, for example, with divinyl
ether (see U.S. Pat. No. 6,713,068 hereby incorporated by reference
in its entirety).
[0506] In certain embodiments, the pH modifier can stabilize the
adjuvant or immunomodulator as described herein.
[0507] In certain embodiments, a pharmaceutical composition
comprises: one to five peptides, dimethylsulfoxide (DMSO),
dextrose, water, succinate, poly I: poly C, poly-L-lysine,
carboxymethylcellulose, and chloride. In certain embodiments, each
of the one to five peptides is present at a concentration of 300
.mu.g/ml. In certain embodiments, the pharmaceutical composition
comprises .ltoreq.3% DMSO by volume. In certain embodiments, the
pharmaceutical composition comprises 3.6-3.7% dextrose in water. In
certain embodiments, the pharmaceutical composition comprises
3.6-3.7 mM succinate (e.g., as sodium succinate) or a salt thereof.
In certain embodiments, the pharmaceutical composition comprises
0.5 mg/ml poly I: poly C. In certain embodiments, the
pharmaceutical composition comprises 0.375 mg/ml poly-L-Lysine. In
certain embodiments, the pharmaceutical composition comprises 1.25
mg/ml sodium carboxymethylcellulose. In certain embodiments, the
pharmaceutical composition comprises 0.225% sodium chloride.
[0508] Pharmaceutical compositions comprise the herein-described
tumor specific neoantigenic peptides in a therapeutically effective
amount for treating diseases and conditions (e.g., a
neoplasia/tumor), which have been described herein, optionally in
combination with a pharmaceutically acceptable additive, carrier
and/or excipient. One of ordinary skill in the art from this
disclosure and the knowledge in the art will recognize that a
therapeutically effective amount of one of more compounds according
to the present invention may vary with the condition to be treated,
its severity, the treatment regimen to be employed, the
pharmacokinetics of the agent used, as well as the patient (animal
or human) treated.
[0509] To prepare the pharmaceutical compositions according to the
present invention, a therapeutically effective amount of one or
more of the compounds according to the present invention is
preferably intimately admixed with a pharmaceutically acceptable
carrier according to conventional pharmaceutical compounding
techniques to produce a dose. A carrier may take a wide variety of
forms depending on the form of preparation desired for
administration, e.g., ocular, oral, topical or parenteral,
including gels, creams ointments, lotions and time released
implantable preparations, among numerous others. In preparing
pharmaceutical compositions in oral dosage form, any of the usual
pharmaceutical media may be used. Thus, for liquid oral
preparations such as suspensions, elixirs and solutions, suitable
carriers and additives including water, glycols, oils, alcohols,
flavoring agents, preservatives, coloring agents and the like may
be used. For solid oral preparations such as powders, tablets,
capsules, and for solid preparations such as suppositories,
suitable carriers and additives including starches, sugar carriers,
such as dextrose, mannitol, lactose and related carriers, diluents,
granulating agents, lubricants, binders, disintegrating agents and
the like may be used. If desired, the tablets or capsules may be
enteric-coated or sustained release by standard techniques.
[0510] The active compound is included in the pharmaceutically
acceptable carrier or diluent in an amount sufficient to deliver to
a patient a therapeutically effective amount for the desired
indication, without causing serious toxic effects in the patient
treated.
[0511] Oral compositions generally include an inert diluent or an
edible carrier. They may be enclosed in gelatin capsules or
compressed into tablets. For the purpose of oral therapeutic
administration, the active compound or its prodrug derivative can
be incorporated with excipients and used in the form of tablets,
troches, or capsules. Pharmaceutically compatible binding agents,
and/or adjuvant materials can be included as part of the
composition.
[0512] The tablets, pills, capsules, troches and the like can
contain any of the following ingredients, or compounds of a similar
nature: a binder such as microcrystalline cellulose, gum tragacanth
or gelatin; an excipient such as starch or lactose, a dispersing
agent such as alginic acid or corn starch; a lubricant such as
magnesium stearate; a glidant such as colloidal silicon dioxide; a
sweetening agent such as sucrose or saccharin; or a flavoring agent
such as peppermint, methyl salicylate, or orange flavoring. When
the dosage unit form is a capsule, it can contain, in addition to
material herein discussed, a liquid carrier such as a fatty oil. In
addition, dosage unit forms can contain various other materials
which modify the physical form of the dosage unit, for example,
coatings of sugar, shellac, or enteric agents.
[0513] Formulations of the present invention suitable for oral
administration may be presented as discrete units such as capsules,
cachets or tablets each containing a predetermined amount of the
active ingredient; as a powder or granules; as a solution or a
suspension in an aqueous liquid or a non-aqueous liquid; or as an
oil-in-water liquid emulsion or a water-in-oil emulsion and as a
bolus, etc.
[0514] A tablet may be made by compression or molding, optionally
with one or more accessory ingredients. Compressed tablets may be
prepared by compressing in a suitable machine the active ingredient
in a free-flowing form such as a powder or granules, optionally
mixed with a binder, lubricant, inert diluent, preservative,
surface-active or dispersing agent. Molded tablets may be made by
molding in a suitable machine a mixture of the powdered compound
moistened with an inert liquid diluent. The tablets optionally may
be coated or scored and may be formulated so as to provide slow or
controlled release of the active ingredient therein.
[0515] Methods of formulating such slow or controlled release
compositions of pharmaceutically active ingredients, are known in
the art and described in several issued US Patents, some of which
include, but are not limited to, U.S. Pat. Nos. 3,870,790;
4,226,859; 4,369,172; 4,842,866 and 5,705,190, the disclosures of
which are incorporated herein by reference in their entireties.
Coatings can be used for delivery of compounds to the intestine
(see, e.g., U.S. Pat. Nos. 6,638,534, 5,541,171, 5,217,720, and
6,569,457, and references cited therein).
[0516] The active compound or pharmaceutically acceptable salt
thereof may also be administered as a component of an elixir,
suspension, syrup, wafer, chewing gum or the like. A syrup may
contain, in addition to the active compounds, sucrose or fructose
as a sweetening agent and certain preservatives, dyes and colorings
and flavors.
[0517] Solutions or suspensions used for ocular, parenteral,
intradermal, subcutaneous, or topical application can include the
following components: a sterile diluent such as water for
injection, saline solution, fixed oils, polyethylene glycols,
glycerine, propylene glycol or other synthetic solvents;
antibacterial agents such as benzyl alcohol or methyl parabens;
antioxidants such as ascorbic acid or sodium bisulfite; chelating
agents such as ethylenediaminetetraacetic acid; buffers such as
acetates, citrates or phosphates; and agents for the adjustment of
tonicity such as sodium chloride or dextrose.
[0518] In certain embodiments, the pharmaceutically acceptable
carrier is an aqueous solvent, i.e., a solvent comprising water,
optionally with additional co-solvents. Exemplary pharmaceutically
acceptable carriers include water, buffer solutions in water (such
as phosphate-buffered saline (PBS), and 5% dextrose in water (D5W).
In certain embodiments, the aqueous solvent further comprises
dimethyl sulfoxide (DMSO), e.g., in an amount of about 1-4%, or
1-3%. In certain embodiments, the pharmaceutically acceptable
carrier is isotonic (i.e., has substantially the same osmotic
pressure as a body fluid such as plasma).
[0519] In one embodiment, the active compounds are prepared with
carriers that protect the compound against rapid elimination from
the body, such as a controlled release formulation, including
implants and microencapsulated delivery systems. Biodegradable,
biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters,
polylactic acid, and polylactic-co-glycolic acid (PLGA). Methods
for preparation of such formulations are within the ambit of the
skilled artisan in view of this disclosure and the knowledge in the
art.
[0520] A skilled artisan from this disclosure and the knowledge in
the art recognizes that in addition to tablets, other dosage forms
can be formulated to provide slow or controlled release of the
active ingredient. Such dosage forms include, but are not limited
to, capsules, granulations and gel-caps.
[0521] Liposomal suspensions may also be pharmaceutically
acceptable carriers. These may be prepared according to methods
known to those skilled in the art. For example, liposomal
formulations may be prepared by dissolving appropriate lipid(s) in
an inorganic solvent that is then evaporated, leaving behind a thin
film of dried lipid on the surface of the container. An aqueous
solution of the active compound are then introduced into the
container. The container is then swirled by hand to free lipid
material from the sides of the container and to disperse lipid
aggregates, thereby forming the liposomal suspension. Other methods
of preparation well known by those of ordinary skill may also be
used in this aspect of the present invention.
[0522] The formulations may conveniently be presented in unit
dosage form and may be prepared by conventional pharmaceutical
techniques. Such techniques include the step of bringing into
association the active ingredient and the pharmaceutical carrier(s)
or excipient(s). In general, the formulations are prepared by
uniformly and intimately bringing into association the active
ingredient with liquid carriers or finely divided solid carriers or
both, and then, if necessary, shaping the product.
[0523] Formulations and compositions suitable for topical
administration in the mouth include lozenges comprising the
ingredients in a flavored basis, usually sucrose and acacia or
tragacanth; pastilles comprising the active ingredient in an inert
basis such as gelatin and glycerin, or sucrose and acacia; and
mouthwashes comprising the ingredient to be administered in a
suitable liquid carrier.
[0524] Formulations suitable for topical administration to the skin
may be presented as ointments, creams, gels and pastes comprising
the ingredient to be administered in a pharmaceutical acceptable
carrier. A preferred topical delivery system is a transdermal patch
containing the ingredient to be administered.
[0525] Formulations for rectal administration may be presented as a
suppository with a suitable base comprising, for example, cocoa
butter or a salicylate.
[0526] Formulations suitable for nasal administration, wherein the
carrier is a solid, include a coarse powder having a particle size,
for example, in the range of 20 to 500 microns which is
administered in the manner in which snuff is administered, i.e., by
rapid inhalation through the nasal passage from a container of the
powder held close up to the nose. Suitable formulations, wherein
the carrier is a liquid, for administration, as for example, a
nasal spray or as nasal drops, include aqueous or oily solutions of
the active ingredient.
[0527] Formulations suitable for vaginal administration may be
presented as pessaries, tampons, creams, gels, pastes, foams or
spray formulations containing in addition to the active ingredient
such carriers as are known in the art to be appropriate.
[0528] The parenteral preparation can be enclosed in ampoules,
disposable syringes or multiple dose vials made of glass or
plastic. If administered intravenously, preferred carriers include,
for example, physiological saline or phosphate buffered saline
(PBS).
[0529] For parenteral formulations, the carrier usually comprises
sterile water or aqueous sodium chloride solution, though other
ingredients including those which aid dispersion may be included.
Of course, where sterile water is to be used and maintained as
sterile, the compositions and carriers are also sterilized.
Injectable suspensions may also be prepared, in which case
appropriate liquid carriers, suspending agents and the like may be
employed.
[0530] Formulations suitable for parenteral administration include
aqueous and non-aqueous sterile injection solutions which may
contain antioxidants, buffers, bacteriostats and solutes which
render the formulation isotonic with the blood of the intended
recipient; and aqueous and non-aqueous sterile suspensions which
may include suspending agents and thickening agents. The
formulations may be presented in unit-dose or multi-dose
containers, for example, sealed ampules and vials, and may be
stored in a freeze-dried (lyophilized) condition requiring only the
addition of the sterile liquid carrier, for example, water for
injections, immediately prior to use. Extemporaneous injection
solutions and suspensions may be prepared from sterile powders,
granules and tablets of the kind previously described.
[0531] Administration of the active compound may range from
continuous (intravenous drip) to several oral administrations per
day (for example, Q.I.D.) and may include oral, topical, eye or
ocular, parenteral, intramuscular, intravenous, sub-cutaneous,
transdermal (which may include a penetration enhancement agent),
buccal and suppository administration, among other routes of
administration, including through an eye or ocular route.
[0532] The neoplasia vaccine or immunogenic composition, and any
additional agents, may be administered by injection, orally,
parenterally, by inhalation spray, rectally, vaginally, or
topically in dosage unit formulations containing conventional
pharmaceutically acceptable carriers, adjuvants, and vehicles. The
term parenteral as used herein includes, into a lymph node or
nodes, subcutaneous, intravenous, intramuscular, intrasternal,
infusion techniques, intraperitoneally, eye or ocular,
intravitreal, intrabuccal, transdermal, intranasal, into the brain,
including intracranial and intradural, into the joints, including
ankles, knees, hips, shoulders, elbows, wrists, directly into
tumors, and the like, and in suppository form.
[0533] In certain embodiments, the vaccine or immunogenic
composition is administered intravenously or subcutaneously.
Various techniques can be used for providing the subject
compositions at the site of interest, such as injection, use of
catheters, trocars, projectiles, pluronic gel, stents, sustained
drug release polymers or other device which provides for internal
access. Where an organ or tissue is accessible because of removal
from the patient, such organ or tissue may be bathed in a medium
containing the subject compositions, the subject compositions may
be painted onto the organ, or may be applied in any convenient
way.
[0534] The tumor specific neoantigenic peptides may be administered
through a device suitable for the controlled and sustained release
of a composition effective in obtaining a desired local or systemic
physiological or pharmacological effect. The method includes
positioning the sustained released drug delivery system at an area
wherein release of the agent is desired and allowing the agent to
pass through the device to the desired area of treatment.
[0535] The tumor specific neoantigenic peptides may be utilized in
combination with at least one known other therapeutic agent, or a
pharmaceutically acceptable salt of said agent. Examples of known
therapeutic agents which can be used for combination therapy
include, but are not limited to, corticosteroids (e.g., cortisone,
prednisone, dexamethasone), non-steroidal anti-inflammatory drugs
(NSAIDS) (e.g., ibuprofen, celecoxib, aspirin, indomethicin,
naproxen), alkylating agents such as busulfan, cis-platin,
mitomycin C, and carboplatin; antimitotic agents such as
colchicine, vinblastine, paclitaxel, and docetaxel; topo I
inhibitors such as camptothecin and topotecan; topo II inhibitors
such as doxorubicin and etoposide; and/or RNA/DNA antimetabolites
such as 5-azacytidine, 5-fluorouracil and methotrexate; DNA
antimetabolites such as 5-fluoro-2'-deoxyuridine, ara-C,
hydroxyurea and thioguanine; antibodies such as HERCEPTIN and
RITUXAN.
[0536] It should be understood that in addition to the ingredients
particularly mentioned herein, the formulations of the present
invention may include other agents conventional in the art having
regard to the type of formulation in question, for example, those
suitable for oral administration may include flavoring agents.
[0537] Pharmaceutically acceptable salt forms may be the preferred
chemical form of compounds according to the present invention for
inclusion in pharmaceutical compositions according to the present
invention.
[0538] The present compounds or their derivatives, including
prodrug forms of these agents, can be provided in the form of
pharmaceutically acceptable salts. As used herein, the term
pharmaceutically acceptable salts or complexes refers to
appropriate salts or complexes of the active compounds according to
the present invention which retain the desired biological activity
of the parent compound and exhibit limited toxicological effects to
normal cells. Nonlimiting examples of such salts are (a) acid
addition salts formed with inorganic acids (for example,
hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric
acid, nitric acid, and the like), and salts formed with organic
acids such as acetic acid, oxalic acid, tartaric acid, succinic
acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic
acid, alginic acid, and polyglutamic acid, among others; (b) base
addition salts formed with metal cations such as zinc, calcium,
sodium, potassium, and the like, among numerous others.
[0539] The compounds herein are commercially available or can be
synthesized. As can be appreciated by the skilled artisan, further
methods of synthesizing the compounds of the formulae herein is
evident to those of ordinary skill in the art. Additionally, the
various synthetic steps may be performed in an alternate sequence
or order to give the desired compounds. Synthetic chemistry
transformations and protecting group methodologies (protection and
deprotection) useful in synthesizing the compounds described herein
are known in the art and include, for example, those such as
described in R. Larock, Comprehensive Organic Transformations, 2nd.
Ed., Wiley-VCH Publishers (1999); T. W. Greene and P.G.M. Wuts,
Protective Groups in Organic Synthesis, 3rd. Ed., John Wiley and
Sons (1999); L. Fieser and M. Fieser, Fieser and Fieser's Reagents
for Organic Synthesis, John Wiley and Sons (1999); and L. Paquette,
ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and
Sons (1995), and subsequent editions thereof.
[0540] The additional agents that may be included with the tumor
specific neo-antigenic peptides of this invention may contain one
or more asymmetric centers and thus occur as racemates and racemic
mixtures, single enantiomers, individual diastereomers and
diastereomeric mixtures. All such isomeric forms of these compounds
are expressly included in the present invention. The compounds of
this invention may also be represented in multiple tautomeric
forms, in such instances, the invention expressly includes all
tautomeric forms of the compounds described herein (e.g.,
alkylation of a ring system may result in alkylation at multiple
sites, the invention expressly includes all such reaction
products). All such isomeric forms of such compounds are expressly
included in the present invention. All crystal forms of the
compounds described herein are expressly included in the present
invention.
Dosage
[0541] When the agents described herein are administered as
pharmaceuticals to humans or animals, they can be given per se or
as a pharmaceutical composition containing active ingredient in
combination with a pharmaceutically acceptable carrier, excipient,
or diluent.
[0542] Actual dosage levels and time course of administration of
the active ingredients in the pharmaceutical compositions of the
invention can be varied so as to obtain an amount of the active
ingredient which is effective to achieve the desired therapeutic
response for a particular patient, composition, and mode of
administration, without being toxic to the patient. Generally,
agents or pharmaceutical compositions of the invention are
administered in an amount sufficient to reduce or eliminate
symptoms associated with neoplasia, e.g. cancer or tumors.
[0543] A preferred dose of an agent is the maximum that a patient
can tolerate and not develop serious or unacceptable side effects.
Exemplary dose ranges include 0.01 mg to 250 mg per day, 0.01 mg to
100 mg per day, 1 mg to 100 mg per day, 10 mg to 100 mg per day, 1
mg to 10 mg per day, and 0.01 mg to 10 mg per day. A preferred dose
of an agent is the maximum that a patient can tolerate and not
develop serious or unacceptable side effects. In embodiments, the
agent is administered at a concentration of about 10 micrograms to
about 100 mg per kilogram of body weight per day, about 0.1 to
about 10 mg/kg per day, or about 1.0 mg to about 10 mg/kg of body
weight per day.
[0544] In embodiments, the pharmaceutical composition comprises an
agent in an amount ranging between 1 and 10 mg, such as 1, 2, 3, 4,
5, 6, 7, 8, 9, or 10 mg.
[0545] In embodiments, the therapeutically effective dosage
produces a serum concentration of an agent of from about 0.1 ng/ml
to about 50-100 mg/ml. The pharmaceutical compositions 5 typically
should provide a dosage of from about 0.001 mg to about 2000 mg of
compound per kilogram of body weight per day. For example, dosages
for systemic administration to a human patient can range from 1-10
mg/kg, 20-80 mg/kg, 5-50 mg/kg, 75-150 mg/kg, 100-500 mg/kg,
250-750 mg/kg, 500-1000 mg/kg, 1-10 mg/kg, 5-50 mg/kg, 25-75 mg/kg,
50-100 mg/kg, 100-250 mg/kg, 50-100 mg/kg, 250-500 mg/kg, 500-750
mg/kg, 750-1000 mg/kg, 1000-1500 mg/kg, 10 1500-2000 mg/kg, 5
mg/kg, 20 mg/kg, 50 mg/kg, 100 mg/kg, 500 mg/kg, 1000 mg/kg, 1500
mg/kg, or 2000 mg/kg. Pharmaceutical dosage unit forms are prepared
to provide from about 1 mg to about 5000 mg, for example from about
100 to about 2500 mg of the compound or a combination of essential
ingredients per dosage unit form.
[0546] In embodiments, about 50 nM to about 1 .mu.M of an agent is
administered to a subject. In related embodiments, about 50-100 nM,
50-250 nM, 100-500 nM, 250-500 nM, 250-750 nM, 500-750 nM, 500 nM
to 1 .mu.M, or 750 nM to 1 .mu.M of an agent is administered to a
subject.
[0547] Determination of an effective amount is well within the
capability of those skilled in the art, especially in light of the
detailed disclosure provided herein. Generally, an efficacious or
effective amount of an agent is determined by first administering a
low dose of the agent(s) and then incrementally increasing the
administered dose or dosages until a desired effect (e.g., reduce
or eliminate symptoms associated with viral infection or autoimmune
disease) is observed in the treated subject, with minimal or
acceptable toxic side effects. Applicable methods for determining
an appropriate dose and dosing schedule for administration of a
pharmaceutical composition of the present invention are described,
for example, in Goodman and Gilman's The Pharmacological Basis of
Therapeutics, Goodman et al., eds., 11th Edition, McGraw-Hill 2005,
and Remington: The Science and Practice of Pharmacy, 20th and 21st
Editions, Gennaro and University of the Sciences in Philadelphia,
Eds., Lippencott Williams & Wilkins (2003 and 2005), each of
which is hereby incorporated by reference.
[0548] Preferred unit dosage formulations are those containing a
daily dose or unit, daily sub-dose, as herein discussed, or an
appropriate fraction thereof, of the administered ingredient.
[0549] The dosage regimen for treating a disorder or a disease with
the tumor specific neoantigenic peptides of this invention and/or
compositions of this invention is based on a variety of factors,
including the type of disease, the age, weight, sex, medical
condition of the patient, the severity of the condition, the route
of administration, and the particular compound employed. Thus, the
dosage regimen may vary widely, but can be determined routinely
using standard methods.
[0550] The amounts and dosage regimens administered to a subject
can depend on a number of factors, such as the mode of
administration, the nature of the condition being treated, the body
weight of the subject being treated and the judgment of the
prescribing physician; all such factors being within the ambit of
the skilled artisan from this disclosure and the knowledge in the
art.
[0551] The amount of compound included within therapeutically
active formulations according to the present invention is an
effective amount for treating the disease or condition. In general,
a therapeutically effective amount of the present preferred
compound in dosage form usually ranges from slightly less than
about 0.025 mg/kg/day to about 2.5 g/kg/day, preferably about 0.1
mg/kg/day to about 100 mg/kg/day of the patient or considerably
more, depending upon the compound used, the condition or infection
treated and the route of administration, although exceptions to
this dosage range may be contemplated by the present invention. In
its most preferred form, compounds according to the present
invention are administered in amounts ranging from about 1
mg/kg/day to about 100 mg/kg/day. The dosage of the compound can
depend on the condition being treated, the particular compound, and
other clinical factors such as weight and condition of the patient
and the route of administration of the compound. It is to be
understood that the present invention has application for both
human and veterinary use.
[0552] For oral administration to humans, a dosage of between
approximately 0.1 to 100 mg/kg/day, preferably between
approximately 1 and 100 mg/kg/day, is generally sufficient.
[0553] Where drug delivery is systemic rather than topical, this
dosage range generally produces effective blood level
concentrations of active compound ranging from less than about 0.04
to about 400 micrograms/cc or more of blood in the patient. The
compound is conveniently administered in any suitable unit dosage
form, including but not limited to one containing 0.001 to 3000 mg,
preferably 0.05 to 500 mg of active ingredient per unit dosage
form. An oral dosage of 10-250 mg is usually convenient.
[0554] According to certain exemplary embodiments, the vaccine or
immunogenic composition is administered at a dose of about 10 .mu.g
to 1 mg per neoantigenic peptide. According to certain exemplary
embodiments, the vaccine or immunogenic composition is administered
at an average weekly dose level of about 10 .mu.g to 2000 .mu.g per
neoantigenic peptide.
[0555] The concentration of active compound in the drug composition
will depend on absorption, distribution, inactivation, and
excretion rates of the drug as well as other factors known to those
of skill in the art. It is to be noted that dosage values will also
vary with the severity of the condition to be alleviated. It is to
be further understood that for any particular subject, specific
dosage regimens should be adjusted over time according to the
individual need and the professional judgment of the person
administering or supervising the administration of the
compositions, and that the concentration ranges set forth herein
are exemplary only and are not intended to limit the scope or
practice of the claimed composition. The active ingredient may be
administered at once, or may be divided into a number of smaller
doses to be administered at varying intervals of time.
[0556] The invention provides for pharmaceutical compositions
containing at least one tumor specific neoantigen described herein.
In embodiments, the pharmaceutical compositions contain a
pharmaceutically acceptable carrier, excipient, or diluent, which
includes any pharmaceutical agent that does not itself induce the
production of an immune response harmful to a subject receiving the
composition, and which may be administered without undue toxicity.
As used herein, the term "pharmaceutically acceptable" means being
approved by a regulatory agency of the Federal or a state
government or listed in the U.S. Pharmacopia, European Pharmacopia
or other generally recognized pharmacopia for use in mammals, and
more particularly in humans. These compositions can be useful for
treating and/or preventing viral infection and/or autoimmune
disease.
[0557] A thorough discussion of pharmaceutically acceptable
carriers, diluents, and other excipients is presented in
Remington's Pharmaceutical Sciences (17th ed., Mack Publishing
Company) and Remington: The Science and Practice of Pharmacy (21st
ed., Lippincott Williams & Wilkins), which are hereby
incorporated by reference. The formulation of the pharmaceutical
composition should suit the mode of administration. In embodiments,
the pharmaceutical composition is suitable for administration to
humans, and can be sterile, non-particulate and/or
non-pyrogenic.
[0558] Pharmaceutically acceptable carriers, excipients, or
diluents include, but are not limited, to saline, buffered saline,
dextrose, water, glycerol, ethanol, sterile isotonic aqueous
buffer, and combinations thereof.
[0559] Wetting agents, emulsifiers and lubricants, such as sodium
lauryl sulfate and magnesium stearate, as well as coloring agents,
release agents, coating agents, sweetening, flavoring and perfuming
agents, preservatives, and antioxidants can also be present in the
compositions.
[0560] Examples of pharmaceutically-acceptable antioxidants
include, but are not limited to: (1) water soluble antioxidants,
such as ascorbic acid, cysteine hydrochloride, sodium bisulfate,
sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble
antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole
(BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate,
alpha-tocopherol, and the like; and (3) metal chelating agents,
such as citric acid, ethylenediamine tetraacetic acid (EDTA),
sorbitol, tartaric acid, phosphoric acid, and the like.
[0561] In embodiments, the pharmaceutical composition is provided
in a solid form, such as a lyophilized powder suitable for
reconstitution, a liquid solution, suspension, emulsion, tablet,
pill, capsule, sustained release formulation, or powder.
[0562] In embodiments, the pharmaceutical composition is supplied
in liquid form, for example, in a sealed container indicating the
quantity and concentration of the active ingredient in the
pharmaceutical composition. In related embodiments, the liquid form
of the pharmaceutical composition is supplied in a hermetically
sealed container.
[0563] Methods for formulating the pharmaceutical compositions of
the present invention are conventional and well known in the art
(see Remington and Remington's). One of skill in the art can
readily formulate a pharmaceutical composition having the desired
characteristics (e.g., route of administration, biosafety, and
release profile).
[0564] Methods for preparing the pharmaceutical compositions
include the step of bringing into association the active ingredient
with a pharmaceutically acceptable carrier and, optionally, one or
more accessory ingredients. The pharmaceutical compositions can be
prepared by uniformly and intimately bringing into association the
active ingredient with liquid carriers, or finely divided solid
carriers, or both, and then, if necessary, shaping the product.
Additional methodology for preparing the pharmaceutical
compositions, including the preparation of multilayer dosage forms,
are described in Ansel's Pharmaceutical Dosage Forms and Drug
Delivery Systems (9th ed., Lippincott Williams & Wilkins),
which is hereby incorporated by reference.
[0565] Pharmaceutical compositions suitable for oral administration
can be in the form of capsules, cachets, pills, tablets, lozenges
(using a flavored basis, usually sucrose and acacia or tragacanth),
powders, granules, or as a solution or a suspension in an aqueous
or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid
emulsion, or as an elixir or syrup, or as pastilles (using an inert
base, such as gelatin and glycerin, or sucrose and acacia) and/or
as mouth washes and the like, each containing a predetermined
amount of a compound(s) described herein, a derivative thereof, or
a pharmaceutically acceptable salt or prodrug thereof as the active
ingredient(s). The active ingredient can also be administered as a
bolus, electuary, or paste.
[0566] In solid dosage forms for oral administration (e.g.,
capsules, tablets, pills, dragees, powders, granules and the like),
the active ingredient is mixed with one or more pharmaceutically
acceptable carriers, excipients, or diluents, such as sodium
citrate or dicalcium phosphate, and/or any of the following: (1)
fillers or extenders, such as starches, lactose, sucrose, glucose,
mannitol, and/or silicic acid; (2) binders, such as, for example,
carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone,
sucrose and/or acacia; (3) humectants, such as glycerol; (4)
disintegrating agents, such as agar-agar, calcium carbonate, potato
or tapioca starch, alginic acid, certain silicates, and sodium
carbonate; (5) solution retarding agents, such as paraffin; (6)
absorption accelerators, such as quaternary ammonium compounds; (7)
wetting agents, such as, for example, acetyl alcohol and glycerol
monostearate; (8) absorbents, such as kaolin and bentonite clay;
(9) lubricants, such a talc, calcium stearate, magnesium stearate,
solid polyethylene glycols, sodium lauryl sulfate, and mixtures
thereof; and (10) coloring agents. In the case of capsules,
tablets, and pills, the pharmaceutical compositions can also
comprise buffering agents. Solid compositions of a similar type can
also be prepared using fillers in soft and hard-filled gelatin
capsules, and excipients such as lactose or milk sugars, as well as
high molecular weight polyethylene glycols and the like.
[0567] A tablet can be made by compression or molding, optionally
with one or more accessory ingredients. Compressed tablets can be
prepared using binders (for example, gelatin or hydroxypropylmethyl
cellulose), lubricants, inert diluents, preservatives,
disintegrants (for example, sodium starch glycolate or cross-linked
sodium carboxymethyl cellulose), surface-actives, and/or dispersing
agents. Molded tablets can be made by molding in a suitable machine
a mixture of the powdered active ingredient moistened with an inert
liquid diluent.
[0568] The tablets and other solid dosage forms, such as dragees,
capsules, pills, and granules, can optionally be scored or prepared
with coatings and shells, such as enteric coatings and other
coatings well known in the art.
[0569] In some embodiments, in order to prolong the effect of an
active ingredient, it is desirable to slow the absorption of the
compound from subcutaneous or intramuscular injection. This can be
accomplished by the use of a liquid suspension of crystalline or
amorphous material having poor water solubility. The rate of
absorption of the active ingredient then depends upon its rate of
dissolution which, in turn, can depend upon crystal size and
crystalline form. Alternatively, delayed absorption of a
parenterally-administered active ingredient is accomplished by
dissolving or suspending the compound in an oil vehicle. In
addition, prolonged absorption of the injectable pharmaceutical
form can be brought about by the inclusion of agents that delay
absorption such as aluminum monostearate and gelatin.
[0570] Controlled release parenteral compositions can be in form of
aqueous suspensions, microspheres, microcapsules, magnetic
microspheres, oil solutions, oil suspensions, emulsions, or the
active ingredient can be incorporated in biocompatible carrier(s),
liposomes, nanoparticles, implants or infusion devices.
[0571] Materials for use in the preparation of microspheres and/or
microcapsules include biodegradable/bioerodible polymers such as
polyglactin, poly-(isobutyl cyanoacrylate),
poly(2-hydroxyethyl-L-glutamine) and poly(lactic acid).
[0572] Biocompatible carriers which can be used when formulating a
controlled release parenteral formulation include carbohydrates
such as dextrans, proteins such as albumin, lipoproteins or
antibodies.
[0573] Materials for use in implants can be non-biodegradable,
e.g., polydimethylsiloxane, or biodegradable such as, e.g.,
poly(caprolactone), poly(lactic acid), poly(glycolic acid) or
poly(ortho esters).
[0574] In embodiments, the active ingredient(s) are administered by
aerosol. This is accomplished by preparing an aqueous aerosol,
liposomal preparation, or solid particles containing the compound.
A nonaqueous (e.g., fluorocarbon propellant) suspension can be
used. The pharmaceutical composition can also be administered using
a sonic nebulizer, which would minimize exposing the agent to
shear, which can result in degradation of the compound.
[0575] Ordinarily, an aqueous aerosol is made by formulating an
aqueous solution or suspension of the active ingredient(s) together
with conventional pharmaceutically-acceptable carriers and
stabilizers. The carriers and stabilizers vary with the
requirements of the particular compound, but typically include
nonionic surfactants (Tweens, Pluronics, or polyethylene glycol),
innocuous proteins like serum albumin, sorbitan esters, oleic acid,
lecithin, amino acids such as glycine, buffers, salts, sugars or
sugar alcohols. Aerosols generally are prepared from isotonic
solutions.
[0576] Dosage forms for topical or transdermal administration of an
active ingredient(s) includes powders, sprays, ointments, pastes,
creams, lotions, gels, solutions, patches and inhalants. The active
ingredient(s) can be mixed under sterile conditions with a
pharmaceutically acceptable carrier, and with any preservatives,
buffers, or propellants as appropriate.
[0577] Transdermal patches suitable for use in the present
invention are disclosed in Transdermal Drug Delivery: Developmental
Issues and Research Initiatives (Marcel Dekker Inc., 1989) and U.S.
Pat. Nos. 4,743,249, 4,906,169, 5,198,223, 4,816,540, 5,422,119,
5,023,084, which are hereby incorporated by reference. The
transdermal patch can also be any transdermal patch well known in
the art, including transscrotal patches. Pharmaceutical
compositions in such transdermal patches can contain one or more
absorption enhancers or skin permeation enhancers well known in the
art (see, e.g., U.S. Pat. Nos. 4,379,454 and 4,973,468, which are
hereby incorporated by reference). Transdermal therapeutic systems
for use in the present invention can be based on iontophoresis,
diffusion, or a combination of these two effects.
[0578] Transdermal patches have the added advantage of providing
controlled delivery of active ingredient(s) to the body. Such
dosage forms can be made by dissolving or dispersing the active
ingredient(s) in a proper medium. Absorption enhancers can also be
used to increase the flux of the active ingredient across the skin.
The rate of such flux can be controlled by either providing a rate
controlling membrane or dispersing the active ingredient(s) in a
polymer matrix or gel.
[0579] Such pharmaceutical compositions can be in the form of
creams, ointments, lotions, liniments, gels, hydrogels, solutions,
suspensions, sticks, sprays, pastes, plasters and other kinds of
transdermal drug delivery systems. The compositions can also
include pharmaceutically acceptable carriers or excipients such as
emulsifying agents, antioxidants, buffering agents, preservatives,
humectants, penetration enhancers, chelating agents, gel-forming
agents, ointment bases, perfumes, and skin protective agents.
[0580] Examples of emulsifying agents include, but are not limited
to, naturally occurring gums, e.g. gum acacia or gum tragacanth,
naturally occurring phosphatides, e.g. soybean lecithin and
sorbitan monooleate derivatives.
[0581] Examples of antioxidants include, but are not limited to,
butylated hydroxy anisole (BHA), ascorbic acid and derivatives
thereof, tocopherol and derivatives thereof, and cysteine.
[0582] Examples of preservatives include, but are not limited to,
parabens, such as methyl or propyl p-hydroxybenzoate and
benzalkonium chloride.
[0583] Examples of humectants include, but are not limited to,
glycerin, propylene glycol, sorbitol and urea.
[0584] Examples of penetration enhancers include, but are not
limited to, propylene glycol, DMSO, triethanolamine,
N,N-dimethylacetamide, N,N-dimethylformamide, 2-pyrrolidone and
derivatives thereof, tetrahydrofurfuryl alcohol, propylene glycol,
diethylene glycol monoethyl or monomethyl ether with propylene
glycol monolaurate or methyl laurate, eucalyptol, lecithin,
TRANSCUTOL, and AZONE.
[0585] Examples of chelating agents include, but are not limited
to, sodium EDTA, citric acid and phosphoric acid.
[0586] Examples of gel forming agents include, but are not limited
to, Carbopol, cellulose derivatives, bentonite, alginates, gelatin
and polyvinylpyrrolidone.
[0587] In addition to the active ingredient(s), the ointments,
pastes, creams, and gels of the present invention can contain
excipients, such as animal and vegetable fats, oils, waxes,
paraffins, starch, tragacanth, cellulose derivatives, polyethylene
glycols, silicones, bentonites, silicic acid, talc and zinc oxide,
or mixtures thereof.
[0588] Powders and sprays can contain excipients such as lactose,
talc, silicic acid, aluminum hydroxide, calcium silicates and
polyamide powder, or mixtures of these substances. Sprays can
additionally contain customary propellants, such as
chlorofluorohydrocarbons, and volatile unsubstituted hydrocarbons,
such as butane and propane.
[0589] Injectable depot forms are made by forming microencapsule
matrices of compound(s) of the invention in biodegradable polymers
such as polylactide-polyglycolide. Depending on the ratio of
compound to polymer, and the nature of the particular polymer
employed, the rate of compound release can be controlled. Examples
of other biodegradable polymers include poly(orthoesters) and
poly(anhydrides). Depot injectable formulations are also prepared
by entrapping the drug in liposomes or microemulsions which are
compatible with body tissue.
[0590] Subcutaneous implants are well known in the art and are
suitable for use in the present invention. Subcutaneous
implantation methods are preferably non-irritating and mechanically
resilient. The implants can be of matrix type, of reservoir type,
or hybrids thereof. In matrix type devices, the carrier material
can be porous or non-porous, solid or semi-solid, and permeable or
impermeable to the active compound or compounds. The carrier
material can be biodegradable or may slowly erode after
administration. In some instances, the matrix is non-degradable but
instead relies on the diffusion of the active compound through the
matrix for the carrier material to degrade. Alternative
subcutaneous implant methods utilize reservoir devices where the
active compound or compounds are surrounded by a rate controlling
membrane, e.g., a membrane independent of component concentration
(possessing zero-order kinetics). Devices consisting of a matrix
surrounded by a rate controlling membrane also suitable for
use.
[0591] Both reservoir and matrix type devices can contain materials
such as polydimethylsiloxane, such as SILASTIC, or other silicone
rubbers. Matrix materials can be insoluble polypropylene,
polyethylene, polyvinyl chloride, ethylvinyl acetate, polystyrene
and polymethacrylate, as well as glycerol esters of the glycerol
palmitostearate, glycerol stearate, and glycerol behenate type.
Materials can be hydrophobic or hydrophilic polymers and optionally
contain solubilizing agents.
[0592] Subcutaneous implant devices can be slow-release capsules
made with any suitable polymer, e.g., as described in U.S. Pat.
Nos. 5,035,891 and 4,210,644, which are hereby incorporated by
reference.
[0593] In general, at least four different approaches are
applicable in order to provide rate control over the release and
transdermal permeation of a drug compound. These approaches are:
membrane-moderated systems, adhesive diffusion-controlled systems,
matrix dispersion-type systems and microreservoir systems. It is
appreciated that a controlled release percutaneous and/or topical
composition can be obtained by using a suitable mixture of these
approaches.
[0594] In a membrane-moderated system, the active ingredient is
present in a reservoir which is totally encapsulated in a shallow
compartment molded from a drug-impermeable laminate, such as a
metallic plastic laminate, and a rate-controlling polymeric
membrane such as a microporous or a non-porous polymeric membrane,
e.g., ethylene-vinyl acetate copolymer. The active ingredient is
released through the rate controlling polymeric membrane. In the
drug reservoir, the active ingredient can either be dispersed in a
solid polymer matrix or suspended in an unleachable, viscous liquid
medium such as silicone fluid. On the external surface of the
polymeric membrane, a thin layer of an adhesive polymer is applied
to achieve an intimate contact of the transdermal system with the
skin surface. The adhesive polymer is preferably a polymer which is
hypoallergenic and compatible with the active drug substance.
[0595] In an adhesive diffusion-controlled system, a reservoir of
the active ingredient is formed by directly dispersing the active
ingredient in an adhesive polymer and then by, e.g., solvent
casting, spreading the adhesive containing the active ingredient
onto a flat sheet of substantially drug-impermeable metallic
plastic backing to form a thin drug reservoir layer.
[0596] A matrix dispersion-type system is characterized in that a
reservoir of the active ingredient is formed by substantially
homogeneously dispersing the active ingredient in a hydrophilic or
lipophilic polymer matrix. The drug-containing polymer is then
molded into disc with a substantially well-defined surface area and
controlled thickness. The adhesive polymer is spread along the
circumference to form a strip of adhesive around the disc.
[0597] A microreservoir system can be considered as a combination
of the reservoir and matrix dispersion type systems. In this case,
the reservoir of the active substance is formed by first suspending
the drug solids in an aqueous solution of water-soluble polymer and
then dispersing the drug suspension in a lipophilic polymer to form
a multiplicity of unleachable, microscopic spheres of drug
reservoirs.
[0598] Any of the herein-described controlled release, extended
release, and sustained release compositions can be formulated to
release the active ingredient in about 30 minutes to about 1 week,
in about 30 minutes to about 72 hours, in about 30 minutes to 24
hours, in about 30 minutes to 12 hours, in about 30 minutes to 6
hours, in about 30 minutes to 4 hours, and in about 3 hours to 10
hours. In embodiments, an effective concentration of the active
ingredient(s) is sustained in a subject for 4 hours, 6 hours, 8
hours, 10 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours,
or more after administration of the pharmaceutical compositions to
the subject.
Vaccine or Immunogenic Compositions
[0599] The present invention is directed in some aspects to
pharmaceutical compositions suitable for the prevention or
treatment of cancer. In one embodiment, the composition comprises
at least an immunogenic composition, e.g., a neoplasia vaccine or
immunogenic composition capable of raising a specific T-cell
response. The neoplasia vaccine or immunogenic composition
comprises neoantigenic peptides and/or neoantigenic polypeptides
corresponding to tumor specific neoantigens as described
herein.
[0600] A suitable neoplasia vaccine or immunogenic composition can
preferably contain a plurality of tumor specific neoantigenic
peptides. In an embodiment, the vaccine or immunogenic composition
can include between 1 and 100 sets of peptides, more preferably
between 1 and 50 such peptides, even more preferably between 10 and
30 sets peptides, even more preferably between 15 and 25 peptides.
According to another preferred embodiment, the vaccine or
immunogenic composition can include at least one peptides, more
preferably 2, 3, 4, or 5 peptides, In certain embodiments, the
vaccine or immunogenic composition can comprise 5, 6, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, or 30 different peptides.
[0601] The optimum amount of each peptide to be included in the
vaccine or immunogenic composition and the optimum dosing regimen
can be determined by one skilled in the art without undue
experimentation. For example, the peptide or its variant may be
prepared for intravenous (i.v.) injection, sub-cutaneous (s.c.)
injection, intradermal (i.d.) injection, intraperitoneal (i.p.)
injection, intramuscular (i.m.) injection. Preferred methods of
peptide injection include s.c, i.d., i.p., i.m., and i.v. Preferred
methods of DNA injection include i.d., i.m., s.c, i.p. and i.v. For
example, doses of between 1 and 500 mg 50 .mu.g and 1.5 mg,
preferably 10 .mu.g to 500 .mu.g of peptide or DNA may be given and
can depend from the respective peptide or DNA. Doses of this range
were successfully used in previous trials (Brunsvig P F, et al.,
Cancer Immunol Immunother. 2006; 55(12): 1553-1564; M. Staehler, et
al., ASCO meeting 2007; Abstract No 3017). Other methods of
administration of the vaccine or immunogenic composition are known
to those skilled in the art.
[0602] In one embodiment of the present invention the different
tumor specific neoantigenic peptides and/or polypeptides are
selected for use in the neoplasia vaccine or immunogenic
composition so as to maximize the likelihood of generating an
immune attack against the neoplasias/tumors in a high proportion of
subjects in the population. Without being bound by theory, it is
believed that the inclusion of a diversity of tumor specific
neoantigenic peptides can generate a broad scale immune attack
against a neoplasia/tumor. In one embodiment, the selected tumor
specific neoantigenic peptides/polypeptides are encoded by missense
mutations. In a second embodiment, the selected tumor specific
neoantigenic peptides/polypeptides are encoded by a combination of
missense mutations and neoORF mutations. In a third embodiment, the
selected tumor specific neoantigenic peptides/polypeptides are
encoded by neoORF mutations.
[0603] In one embodiment in which the selected tumor specific
neoantigenic peptides/polypeptides are encoded by missense
mutations, the peptides and/or polypeptides are chosen based on
their capability to associate with the MHC molecules of a high
proportion of subjects in the population. Peptides/polypeptides
derived from neoORF mutations can also be selected on the basis of
their capability to associate with the MHC molecules of the patient
population.
[0604] The vaccine or immunogenic composition is capable of raising
a specific cytotoxic T-cells response and/or a specific helper
T-cell response.
[0605] The vaccine or immunogenic composition can further comprise
an adjuvant and/or a carrier. Examples of useful adjuvants and
carriers are given herein. The peptides and/or polypeptides in the
composition can be associated with a carrier such as, e.g., a
protein or an antigen-presenting cell such as e.g. a dendritic cell
(DC) capable of presenting the peptide to a T-cell.
[0606] Adjuvants are any substance whose admixture into the vaccine
or immunogenic composition increases or otherwise modifies the
immune response to the mutant peptide. Carriers are scaffold
structures, for example a polypeptide or a polysaccharide, to which
the neoantigenic peptides, is capable of being associated.
Optionally, adjuvants are conjugated covalently or non-covalently
to the peptides or polypeptides of the invention.
[0607] The ability of an adjuvant to increase the immune response
to an antigen is typically manifested by a significant increase in
immune-mediated reaction, or reduction in disease symptoms. For
example, an increase in humoral immunity is typically manifested by
a significant increase in the titer of antibodies raised to the
antigen, and an increase in T-cell activity is typically manifested
in increased cell proliferation, or cellular cytotoxicity, or
cytokine secretion. An adjuvant may also alter an immune response,
for example, by changing a primarily humoral or Th2 response into a
primarily cellular, or Th1 response.
[0608] Suitable adjuvants include, but are not limited to 1018 ISS,
aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA,
dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch,
ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A,
Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide
ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PEPTEL. vector system,
PLG microparticles, resiquimod, SRL172, Virosomes and other
Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan,
Pam3Cys, Aquila's QS21 stimulon (Aquila Biotech, Worcester, Mass.,
USA) which is derived from saponin, mycobacterial extracts and
synthetic bacterial cell wall mimics, and other proprietary
adjuvants such as Ribi's Detox. Quil or Superfos. Several
immunological adjuvants (e.g., MF59) specific for dendritic cells
and their preparation have been described previously (Dupuis M, et
al., Cell Immunol. 1998; 186(1): 18-27; Allison A C; Dev Biol
Stand. 1998; 92:3-11). Also cytokines may be used. Several
cytokines have been directly linked to influencing dendritic cell
migration to lymphoid tissues (e.g., TNF-alpha), accelerating the
maturation of dendritic cells into efficient antigen-presenting
cells for T-lymphocytes (e.g., GM-CSF, IL-1 and IL-4) (U.S. Pat.
No. 5,849,589, specifically incorporated herein by reference in its
entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich
D I, et al., J Immunother Emphasis Tumor Immunol. 1996
(6):414-418).
[0609] Toll like receptors (TLRs) may also be used as adjuvants,
and are important members of the family of pattern recognition
receptors (PRRs) which recognize conserved motifs shared by many
micro-organisms, termed "pathogen-associated molecular patterns"
(PAMPS). Recognition of these "danger signals" activates multiple
elements of the innate and adaptive immune system. TLRs are
expressed by cells of the innate and adaptive immune systems such
as dendritic cells (DCs), macrophages, T and B cells, mast cells,
and granulocytes and are localized in different cellular
compartments, such as the plasma membrane, lysosomes, endosomes,
and endolysosomes. Different TLRs recognize distinct PAMPS. For
example, TLR4 is activated by LPS contained in bacterial cell
walls, TLR9 is activated by unmethylated bacterial or viral CpG
DNA, and TLR3 is activated by double stranded RNA. TLR ligand
binding leads to the activation of one or more intracellular
signaling pathways, ultimately resulting in the production of many
key molecules associated with inflammation and immunity
(particularly the transcription factor NF-.kappa.B and the Type-I
interferons). TLR mediated DC activation leads to enhanced DC
activation, phagocytosis, upregulation of activation and
co-stimulation markers such as CD80, CD83, and CD86, expression of
CCR7 allowing migration of DC to draining lymph nodes and
facilitating antigen presentation to T cells, as well as increased
secretion of cytokines such as type I interferons, IL-12, and IL-6.
All of these downstream events are critical for the induction of an
adaptive immune response.
[0610] Among the most promising cancer vaccine or immunogenic
composition adjuvants currently in clinical development are the
TLR9 agonist CpG and the synthetic double-stranded RNA (dsRNA) TLR3
ligand poly-ICLC. In preclinical studies poly-ICLC appears to be
the most potent TLR adjuvant when compared to LPS and CpG due to
its induction of pro-inflammatory cytokines and lack of stimulation
of IL-10, as well as maintenance of high levels of co-stimulatory
molecules in DCs1. Furthermore, poly-ICLC was recently directly
compared to CpG in non-human primates (rhesus macaques) as adjuvant
for a protein vaccine or immunogenic composition consisting of
human papillomavirus (HPV)16 capsomers (Stahl-Hennig C,
Eisenblatter M, Jasny E, et al. Synthetic double-stranded RNAs are
adjuvants for the induction of T helper 1 and humoral immune
responses to human papillomavirus in rhesus macaques. PLoS
pathogens. April 2009; 5(4)).
[0611] CpG immuno stimulatory oligonucleotides have also been
reported to enhance the effects of adjuvants in a vaccine or
immunogenic composition setting. Without being bound by theory, CpG
oligonucleotides act by activating the innate (non-adaptive) immune
system via Toll-like receptors (TLR), mainly TLR9. CpG triggered
TLR9 activation enhances antigen-specific humoral and cellular
responses to a wide variety of antigens, including peptide or
protein antigens, live or killed viruses, dendritic cell vaccines,
autologous cellular vaccines and polysaccharide conjugates in both
prophylactic and therapeutic vaccines. More importantly, it
enhances dendritic cell maturation and differentiation, resulting
in enhanced activation of Th1 cells and strong cytotoxic
T-lymphocyte (CTL) generation, even in the absence of CD4 T-cell
help. The Th1 bias induced by TLR9 stimulation is maintained even
in the presence of vaccine adjuvants such as alum or incomplete
Freund's adjuvant (IFA) that normally promote a Th2 bias. CpG
oligonucleotides show even greater adjuvant activity when
formulated or co-administered with other adjuvants or in
formulations such as microparticles, nano particles, lipid
emulsions or similar formulations, which are especially necessary
for inducing a strong response when the antigen is relatively weak.
They also accelerate the immune response and enabled the antigen
doses to be reduced by approximately two orders of magnitude, with
comparable antibody responses to the full-dose vaccine without CpG
in some experiments (Arthur M. Krieg, Nature Reviews, Drug
Discovery, 5, June 2006, 471-484). U.S. Pat. No. 6,406,705 B1
describes the combined use of CpG oligonucleotides, non-nucleic
acid adjuvants and an antigen to induce an antigen-specific immune
response. A commercially available CpG TLR9 antagonist is dSLIM
(double Stem Loop Immunomodulator) by Mologen (Berlin, GERMANY),
which is a preferred component of the pharmaceutical composition of
the present invention. Other TLR binding molecules such as RNA
binding TLR 7, TLR 8 and/or TLR 9 may also be used.
[0612] Other examples of useful adjuvants include, but are not
limited to, chemically modified CpGs (e.g. CpR, Idera),
Poly(I:C)(e.g. polyi:CI2U), non-CpG bacterial DNA or RNA as well as
immunoactive small molecules and antibodies such as
cyclophosphamide, sunitinib, bevacizumab, celebrex, NCX-4016,
sildenafil, tadalafil, vardenafil, sorafinib, XL-999, CP-547632,
pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175,
which may act therapeutically and/or as an adjuvant. The amounts
and concentrations of adjuvants and additives useful in the context
of the present invention can readily be determined by the skilled
artisan without undue experimentation. Additional adjuvants include
colony-stimulating factors, such as Granulocyte Macrophage Colony
Stimulating Factor (GM-CSF, sargramostim).
[0613] Poly-ICLC is a synthetically prepared double-stranded RNA
consisting of polyI and polyC strands of average length of about
5000 nucleotides, which has been stabilized to thermal denaturation
and hydrolysis by serum nucleases by the addition of polylysine and
carboxymethylcellulose. The compound activates TLR3 and the RNA
helicase-domain of MDA5, both members of the PAMP family, leading
to DC and natural killer (NK) cell activation and production of a
"natural mix" of type I interferons, cytokines, and chemokines.
Furthermore, poly-ICLC exerts a more direct, broad host-targeted
anti-infectious and possibly antitumor effect mediated by the two
IFN-inducible nuclear enzyme systems, the 2'5'-OAS and the P1/eIF2a
kinase, also known as the PKR (4-6), as well as RIG-I helicase and
MDA5.
[0614] In rodents and non-human primates, poly-ICLC was shown to
enhance T cell responses to viral antigens, cross-priming, and the
induction of tumor-, virus-, and autoantigen-specific CD8+ T-cells.
In a recent study in non-human primates, poly-ICLC was found to be
essential for the generation of antibody responses and T-cell
immunity to DC targeted or non-targeted HIV Gag p24 protein,
emphasizing its effectiveness as a vaccine adjuvant.
[0615] In human subjects, transcriptional analysis of serial whole
blood samples revealed similar gene expression profiles among the 8
healthy human volunteers receiving one single s.c. administration
of poly-ICLC and differential expression of up to 212 genes between
these 8 subjects versus 4 subjects receiving placebo. Remarkably,
comparison of the poly-ICLC gene expression data to previous data
from volunteers immunized with the highly effective yellow fever
vaccine YF17D showed that a large number of transcriptional and
signal transduction canonical pathways, including those of the
innate immune system, were similarly upregulated at peak time
points.
[0616] More recently, an immunologic analysis was reported on
patients with ovarian, fallopian tube, and primary peritoneal
cancer in second or third complete clinical remission who were
treated on a phase 1 study of subcutaneous vaccination with
synthetic overlapping long peptides (OLP) from the cancer testis
antigen NY-ESO-1 alone or with Montanide-ISA-51, or with 1.4 mg
poly-ICLC and Montanide. The generation of NY-ESO-1-specific CD4+
and CD8+ T-cell and antibody responses were markedly enhanced with
the addition of poly-ICLC and Montanide compared to OLP alone or
OLP and Montanide.
[0617] A vaccine or immunogenic composition according to the
present invention may comprise more than one different adjuvant.
Furthermore, the invention encompasses a therapeutic composition
comprising any adjuvant substance including any of those herein
discussed. It is also contemplated that the peptide or polypeptide,
and the adjuvant can be administered separately in any appropriate
sequence.
[0618] A carrier may be present independently of an adjuvant. The
carrier may be covalently linked to the antigen. A carrier can also
be added to the antigen by inserting DNA encoding the carrier in
frame with DNA encoding the antigen. The function of a carrier can
for example be to confer stability, to increase the biological
activity, or to increase serum half-life. Extension of the
half-life can help to reduce the number of applications and to
lower doses, thus are beneficial for therapeutic but also economic
reasons. Furthermore, a carrier may aid presenting peptides to
T-cells. The carrier may be any suitable carrier known to the
person skilled in the art, for example a protein or an antigen
presenting cell. A carrier protein could be but is not limited to
keyhole limpet hemocyanin, serum proteins such as transferrin,
bovine serum albumin, human serum albumin, thyroglobulin or
ovalbumin, immunoglobulins, or hormones, such as insulin or
palmitic acid. For immunization of humans, the carrier may be a
physiologically acceptable carrier acceptable to humans and safe.
However, tetanus toxoid and/or diptheria toxoid are suitable
carriers in one embodiment of the invention. Alternatively, the
carrier may be dextrans for example sepharose.
[0619] Cytotoxic T-cells (CTLs) recognize an antigen in the form of
a peptide bound to an WIC molecule rather than the intact foreign
antigen itself. The MHC molecule itself is located at the cell
surface of an antigen presenting cell. Thus, an activation of CTLs
is only possible if a trimeric complex of peptide antigen, MHC
molecule, and APC is present. Correspondingly, it may enhance the
immune response if not only the peptide is used for activation of
CTLs, but if additionally APCs with the respective MHC molecule are
added. Therefore, in some embodiments the vaccine or immunogenic
composition according to the present invention additionally
contains at least one antigen presenting cell.
[0620] The antigen-presenting cell (or stimulator cell) typically
has an WIC class I or II molecule on its surface, and in one
embodiment is substantially incapable of itself loading the WIC
class I or II molecule with the selected antigen. As is described
in more detail herein, the WIC class I or II molecule may readily
be loaded with the selected antigen in vitro.
[0621] CD8+ cell activity may be augmented through the use of CD4+
cells. The identification of CD4 T+ cell epitopes for tumor
antigens has attracted interest because many immune based therapies
against cancer may be more effective if both CD8+ and CD4+T
lymphocytes are used to target a patient's tumor. CD4+ cells are
capable of enhancing CD8 T cell responses. Many studies in animal
models have clearly demonstrated better results when both CD4+ and
CD8+ T cells participate in anti-tumor responses (see e.g.,
Nishimura et al. (1999) Distinct role of antigen-specific T helper
type 1 (TH1) and Th2 cells in tumor eradication in vivo. J Ex Med
190:617-27). Universal CD4+ T cell epitopes have been identified
that are applicable to developing therapies against different types
of cancer (see e.g., Kobayashi et al. (2008) Current Opinion in
Immunology 20:221-27). For example, an HLA-DR restricted helper
peptide from tetanus toxoid was used in melanoma vaccines to
activate CD4+ T cells non-specifically (see e.g., Slingluff et al.
(2007) Immunologic and Clinical Outcomes of a Randomized Phase II
Trial of Two Multipeptide Vaccines for Melanoma in the Adjuvant
Setting, Clinical Cancer Research 13(21):6386-95). It is
contemplated within the scope of the invention that such CD4+ cells
may be applicable at three levels that vary in their tumor
specificity: 1) a broad level in which universal CD4+ epitopes
(e.g., tetanus toxoid) may be used to augment CD8+ cells; 2) an
intermediate level in which native, tumor-associated CD4+ epitopes
may be used to augment CD8+ cells; and 3) a patient specific level
in which neoantigen CD4+ epitopes may be used to augment CD8+ cells
in a patient specific manner. Although current algorithms for
predicting CD4 epitopes are limited in accuracy, it is a reasonable
expectation that many long peptides containing predicted CD8
neoepitopes will also include CD4 epitopes. CD4 epitopes are longer
than CD8 epitopes and typically are 10-12 amino acids in length
although some can be longer (Kreiter et al, Mutant MHC Class II
epitopes drive therapeutic immune responses to cancer, Nature
(2015). Thus the neoantigenic epitopes described herein, either in
the form of long peptides (>25 amino acids) or nucleic acids
encoding such long peptides, may also boost CD4 responses in a
tumor and patient-specific manner (level (3) above).
[0622] CD8+ cell immunity may also be generated with neoantigen
loaded dendritic cell (DC) vaccine. DCs are potent
antigen-presenting cells that initiate T cell immunity and can be
used as cancer vaccines when loaded with one or more peptides of
interest, for example, by direct peptide injection. For example,
patients that were newly diagnosed with metastatic melanoma were
shown to be immunized against 3 HLA-A*0201-restricted gp100
melanoma antigen-derived peptides with autologous peptide pulsed
CD40L/IFN-g-activated mature DCs via an IL-12p70-producing patient
DC vaccine (see e.g., Carreno et al (2013) L-12p70-producing
patient DC vaccine elicits Tc1-polarized immunity, Journal of
Clinical Investigation, 123(8):3383-94 and Ali et al. (2009) In
situ regulation of DC subsets and T cells mediates tumor regression
in mice, Cancer Immunotherapy, 1(8):1-10). It is contemplated
within the scope of the invention that neoantigen loaded DCs may be
prepared using the synthetic TLR 3 agonist
Polyinosinic-Polycytidylic Acid-poly-L-lysine
Carboxymethylcellulose (Poly-ICLC) to stimulate the DCs. Poly-ICLC
is a potent individual maturation stimulus for human DCs as
assessed by an upregulation of CD83 and CD86, induction of
interleukin-12 (IL-12), tumor necrosis factor (TNF), interferon
gamma-induced protein 10 (IP-10), interleukin 1 (IL-1), and type I
interferons (IFN), and minimal interleukin 10 (IL-10) production.
DCs may be differentiated from frozen peripheral blood mononuclear
cells (PBMCs) obtained by leukapheresis, while PBMCs may be
isolated by Ficoll gradient centrifugation and frozen in
aliquots.
[0623] Illustratively, the following 7 day activation protocol may
be used. Day 1--PBMCs are thawed and plated onto tissue culture
flasks to select for monocytes which adhere to the plastic surface
after 1-2 hr incubation at 37.degree. C. in the tissue culture
incubator. After incubation, the lymphocytes are washed off and the
adherent monocytes are cultured for 5 days in the presence of
interleukin-4 (IL-4) and granulocyte macrophage-colony stimulating
factor (GM-C SF) to differentiate to immature DCs. On Day 6,
immature DCs are pulsed with the keyhole limpet hemocyanin (KLH)
protein which serves as a control for the quality of the vaccine
and may boost the immunogenicity of the vaccine. The DCs are
stimulated to mature, loaded with peptide antigens, and incubated
overnight. On Day 7, the cells are washed, and frozen in 1 ml
aliquots containing 4-20.times.10(6) cells using a controlled-rate
freezer. Lot release testing for the batches of DCs may be
performed to meet minimum specifications before the DCs are
injected into patients (see e.g., Sabado et al. (2013) Preparation
of tumor antigen-loaded mature dendritic cells for immunotherapy,
J. Vis Exp. August 1; (78). doi: 10.3791/50085).
[0624] A DC vaccine may be incorporated into a scaffold system to
facilitate delivery to a patient. Therapeutic treatment of a
patients neoplasia with a DC vaccine may utilize a biomaterial
system that releases factors that recruit host dendritic cells into
the device, differentiates the resident, immature DCs by locally
presenting adjuvants (e.g., danger signals) while releasing
antigen, and promotes the release of activated, antigen loaded DCs
to the lymph nodes (or desired site of action) where the DCs may
interact with T cells to generate a potent cytotoxic T lymphocyte
response to the cancer neoantigens. Implantable biomaterials may be
used to generate a potent cytotoxic T lymphocyte response against a
neoplasia in a patient specific manner. The biomaterial-resident
dendritic cells may then be activated by exposing them to danger
signals mimicking infection, in concert with release of antigen
from the biomaterial. The activated dendritic cells then migrate
from the biomaterials to lymph nodes to induce a cytotoxic T
effector response. This approach has previously been demonstrated
to lead to regression of established melanoma in preclinical
studies using a lysate prepared from tumor biopsies (see e.g., Ali
et al. (2209) In situ regulation of DC subsets and T cells mediates
tumor regression in mice, Cancer Immunotherapy 1(8):1-10; Ali et
al. (2009) Infection-mimicking materials to program dendritic cells
in situ. Nat Mater 8:151-8), and such a vaccine is currently being
tested in a Phase I clinical trial recently initiated at the
Dana-Farber Cancer Institute. This approach has also been shown to
lead to regression of glioblastoma, as well as the induction of a
potent memory response to prevent relapse, using the C6 rat glioma
model.24 in the current proposal. The ability of such an
implantable, biomatrix vaccine delivery scaffold to amplify and
sustain tumor specific dendritic cell activation may lead to more
robust anti-tumor immunosensitization than can be achieved by
traditional subcutaneous or intra-nodal vaccine
administrations.
[0625] The present invention may include any method for loading a
neoantigenic peptide onto a dendritic cell. One such method
applicable to the present invention is a microfluidic intracellular
delivery system. Such systems cause temporary membrane disruption
by rapid mechanical deformation of human and mouse immune cells,
thus allowing the intracellular delivery of biomolecules (Sharei et
al., 2015, PLOS ONE).
[0626] Preferably, the antigen presenting cells are dendritic
cells. Suitably, the dendritic cells are autologous dendritic cells
that are pulsed with the neoantigenic peptide. The peptide may be
any suitable peptide that gives rise to an appropriate T-cell
response. T-cell therapy using autologous dendritic cells pulsed
with peptides from a tumor associated antigen is disclosed in
Murphy et al. (1996) The Prostate 29, 371-380 and Tjua et al.
(1997) The Prostate 32, 272-278. In certain embodiments the
dendritic cells are targeted using CD141, DEC205, or XCR1 markers.
CD141+XCR1+DC's were identified as a subset that may be better
suited to the induction of anti-tumor responses (Bachem et al., J.
Exp. Med. 207, 1273-1281 (2010); Crozat et al., J. Exp. Med. 207,
1283-1292 (2010); and Gallois & Bhardwaj, Nature Med. 16,
854-856 (2010)).
[0627] Thus, in one embodiment of the present invention the vaccine
or immunogenic composition containing at least one antigen
presenting cell is pulsed or loaded with one or more peptides of
the present invention. Alternatively, peripheral blood mononuclear
cells (PBMCs) isolated from a patient may be loaded with peptides
ex vivo and injected back into the patient. As an alternative the
antigen presenting cell comprises an expression construct encoding
a peptide of the present invention. The polynucleotide may be any
suitable polynucleotide and it is preferred that it is capable of
transducing the dendritic cell, thus resulting in the presentation
of a peptide and induction of immunity.
[0628] The inventive pharmaceutical composition may be compiled so
that the selection, number and/or amount of peptides present in the
composition covers a high proportion of subjects in the population.
The selection may be dependent on the specific type of cancer, the
status of the disease, earlier treatment regimens, and, of course,
the HLA-haplotypes present in the patient population.
[0629] Pharmaceutical compositions comprising the peptide of the
invention may be administered to an individual already suffering
from cancer. In therapeutic applications, compositions are
administered to a patient in an amount sufficient to elicit an
effective CTL response to the tumor antigen and to cure or at least
partially arrest symptoms and/or complications. An amount adequate
to accomplish this is defined as "therapeutically effective dose."
Amounts effective for this use can depend on, e.g., the peptide
composition, the manner of administration, the stage and severity
of the disease being treated, the weight and general state of
health of the patient, and the judgment of the prescribing
physician, but generally range for the initial immunization (that
is for therapeutic or prophylactic administration) from about 1.0
.mu.g to about 50,000 .mu.g of peptide for a 70 kg patient,
followed by boosting dosages or from about 1.0 .mu.g to about
10,000 .mu.g of peptide pursuant to a boosting regimen over weeks
to months depending upon the patient's response and condition and
possibly by measuring specific CTL activity in the patient's blood.
It should be kept in mind that the peptide and compositions of the
present invention may generally be employed in serious disease
states, that is, life-threatening or potentially life threatening
situations, especially when the cancer has metastasized. For
therapeutic use, administration should begin as soon as possible
after the detection or surgical removal of tumors. This is followed
by boosting doses until at least symptoms are substantially abated
and for a period thereafter.
[0630] The pharmaceutical compositions (e.g., vaccine compositions)
for therapeutic treatment are intended for parenteral, topical,
nasal, oral or local administration. Preferably, the pharmaceutical
compositions are administered parenterally, e.g., intravenously,
subcutaneously, intradermally, or intramuscularly. The compositions
may be administered at the site of surgical excision to induce a
local immune response to the tumor. The invention provides
compositions for parenteral administration which comprise a
solution of the peptides and vaccine or immunogenic compositions
are dissolved or suspended in an acceptable carrier, preferably an
aqueous carrier. A variety of aqueous carriers may be used, e.g.,
water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid
and the like. These compositions may be sterilized by conventional,
well known sterilization techniques, or may be sterile filtered.
The resulting aqueous solutions may be packaged for use as is, or
lyophilized, the lyophilized preparation being combined with a
sterile solution prior to administration. The compositions may
contain pharmaceutically acceptable auxiliary substances as
required to approximate physiological conditions, such as pH
adjusting and buffering agents, tonicity adjusting agents, wetting
agents and the like, for example, sodium acetate, sodium lactate,
sodium chloride, potassium chloride, calcium chloride, sorbitan
monolaurate, triethanolamine oleate, etc.
[0631] A liposome suspension containing a peptide may be
administered intravenously, locally, topically, etc. in a dose
which varies according to, inter alia, the manner of
administration, the peptide being delivered, and the stage of the
disease being treated. For targeting to the immune cells, a ligand,
such as, e.g., antibodies or fragments thereof specific for cell
surface determinants of the desired immune system cells, can be
incorporated into the liposome.
[0632] For solid compositions, conventional or nanoparticle
nontoxic solid carriers may be used which include, for example,
pharmaceutical grades of mannitol, lactose, starch, magnesium
stearate, sodium saccharin, talcum, cellulose, glucose, sucrose,
magnesium carbonate, and the like. For oral administration, a
pharmaceutically acceptable nontoxic composition is formed by
incorporating any of the normally employed excipients, such as
those carriers previously listed, and generally 10-95% of active
ingredient, that is, one or more peptides of the invention, and
more preferably at a concentration of 25%-75%.
[0633] For aerosol administration, the immunogenic peptides are
preferably supplied in finely divided form along with a surfactant
and propellant. Typical percentages of peptides are 0.01%-20% by
weight, preferably 1%-10%. The surfactant can, of course, be
nontoxic, and preferably soluble in the propellant. Representative
of such agents are the esters or partial esters of fatty acids
containing from 6 to 22 carbon atoms, such as caproic, octanoic,
lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic
acids with an aliphatic polyhydric alcohol or its cyclic anhydride.
Mixed esters, such as mixed or natural glycerides may be employed.
The surfactant may constitute 0.1%-20% by weight of the
composition, preferably 0.25-5%. The balance of the composition is
ordinarily propellant. A carrier can also be included as desired,
as with, e.g., lecithin for intranasal delivery.
[0634] The peptides and polypeptides of the invention can be
readily synthesized chemically utilizing reagents that are free of
contaminating bacterial or animal substances (Merrifield RB: Solid
phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am.
Chem. Soc. 85:2149-54, 1963).
[0635] The peptides and polypeptides of the invention can also be
expressed by a vector, e.g., a nucleic acid molecule as
herein-discussed, e.g., RNA or a DNA plasmid, a viral vector such
as a poxvirus, e.g., orthopox virus, avipox virus, or adenovirus,
AAV or lentivirus. This approach involves the use of a vector to
express nucleotide sequences that encode the peptide of the
invention. Upon introduction into an acutely or chronically
infected host or into a noninfected host, the vector expresses the
immunogenic peptide, and thereby elicits a host CTL response.
[0636] For therapeutic or immunization purposes, nucleic acids
encoding the peptide of the invention and optionally one or more of
the peptides described herein can also be administered to the
patient. A number of methods are conveniently used to deliver the
nucleic acids to the patient. For instance, the nucleic acid can be
delivered directly, as "naked DNA". This approach is described, for
instance, in Wolff et al., Science 247: 1465-1468 (1990) as well as
U.S. Pat. Nos. 5,580,859 and 5,589,466. The nucleic acids can also
be administered using ballistic delivery as described, for
instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of
DNA can be administered. Alternatively, DNA can be adhered to
particles, such as gold particles. Generally, a plasmid for a
vaccine or immunological composition can comprise DNA encoding an
antigen (e.g., one or more neoantigens) operatively linked to
regulatory sequences which control expression or expression and
secretion of the antigen from a host cell, e.g., a mammalian cell;
for instance, from upstream to downstream, DNA for a promoter, such
as a mammalian virus promoter (e.g., a CMV promoter such as an hCMV
or mCMV promoter, e.g., an early-intermediate promoter, or an SV40
promoter--see documents cited or incorporated herein for useful
promoters), DNA for a eukaryotic leader peptide for secretion
(e.g., tissue plasminogen activator), DNA for the neoantigen(s),
and DNA encoding a terminator (e.g., the 3' UTR transcriptional
terminator from the gene encoding Bovine Growth Hormone or bGH
polyA). A composition can contain more than one plasmid or vector,
whereby each vector contains and expresses a different neoantigen.
Mention is also made of Wasmoen U.S. Pat. No. 5,849,303, and Dale
U.S. Pat. No. 5,811,104, whose text may be useful. DNA or DNA
plasmid formulations can be formulated with or inside cationic
lipids; and, as to cationic lipids, as well as adjuvants, mention
is also made of Loosmore U.S. Patent Application 2003/0104008.
Also, teachings in Audonnet U.S. Pat. Nos. 6,228,846 and 6,159,477
may be relied upon for DNA plasmid teachings that can be employed
in constructing and using DNA plasmids that contain and express in
vivo.
[0637] The nucleic acids can also be delivered complexed to
cationic compounds, such as cationic lipids. Lipid-mediated gene
delivery methods are described, for instance, in W01996/18372; WO
1993/24640; Mannino & Gould-Fogerite, BioTechniques 6(7):
682-691 (1988); U.S. Pat. No. 5,279,833; WO 1991/06309; and Feigner
et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).
[0638] RNA encoding the peptide of interest (e.g., mRNA) can also
be used for delivery (see, e.g., Kiken et al, 2011; Su et al, 2011;
see also U.S. Pat. No. 8,278,036; Halabi et al. J Clin Oncol (2003)
21:1232-1237; Petsch et al, Nature Biotechnology 2012 Dec. 7;
30(12):1210-6).
[0639] Viral vectors as described herein can also be used to
deliver the neoantigenic peptides of the invention. Vectors can be
administered so as to have in vivo expression and response akin to
doses and/or responses elicited by antigen administration.
[0640] A preferred means of administering nucleic acids encoding
the peptide of the invention uses minigene constructs encoding
multiple epitopes. To create a DNA sequence encoding the selected
CTL epitopes (minigene) for expression in human cells, the amino
acid sequences of the epitopes are reverse translated. A human
codon usage table is used to guide the codon choice for each amino
acid. These epitope-encoding DNA sequences are directly adjoined,
creating a continuous polypeptide sequence. To optimize expression
and/or immunogenicity, additional elements can be incorporated into
the minigene design. Examples of amino acid sequence that could be
reverse translated and included in the minigene sequence include:
helper T lymphocyte, epitopes, a leader (signal) sequence, and an
endoplasmic reticulum retention signal. In addition, MEW
presentation of CTL epitopes may be improved by including synthetic
(e.g. poly-alanine) or naturally-occurring flanking sequences
adjacent to the CTL epitopes.
[0641] The minigene sequence is converted to DNA by assembling
oligonucleotides that encode the plus and minus strands of the
minigene. Overlapping oligonucleotides (30-100 bases long) are
synthesized, phosphorylated, purified and annealed under
appropriate conditions using well known techniques. The ends of the
oligonucleotides are joined using T4 DNA ligase. This synthetic
minigene, encoding the CTL epitope polypeptide, can then cloned
into a desired expression vector.
[0642] Standard regulatory sequences well known to those of skill
in the art are included in the vector to ensure expression in the
target cells. Several vector elements are required: a promoter with
a down-stream cloning site for minigene insertion; a
polyadenylation signal for efficient transcription termination; an
E. coli origin of replication; and an E. coli selectable marker
(e.g. ampicillin or kanamycin resistance). Numerous promoters can
be used for this purpose, e.g., the human cytomegalovirus (hCMV)
promoter. See, U.S. Pat. Nos. 5,580,859 and 5,589,466 for other
suitable promoter sequences.
[0643] Additional vector modifications may be desired to optimize
minigene expression and immunogenicity. In some cases, introns are
required for efficient gene expression, and one or more synthetic
or naturally-occurring introns could be incorporated into the
transcribed region of the minigene. The inclusion of mRNA
stabilization sequences can also be considered for increasing
minigene expression. It has recently been proposed that immuno
stimulatory sequences (ISSs or CpGs) play a role in the
immunogenicity of DNA' vaccines. These sequences could be included
in the vector, outside the minigene coding sequence, if found to
enhance immunogenicity.
[0644] In some embodiments, a bicistronic expression vector, to
allow production of the minigene-encoded epitopes and a second
protein included to enhance or decrease immunogenicity can be used.
Examples of proteins or polypeptides that could beneficially
enhance the immune response if co-expressed include cytokines
(e.g., IL2, IL12, GM-CSF), cytokine-inducing molecules (e.g. LeIF)
or costimulatory molecules. Helper (HTL) epitopes could be joined
to intracellular targeting signals and expressed separately from
the CTL epitopes. This would allow direction of the HTL epitopes to
a cell compartment different than the CTL epitopes. If required,
this could facilitate more efficient entry of HTL epitopes into the
MHC class II pathway, thereby improving CTL induction. In contrast
to CTL induction, specifically decreasing the immune response by
co-expression of immunosuppressive molecules (e.g. TGF-.beta.) may
be beneficial in certain diseases.
[0645] Once an expression vector is selected, the minigene is
cloned into the polylinker region downstream of the promoter. This
plasmid is transformed into an appropriate E. coli strain, and DNA
is prepared using standard techniques. The orientation and DNA
sequence of the minigene, as well as all other elements included in
the vector, are confirmed using restriction mapping and DNA
sequence analysis. Bacterial cells harboring the correct plasmid
can be stored as a master cell bank and a working cell bank.
[0646] Purified plasmid DNA can be prepared for injection using a
variety of formulations. The simplest of these is reconstitution of
lyophilized DNA in sterile phosphate-buffer saline (PBS). A variety
of methods have been described, and new techniques may become
available. As noted herein, nucleic acids are conveniently
formulated with cationic lipids. In addition, glycolipids,
fusogenic liposomes, peptides and compounds referred to
collectively as protective, interactive, non-condensing (PINC)
could also be complexed to purified plasmid DNA to influence
variables such as stability, intramuscular dispersion, or
trafficking to specific organs or cell types.
[0647] Target cell sensitization can be used as a functional assay
for expression and MHC class I presentation of minigene-encoded CTL
epitopes. The plasmid DNA is introduced into a mammalian cell line
that is suitable as a target for standard CTL chromium release
assays. The transfection method used is dependent on the final
formulation. Electroporation can be used for "naked" DNA, whereas
cationic lipids allow direct in vitro transfection. A plasmid
expressing green fluorescent protein (GFP) can be co-transfected to
allow enrichment of transfected cells using fluorescence activated
cell sorting (FACS). These cells are then chromium-51 labeled and
used as target cells for epitope-specific CTL lines. Cytolysis,
detected by 51 Cr release, indicates production of MHC presentation
of mini gene-encoded CTL epitopes.
[0648] In vivo immunogenicity is a second approach for functional
testing of minigene DNA formulations. Transgenic mice expressing
appropriate human MHC molecules are immunized with the DNA product.
The dose and route of administration are formulation dependent
(e.g. IM for DNA in PBS, IP for lipid-complexed DNA). Twenty-one
days after immunization, splenocytes are harvested and restimulated
for 1 week in the presence of peptides encoding each epitope being
tested. These effector cells (CTLs) are assayed for cytolysis of
peptide-loaded, chromium-51 labeled target cells using standard
techniques. Lysis of target cells sensitized by MHC loading of
peptides corresponding to minigene-encoded epitopes demonstrates
DNA vaccine function for in vivo induction of CTLs.
[0649] Peptides may be used to elicit CTL ex vivo, as well. The
resulting CTL, can be used to treat chronic tumors in patients in
need thereof that do not respond to other conventional forms of
therapy, or does not respond to a peptide vaccine approach of
therapy. Ex vivo CTL responses to a particular tumor antigen are
induced by incubating in tissue culture the patient's CTL precursor
cells (CTLp) together with a source of antigen-presenting cells
(APC) and the appropriate peptide. After an appropriate incubation
time (typically 1-4 weeks), in which the CTLp are activated and
mature and expand into effector CTL, the cells are infused back
into the patient, where they destroy their specific target cell
(i.e., a tumor cell). In order to optimize the in vitro conditions
for the generation of specific cytotoxic T cells, the culture of
stimulator cells are maintained in an appropriate serum-free
medium.
[0650] Prior to incubation of the stimulator cells with the cells
to be activated, e.g., precursor CD8+ cells, an amount of antigenic
peptide is added to the stimulator cell culture, of sufficient
quantity to become loaded onto the human Class I molecules to be
expressed on the surface of the stimulator cells. In the present
invention, a sufficient amount of peptide is an amount that allows
about 200, and preferably 200 or more, human Class I MHC molecules
loaded with peptide to be expressed on the surface of each
stimulator cell. Preferably, the stimulator cells are incubated
with >2 .mu.g/ml peptide. For example, the stimulator cells are
incubates with >3, 4, 5, 10, 15, or more .mu.g/ml peptide.
[0651] Resting or precursor CD8+ cells are then incubated in
culture with the appropriate stimulator cells for a time period
sufficient to activate the CD8+ cells. Preferably, the CD8+ cells
are activated in an antigen-specific manner. The ratio of resting
or precursor CD8+(effector) cells to stimulator cells may vary from
individual to individual and may further depend upon variables such
as the amenability of an individual's lymphocytes to culturing
conditions and the nature and severity of the disease condition or
other condition for which the within-described treatment modality
is used. Preferably, however, the lymphocyte: stimulator cell ratio
is in the range of about 30:1 to 300:1. The effector/stimulator
culture may be maintained for as long a time as is necessary to
stimulate a therapeutically useable or effective number of CD8+
cells.
[0652] The induction of CTL in vitro requires the specific
recognition of peptides that are bound to allele specific MHC class
I molecules on APC. The number of specific MHC/peptide complexes
per APC is crucial for the stimulation of CTL, particularly in
primary immune responses. While small amounts of peptide/MHC
complexes per cell are sufficient to render a cell susceptible to
lysis by CTL, or to stimulate a secondary CTL response, the
successful activation of a CTL precursor (pCTL) during primary
response requires a significantly higher number of MHC/peptide
complexes. Peptide loading of empty major histocompatability
complex molecules on cells allows the induction of primary
cytotoxic T lymphocyte responses.
[0653] Since mutant cell lines do not exist for every human MHC
allele, it is advantageous to use a technique to remove endogenous
MHC-associated peptides from the surface of APC, followed by
loading the resulting empty MHC molecules with the immunogenic
peptides of interest. The use of non-transformed (non-tumorigenic),
noninfected cells, and preferably, autologous cells of patients as
APC is desirable for the design of CTL induction protocols directed
towards development of ex vivo CTL therapies. This application
discloses methods for stripping the endogenous MHC-associated
peptides from the surface of APC followed by the loading of desired
peptides.
[0654] A stable MHC class I molecule is a trimeric complex formed
of the following elements: 1) a peptide usually of 8-10 residues,
2) a transmembrane heavy polymorphic protein chain which bears the
peptide-binding site in its a1 and a2 domains, and 3) a
non-covalently associated non-polymorphic light chain,
p2microglobuiin. Removing the bound peptides and/or dissociating
the p2microglobulin from the complex renders the MHC class I
molecules nonfunctional and unstable, resulting in rapid
degradation. All MHC class I molecules isolated from PBMCs have
endogenous peptides bound to them. Therefore, the first step is to
remove all endogenous peptides bound to MHC class I molecules on
the APC without causing their degradation before exogenous peptides
can be added to them.
[0655] Two possible ways to free up MHC class I molecules of bound
peptides include lowering the culture temperature from 37.degree.
C. to 26.degree. C. overnight to destablize p2microglobulin and
stripping the endogenous peptides from the cell using a mild acid
treatment. The methods release previously bound peptides into the
extracellular environment allowing new exogenous peptides to bind
to the empty class I molecules. The cold-temperature incubation
method enables exogenous peptides to bind efficiently to the MHC
complex, but requires an overnight incubation at 26.degree. C.
which may slow the cell's metabolic rate. It is also likely that
cells not actively synthesizing MHC molecules (e.g., resting PBMC)
would not produce high amounts of empty surface MHC molecules by
the cold temperature procedure.
[0656] Harsh acid stripping involves extraction of the peptides
with trifluoroacetic acid, pH 2, or acid denaturation of the
immunoaffinity purified class I-peptide complexes. These methods
are not feasible for CTL induction, since it is important to remove
the endogenous peptides while preserving APC viability and an
optimal metabolic state which is critical for antigen presentation.
Mild acid solutions of pH 3 such as glycine or citrate-phosphate
buffers have been used to identify endogenous peptides and to
identify tumor associated T cell epitopes. The treatment is
especially effective, in that only the MHC class I molecules are
destabilized (and associated peptides released), while other
surface antigens remain intact, including MHC class II molecules.
Most importantly, treatment of cells with the mild acid solutions
do not affect the cell's viability or metabolic state. The mild
acid treatment is rapid since the stripping of the endogenous
peptides occurs in two minutes at 4.degree. C. and the APC is ready
to perform its function after the appropriate peptides are loaded.
The technique is utilized herein to make peptide-specific APCs for
the generation of primary antigen-specific CTL. The resulting APC
are efficient in inducing peptide-specific CD8+ CTL.
[0657] Activated CD8+ cells may be effectively separated from the
stimulator cells using one of a variety of known methods. For
example, monoclonal antibodies specific for the stimulator cells,
for the peptides loaded onto the stimulator cells, or for the CD8+
cells (or a segment thereof) may be utilized to bind their
appropriate complementary ligand. Antibody-tagged molecules may
then be extracted from the stimulator-effector cell admixture via
appropriate means, e.g., via well-known immunoprecipitation or
immunoassay methods.
[0658] Effective, cytotoxic amounts of the activated CD8+ cells can
vary between in vitro and in vivo uses, as well as with the amount
and type of cells that are the ultimate target of these killer
cells. The amount can also vary depending on the condition of the
patient and should be determined via consideration of all
appropriate factors by the practitioner. Preferably, however, about
1.times.10.sup.6 to about 1.times.10.sup.12, more preferably about
1.times.10.sup.8 to about 1.times.10.sup.11, and even more
preferably, about 1.times.10.sup.9 to about 1.times.10.sup.10
activated CD8+ cells are utilized for adult humans, compared to
about 5.times.10.sup.6-5.times.10.sup.7 cells used in mice.
[0659] Preferably, as discussed herein, the activated CD8+ cells
are harvested from the cell culture prior to administration of the
CD8+ cells to the individual being treated. It is important to
note, however, that unlike other present and proposed treatment
modalities, the present method uses a cell culture system that is
not tumorigenic. Therefore, if complete separation of stimulator
cells and activated CD8+ cells are not achieved, there is no
inherent danger known to be associated with the administration of a
small number of stimulator cells, whereas administration of
mammalian tumor-promoting cells may be extremely hazardous.
[0660] Methods of re-introducing cellular components are known in
the art and include procedures such as those exemplified in U.S.
Pat. No. 4,844,893 to Honsik, et al. and U.S. Pat. No. 4,690,915 to
Rosenberg. For example, administration of activated CD8+ cells via
intravenous infusion is appropriate.
[0661] The practice of the present invention employs, unless
otherwise indicated, conventional techniques of molecular biology
(including recombinant techniques), microbiology, cell biology,
biochemistry and immunology, which are well within the purview of
the skilled artisan. Such techniques are explained fully in the
literature, such as, "Molecular Cloning: A Laboratory Manual",
second edition (Sambrook, 1989); "Oligonucleotide Synthesis" (Gait,
1984); "Animal Cell Culture" (Freshney, 1987); "Methods in
Enzymology" "Handbook of Experimental Immunology" (Wei, 1996);
"Gene Transfer Vectors for Mammalian Cells" (Miller and Calos,
1987); "Current Protocols in Molecular Biology" (Ausubel, 1987);
"PCR: The Polymerase Chain Reaction", (Mullis, 1994); "Current
Protocols in Immunology" (Coligan, 1991). These techniques are
applicable to the production of the polynucleotides and
polypeptides of the invention, and, as such, may be considered in
making and practicing the invention. Particularly useful techniques
for particular embodiments are discussed in the sections that
follow.
Therapeutic Methods
[0662] The present invention provides methods of inducing a
neoplasia/tumor specific immune response in a subject, vaccinating
against a neoplasia/tumor, treating and or alleviating a symptom of
cancer in a subject by administering the subject a plurality of
neoantigenic peptides or composition of the invention.
[0663] According to the invention, the herein-described neoplasia
vaccine or immunogenic composition may be used for a patient that
has been diagnosed as having cancer, or at risk of developing
cancer.
[0664] The claimed combination of the invention is administered in
an amount sufficient to induce a CTL response.
Additional Therapies
[0665] The tumor specific neoantigen peptides and pharmaceutical
compositions described herein can also be administered in a
combination therapy with another agent, for example a therapeutic
agent. In certain embodiments, the additional agents can be, but
are not limited to, chemotherapeutic agents, anti-angiogenesis
agents and agents that reduce immune-suppression.
[0666] The neoplasia vaccine or immunogenic composition can be
administered before, during, or after administration of the
additional agent. In embodiments, the neoplasia vaccine or
immunogenic composition is administered before the first
administration of the additional agent. In other embodiments, the
neoplasia vaccine or immunogenic composition is administered after
the first administration of the additional therapeutic agent (e.g.,
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 days or more). In
embodiments, the neoplasia vaccine or immunogenic composition is
administered simultaneously with the first administration of the
additional therapeutic agent.
[0667] The therapeutic agent is for example, a chemotherapeutic or
biotherapeutic agent, radiation, or immunotherapy. Any suitable
therapeutic treatment for a particular cancer may be administered.
Examples of chemotherapeutic and biotherapeutic agents include, but
are not limited to, an angiogenesis inhibitor, such ashydroxy
angiostatin K1-3, DL-.alpha.-Difluoromethyl-ornithine, endostatin,
fumagillin, genistein, minocycline, staurosporine, and thalidomide;
a DNA intercaltor/cross-linker, such as Bleomycin, Carboplatin,
Carmustine, Chlorambucil, Cyclophosphamide,
cis-Diammineplatinum(II) dichloride (Cisplatin), Melphalan,
Mitoxantrone, and Oxaliplatin; a DNA synthesis inhibitor, such as
(.+-.)-Amethopterin (Methotrexate), 3-Amino-1,2,4-benzotriazine
1,4-dioxide, Aminopterin, Cytosine .beta.-D-arabinofuranoside,
5-Fluoro-5'-deoxyuridine, 5-Fluorouracil, Ganciclovir, Hydroxyurea,
and Mitomycin C; a DNA-RNA transcription regulator, such as
Actinomycin D, Daunorubicin, Doxorubicin, Homoharringtonine, and
Idarubicin; an enzyme inhibitor, such as S(+)-Camptothecin,
Curcumin, (-)-Deguelin, 5,6-Dichlorobenzimidazole
1-.beta.-D-ribofuranoside, Etoposide, Formestane, Fostriecin,
Hispidin, 2-Imino-1-imidazoli-dineacetic acid (Cyclocreatine),
Mevinolin, Trichostatin A, Tyrphostin AG 34, and Tyrphostin AG 879;
a gene regulator, such as 5-Aza-2'-deoxycytidine, 5-Azacytidine,
Cholecalciferol (Vitamin D3), 4-Hydroxytamoxifen, Melatonin,
Mifepristone, Raloxifene, all trans-Retinal (Vitamin A aldehyde),
Retinoic acid all trans (Vitamin A acid), 9-cis-Retinoic Acid,
13-cis-Retinoic acid, Retinol (Vitamin A), Tamoxifen, and
Troglitazone; a microtubule inhibitor, such as Colchicine,
docetaxel, Dolastatin 15, Nocodazole, Paclitaxel, Podophyllotoxin,
Rhizoxin, Vinblastine, Vincristine, Vindesine, and Vinorelbine
(Navelbine); and an unclassified therapeutic agent, such as
17-(Allylamino)-17-demethoxygeldanamycin,
4-Amino-1,8-naphthalimide, Apigenin, Brefeldin A, Cimetidine,
Dichloromethylene-diphosphonic acid, Leuprolide (Leuprorelin),
Luteinizing Hormone-Releasing Hormone, Pifithrin-.alpha.,
Rapamycin, Sex hormone-binding globulin, Thapsigargin, and Urinary
trypsin inhibitor fragment (Bikunin). The therapeutic agent may be
altretamine, amifostine, asparaginase, capecitabine, cladribine,
cisapride, cytarabine, dacarbazine (DTIC), dactinomycin,
dronabinol, epoetin alpha, filgrastim, fludarabine, gemcitabine,
granisetron, ifosfamide, irinotecan, lansoprazole, levamisole,
leucovorin, megestrol, mesna, metoclopramide, mitotane, omeprazole,
ondansetron, pilocarpine, prochloroperazine, or topotecan
hydrochloride. The therapeutic agent may be a monoclonal antibody
or small molecule such as rituximab (Rituxan.RTM.), alemtuzumab
(Campath.RTM.), Bevacizumab (Avastin.RTM.), Cetuximab
(Erbitux.RTM.), panitumumab (Vectibix.RTM.), and trastuzumab
(Herceptin.RTM.), Vemurafenib (Zelboraf.RTM.) imatinib mesylate
(Gleevec.RTM.), erlotinib (Tarceva.RTM.), gefitinib (Iressa.RTM.),
Vismodegib (Erivedge.TM.), 90Y-ibritumomab tiuxetan,
131I-tositumomab, ado-trastuzumab emtansine, lapatinib
(Tykerb.RTM.), pertuzumab (Perjeta.TM.), ado-trastuzumab emtansine
(Kadcyla.TM.) regorafenib (Stivarga.RTM.), sunitinib (Sutent.RTM.),
Denosumab (Xgeva.RTM.), sorafenib (Nexavar.RTM.), pazopanib
(Votrient.RTM.), axitinib (Inlyta.RTM.), dasatinib (Sprycel.RTM.),
nilotinib (Tasigna.RTM.), bosutinib (Bosulif.RTM.), ofatumumab
(Arzerra.RTM.), obinutuzumab (Gazyva.TM.), ibrutinib
(Imbruvica.TM.) idelalisib (Zydelig.RTM.), crizotinib
(Xalkori.RTM.), erlotinib (Tarceva.RTM.), afatinib dimaleate
(Gilotrif.RTM.), ceritinib (LDK378/Zykadia), Tositumomab and
131I-tositumomab (Bexxar.RTM.), ibritumomab tiuxetan
(Zevalin.RTM.), brentuximab vedotin (Adcetris.RTM.), bortezomib
(Velcade.RTM.), siltuximab (Sylvant.TM.), trametinib
(Mekinist.RTM.), dabrafenib (Tafinlar.RTM.), pembrolizumab
(Keytruda.RTM.), carfilzomib (Kyprolis.RTM.), Ramucirumab
(Cyramza.TM.), Cabozantinib (Cometriq.TM.), vandetanib
(Caprelsa.RTM.), Optionally, the therapeutic agent is a neoantigen.
The therapeutic agent may be a cytokine such as interferons (INFs),
interleukins (ILs), or hematopoietic growth factors. The
therapeutic agent may be INF-.alpha., IL-2, Aldesleukin, IL-2,
Erythropoietin, Granulocyte-macrophage colony-stimulating factor
(GM-CSF) or granulocyte colony-stimulating factor. The therapeutic
agent may be a targeted therapy such as toremifene (Fareston.RTM.),
fulvestrant (Faslodex.RTM.), anastrozole (Arimidex.RTM.),
exemestane (Aromasin.RTM.), letrozole (Femara.RTM.),
ziv-aflibercept (Zaltrap.RTM.), Alitretinoin (Panretin.RTM.),
temsirolimus (Torisel.RTM.), Tretinoin (Vesanoid.RTM.), denileukin
diftitox (Ontak.RTM.), vorinostat (Zolinza.RTM.), romidepsin
(Istodax.RTM.), bexarotene (Targretin.RTM.), pralatrexate
(Folotyn.RTM.), lenaliomide (Revlimid.RTM.), belinostat
(Beleodag.TM.) lenaliomide (Revlimid.RTM.), pomalidomide
(Pomalyst.RTM.), Cabazitaxel (Jevtana.RTM.), enzalutamide
(Xtandi.RTM.), abiraterone acetate (Zytiga.RTM.), radium 223
chloride (Xofigo.RTM.), or everolimus (Afinitor.RTM.).
Additionally, the therapeutic agent may be an epigenetic targeted
drug such as HDAC inhibitors, kinase inhibitors, DNA
methyltransferase inhibitors, histone demethylase inhibitors, or
histone methylation inhibitors. The epigenetic drugs may be
Azacitidine (Vidaza), Decitabine (Dacogen), Vorinostat (Zolinza),
Romidepsin (Istodax), or Ruxolitinib (Jakafi). For prostate cancer
treatment, a preferred chemotherapeutic agent with which
anti-CTLA-4 can be combined is paclitaxel (TAXOL).
[0668] In certain embodiments, the one or more additional agents
are one or more anti-glucocorticoid-induced tumor necrosis factor
family receptor (GITR) agonistic antibodies. GITR is a
costimulatory molecule for T lymphocytes, modulates innate and
adaptive immune system and has been found to participate in a
variety of immune responses and inflammatory processes. GITR was
originally described by Nocentini et al. after being cloned from
dexamethasone-treated murine T cell hybridomas (Nocentini et al.
Proc Natl Acad Sci USA 94:6216-6221.1997). Unlike CD28 and CTLA-4,
GITR has a very low basal expression on naive CD4+ and CD8+ T cells
(Ronchetti et al. Eur J Immunol 34:613-622. 2004). The observation
that GITR stimulation has immunostimulatory effects in vitro and
induced autoimmunity in vivo prompted the investigation of the
antitumor potency of triggering this pathway. A review of
Modulation Of Ctla 4 And Gitr For Cancer Immunotherapy can be found
in Cancer Immunology and Immunotherapy (Avogadri et al. Current
Topics in Microbiology and Immunology 344. 2011). Other agents that
can contribute to relief of immune suppression include checkpoint
inhibitors targeted at another member of the CD28/CTLA4 Ig
superfamily such as BTLA, LAG3, ICOS, PDL1 or KIR (Page et a,
Annual Review of Medicine 65:27 (2014)). In further additional
embodiments, the checkpoint inhibitor is targeted at a member of
the TNFR superfamily such as CD40, OX40, CD137, GITR, CD27 or
TIM-3. In some cases targeting a checkpoint inhibitor is
accomplished with an inhibitory antibody or similar molecule. In
other cases, it is accomplished with an agonist for the target;
examples of this class include the stimulatory targets OX40 and
GITR.
[0669] In certain embodiments, the one or more additional agents
are synergistic in that they increase immunogenicity after
treatment. In one embodiment the additional agent allows for lower
toxicity and/or lower discomfort due to lower doses of the
additional therapeutic agents or any components of the combination
therapy described herein. In another embodiment the additional
agent results in longer lifespan due to increased effectiveness of
the combination therapy described herein. Chemotherapeutic
treatments that enhance the immunological response in a patient
have been reviewed (Zitvogel et al., Immunological aspects of
cancer chemotherapy. Nat Rev Immunol. 2008 January; 8(1):59-73).
Additionally, chemotherapeutic agents can be administered safely
with immunotherapy without inhibiting vaccine specific T-cell
responses (Perez et al., A new era in anticancer peptide vaccines.
Cancer May 2010). In one embodiment the additional agent is
administered to increase the efficacy of the therapy described
herein. In one embodiment the additional agent is a chemotherapy
treatment. In one embodiment low doses of chemotherapy potentiate
delayed-type hypersensitivity (DTH) responses. In one embodiment
the chemotheray agent targets regulatory T-cells. In one embodiment
cyclophosphamide is the therapeutic agent. In one embodiment
cyclophosphamide is administered prior to vaccination. In one
embodiment cyclophosphamide is administered as a single dose before
vaccination (Walter et al., Multipeptide immune response to cancer
vaccine IMA901 after single-dose cyclophosphamide associates with
longer patient survival. Nature Medicine; 18:8 2012). In another
embodiment, cyclophosphamide is administered according to a
metronomic program, where a daily dose is administered for one
month (Ghiringhelli et al., Metronomic cyclophosphamide regimen
selectively depletes CD4+CD25+ regulatory T cells and restores T
and NK effector functions in end stage cancer patients. Cancer
Immunol Immunother 2007 56:641-648). In another embodiment taxanes
are administered before vaccination to enhance T-cell and NK-cell
functions (Zitvogel et al., 2008). In another embodiment a low dose
of a chemotherapeutic agent is administered with the therapy
described herein. In one embodiment the chemotherapeutic agent is
estramustine. In one embodiment the cancer is hormone resistant
prostate cancer. A .gtoreq.50% decrease in serum prostate specific
antigen (PSA) was seen in 8.7% of advanced hormone refractory
prostate cancer patients by personalized vaccination alone, whereas
such a decrease was seen in 54% of patients when the personalized
vaccination was combined with a low dose of estramustine (Itoh et
al., Personalized peptide vaccines: A new therapeutic modality for
cancer. Cancer Sci 2006; 97: 970-976). In another embodiment
glucocorticoids are administered with or before the therapy
described herein (Zitvogel et al., 2008). In another embodiment
glucocorticoids are administered after the therapy described
herein. In another embodiment Gemcitabine is administered before,
simultaneously, or after the therapy described herein to enhance
the frequency of tumor specific CTL precursors (Zitvogel et al.,
2008). In another embodiment 5-fluorouracil is administered with
the therapy described herein as synergistic effects were seen with
a peptide based vaccine (Zitvogel et al., 2008). In another
embodiment an inhibitor of Braf, such as Vemurafenib, is used as an
additional agent. Braf inhibition has been shown to be associated
with an increase in melanoma antigen expression and T-cell
infiltrate and a decrease in immunosuppressive cytokines in tumors
of treated patients (Frederick et al., BRAF inhibition is
associated with enhanced melanoma antigen expression and a more
favorable tumor microenvironment in patients with metastatic
melanoma. Clin Cancer Res. 2013; 19:1225-1231). In another
embodiment an inhibitor of tyrosine kinases is used as an
additional agent. In one embodiment the tyrosine kinase inhibitor
is used before vaccination with the therapy described herein. In
one embodiment the tyrosine kinase inhibitor is used simultaneously
with the therapy described herein. In another embodiment the
tyrosine kinase inhibitor is used to create a more immune
permissive environment. In another embodiment the tyrosine kinase
inhibitor is sunitinib or imatinib mesylate. It has previously been
shown that favorable outcomes could be achieved with sequential
administration of continuous daily dosing of sunitinib and
recombinant vaccine (Farsaci et al., Consequence of dose scheduling
of sunitinib on host immune response elements and vaccine
combination therapy. Int J Cancer; 130: 1948-1959). Sunitinib has
also been shown to reverse type-1 immune suppression using a daily
dose of 50 mg/day (Finke et al., Sunitinib Reverses Type-1 Immune
Suppression and Decreases T-Regulatory Cells in Renal Cell
Carcinoma Patients. Clin Cancer Res 2008; 14(20)). In another
embodiment targeted therapies are administered in combination with
the therapy described herein. Doses of targeted therapies has been
described previously (Alvarez, Present and future evolution of
advanced breast cancer therapy. Breast Cancer Research 2010,
12(Suppl 2):S1). In another embodiment temozolomide is administered
with the therapy described herein. In one embodiment temozolomide
is administered at 200 mg/day for 5 days every fourth week of a
combination therapy with the therapy described herein. Results of a
similar strategy have been shown to have low toxicity (Kyte et al.,
Telomerase Peptide Vaccination Combined with Temozolomide: A
Clinical Trial in Stage IV Melanoma Patients. Clin Cancer Res;
17(13) 2011). In another embodiment the therapy is administered
with an additional therapeutic agent that results in lymphopenia.
In one embodiment the additional agent is temozolomide. An immune
response can still be induced under these conditions (Sampson et
al., Greater chemotherapy-induced lymphopenia enhances
tumor-specific immune responses that eliminate EGFRvIII-expressing
tumor cells in patients with glioblastoma. Neuro-Oncology
13(3):324-333, 2011).
[0670] Patients in need thereof may receive a series of priming
vaccinations with a mixture of tumor-specific peptides.
Additionally, over a 4 week period the priming may be followed by
two boosts during a maintenance phase. All vaccinations are
subcutaneously delivered. The vaccine or immunogenic composition is
evaluated for safety, tolerability, immune response and clinical
effect in patients and for feasibility of producing vaccine or
immunogenic composition and successfully initiating vaccination
within an appropriate time frame. The first cohort can consist of 5
patients, and after safety is adequately demonstrated, an
additional cohort of 10 patients may be enrolled. Peripheral blood
is extensively monitored for peptide-specific T-cell responses and
patients are followed for up to two years to assess disease
recurrence.
Administering a Combination Therapy Consistent with Standard of
Care
[0671] In another aspect, the therapy described herein provides
selecting the appropriate point to administer a combination therapy
in relation to and within the standard of care for the cancer being
treated for a patient in need thereof. The studies described herein
show that the combination therapy can be effectively administered
even within the standard of care that includes surgery, radiation,
or chemotherapy. The standards of care for the most common cancers
can be found on the website of National Cancer Institute
(www.cancer.gov/cancertopics). The standard of care is the current
treatment that is accepted by medical experts as a proper treatment
for a certain type of disease and that is widely used by healthcare
professionals. Standard or care is also called best practice,
standard medical care, and standard therapy. Standards of Care for
cancer generally include surgery, lymph node removal, radiation,
chemotherapy, targeted therapies, antibodies targeting the tumor,
and immunotherapy. Immunotherapy can include checkpoint blockers
(CBP), chimeric antigen receptors (CARs), and adoptive T-cell
therapy. The combination therapy described herein can be
incorporated within the standard of care. The combination therapy
described herein may also be administered where the standard of
care has changed due to advances in medicine.
[0672] Incorporation of the combination therapy described herein
may depend on a treatment step in the standard of care that can
lead to activation of the immune system. Treatment steps that can
activate and function synergistically with the combination therapy
have been described herein. The therapy can be advantageously
administered simultaneously or after a treatment that activates the
immune system.
[0673] Incorporation of the combination therapy described herein
may depend on a treatment step in the standard of care that causes
the immune system to be suppressed. Such treatment steps may
include irradiation, high doses of alkylating agents and/or
methotrexate, steroids such as glucosteroids, surgery, such as to
remove the lymph nodes, imatinib mesylate, high doses of TNF, and
taxanes (Zitvogel et al., 2008). The combination therapy may be
administered before such steps or may be administered after.
[0674] In one embodiment the combination therapy may be
administered after bone marrow transplants and peripheral blood
stem cell transplantation. Bone marrow transplantation and
peripheral blood stem cell transplantation are procedures that
restore stem cells that were destroyed by high doses of
chemotherapy and/or radiation therapy. After being treated with
high-dose anticancer drugs and/or radiation, the patient receives
harvested stem cells, which travel to the bone marrow and begin to
produce new blood cells. A "mini-transplant" uses lower, less toxic
doses of chemotherapy and/or radiation to prepare the patient for
transplant. A "tandem transplant" involves two sequential courses
of high-dose chemotherapy and stem cell transplant. In autologous
transplants, patients receive their own stem cells. In syngeneic
transplants, patients receive stem cells from their identical twin.
In allogeneic transplants, patients receive stem cells from their
brother, sister, or parent. A person who is not related to the
patient (an unrelated donor) also may be used. In some types of
leukemia, the graft-versus-tumor (GVT) effect that occurs after
allogeneic BMT and PBSCT is crucial to the effectiveness of the
treatment. GVT occurs when white blood cells from the donor (the
graft) identify the cancer cells that remain in the patient's body
after the chemotherapy and/or radiation therapy (the tumor) as
foreign and attack them. Immunotherapy with the combination therapy
described herein can take advantage of this by vaccinating after a
transplant. Additionally, the transferred cells may be presented
with neoantigens of the combination therapy described herein before
transplantation.
[0675] In one embodiment the combination therapy is administered to
a patient in need thereof with a cancer that requires surgery. In
one embodiment the combination therapy described herein is
administered to a patient in need thereof in a cancer where the
standard of care is primarily surgery followed by treatment to
remove possible micro-metastases, such as breast cancer. Breast
cancer is commonly treated by various combinations of surgery,
radiation therapy, chemotherapy, and hormone therapy based on the
stage and grade of the cancer. Adjuvant therapy for breast cancer
is any treatment given after primary therapy to increase the chance
of long-term survival. Neoadjuvant therapy is treatment given
before primary therapy. Adjuvant therapy for breast cancer is any
treatment given after primary therapy to increase the chance of
long-term disease-free survival. Primary therapy is the main
treatment used to reduce or eliminate the cancer. Primary therapy
for breast cancer usually includes surgery, a mastectomy (removal
of the breast) or a lumpectomy (surgery to remove the tumor and a
small amount of normal tissue around it; a type of
breast-conserving surgery). During either type of surgery, one or
more nearby lymph nodes are also removed to see if cancer cells
have spread to the lymphatic system. When a woman has
breast-conserving surgery, primary therapy almost always includes
radiation therapy. Even in early-stage breast cancer, cells may
break away from the primary tumor and spread to other parts of the
body (metastasize). Therefore, doctors give adjuvant therapy to
kill any cancer cells that may have spread, even if they cannot be
detected by imaging or laboratory tests.
[0676] In one embodiment the combination therapy is administered
consistent with the standard of care for Ductal carcinoma in situ
(DCIS). The standard of care for this breast cancer type is:
[0677] 1. Breast-conserving surgery and radiation therapy with or
without tamoxifen.
[0678] 2. Total mastectomy with or without tamoxifen.
[0679] 3. Breast-conserving surgery without radiation therapy.
[0680] The combination therapy may be administered before breast
conserving surgery or total mastectomy to shrink the tumor before
surgery. In another embodiment the combination therapy can be
administered as an adjuvant therapy to remove any remaining cancer
cells. In another embodiment patients diagnosed with stage I, II,
IIIA, and Operable IIIC breast cancer are treated with the
combination therapy as described herein. The standard of care for
this breast cancer type is:
[0681] 1. Local-regional treatment: [0682] Breast-conserving
therapy (lumpectomy, breast radiation, and surgical staging of the
axilla). [0683] Modified radical mastectomy (removal of the entire
breast with level I-II axillary dissection) with or without breast
reconstruction. [0684] Sentinel node biopsy.
[0685] 2. Adjuvant radiation therapy postmastectomy in axillary
node-positive tumors: [0686] For one to three nodes: unclear role
for regional radiation (infra/supraclavicular nodes, internal
mammary nodes, axillary nodes, and chest wall). [0687] For more
than four nodes or extranodal involvement: regional radiation is
advised.
[0688] 3. Adjuvant systemic therapy
[0689] In one embodiment the combination therapy is administered as
a neoadjuvant therapy to shrink the tumor. In another embodiment
the combination is administered as an adjuvant systemic
therapy.
[0690] In another embodiment patients diagnosed with inoperable
stage IIIB or IIIC or inflammatory breast cancer are treated with
the combination therapy as described herein. The standard of care
for this breast cancer type is:
[0691] 1. Multimodality therapy delivered with curative intent is
the standard of care for patients with clinical stage IIIB
disease.
[0692] 2. Initial surgery is generally limited to biopsy to permit
the determination of histology, estrogen-receptor (ER) and
progesterone-receptor (PR) levels, and human epidermal growth
factor receptor 2 (HER2/neu) overexpression. Initial treatment with
anthracycline-based chemotherapy and/or taxane-based therapy is
standard. For patients who respond to neoadjuvant chemotherapy,
local therapy may consist of total mastectomy with axillary lymph
node dissection followed by postoperative radiation therapy to the
chest wall and regional lymphatics. Breast-conserving therapy can
be considered in patients with a good partial or complete response
to neoadjuvant chemotherapy. Subsequent systemic therapy may
consist of further chemotherapy. Hormone therapy should be
administered to patients whose tumors are ER-positive or unknown.
All patients should be considered candidates for clinical trials to
evaluate the most appropriate fashion in which to administer the
various components of multimodality regimens.
[0693] In one embodiment the combination therapy is administered as
part of the various components of multimodality regimens. In
another embodiment the combination therapy is administered before,
simultaneously with, or after the multimodality regimens. In
another embodiment the combination therapy is administered based on
synergism between the modalities. In another embodiment the
combination therapy is administered after treatment with
anthracycline-based chemotherapy and/or taxane-based therapy
(Zitvogel et al., 2008). Treatment after administering the
combination therapy may negatively affect dividing effector
T-cells. The combination therapy may also be administered after
radiation.
[0694] In another embodiment the combination therapy described
herein is used in the treatment in a cancer where the standard of
care is primarily not surgery and is primarily based on systemic
treatments, such as Chronic Lymphocytic Leukemia (CLL).
[0695] In another embodiment patients diagnosed with stage I, II,
III, and IV Chronic Lymphocytic Leukemia are treated with the
combination therapy as described herein. The standard of care for
this cancer type is:
[0696] 1. Observation in asymptomatic or minimally affected
patients
[0697] 2. Rituximab
[0698] 3. Ofatumomab
[0699] 4. Oral alkylating agents with or without
corticosteroids
[0700] 5. Fludarabine, 2-chlorodeoxyadenosine, or pentostatin
[0701] 6. Bendamustine
[0702] 7. Lenalidomide
[0703] 8. Combination chemotherapy. [0704] combination chemotherapy
regimens include the following: [0705] Fludarabine plus
cyclophosphamide plus rituximab. [0706] Fludarabine plus rituximab
as seen in the CLB-9712 and CLB-9011 trials. [0707] Fludarabine
plus cyclophosphamide versus fludarabine plus cyclophosphamide plus
rituximab. [0708] Pentostatin plus cyclophosphamide plus rituximab
as seen in the MAYO-MC0183 trial, for example. [0709] Ofatumumab
plus fludarabine plus cyclophosphamide. [0710] CVP:
cyclophosphamide plus vincristine plus prednisone. [0711] CHOP:
cyclophosphamide plus doxorubicin plus vincristine plus prednisone.
[0712] Fludarabine plus cyclophosphamide versus fludarabine as seen
in the E2997 trial [NCT00003764] and the LRF-CLL4 trial, for
example. [0713] Fludarabine plus chlorambucil as seen in the
CLB-9011 trial, for example.
[0714] 9. Involved-field radiation therapy.
[0715] 10. Alemtuzumab
[0716] 11. Bone marrow and peripheral stem cell transplantations
are under clinical evaluation.
[0717] 12. Ibrutinib
[0718] In one embodiment the combination therapy is administered
before, simultaneously with or after treatment with Rituximab or
Ofatumomab. As these are monoclonal antibodies that target B-cells,
treatment with the combination therapy may be synergistic. In
another embodiment the combination therapy is administered after
treatment with oral alkylating agents with or without
corticosteroids, and Fludarabine, 2-chlorodeoxyadenosine, or
pentostatin, as these treatments may negatively affect the immune
system if administered before. In one embodiment bendamustine is
administered with the combination therapy in low doses based on the
results for prostate cancer described herein. In one embodiment the
combination therapy is administered after treatment with
bendamustine.
[0719] In another embodiment, therapies targeted to specific
recurrent mutations in genes that include extracellular domains are
used in the treatment of a patient in need thereof suffering from
cancer. The genes may advantageously be well-expressed genes. Well
expressed may be expressed in "transcripts per million" (TPM). A
TPM greater than 100 is considered well expressed. Well expressed
genes may be FGFR3, ERBB3, EGFR, MUC4, PDGFRA, MMP12, TMEM52, and
PODXL. The therapies may be a ligand capable of binding to an
extracellular neoantigen epitope. Such ligands are well known in
the art and may include therapeutic antibodies or fragments
thereof, antibody-drug conjugates, engineered T cells, or aptamers.
Engineered T cells may be chimeric antigen receptors (CARs).
Antibodies may be fully humanized, humanized, or chimeric. The
antibody fragments may be a nanobody, Fab, Fab', (Fab')2, Fv, ScFv,
diabody, triabody, tetrabody, Bis-scFv, minibody, Fab2, or Fab3
fragment. Antibodies may be developed against tumor-specific
neoepitopes using known methods in the art.
Adoptive Cell Transfer (ACT)
[0720] Aspects of the invention involve the adoptive transfer of
immune system cells, such as T cells, specific for selected
antigens, such as tumor associated antigens (see Maus et al., 2014,
Adoptive Immunotherapy for Cancer or Viruses, Annual Review of
Immunology, Vol. 32: 189-225; Rosenberg and Restifo, 2015, Adoptive
cell transfer as personalized immunotherapy for human cancer,
Science Vol. 348 no. 6230 pp. 62-68; Restifo et al., 2015, Adoptive
immunotherapy for cancer: harnessing the T cell response. Nat. Rev.
Immunol. 12(4): 269-281; and Jenson and Riddell, 2014, Design and
implementation of adoptive therapy with chimeric antigen
receptor-modified T cells. Immunol Rev. 257(1): 127-144). Various
strategies may for example be employed to genetically modify T
cells by altering the specificity of the T cell receptor (TCR) for
example by introducing new TCR .alpha. and .beta. chains with
selected peptide specificity (see U.S. Pat. No. 8,697,854; PCT
Patent Publications: WO2003020763, WO2004033685, WO2004044004,
WO2005114215, WO2006000830, WO2008038002, WO2008039818,
WO2004074322, WO2005113595, WO2006125962, WO2013166321,
WO2013039889, WO2014018863, WO2014083173; U.S. Pat. No.
8,088,379).
[0721] As an alternative to, or addition to, TCR modifications,
chimeric antigen receptors (CARs) may be used in order to generate
immunoresponsive cells, such as T cells, specific for selected
targets, such as malignant cells, with a wide variety of receptor
chimera constructs having been described (see U.S. Pat. Nos.
5,843,728; 5,851,828; 5,912,170; 6,004,811; 6,284,240; 6,392,013;
6,410,014; 6,753,162; 8,211,422; and, PCT Publication WO9215322).
Alternative CAR constructs may be characterized as belonging to
successive generations. First-generation CARs typically consist of
a single-chain variable fragment of an antibody specific for an
antigen, for example comprising a V.sub.L linked to a V.sub.H of a
specific antibody, linked by a flexible linker, for example by a
CD8.alpha. hinge domain and a CD8.alpha. transmembrane domain, to
the transmembrane and intracellular signaling domains of either
CD3.zeta. or FcR.gamma. (scFv-CD3.zeta. or scFv-FcR.gamma.; see
U.S. Pat. Nos. 7,741,465; 5,912,172; 5,906,936). Second-generation
CARs incorporate the intracellular domains of one or more
costimulatory molecules, such as CD28, OX40 (CD134), or 4-1BB
(CD137) within the endodomain (for example
scFv-CD28/OX40/4-1BB-CD3.zeta.; see U.S. Pat. Nos. 8,911,993;
8,916,381; 8,975,071; 9,101,584; 9,102,760; 9,102,761).
Third-generation CARs include a combination of costimulatory
endodomains, such a CD3.zeta.-chain, CD97, GDI 1a-CD18, CD2, ICOS,
CD27, CD154, CDS, OX40, 4-1BB, or CD28 signaling domains (for
example scFv-CD28-4-1BB-CD3.zeta. t or scFv-CD28-OX40-CD3.zeta.;
see U.S. Pat. Nos. 8,906,682; 8,399,645; 5,686,281; PCT Publication
No. WO2014134165; PCT Publication No. WO2012079000). Alternatively,
costimulation may be orchestrated by expressing CARs in
antigen-specific T cells, chosen so as to be activated and expanded
following engagement of their native .alpha..beta.TCR, for example
by antigen on professional antigen-presenting cells, with attendant
costimulation. In addition, additional engineered receptors may be
provided on the immunoresponsive cells, for example to improve
targeting of a T-cell attack and/or minimize side effects.
[0722] Alternative techniques may be used to transform target
immunoresponsive cells, such as protoplast fusion, lipofection,
transfection or electroporation. A wide variety of vectors may be
used, such as retroviral vectors, lentiviral vectors, adenoviral
vectors, adeno-associated viral vectors, plasmids or transposons,
such as a Sleeping Beauty transposon (see U.S. Pat. Nos. 6,489,458;
7,148,203; 7,160,682; 7,985,739; 8,227,432), may be used to
introduce CARs, for example using 2nd generation antigen-specific
CARs signaling through CD3.zeta. and either CD28 or CD137. Viral
vectors may for example include vectors based on HIV, SV40, EBV,
HSV or BPV.
[0723] Cells that are targeted for transformation may for example
include T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes
(CTL), regulatory T cells, human embryonic stem cells,
tumor-infiltrating lymphocytes (TIL) or a pluripotent stem cell
from which lymphoid cells may be differentiated. T cells expressing
a desired CAR may for example be selected through co-culture with
.gamma.-irradiated activating and propagating cells (AaPC), which
co-express the cancer antigen and co-stimulatory molecules. The
engineered CAR T-cells may be expanded, for example by co-culture
on AaPC in presence of soluble factors, such as IL-2 and IL-21.
This expansion may for example be carried out so as to provide
memory CAR+ T cells (which may for example be assayed by
non-enzymatic digital array and/or multi-panel flow cytometry). In
this way, CAR T cells may be provided that have specific cytotoxic
activity against antigen-bearing tumors (optionally in conjunction
with production of desired chemokines such as interferon-.gamma.).
CART cells of this kind may for example be used in animal models,
for example to treat tumor xenografts.
[0724] Approaches such as the foregoing may be adapted to provide
methods of treating and/or increasing survival of a subject having
a disease, such as a neoplasia, for example by administering an
effective amount of an immunoresponsive cell comprising an antigen
recognizing receptor that binds a selected antigen, wherein the
binding activates the immunoreponsive cell, thereby treating or
preventing the disease (such as a neoplasia, a pathogen infection,
an autoimmune disorder, or an allogeneic transplant reaction).
[0725] In one embodiment, the treatment can be administrated into
patients undergoing an immunosuppressive treatment. The cells or
population of cells, may be made resistant to at least one
immunosuppressive agent due to the inactivation of a gene encoding
a receptor for such immunosuppressive agent. Not being bound by a
theory, the immunosuppressive treatment should help the selection
and expansion of the immunoresponsive or T cells according to the
invention within the patient.
[0726] The administration of the cells or population of cells
according to the present invention may be carried out in any
convenient manner, including by aerosol inhalation, injection,
ingestion, transfusion, implantation or transplantation. The cells
or population of cells may be administered to a patient
subcutaneously, intradermally, intratumorally, intranodally,
intramedullary, intramuscularly, by intravenous or intralymphatic
injection, or intraperitoneally. In one embodiment, the cell
compositions of the present invention are preferably administered
by intravenous injection.
[0727] The administration of the cells or population of cells can
consist of the administration of 10.sup.4-10.sup.9 cells per kg
body weight, preferably 10.sup.5 to 10.sup.6 cells/kg body weight
including all integer values of cell numbers within those ranges.
Dosing in CAR T cell therapies may for example involve
administration of from 10.sup.6 to 10.sup.9 cells/kg, with or
without a course of lymphodepletion, for example with
cyclophosphamide. The cells or population of cells can be
administrated in one or more doses. In another embodiment, the
effective amount of cells are administrated as a single dose. In
another embodiment, the effective amount of cells are administrated
as more than one dose over a period time. Timing of administration
is within the judgment of managing physician and depends on the
clinical condition of the patient. The cells or population of cells
may be obtained from any source, such as a blood bank or a donor.
While individual needs vary, determination of optimal ranges of
effective amounts of a given cell type for a particular disease or
conditions are within the skill of one in the art. An effective
amount means an amount which provides a therapeutic or prophylactic
benefit. The dosage administrated will be dependent upon the age,
health and weight of the recipient, kind of concurrent treatment,
if any, frequency of treatment and the nature of the effect
desired.
[0728] In another embodiment, the effective amount of cells or
composition comprising those cells are administrated parenterally.
The administration can be an intravenous administration. The
administration can be directly done by injection within a
tumor.
[0729] To guard against possible adverse reactions, engineered
immunoresponsive cells may be equipped with a transgenic safety
switch, in the form of a transgene that renders the cells
vulnerable to exposure to a specific signal. For example, the
herpes simplex viral thymidine kinase (TK) gene may be used in this
way, for example by introduction into allogeneic T lymphocytes used
as donor lymphocyte infusions following stem cell transplantation
(Greco, et al., Improving the safety of cell therapy with the
TK-suicide gene. Front. Pharmacol. 2015; 6: 95). In such cells,
administration of a nucleoside prodrug such as ganciclovir or
acyclovir causes cell death. Alternative safety switch constructs
include inducible caspase 9, for example triggered by
administration of a small-molecule dimerizer that brings together
two nonfunctional icasp9 molecules to form the active enzyme. A
wide variety of alternative approaches to implementing cellular
proliferation controls have been described (see U.S. Patent
Publication No. 20130071414; PCT Patent Publication WO2011146862;
PCT Patent Publication WO2014011987; PCT Patent Publication
WO2013040371; Zhou et al. BLOOD, 2014, 123/25:3895-3905; Di Stasi
et al., The New England Journal of Medicine 2011; 365:1673-1683;
Sadelain M, The New England Journal of Medicine 2011; 365:1735-173;
Ramos et al., Stem Cells 28(6):1107-15 (2010)).
[0730] In a further refinement of adoptive therapies, genome
editing may be used to tailor immunoresponsive cells to alternative
implementations, for example providing edited CAR T cells (see
Poirot et al., 2015, Multiplex genome edited T-cell manufacturing
platform for "off-the-shelf" adoptive T-cell immunotherapies,
Cancer Res 75 (18): 3853). Cells may be edited using any DNA
targeting protein, including, but not limited to a CRISPR system,
Zinc Finger binding protein, TALE or TALEN as known in the art. DNA
targeting proteins may be delivered to an immune cell by any method
known in the art. In preferred embodiments, cells are edited ex
vivo and transferred to a subject in need thereof. Immunoresponsive
cells, CAR T cells or any cells used for adoptive cell transfer may
be edited. Editing may be performed to eliminate potential
alloreactive T-cell receptors (TCR), disrupt the target of a
chemotherapeutic agent, block an immune checkpoint, activate a T
cell, and/or increase the differentiation and/or proliferation of
functionally exhausted or dysfunctional CD8+ T-cells (see PCT
Patent Publications: WO2013176915, WO2014059173, WO2014172606,
WO2014184744, and WO2014191128). Editing may result in inactivation
of a gene.
[0731] By inactivating a gene it is intended that the gene of
interest is not expressed in a functional protein form. In a
particular embodiment, the CRISPR system specifically catalyzes
cleavage in one targeted gene thereby inactivating said targeted
gene. The nucleic acid strand breaks caused are commonly repaired
through the distinct mechanisms of homologous recombination or
non-homologous end joining (NHEJ). However, NHEJ is an imperfect
repair process that often results in changes to the DNA sequence at
the site of the cleavage. Repair via non-homologous end joining
(NHEJ) often results in small insertions or deletions (Indel) and
can be used for the creation of specific gene knockouts. Cells in
which a cleavage induced mutagenesis event has occurred can be
identified and/or selected by well-known methods in the art.
[0732] T cell receptors (TCR) are cell surface receptors that
participate in the activation of T cells in response to the
presentation of antigen. The TCR is generally made from two chains,
.alpha. and .beta., which assemble to form a heterodimer and
associates with the CD3-transducing subunits to form the T cell
receptor complex present on the cell surface. Each .alpha. and
.beta. chain of the TCR consists of an immunoglobulin-like
N-terminal variable (V) and constant (C) region, a hydrophobic
transmembrane domain, and a short cytoplasmic region. As for
immunoglobulin molecules, the variable region of the .alpha. and
.beta. chains are generated by V(D)J recombination, creating a
large diversity of antigen specificities within the population of T
cells. However, in contrast to immunoglobulins that recognize
intact antigen, T cells are activated by processed peptide
fragments in association with an MHC molecule, introducing an extra
dimension to antigen recognition by T cells, known as MHC
restriction. Recognition of MHC disparities between the donor and
recipient through the T cell receptor leads to T cell proliferation
and the potential development of graft versus host disease (GVHD).
The inactivation of TCR.alpha. or TCR.beta. can result in the
elimination of the TCR from the surface of T cells preventing
recognition of alloantigen and thus GVHD. However, TCR disruption
generally results in the elimination of the CD3 signaling component
and alters the means of further T cell expansion.
[0733] Allogeneic cells are rapidly rejected by the host immune
system. It has been demonstrated that, allogeneic leukocytes
present in non-irradiated blood products will persist for no more
than 5 to 6 days (Boni, Muranski et al. 2008 Blood 1;
112(12):4746-54). Thus, to prevent rejection of allogeneic cells,
the host's immune system usually has to be suppressed to some
extent. However, in the case of adoptive cell transfer the use of
immunosuppressive drugs also have a detrimental effect on the
introduced therapeutic T cells. Therefore, to effectively use an
adoptive immunotherapy approach in these conditions, the introduced
cells would need to be resistant to the immunosuppressive
treatment. Thus, in a particular embodiment, the present invention
further comprises a step of modifying T cells to make them
resistant to an immunosuppressive agent, preferably by inactivating
at least one gene encoding a target for an immunosuppressive agent.
An immunosuppressive agent is an agent that suppresses immune
function by one of several mechanisms of action. An
immunosuppressive agent can be, but is not limited to a calcineurin
inhibitor, a target of rapamycin, an interleukin-2 receptor
.alpha.-chain blocker, an inhibitor of inosine monophosphate
dehydrogenase, an inhibitor of dihydrofolic acid reductase, a
corticosteroid or an immunosuppressive antimetabolite. The present
invention allows conferring immunosuppressive resistance to T cells
for immunotherapy by inactivating the target of the
immunosuppressive agent in T cells. As non-limiting examples,
targets for an immunosuppressive agent can be a receptor for an
immunosuppressive agent such as: CD52, glucocorticoid receptor
(GR), a FKBP family gene member and a cyclophilin family gene
member.
[0734] Immune checkpoints are inhibitory pathways that slow down or
stop immune reactions and prevent excessive tissue damage from
uncontrolled activity of immune cells. In certain embodiments, the
immune checkpoint targeted is the programmed death-1 (PD-1 or
CD279) gene (PDCD1). In other embodiments, the immune checkpoint
targeted is cytotoxic T-lymphocyte-associated antigen (CTLA-4). In
additional embodiments, the immune checkpoint targeted is another
member of the CD28 and CTLA4 Ig superfamily such as BTLA, LAG3,
ICOS, PDL1 or KIR. In further additional embodiments, the immune
checkpoint targeted is a member of the TNFR superfamily such as
CD40, OX40, CD137, GITR, CD27 or TIM-3.
[0735] Additional immune checkpoints include Src homology 2
domain-containing protein tyrosine phosphatase 1 (SHP-1) (Watson H
A, et al., SHP-1: the next checkpoint target for cancer
immunotherapy? Biochem Soc Trans. 2016 Apr. 15; 44(2):356-62).
SHP-1 is a widely expressed inhibitory protein tyrosine phosphatase
(PTP). In T-cells, it is a negative regulator of antigen-dependent
activation and proliferation. It is a cytosolic protein, and
therefore not amenable to antibody-mediated therapies, but its role
in activation and proliferation makes it an attractive target for
genetic manipulation in adoptive transfer strategies, such as
chimeric antigen receptor (CAR) T cells. Immune checkpoints may
also include T cell immunoreceptor with Ig and ITIM domains
(TIGIT/Vstm3/WUCAM/VSIG9) and VISTA (Le Mercier I, et al., (2015)
Beyond CTLA-4 and PD-1, the generation Z of negative checkpoint
regulators. Front. Immunol. 6:418).
[0736] WO2014172606 relates to the use of MT1 and/or MT1 inhibitors
to increase proliferation and/or activity of exhausted CD8+ T-cells
and to decrease CD8+ T-cell exhaustion (e.g., decrease functionally
exhausted or unresponsive CD8+ immune cells). In certain
embodiments, metallothioneins are targeted by gene editing in
adoptively transferred T cells.
[0737] In certain embodiments, targets of gene editing may be at
least one targeted locus involved in the expression of an immune
checkpoint protein. Such targets may include, but are not limited
to CTLA4, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, ICOS (CD278), PDL1,
KIR, LAG3, HAVCR2, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7,
SIGLEC9, CD244 (2B4), TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3,
CASP6, CASP7, FADD, FAS, TGFBRII, TGFRBRI, SMAD2, SMAD3, SMAD4,
SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST,
EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, VISTA, GUCY1A2,
GUCY1A3, GUCY1B2, GUCY1B3, MT1, MT2, CD40, OX40, CD137, GITR, CD27,
SHP-1 or TIM-3. In preferred embodiments, the gene locus involved
in the expression of PD-1 or CTLA-4 genes is targeted. In other
preferred embodiments, combinations of genes are targeted, such as
but not limited to PD-1 and TIGIT.
[0738] In other embodiments, at least two genes are edited. Pairs
of genes may include, but are not limited to PD1 and TCR.alpha.,
PD1 and TCR.beta., CTLA-4 and TCR.alpha., CTLA-4 and TCR.beta.,
LAG3 and TCR.alpha., LAG3 and TCR.beta., Tim3 and TCR.alpha., Tim3
and TCR.beta., BTLA and TCR.alpha., BTLA and TCR.beta., BY55 and
TCR.alpha., BY55 and TCR.beta., TIGIT and TCR.alpha., TIGIT and
TCR.beta., B7H5 and TCR.alpha., B7H5 and TCR.beta., LAIR1 and
TCR.alpha., LAIR1 and TCR.beta., SIGLEC10 and TCR.alpha., SIGLEC10
and TCR.beta., 2B4 and TCR.alpha., 2B4 and TCR.beta..
[0739] Whether prior to or after genetic modification of the T
cells, the T cells can be activated and expanded generally using
methods as described, for example, in U.S. Pat. Nos. 6,352,694;
6,534,055; 6,905,680; 5,858,358; 6,887,466; 6,905,681; 7,144,575;
7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041;
and 7,572,631. T cells can be expanded in vitro or in vivo.
Selecting the Patient Population Most Likely to Benefit from the
Therapy
[0740] In another aspect, the invention provides selecting for the
patients in need thereof most likely to benefit from the therapy of
the present invention. Although the compositions and methods of the
present invention are typically applicable in a high proportion of
subjects suffering from cancer, the method may still comprise one
or more steps of selecting patients from the patient population who
are likely to benefit. For instance, the method may comprise
selecting subjects whose tumors contain one or more of the
mutations represented in the neoantigenic peptides in the
composition. In another embodiment, the method may comprise
selecting subjects having at least one HLA allele which binds to
one or more neoepitopes represented in the neoantigenic peptides in
the composition.
Vaccine or Immunogenic Composition Kits and Co-Packaging
[0741] In an aspect, the invention provides kits containing any one
or more of the elements discussed herein to allow administration of
the therapy. Elements may be provided individually or in
combinations, and may be provided in any suitable container, such
as a vial, a bottle, or a tube. In some embodiments, the kit
includes instructions in one or more languages, for example in more
than one language. In some embodiments, a kit comprises one or more
reagents for use in a process utilizing one or more of the elements
described herein. Reagents may be provided in any suitable
container. For example, a kit may provide one or more delivery or
storage buffers. Reagents may be provided in a form that is usable
in a particular process, or in a form that requires addition of one
or more other components before use (e.g. in concentrate or
lyophilized form). A buffer can be any buffer, including but not
limited to a sodium carbonate buffer, a sodium bicarbonate buffer,
a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and
combinations thereof. In some embodiments, the buffer is alkaline.
In some embodiments, the buffer has a pH from about 7 to about 10.
In some embodiments, the kit comprises one or more of the vectors,
proteins and/or one or more of the polynucleotides described
herein. The kit may advantageously allow the provision of all
elements of the systems of the invention. Kits can involve
vector(s) and/or particle(s) and/or nanoparticle(s) containing or
encoding RNA(s) for 1-50 or more neoantigen mutations to be
administered to an animal, mammal, primate, rodent, etc., with such
a kit including instructions for administering to such a eukaryote;
and such a kit can optionally include any of the anti-cancer agents
described herein. The kit may include any of the components above
(e.g. vector(s) and/or particle(s) and/or nanoparticle(s)
containing or encoding RNA(s) for 1-50 or more neoantigen
mutations, neoantigen proteins or peptides) as well as instructions
for use with any of the methods of the present invention.
[0742] In one embodiment the kit contains at least one vial with an
immunogenic composition or vaccine. In one embodiment the kit
contains at least one vial with an immunogenic composition or
vaccine and at least one vial with an anticancer agent. In one
embodiment kits may comprise ready to use components that are mixed
and ready to administer. In one aspect a kit contains a ready to
use immunogenic or vaccine composition and a ready to use
anti-cancer agent. The ready to use immunogenic or vaccine
composition may comprise separate vials containing different pools
of immunogenic compositions. The immunogenic compositions may
comprise one vial containing a viral vector or DNA plasmid and the
other vial may comprise immunogenic protein. The ready to use
anticancer agent may comprise a cocktail of anticancer agents or a
single anticancer agent. Separate vials may contain different
anti-cancer agents. In another embodiment a kit may contain a ready
to use anti-cancer agent and an immunogenic composition or vaccine
in a ready to be reconstituted form. The immunogenic or vaccine
composition may be freeze dried or lyophilized. The kit may
comprise a separate vial with a reconstitution buffer that can be
added to the lyophilized composition so that it is ready to
administer. The buffer may advantageously comprise an adjuvant or
emulsion according to the present invention. In another embodiment
the kit may comprise a ready to reconstitute anti-cancer agent and
a ready to reconstitute immunogenic composition or vaccine. In this
aspect both may be lyophilized. In this aspect separate
reconstitution buffers for each may be included in the kit. The
buffer may advantageously comprise an adjuvant or emulsion
according to the present invention. In another embodiment the kit
may comprise single vials containing a dose of immunogenic
composition and anti-cancer agent that are administered together.
In another aspect multiple vials are included so that one vial is
administered according to a treatment timeline. One vial may only
contain the anti-cancer agent for one dose of treatment, another
may contain both the anti-cancer agent and immunogenic composition
for another dose of treatment, and one vial may only contain the
immunogenic composition for yet another dose. In a further aspect
the vials are labeled for their proper administration to a patient
in need thereof. The immunogen or anti-cancer agents of any
embodiment may be in a lyophilized form, a dried form or in aqueous
solution as described herein. The immunogen may be a live
attenuated virus, protein, or nucleic acid as described herein.
[0743] In one embodiment the anticancer agent is one that enhances
the immune system to enhance the effectiveness of the immunogenic
composition or vaccine. In a preferred embodiment the anti-cancer
agent is a checkpoint inhibitor. In another embodiment the kit
contains multiple vials of immunogenic compositions and anti-cancer
agents to be administered at different time intervals along a
treatment plan. In another embodiment the kit may comprise separate
vials for an immunogenic composition for use in priming an immune
response and another immunogenic composition to be used for
boosting. In one aspect the priming immunogenic composition could
be DNA or a viral vector and the boosting immunogenic composition
may be protein. Either composition may be lyophilized or ready for
administering. In another embodiment different cocktails of
anti-cancer agents containing at least one anti-cancer agent are
included in different vials for administration in a treatment
plan.
[0744] Although the present invention and its advantages have been
described in detail, it should be understood that various changes,
substitutions and alterations can be made herein without departing
from the spirit and scope of the invention as defined in the
appended claims.
[0745] The present invention will be further illustrated in the
following Examples which are given for illustration purposes only
and are not intended to limit the invention in any way.
EXAMPLES
Example 1
[0746] sPDL1 Generates Immunogenic Epitopes Across a Variety of HLA
Alleles.
[0747] PDL1 (CD274) is a trans-membrane protein which interacts
with PD1 (CD279; PDCD1) on T cells and may be involved in multiple
forms of natural immune suppression (such as during gestation).
Expression of PDL1 is also utilized by tumor cells as a way to
evade host immune response. sPDL1 is an alternate spliced form of
the PDL1 gene. This alternate spliced form is caused by a lack of
splicing at the end of Exon 4, reading into the 4.sup.th intron.
The transcript terminates within intron 4. The translation product
is in frame for 18 amino acids before a stop codon is
encountered.
[0748] The translated product lacks the transmembrane domain
typically found in PDL1 and thus is secreted. It also contains a
cysteine within the neoORF translated from the intron and appears
to dimerize in the media. The secreted form appears to block
binding between PDL1 and PD1.
[0749] Applicants analyzed the predicted binding possibilities for
9 and 10mer peptides containing the neoORF region encoded by the
intron. The analysis is shown for predicted 9mer peptides Table 1.
The values highlighted in yellow are alleles that are present at a
frequency >5% in the indicated population. Notably, the common
HLA allele A0210 in the Caucasian population is predicted to have a
reasonably tight binding peptide. A similar analysis shows that
10mer peptides are also predicted to be potentially immunogenic,
including for the A0201 allele (85 nM). Tumor cells expressing the
alternate form of the PDL1 message would be thus rendered as
targets of the immune system.
[0750] These peptides could be utilized across multiple patients
(either HLA-restricted or more broadly if the patient is expected
to have some probability to contain a relevant HLA allele) as a
"Shared Neoantigen". Note that given the relatively short size of
the neoORF region of sPDL1, two or three long overlapping peptides
could be used as a mixture, allowing targeting of any HLA allele,
even rare alleles, and reducing the need to prepare a different
product for each patient based on their HLA type.
[0751] This neoORF may also contain a CD4 epitope although
prediction algorithms for CD4 epitopes are not highly accurate. The
presence of a CD4 epitope could be assessed in vitro with naive T
cells or in patient samples.
TABLE-US-00001 TABLE 1 (SEQ ID NOS 1-23, respectively, in order of
appearance) peptide affinity Cauca- HLA 9mers (nM) sian Black Asian
Hispanic ENHTAELVIPGNILNVSIKICLTLSPST A0201 VIPGNILNV 182 28.3%
11.4% 9.7% 19.7% B4001 AELVIPGNI 144 4.0% 1.0% 12.0% 1.3% A3201
NILNVSIKI 491 3.2% 1.6% 0.3% 2.6% A3201 VSIKICLTL 224 3.2% 1.6%
0.3% 2.6% A2301 VSIKICLTL 468 2.3% 11.6% 0.2% 3.5% B4002 AELVIPGNI
53 1.6% 0.3% 7.6% 5.0% B4901 AELVIPGNI 108 1.4% 3.1% 0.0% 2.3%
B4102 AELVIPGNI 192 1.0% 0.6% 0.0% 0.5% A0205 VIPGNILNV 170 0.8%
2.3% 0.1% 1.4% B5801 VSIKICLTL 373 0.8% 4.3% 4.5% 1.3% A6802
HTAELVIPG 170 0.7% 6.4% 0.0% 2.4% B4405 AELVIPGNI 219 0.6% 0.0%
0.0% 0.2% B4101 AELVIPGNI 92 0.5% 0.6% 0.0% 1.1% B4501 AELVIPGNI
302 0.4% 5.3% 0.0% 1.5% B1517 VSIKICLTL 23 0.3% 0.5% 0.1% 0.6%
A0206 VIPGNILNV 85 0.2% 0.0% 4.7% 4.1% A0202 VIPGNILNV 90 0.1% 4.4%
0.0% 0.7% A6901 HTAELVIPG 283 0.1% 0.1% 0.0% 0.5% A6901 NILNVSIKI
162 0.1% 0.1% 0.0% 0.5% B1503 IKICLTLSP 408 0.1% 6.5% 0.1% 1.5%
B1503 VSIKICLTL 138 0.1% 6.5% 0.1% 1.5% A0203 VIPGNILNV 98 0.0%
0.0% 5.2% 0.0%
Example 2
[0752] Androgen Receptor Generates Immunogenic Epitopes Across a
Variety of HLA Alleles.
[0753] The androgen receptor was identified as another alternate
spliced form of a message that results in a neoORF which may be
specifically expressed in tumor cells. Alternate splicing results
in at least two isoforms that bring in cryptic exons that
are.neoORFs.
[0754] Of these alternate transcripts, AR-V1 and AR-V7 were
consistently seen in hormone resistant prostate cancer samples.
[0755] The immunogenic potential of these neoORFs was unknown and
thus Applicants conducted predicted binding analysis across a
number of common HLA alleles. These are shown for HLA A alleles
(Table 2).
TABLE-US-00002 TABLE 2 (SEQ ID NOS 24, 27, 28, 30, 25, 29, 31, 26,
32, 33, 41, 43, 45, 34, 42, 44, 46, 35, 47, 36, 48, 37, 49 and
38-40, respectively, in order of appearance) A0201 A0301 A1101
A3001 Caucasian 28.30% 13.70% 6.00% 1.60% Asian 9.70% 0.90% 22.40%
1.40% Hispanic 19.65% 7.59% 4.88% 2.20% Black 11.40% 7.10% 1.00%
6.50% RVFGVS SEQ2 233 RVGNC SEQ1 122 RVGN SEQ1 33 SEQ1 30 EWL KHLK
CKHL K GMTLG SEQ2 282 VVVS SEQ2 359 KFRV SEQ1 103 AVVV ERILR GNC KH
MTLGE SEQ1 400 KFRV SEQ1 190 KFRV GNCK HL A3101 A3201 A3301 A6801 A
B 2.40% 3.20% 0.70% 3.40% 30.30% 6.80% Caucasian 3.40% 0.30% 0.60%
0.30% 28.70% 19.70% Asian 4.72% 2.62% 1.97% 4.46% 26.46% 7.86%
Hispanic 1.00% 1.60% 1.70% 3.20% 20.40% 2.10% Black SEQ1 70 RVFGVS
SEQ2 41 NCK SEQ1 385 VVVS SEQ2 47 EWL HLK ERIL MTR R TLGAVV SEQ2
121 ILRVFG SEQ2 255 TLG SEQ2 417 TLGA SEQ2 84 VSER VSEW AVV VVVS
VSE ER R VVVSERI SEQ2 127 EAGM SEQ1 230 LR TLGE K GMTLGE SEQ1 199
LGAV SEQ2 268 KFR VVSE R AVVVSE SEQ2 230 AVVV SEQ2 339 RILR SERIL R
AGMTLG SEQ1 284 EKFR GNCKHL SEQ1 466 KMTR LGAVVV SEQ2 488 SER
[0756] Again, as for sPDL1, a number of peptides are predicted to
be immunogenic binders and these can be applied across a large
subset of patients. These immunogenic peptides can be used across
multiple patients.
Example 3
[0757] Drug Resistant Mutations.
[0758] Treatment with various chemotherapeutic agents, particularly
with targeted therapies such as tyrosine kinase inhibitors,
frequently leads to new mutations in the target molecules that
resist the activity of the therapeutic. Multiple strategies to
overcome this resistance are being evaluated, including development
of second generation therapies that are not affected by these
mutations and treatment with multiple agents including those that
act downstream of the resistance mutation.
[0759] Applicants have evaluated the immunogenic potential of the
mutated peptides created by these resistance mutations and have
found that for some, predicted immunogenic peptides are created
that can bind to a range of HLA alleles. Two specific examples are
provided below as well as data for a range of resistance
variants.
BTK/C481S
[0760] A very common mutation to ibrutinib, a molecule targeting
Bruton's Tyrosine Kinase (BTK) and used for CLL and certain
lymphomas, is a Cysteine to Serine change at position 481. This
change produces a number of binding peptides which bind to a range
of HLA molecules.
[0761] Shown are results of binding predictions for 9mer peptides.
Similar binding peptides can be found for 10mer peptides (Table 3).
Only peptides with mutant predicted affinity below 150 nM are
included. Expanding the range of peptides up to 500 nM would also
significantly increase the number of HLA range.
TABLE-US-00003 TABLE 3 (SEQ ID NOS 50-72, respectively, in order of
appearance) affinity affinity HLA peptide (nM) MUT (nM) NAT
Caucasian Black Asian Hispanic A0201 SLLNYLREM 97 278 28.3% 11.4%
9.7% 19.7% A2402 EYMANGSLL 95 120 9.3% 2.0% 23.1% 12.4% B1801
TEYMANGSL 80 252 6.1% 3.5% 0.4% 4.1% B1501 MANGSLLNY 91 158 5.8%
0.8% 12.1% 2.6% B3501 MANGSLLNY 17 17 5.6% 6.1% 2.4% 6.0% B4001
TEYMANGSL 10 24 4.0% 1.0% 12.0% 1.3% A3101 LLNYLREMR 43 206 2.4%
1.0% 3.4% 4.7% A2301 EYMANGSLL 122 133 2.3% 11.6% 0.2% 3.5% A2902
MANGSLLNY 17 10 2.0% 4.4% 0.0% 4.1% B4002 TEYMANGSL 45 110 1.6%
0.3% 7.6% 5.0% B4102 TEYMANGSL 133 341 1.0% 0.6% 0.0% 0.5% B5801
MANGSLLNY 40 35 0.8% 4.3% 4.5% 1.3% A3301 LLNYLREMR 91 188 0.7%
1.7% 0.6% 2.0% A3002 MANGSLLNY 16 15 0.5% 6.6% 0.0% 2.8% A6804
EYMANGSLL 47 448 0.0% 0.0% 0.0% 0.0% B1801 TEYMANGSL 44 252 6.1%
3.5% 0.4% 4.1% B1501 MANGSLLNY 42 158 5.8% 0.8% 12.1% 2.6% B3501
MANGSLLNY 40 17 5.6% 6.1% 2.4% 6.0% B4001 TEYMANGSL 38 24 4.0% 1.0%
12.0% 1.3% A3101 LLNYLREMR 36 206 2.4% 1.0% 3.4% 4.7% A2301
EYMANGSLL 34 133 2.3% 11.6% 0.2% 3.5% A2902 MANGSLLNY 32 10 2.0%
4.4% 0.0% 4.1% B4002 TEYMANGSL 30 110 1.6% 0.3% 7.6% 5.0%
[0762] Such peptide immunogens are preferably utilized
prophylactically (prior to detection of resistant disease) to
induce an immunogenic response capable of killing any pre-existing
or newly mutated cells or could also be used at the time of
detection of disease recurrence following or during therapy. These
peptides could be utilized across multiple patients (either
HLA-restricted or more broadly if the patient is expected with some
probability to contain a relevant HLA allele).
EGFR/T790M
[0763] Erlotinib, which targets the tyrosine kinase domain of the
Epidermal Growth Factor Receptor (EGFR), is commonly used in the
treatment of lung cancer and resistant tumors invariably develop
following therapy. A common mutation found in resistant clones is a
Threonine to methionine mutation at position 790. This change
produces a number of binding peptides which bind to a range of HLA
molecules (Table 4).
TABLE-US-00004 TABLE 4 (SEQ ID NOS 73, 74, 74-76, 73, 73, 78, 78,
78, 78, 78, 79, 80, 78, 77 and 77, respectively, in order of
appearance) SUM Caucasian 2.3% 3.9% 4.0% 3.2% 3.2% 17% Black 11.6%
0.3% 1.5% 1.6% 1.6% 17% Asian 0.2% 0.0% 3.9% 0.3% 0.3% 5% His anic
3.5% 0.9% 2.8% 2.6% 2.6% 12% A2301 A2501 A2601 A3201 A3201
VQLIMQLMPF 366 STVQLIMQLM 125 STVQLIMQLM 67 QLIMQLMPF 155 QLIMQLMPF
155 VQLIMQLMPF 426 VQLIMQLMPF 426 Caucasian 4.2% 5.8% 2.9% 1.4%
0.4% 1.6% 16% Black 1.2% 0.8% 0.1% 0.3% 0.1% 0.3% 3% Asian 1.2%
12.1% 0.2% 2.4% 0.0% 7.6% 24% Hispanic 1.2% 2.6% 1.8% 1.0% 2.2%
5.0% 14% B1302 B1501 B3801 B3901 B3906 B4002 MQLMPFGCLL 125
MQLMPFGCLL 488 MQLMPFGCLL 400 MQLMPFGCLL 213 MQLMPFGCLL 400
MQLMPFGCL 221 QUMQLMPF 23 MQLMPFGCLL 103 VQLIMQLMPF 73 VQLIMQLMPF
365
[0764] As stated herein, such peptide immunogens are ideally
utilized prophylactically (prior to detection of resistant disease)
to induce an immunogenic response capable of killing any
pre-existing or newly mutated cells or are also used at the time of
detection of disease recurrence following or during therapy. These
peptides could be utilized across multiple patients (either
HLA-restricted or more broadly if the patient is expected with some
probability to contain a relevant HLA allele).
[0765] Note that as an immunogen, only a single long peptide
containing the mutated amino acid and at least 10 amino acids on
either side of the mutated amino acid would be sufficient to
contain all the epitopes listed. Thus, all the HLA alleles shown,
as well as any additional alleles that have not been shown in this
analysis would be covered. For the Caucasian population, the HLA A
alleles shown represent 17% of the population distribution of
alleles and the HLA B alleles represent 16% of the population
distribution of alleles. As each individual has two HLA A alleles
and two HLA B alleles, approximately 50% of Caucasian patients will
be expected to have at least one of the alleles shown and thus
benefit from immune therapy with a vaccine targeting this molecule.
This rationale also applies to any other single amino acid mutation
discussed herein.
Other Resistance Variants
[0766] In addition to the specific resistance cases discussed
herein, there are many other observed resistance mutations to
targeted therapy. Each of these are also used to define immunogenic
epitopes that could be utilized as vaccine for immunotherapy
targeting those cells containing the resistance mutations (Table
5).
TABLE-US-00005 TABLE 5 Drug Gene Resistance rr Sensitive Refs
Imatinib BCR-Abl T315I
http://www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/
Imatinib BCR-Abl Y253H
http.//www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/
Imatinib BCR-Abl E255K
http.//www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/
Imatinib BCR-Abl E255V
http://www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/
Imatinib c-kit T670I
http://www.mycancergenome.org/content/disease/gist/kit/50/
Erlotinib/gefitinib PIK3CA E545K PMC1570180; PMC3132801
Erlotinib/gefitinib HER2 G776(YVMA) PMID 16843263; 15753357
Erlotinib/gefitinib EML4-ALK G1269A
http://www.ncbi.nlm.nih.gov/pubmed/22235099?dopt=Abstract
Crizotinib KRAS G12V/D
http://www.ncbi.nlm.nih.gov/pubmed/22235099?dopt=Abstract
Crizotinib ALK L1196M
http://stm.sciencemag.org/content/4/120/120ra17 Crizotinib ALK
G1202R http://stm.sciencemag.org/content/4/120/120ra17 Crizotinib
ALK S1206Y http://stm.sciencemag.org/content/4/120/120ra17
Crizotinib ALK 1151T(ins)
http://stm.sciencemag.org/content/4/120/120ra17 Crizotinib ALK
F1174C http://cancerdiscovery.aacrjournals.org/content/4/6/662
Crizotinib ROS1 G2032R
http.//www.nejm.org/doi/full/10.1056/NEJMoa1215530 Crizotinib
PIK3CA E542K
http://www.mycancergenome.org/content/disease/breast-cancer/
Trastuzumab Her2 E545K
http://www.mycancergenome.org/content/disease/breast-cancer/
Trastuzumab Hwe2 H1047R
http://www.mycancergenome.org/content/disease/breast-cancer/
Trastuzumab AKT1 E17K
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2834432/ Trastuzumab
BRAF V600E Vemurafenib MEK1 Q56P
http://www.ncbi.nlm.nih.gov/pubmed/23569304 Vemurafenib MEK1 E203K
http://www.ncbi.nlm.nih.gov/pubmed/23569304 Vemurafenib MEK1 C121S
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong
Vemurafenib NRAS Q61K/L http://www.ncbi.nlm.nih.gov/pubmed/23569304
Vemurafenib NRAS Q61R
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong
Vemurafenib NRAS T58I
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong
Vemurafenib MEK2 C125S
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong
Vemurafenib MEK1 V60E
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong RAF/MEK
MEK1 G128V
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong RAF/MEK
MEK1 V154I
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong RAF/MEK
MEK1 P124S
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong RAF/MEK
MEK1 P124L
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong RAF/MEK
RAC1 P29S
http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong RAF/MEK
ESR1 S463P
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR V534E
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR P535H
http.//www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR L536Q
http.//www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR L536R
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR Y537C
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR Y537S
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR Y537N
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR D538G
http://www.mycancergenome.org/content/disease/breast-cancer/er/314/
Antiestrogen therapy AR F876L
http://cancerdiscovery.aacrjournals.org/content/early/2013/06/18/2159-829-
0.CD-13-0226
[0767] A number of these examples have been used to predict
immunogenic epitopes. These results are summarized in Table 6, in
which for each resistance mutation, the number of potential binding
peptides (with predicted affinity <500 nM) for each mutation are
shown for multiple Human HLA alleles.
TABLE-US-00006 TABLE 6 ABL1:p.T315I ALK:p.F1174C ALK:p.F1174L
ALK:p.G1202R ALK:p.G1269A ALK:p.L1196M ALK:p.S1206Y AR:p.F876L RES
500 Caucasian Black Asian 80 80 80 80 80 80 80 80 hla_a_01_01 0.143
0.047 0.012 1 hla_a_02_01 0.283 0.114 0.097 1 2 hla_a_02_03 0 0
0.052 1 2 2 hla_a_02_07 0 0 0.08 1 hla_a_03_01 0.137 0.071 0.009 1
1 hla_a_11_01 0.06 0.01 0.224 1 1 2 hla_a_23_01 0.023 0.116 0.002 2
hla_a_24_02 0.093 0.02 0.231 1 hla_a_30_01 0.016 0.065 0.014 1 1 2
1 1 1 hla_a_30_02 0.005 0.066 0 2 2 hla_a_33_03 0.004 0.041 0.072 3
1 3 hla_a_68_02 0.007 0.064 0 hla_a_74_01 0 0.051 0.001 1 1 1
hla_b_07_02 0.118 0.062 0.015 2 1 hla_b_08_01 0.098 0.039 0.002 1
hla_b_15_01 0.058 0.008 0.121 1 1 3 1 hla_b_15_02 0 0 0.066 1 2 3 1
hla_b_15_03 0.001 0.065 0.001 5 3 3 2 4 4 4 hla_b_18_01 0.061 0.035
0.004 2 1 1 1 hla_b_35_01 0.056 0.061 0.024 3 1 1 2 2 hla_b_40_01
0.04 0.01 0.12 3 1 1 1 1 hla_b_40_02 0.016 0.003 0.076 3 1 1 1 1 1
2 hla_b_42_01 0 0.057 0 2 hla_b_44_02 0.071 0.014 0.002 1 1
hla_b_45_01 0.004 0.053 0 1 1 hla_b_46_01 0 0 0.082 1 hla_b_51_01
0.051 0.021 0.04 2 hla_b_53_01 0.003 0.11 0 1 1 BTK:p.C481S
EGFR:p.T790M KRAS:p.G12D MAP2K1:p.C121S MAP2K1:p.E203K
MAP2K1:p.G128V MAP2K1:p.P124L MAP2K1:p.P124S RES 500 Caucasian
Black Asian 80 80 80 80 80 80 80 80 hla_a_01_01 0.143 0.047 0.012 2
1 1 2 hla_a_02_01 0.283 0.114 0.097 1 2 1 1 3 2 1 hla_a_02_03 0 0
0.052 2 1 2 1 3 2 1 hla_a_02_07 0 0 0.08 hla_a_03_01 0.137 0.071
0.009 1 1 hla_a_11_01 0.06 0.01 0.224 2 2 1 hla_a_23_01 0.023 0.116
0.002 1 2 1 1 2 hla_a_24_02 0.093 0.02 0.231 1 1 1 1 hla_a_30_01
0.016 0.065 0.014 1 1 hla_a_30_02 0.005 0.066 0 2 3 2 3 4 5
hla_a_33_03 0.004 0.041 0.072 2 1 hla_a_68_02 0.007 0.064 0 1 2 1 1
1 hla_a_74_01 0 0.051 0.001 1 hla_b_07_02 0.118 0.062 0.015 2
hla_b_08_01 0.098 0.039 0.002 hla_b_15_01 0.058 0.008 0.121 3 2 2 1
3 1 2 hla_b_15_02 0 0 0.066 3 2 2 1 3 3 3 hla_b_15_03 0.001 0.065
0.001 8 7 7 2 6 8 8 hla_b_18_01 0.061 0.035 0.004 2 1 1 1
hla_b_35_01 0.056 0.061 0.024 3 1 2 1 3 3 hla_b_40_01 0.04 0.01
0.12 2 1 2 1 1 1 hla_b_40_02 0.016 0.003 0.076 2 3 3 1 1 1
hla_b_42_01 0 0.057 0 hla_b_44_02 0.071 0.014 0.002 hla_b_45_01
0.004 0.053 0 2 1 1 1 hla_b_46_01 0 0 0.082 3 1 1 1 1 hla_b_51_01
0.051 0.021 0.04 1 1 hla_b_53_01 0.003 0.11 0 2 2 MAP2K1:p.056P
MAP2K1:p.V154I MAP2K1:p.V60E MAP2K2:p.C125S MAP2K2:p.L46F
MAP2K2:p.N126D MAP2K2:p.V35M NRAS:p.Q61R RES 500 Caucasian Black
Asian 80 80 80 80 80 80 80 80 hla_a_01_01 0.143 0.047 0.012 1
hla_a_02_01 0.283 0.114 0.097 1 1 1 1 hla_a_02_03 0 0 0.052 1 1 1 1
hla_a_02_07 0 0 0.08 hla_a_03_01 0 137 0.071 0.009 1 hla_a_11_01
0.06 0.01 0.224 1 1 hla_a_23_01 0.023 0.116 0.002 hla_a_24_02 0.093
0.02 0.231 hla_a_30_01 0.016 0.065 0.014 2 1 1 hla_a_30_02 0.005
0.066 0 3 4 1 hla_a_33_03 0.004 0.041 0.072 1 hla_a_68_02 0.007
0.064 0 1 1 hla_a_74_01 0 0.051 0.001 hla_b_07_02 0.118 0.062 0.015
1 hla_b_08_01 0.098 0.039 0.002 1 2 1 1 hla_b_15_01 0.058 0.008
0.121 2 2 hla_b_15_02 0 0 0.066 7 2 5 1 3 hla_b_15_03 0.001 0.065
0.001 1 1 hla_b_18_01 0.061 0.035 0.004 2 2 hla_b_35_01 0.056 0.061
0.024 2 1 1 hla_b_40_01 0.04 0.01 0.12 3 1 1 hla_b_40_02 0.016
0.003 0.076 hla_b_42_01 0 0.057 0 hla_b_44_02 0.071 0.014 0.002 2 1
hla_b_45_01 0.034 0.053 0 1 hla_b_46_01 0 0 0.082 hla_b_51_01 0.051
0.021 0.04 hla_b_53_01 0.033 0.11 0 NRAS:p.T58I PIK3CA:p.E545K
PLCG2:p.R665W ROS1:p.G2032A RES 500 Caucasian Black Asian 80 80 80
80 hla_a_01_01 0.143 0.047 0.012 1 1 hla_a_02_01 0.283 0.114 0.097
1 2 3 hla_a_02_03 0 0 0.052 1 3 3 hla_a_02_07 0 0 0.08 hla_a_03_01
0.137 0.071 0.009 hla_a_11_01 0.06 0.01 0.224 2 hla_a_23_01 0.023
0.116 0.002 hla_a_24_02 0.093 0.02 0.231 hla_a_30_01 0.016 0.065
0.014 1 hla_a_30_02 0.005 0.066 0 1 1 2 hla_a_33_03 0.004 0.041
0.072 1 hla_a_68_02 0.007 0.064 0 1 2 hla_a_74_01 0 0.051 0.001
hla_b_07_02 0.118 0.062 0.015 hla_b_08_01 0.098 0.039 0.002
hla_b_15_01 0.058 0.008 0.121 1 2 hla_b_15_02 0 0 0.066 1 2
hla_b_15_03 0.001 0.065 0.001 3 2 4 5 hla_b_18_01 0.061 0.035 0.004
1 2 hla_b_35_01 0.056 0.061 0.024 1 1 hla_b_40_01 0.04 0.01 0.12 3
hla_b_40_02 0.016 0.003 0.076 1 3 hla_b_42_01 0 0.057 0 hla_b_44_02
0.071 0.014 0.002 1 2 2 hla_b_45_01 0.004 0.053 0 hla_b_46_01 0
0.082 1 hla_b_51_01 0.051 0.021 0.04 1 hla_b_53_01 0.003 0.11 0
1
[0768] In all of the above examples, predictions are only shown for
a subset of HLA alleles. These are often but not exclusively the
most abundant alleles in each ethnic population. Additional alleles
are readily predicted.
[0769] Moreover, for a given immunization designed to attack
resistant variants for a given resistance mutation, multiple
peptides, each targeting a separate possible resistance variant
that may arise, are utilized to benefit the broadest set of
patients.
Example 4
[0770] Cancer Subtype Specific Immunogenic Compositions.
[0771] Table 7 shows a data summary for the number of mutations
found within a population of samples specific to a cancer subtype.
Each mutation found within the data set for each disease leads to
at least one predicted binder to any one of 33 HLA alleles selected
based on being found in at least 5% of any one of the three ethnic
populations (Caucasian, Black, Asian). A combination of
neoantigenic peptides derived from polypeptides resulting from
these mutations can be used in an immunogenic composition. Based on
the number of peptides from the mutations selected, a larger
percentage of patients may receive a benefit from the vaccine.
Table 7 shows the number of mutations that are recurrent in each
cancer specific data set. Also shown are the percentage of subjects
in each data set that will have at least a single mutation when
selecting recurrent mutations. For example, an immunogenic
composition for SKCM that includes neoantigenic peptides derived
from 64 recurrent mutations described herein covers 90.91% of
patients in this population, whereby each subject will contain at
least one of the neoantigenic mutations.
TABLE-US-00007 TABLE 7 recurrence # samples (muts that # that have
occur in unique at least one Exemplary .gtoreq. given muts in
mutation in total # disease # samples the set the set samples
percentage SKCM 5 64 230 253 90.91 SKCM 4 200 241 253 95.26 SKCM 3
707 247 253 97.63 SKCM 2 4437 250 253 98.81 SKCM 1 103732 253 253
100 ACC 5 161 90 90 100 ACC 4 219 90 90 100 ACC 3 299 90 90 100 ACC
2 546 90 90 100 ACC 1 10310 90 90 100 BLCA 5 6 35 130 26.92 BLCA 4
9 47 130 36.15 BLCA 3 26 77 130 59.23 BLCA 2 181 121 130 93.08 BLCA
1 25605 130 130 100 BRCA 5 18 320 888 36.04 BRCA 4 25 337 888 37.95
BRCA 3 35 357 888 40.2 BRCA 2 148 475 888 53.49 BRCA 1 31457 886
888 99.77 CESC 5 4 46 194 23.71 CESC 4 7 55 194 28.35 CESC 3 12 65
194 33.51 CESC 2 145 133 194 68.56 CESC 1 25585 194 194 100 CRC 5
15 132 233 56.65 CRC 4 22 142 233 60.94 CRC 3 53 160 233 68.67 CRC
2 711 209 233 89.7 CRC 1 55287 233 233 100 DLBCL 5 0 0 58 0 DLBCL 4
2 8 58 13.79 DLBCL 3 4 13 58 22.41 DLBCL 2 30 38 58 65.52 DLBCL 1
7435 57 58 98.28 HNSC 5 10 83 384 21.61 HNSC 4 15 97 384 25.26 HNSC
3 27 123 384 32.03 HNSC 2 154 227 384 59.11 HNSC 1 43143 384 384
100 KICH 5 0 0 66 0 KICH 4 0 0 66 0 KICH 3 0 0 66 0 KICH 2 24 33 66
50 KICH 1 2576 66 66 100 KIRP 5 9 68 161 42.24 KIRP 4 18 86 161
53.42 KIRP 3 35 104 161 64.6 KIRP 2 117 139 161 86.34 KIRP 1 10482
161 161 100 LIHC 5 2 13 198 6.57 LIHC 4 5 25 198 12.63 LIHC 3 10 38
198 19.19 LIHC 2 33 73 198 36.87 LIHC 1 18574 198 198 100 LUAD 5 11
134 401 33.42 LUAD 4 17 152 401 37.91 LUAD 3 35 185 401 46.13 LUAD
2 611 330 401 82.29 LUAD 1 101222 399 401 99.5 MM 5 6 49 205 23.9
MM 4 8 55 205 26.83 MM 3 16 71 205 34.63 MM 2 51 101 205 49.27 MM 1
7116 204 205 99.51 PRAD 5 24 104 261 39.85 PRAD 4 38 133 261 50.96
PRAD 3 83 174 261 66.67 PRAD 2 205 213 261 81.61 PRAD 1 10174 261
261 100 STAD 5 150 141 289 48.79 STAD 4 245 156 289 53.98 STAD 3
613 201 289 69.55 STAD 2 2729 269 289 93.08 STAD 1 97578 289 289
100 TGCT 5 14 80 155 51.61 TGCT 4 25 99 155 63.87 TGCT 3 64 124 155
80 TGCT 2 338 149 155 96.13 TGCT 1 7632 155 155 100 THCA 5 5 283
405 69.88 THCA 4 5 283 405 69.88 THCA 3 7 287 405 70.86 THCA 2 31
300 405 74.07 THCA 1 4439 405 405 100 UCS 5 2 9 56 16.07 UCS 4 10
31 56 55.36 UCS 3 19 41 56 73.21 UCS 2 55 53 56 94.64 UCS 1 3805 56
56 100 CLL 5 6 46 263 17.49 CLL 4 19 74 263 28.14 CLL 3 38 100 263
38.02 CLL 2 157 167 263 63.5 CLL 1 7870 263 263 100 GBM 5 14 100
291 34.36 GBM 4 24 125 291 42.96 GBM 3 45 153 291 52.58 GBM 2 221
252 291 86.6 GBM 1 14142 291 291 100 KIRC 5 4 25 417 6 KIRC 4 8 41
417 9.83 KIRC 3 23 78 417 18.71 KIRC 2 291 292 417 70.02 KIRC 1
17725 417 417 100 LAML 5 11 93 196 47.45 LAML 4 12 95 196 48.47
LAML 3 16 101 196 51.53 LAML 2 27 114 196 58.16 LAML 1 1458 195 196
99.49 LUSC 5 2 14 178 7.87 LUSC 4 4 22 178 12.36 LUSC 3 15 50 178
28.09 LUSC 2 130 138 178 77.53 LUSC 1 42062 178 178 100 OV 5 10 72
316 22.78 OV 4 12 80 316 25.32 OV 3 14 86 316 27.22 OV 2 56 151 316
47.78 OV 1 12840 316 316 100 PAAD 5 53 146 146 100 PAAD 4 69 146
146 100 PAAD 3 123 146 146 100 PAAD 2 398 146 146 100 PAAD 1 23715
146 146 100 UCEC 5 30 168 248 67.74 UCEC 4 81 196 248 79.03 UCEC 3
302 217 248 87.5 UCEC 2 2797 237 248 95.56 UCEC 1 112636 248 248
100 COAD 5 3 19 70 27.14% COAD 4 7 20 70 28.57% COAD 3 11 25 70
35.71% COAD 2 84 44 70 62.86% COAD 1 16670 70 70 100.00% READ 5 0 0
39 0.00% READ 4 2 8 39 20.51% READ 3 5 16 39 41.03% READ 2 33 29 39
74.36% READ 1 12132 39 39 100.00%
[0772] Table 8 shows the specific recurrent mutations for each
cancer subtype, as well as the peptides that each mutation
generates and the flanking peptide that includes the peptides
("ACC", "BLCA", "BRCA", "CESC", "COAD", "CLL", "CRC", "DLBCL",
"GBM", "HNSC", "KICH", "KIRC", "KIRP", "LAML", "LIHC", "LUAD",
"LUSC", "MM", "OV", "PAAD", "PRAD", "READ", "SKCM", "STAD", "TGCT",
"THCA", "UCEC", and "UCS"). Frameshift muations are denoted with a
"fs". "Del" and "Ins" indicate deletions and inserts. The number of
peptides that are generated from each mutation that binds to a
specific HLA allele are shown. The recurrent mutations include
frameshift mutations and create HLA binders across many
alleles.
TABLE-US-00008 Lengthy table referenced here
US20200368337A1-20201126-T00001 Please refer to the end of the
specification for access instructions.
Example 5
[0773] Recurrent Mutations for Cancer Subtype Specific Immunogenic
Compositions.
[0774] The Cancer Genome Atlas (TCGA) contains comprehensive
large-scale genome sequencing data from tumor samples to catalogue
genetic mutations responsible for cancer. Tumor-specific
neoantigenic peptides for use in an immunogenic composition can be
selected based on a number of criteria. The first criteria is based
on gene expression. The fraction of patients (per tumor type) who
express the gene at >10 transcripts per million was determined.
Estimates assume a random assortment of HLA type vs. mutation
status of each gene vs. gene expression (per tumor type). National
yearly incidence was used to quantify the population that could be
treated with each peptide. Peptides were ranked by expected
population. The results of the analysis is shown in Table 9.
TABLE-US-00009 TABLE 9 Mutant Sequence (SEQ ID NOS 33503-33732,
Relevant Tumor Presenting respectively, Estimated Types HLAs in
order of Yearly (>500 patients (predicted Mutation appearance)
Population per year) <500 nM) RBM14 p.AAAAAAA286del VTAASTSYY
19282 Pancreatic Cancer HLA.A01.01 (uc009yrj.2) HLA.A03.01
HLA.A11.01 HLA.A26.01 HLA.A26.02 HLA.A26.03 HLA.A29.02 HLA.A68.01
HLA.A80.01 HLA.B15.01 HLA.B15.03 HLA.B15.17 HLA.B58.01 HRAS p.G12D
(uc001lpv.2) KLVVVGADGV 16466 Colorectal Cancer HLA.A02.01 KRAS
p.G12D (uc001rgp.1) Pancreatic Cancer HLA.A02.03 NRAS p.G12D
(uc009wgu.2) Uterine Corpus HLA.A02.06 Endometrial Carcinoma NRAS
p.G12V (uc009wgu.2) KLVVVGAVGV 13995 Colorectal Cancer HLA.A02.01
KRAS p.G12V (uc001rgp.1) Lung HLA.A02.03 Adenocarcinoma HLA.A02.06
Pancreatic Cancer Uterine Corpus Endonnetrial Carcinoma NRAS p.G12V
(uc009wgu.2) VVGAVGVGK 11278 Colorectal Cancer HLA.A03.01 KRAS
p.G12V (uc001rgp.1) Lung HLA.A11.01 Adenocarcinoma Pancreatic
Cancer Uterine Corpus Endonnetrial Carcinoma KRAS p.G12C
(uc001rgp.1) KLVVVGACGV 7538 Colorectal Cancer HLA.A02.01 NRAS
p.G12C (uc009wgu.2) Lung HLA.A02.03 HRAS p.G12C (uc001Ipv.2)
Adenocarcinoma HLA.A02.06 KRAS p.G12C (uc001rgp.1) VVGACGVGK 5751
Colorectal Cancer HLA.A03.01 NRAS p.G12C (uc009wgu.2) Lung
HLA.A11.01 HRAS p.G12C (uc001lpv.2) Adenocarcinoma NRAS p.G12V
(uc009wgu.2) VVVGAVGVGK 5535 Colorectal Cancer HLA.A11.01 KRAS
p.G12V (uc001rgp.1) Lung HLA.A68.01 Adenocarcinoma Pancreatic
Cancer TP53 p.R248W (uc002ginn.2) GMNWRPILTI 5006 Breast Cancer
HLA.A02.01 Colorectal Cancer HLA.A02.03 Pancreatic Cancer PIK3CA
p.E542K (uc003fjk.2) AISTRDPLSK 4852 Bladder Cancer HLA.A03.01
Breast Cancer HLA.A11.01 FRG1B p.110T (uc010ztl.1) KLSDSRTAL 4782
Prostate Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.B07.02
HLA.B15.03 GATA3 p.H435fs (uc001ijz.2) KIMFATLQR 4535 Breast Cancer
HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA.A68.01 HRAS p.G12D
(uc001lpv.2) VVGADGVGK 4530 Colorectal Cancer KRAS p.G12D
(uc001rgp.1) Pancreatic Cancer HLA.A11.01 NRAS p.G12D (uc009wgu.2)
NRAS p.Q61R (uc009wgu.2) ILDTAGREEY 4433 Melanoma HLA.A01.01 KRAS
p.Q61R (uc001rgp.1) Thyroid Cancer HRAS p.Q61R (uc001lpv.2) NRAS
p.Q61K (uc009wgu.2) ILDTAGKEEY 4203 Colorectal Cancer HLA.A01.01
HRAS p.Q61K (uc001lpv.2) Melanoma KRAS p.Q61K (uc001rgp.1) GATA3
p.H435fs (uc001ijz.2) MLTGPPARV 4113 Breast Cancer HLA.A02.01
HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.A68.02 HLA.A69.01 RBM47
p.495_502AAAAAAAA>A AAAAVIPTV 4035 Pancreatic Cancer HLA.A02.01
(uc003gvc.2) HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.A68.02 HLA.A69.01
HLA.B15.17 RBM47 p.495_502AAAAAAAA>A AAAAAVIPTV 3864 Pancreatic
Cancer HLA.A02.01 (uc003gvc.2) HLA.A02.03 HLA.A02.06 HLA.A68.02
GATA3 p.H435fs (uc001ijz.2) YMFLKAESK 3832 Breast Cancer HLA.A03.01
HLA.A11.01 HLA.A68.01 GATA3 p.H435fs (uc001ijz.2) SMLTGPPARV 3718
Breast Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06 GATA3 p.H435fs
(uc001ijz.2) YMFLKAESKI 3718 Breast Cancer HLA.A02.01 HLA.A02.03
HLA.A02.06 GATA3 p.H435fs (uc001ijz.2) TLQRSSLWCL 3621 Breast
Cancer HLA.A02.01 HLA.A02.03 AP3S1 p.K41fs (uc003krl.2) LVSEMKMFV
3603 Pancreatic Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06
HLA.A68.02 HLA.A69.01 PIK3CA p.H1047R (uc003fjk.2) FMKQMNDAR 3582
Breast Cancer HLA.A31.01 HLA.A33.01 HLA.A68.01 KRAS p.Q61L
(uc001rgp.1) LLDILDTAGL 3563 Colorectal Cancer HLA.A02.01 NRAS
p.Q61L (uc009wgu.2) Lung HLA.A02.03 HRAS p.Q61L (uc001lpv.2)
Adenocarcinoma HLA.A02.06 Melanoma GATA3 p.H435fs (uc001ijz.2)
FATLQRSSL 3551 Breast Cancer HLA.B07.02 HLA.B08.01 HLA.B39.01 AP3S1
p.K41fs (uc003krl.2) HLVSEMKMFV 3524 Pancreatic Cancer HLA.A02.01
HLA.A02.03 HLA.A02.06 HLA.A68.02 FRG1B p.L525 (uc010ztl.1)
ALSASNSCFI 3502 Prostate Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06
FRG1B p.L525 (uc010ztl.1) FQNGKMALSA 3502 Prostate Cancer
HLA.A02.01 HLA.A02.03 HLA.A02.06 RBM14 p.AAAAAAA286del AVTAASTSY
3477 Pancreatic Cancer HLA.A26.02 (uc009yrj.2) HLA.A29.02
HLA.B15.01 HLA.B15.03 HLA.B15.17 KRAS p.G12R (uc001rgp.1) VVGARGVGK
3176 Pancreatic Cancer HLA.A03.01 NRAS p.G12R (uc009wgu.2)
HLA.A11.01 PIK3CA p.E545K (uc003fjk.2) SEITKQEKDF 3090 Breast
Cancer HLA.B44.02 FRG1B p.A53T (uc010ztl.1) LLTSNSCFI 3016 Prostate
Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 FRG1B p.A53T
(uc010ztl.1) ALLTSNSCFI 2959 Prostate Cancer HLA.A02.01 HLA.A02.03
HLA.A02.06 FRG1B p.110T (uc010ztl.1) RTALKSGYGK 2787 Prostate
Cancer HLA.A03.01 HLA.A11.01 HLA.A68.01 FRG1B p.A5OP (uc010ztl.1)
FQNGKMPLL 2781 Prostate Cancer HLA.A02.01 Melanoma HLA.A02.02
HLA.A02.03 HLA.A02.06 HLA.B15.03 HLA.B39.01 PIK3CA p.H1047L
(uc003fjk.2) FMKQMNDAL 2610 Breast Cancer HLA.A02.01 HLA.A02.02
HLA.A02.03 HLA.A02.06 HLA.B08.01 HLA.B15.01 HLA.B15.03 KRAS p.Q61L
(uc001rgp.1) ILDTAGLEEY 2555 Colorectal Cancer HLA.A01.01 NRAS
p.Q61L (uc009wgu.2) Lung HRAS p.Q61L (uc001lpv.2) Adenocarcinoma
Melanoma FRG1B p.A11T (uc010ztl.1) ITLKSGYGK 2523 Prostate Cancer
HLA.A03.01 Melanoma HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA.A68.01
ANAPC1 p.T537A (uc002thi.2) VSAPKPLSK 2521 Pancreatic Cancer
HLA.A03.01 Prostate Cancer HLA.A11.01 HLA.A30.01 GATA3 p.H435fs
(uc001ijz.2) FLKAESKIM 2496 Breast Cancer HLA.A02.03 HLA.B08.01
HLA.B15.01 HLA.B15.03 FRG1B p.A5OP (uc010ztl.1) FQNGKMPLLA 2486
Prostate Cancer HLA.A02.01 Melanoma HLA.A02.03 HLA.A02.06 PIK3CA
p.H1047R (uc003fjk.2) YFMKQMNDAR 2478 Breast Cancer HLA.A33.01
HLA.A68.01 GATA3 p.5408fs (uc001ijz.2) AIQPVLWTT 2371 Breast Cancer
HLA.A02.01 HLA.A02.02 HLA.A02.06 RBM14 p.AAAAAAA286del AVTAASTSYY
2363 Pancreatic Cancer HLA.A11.01 (uc009yrj.2) FRG1B p.l10T
(uc010ztl.1) KLSDSRTALK 2356 Prostate Cancer HLA.A03.01 HLA.A11.01
FRG1B p.A11T (uc010ztl.1) KLSDSRITL 2328 Prostate Cancer HLA.A02.01
Melanoma HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.B15.03 ANAPC1 p.T537A
(uc002thi.2) GVSAPKPLSK 2260 Pancreatic Cancer HLA.A03.01 Prostate
Cancer HLA.A11.01 TP53 p.Y220C (uc002ginn.2) VVVPCEPPEV 2200 Breast
Cancer HLA.A02.01 HLA.A02.06 TP53 p.R248W (uc002ginn.2) SSCMGGMNWR
2135 Colorectal Cancer HLA.A11.01 HLA.A68.01 KRAS p.G12R
(uc001rgp.1) GARGVGKSAL 2075 Pancreatic Cancer HLA.B07.02
NRAS p.G12R (uc009wgu.2) RAC1 p.P295 (uc0035px.2) TTNAFSGEY 2042
Melanoma HLA.A01.01 HLA.A11.01 HLA.A25.01 HLA.A26.01 HLA.A26.02
HLA.A26.03 HLA.A29.02 HLA.A68.01 HLA.A80.01 HLA.B15.01 HLA.B15.03
HLA.B15.17 GATA3 p.H435fs (uc001ijz.2) GPPARVPAV 2039 Breast Cancer
HLA.B07.02 GATA3 p.H435fs (uc001ijz.2) KPKRDGYMF 2039 Breast Cancer
HLA.B07.02 GATA3 p.H435fs (uc001ijz.2) KPKRDGYMFL 2039 Breast
Cancer HLA.B07.02 KRAS p.G12A (uc001rgp.1) Colorectal Cancer
HLA.A02.01 HRAS p.G12A (uc001lpv.2) KLVVVGAAGV 2034 Lung HLA.A02.03
NRAS p.G12A (uc009wgu.2) Adenocarcinoma HLA.A02.06 SPOP p.F133L
(uc002ipg.2) FVQGKDWGL 2002 Prostate Cancer HLA.A02.01 HLA.A02.02
HLA.A02.03 HLA.A02.06 HLA.A68.02 HLA.A69.01 GATA3 p.H435fs
(uc001ijz.2) CSMLTGPPAR 1995 Breast Cancer HLA.A11.01 HLA.A33.01
HLA.A68.01 WASH3P p.G1755 (uc002cdi.2) SIRQAGGISK 1978 Prostate
Cancer HLA.A03.01 WASH2P p.G1755 (uc002tkh.2) Melanoma HLA.A11.01
ARFGAP3 p.N299fs (uc003bdd.2) EIAEVLFHI 1959 Prostate Cancer
HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.A26.02 HLA.A26.03
HLA.A68.02 HLA.A69.01 GATA3 p.5408fs (uc001ijz.2) ALQPLQPHA 1906
Breast Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 ARFGAP3 p.N299fs
(uc003bdd.2) SAWDLEIAEV 1892 Prostate Cancer HLA.A02.01 HLA.A02.06
HLA.A68.02 FRG1B p.I59V (uc010ztl.1) LLASNSCFV 1824 Prostate Cancer
HLA.A02.01 FRG1 p.I157V (uc003iz5.2) Melanoma HLA.A02.02 HLA.A02.03
HLA.A02.06 HLA.A68.02 HLA.A69.01 ARFGAP3 p.N299fs (uc003bdd.2)
KMLTQTDSA 1818 Prostate Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03
HLA.A02.06 PTH2 p.L22del (uc002pnn.1) LLLLLLLLV 1807 Prostate
Cancer HLA.A02.01 CTSA p.L37del (uc002xqh.2) HLA.A02.02 AGPAT2
p.17_18insL (uc004cii.1) HLA.A02.03 HLA.A02.06 TP53 p.R248Q
(uc002ginn.2) SSCMGGMNQR 1795 Bladder Cancer HLA.A11.01 HLA.A68.01
KRAS p.G12C (uc001rgp.1) VVVGACGVGK 1785 Colorectal Cancer
HLA.A11.01 NRAS p.G12C (uc009wgu.2) Lung HRAS p.G12C (uc0011pv.2)
Adenocarcinoma PIK3CA p.N345K (uc003fjk.2) KILCATYVK 1776 Breast
Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A31.01 FRG1B p.A11T
(uc010ztl.1) KLSDSRITLK 1749 Prostate Cancer HLA.A03.01 HLA.A11.01
FRG1B p.A11T (uc010ztl.1) RITLKSGYGK 1749 Prostate Cancer
HLA.A03.01 HLA.A11.01 GATA3 p.H435fs (uc001ijz.2) AVPFDLHFCR 1749
Breast Cancer HLA.A11.01 HLA.A68.01 PIK3CA p.E542K (uc003fjk.2)
ISTRDPLSK 1746 Breast Cancer HLA.A11.01 TP53 p.G2455 (uc002ginn.2)
SSCMGSMNR 1732 Colorectal Cancer HLA.A11.01 HLA.A31.01 HLA.A68.01
GATA3 p.H435fs (uc001ijz.2) AESKIMFATL 1731 Breast Cancer
HLA.B40.01 HLA.B44.02 AKT1 p.E17K (uc001ypk.2) WLHKRGKYIK 1717
Breast Cancer HLA.A03.01 AKT2 p.E17K (uc002onf.2) PIK3CA p.N345K
(uc003fjk.2) ILCATYVKV 1715 Breast Cancer HLA.A02.01 HLA.A02.02
HLA.A02.03 HLA.A02.06 FRG1B p.I59V (uc010ztl.1) ALLASNSCFV 1698
Prostate Cancer HLA.A02.01 FRG1 p.I157V (uc003iz5.2) Melanoma
HLA.A02.03 HLA.A02.06 FRG1B p.L525 (uc010ztl.1) SASNSCFIR 1685
Prostate Cancer HLA.A11.01 HLA.A31.01 HLA.A33.01 HLA.A68.01 PIK3CA
p.N345K (uc003fjk.2) KILCATYVKV 1679 Breast Cancer HLA.A02.01
HLA.A02.03 HLA.A02.06 AP3S1 p.K41fs (uc003krl.2) ETFHLVSEM 1635
Pancreatic Cancer HLA.A25.01 HLA.A26.01 HLA.A26.02 HLA.A26.03
HLA.A68.01 HLA.A68.02 HLA.A69.01 HLA.B15.17 PIK3CA p.N345K
(uc003fjk.2) KVNIRDIDK 1620 Breast Cancer HLA.A03.01 HLA.A11.01
HLA.A30.01 KRAS p.G12A (uc001rgp.1) VVGAAGVGK 1613 Colorectal
Cancer HLA.A03.01 HRAS p.G12A (uc001lpv.2) Lung HLA.A11.01 NRAS
p.G12A (uc009wgu.2) Adenocarcinoma CDC27 p.D555E (uc002ile.3)
TLWHLQKEV 1577 Colorectal Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03
HLA.A02.06 GATA3 p.H435fs (uc001ijz.2) ESKIM FATL 1573 Breast
Cancer HLA.A68.02 HLA.B08.01 TP53 p.P75fs (uc002ginn.2) KPTRAATVSV
1536 Colorectal Cancer HLA.B07.02 CTNNB1 p.T41A (uc010hia.1)
ATAPSLSGK 1536 Prostate Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01
HLA.A31.01 HLA.A68.01 CDC27 p.D555E (uc002ile.3) HLQKEVALSV 1530
Colorectal Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06 PIK3CA p.H1047L
(uc003fjk.2) ALHGGWTTK 1513 Breast Cancer HLA.A03.01 HLA.A11.01
HLA.A30.01 UBC p.R73L (uc002gyy.3) RLRGGMQIFV 1474 Prostate Cancer
HLA.A02.01 HLA.A02.03 HLA.A02.06 PEX1 p.1370fs (uc003uly.2)
KMRRPVCYK 1456 Prostate Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01
HLA.A31.01 TP53 p.C238Y (uc002ginn.2) TTIHYNYMY 1454 Colorectal
Cancer HLA.A01.01 HLA.A11.01 HLA.A25.01 HLA.A26.01 HLA.A26.02
HLA.A26.03 HLA.A29.02 HLA.A68.01 HLA.A80.01 HLA.B15.17 ANAPC1
p.T537A (uc002thi.2) APKPLSKLL 1449 Pancreatic Cancer HLA.B07.02
FRG 1B p.A53T (uc010ztl.1) LTSNSCFIR 1447 Prostate Cancer
HLA.A11.01 HLA.A31.01 HLA.A33.01 HLA.A68.01 RNF43 p.G659fs
(uc002iwf.2) TQLARFFPI 1442 Colorectal Cancer HLA.A02.01 Prostate
Cancer HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.A23.01 HLA.A30.01
HLA.A31.01 HLA.A69.01 HLA.B08.01 HLA.B08.03 HLA.B15.03 HLA.B38.01
HLA.B39.01 HLA.B40.01 HLA.B40.02 AP3S1 p.K41fs (uc003krl.2)
ETFHLVSEMK 1440 Pancreatic Cancer HLA.A11.01 HLA.A68.01 PIK3CA
p.H1047R (uc003fjk.2) ARHGGWTTK 1426 Breast Cancer HLA.B27.05
PIK3CA p.H1047R (uc003fjk.2) ARHGGWTTKM 1426 Breast Cancer
HLA.B27.05 GATA3 p.5408fs (uc001ijz.2) QPVLWTTPPL 1421 Breast
Cancer HLA.B07.02 FRG 1B p.A5OP (uc010ztl.1) MPLLASNSCF 1374
Prostate Cancer HLA.B07.02 WASH3P p.G1755 (uc002cdi.2) ISKAKLRSM
1337 Prostate Cancer HLA.A30.01 WASH2P p.G1755 (uc002tkh.2)
Melanoma HLA.B08.01 HLA.B15.17 HRAS p.G13R (uc001lpv.2) VVGAGRVGK
1324 Colorectal Cancer HLA.A03.01 NRAS p.G13R (uc009wgu.2)
HLA.A11.01 HLA.A30.01 ACADS p.R330H (uc001tza.3) RLLTWHAAM 1321
Prostate Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06
HLA.B08.01 HLA.B15.01 HLA.B15.03 HLA.B15.17 HRAS p.G12D
(uc001lpv.2) LVVVGADGV 1284 Pancreatic Cancer HLA.A02.06 KRAS
p.G12D (uc001rgp.1) HLA.A68.02 NRAS p.G12D (uc009wgu.2) HLA.A69.01
KRAS p.G12S (uc001rgp.1) KLVVVGASGV 1278 Colorectal Cancer
HLA.A02.01 HRAS p.G125 (uc001lpv.2) HLA.A02.03 NRAS p.G125
(uc009wgu.2) HLA.A02.06 TP53 p.A159V (uc002ginn.2) RVRVMAIYK 1271
Bladder Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA-A
p.Q78R (uc003nol.2) IEREGPEYW 1271 Prostate Cancer HLA.B44.02
HLA.B44.03
GATA3 p.H435fs (uc001ijz.2) LQRSSLWCL 1248 Breast Cancer HLA.A02.06
HLA.B15.01 HLA.B15.03 ZMIZ2 ALQEKQSQEL 1226 Pancreatic Cancer
HLA.A02.01 p.VAAAAATATATATAT153del HLA.A02.03 (uc003tlr.2) GIGYF2
p.Q1005del (uc002vtj.3) KLSGWGNVSK 1204 Pancreatic Cancer
HLA.A03.01 HLA.A11.01 FRG1B p.L525 (uc010ztl.1) LSASNSCFIR 1190
Prostate Cancer HLA.A11.01 HLA.A68.01 AKT1 p.E17K (uc001ypk.2)
WLHKRGKYI 1172 Breast Cancer HLA.A02.03 AKT2 p.E17K (uc002onf.2)
HLA.B08.01 PEX1 p.1370fs (uc003uly.2) KLGQIIMKK 1165 Prostate
Cancer HLA.A03.01 HLA.A11.01 RAC1 p.P295 (uc0035px.2) FSGEYIPTV
1152 Melanoma HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06
HLA.A68.02 HLA.A69.01 GATA3 p.H435fs (uc001ijz.2) IMKPKRDGY 1151
Breast Cancer HLA.B15.01 HLA.B15.03 AEBP1 p.K1133del (uc003tkb.2)
EEEIATGQAF 1143 Pancreatic Cancer HLA.B44.02 FBXW7 p.R465H
(uc003inn5.2) TVHCMHLHEK 1142 Colorectal Cancer HLA.A03.01
HLA.A11.01 HLA.A68.01 TSPAN4 p.L92V (uc001lsd.1) LTFFLLLLV 1140
Prostate Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06
HLA.A68.02 HLA.A69.01 HLA.B15.17 TP53 p.R158L (uc002ginn.2)
RVLAMAIYK 1136 Lung Squamous HLA.A03.01 Cell Carcinoma HLA.A11.01
HLA.A30.01 HLA.A31.01 HLA.A68.01 NRAS p.G12V (uc009wgu.2) LVVVGAVGV
1130 Pancreatic Cancer HLA.A02.03 KRAS p.G12V (uc001rgp.1)
HLA.A02.06 HLA.A68.02 HLA.A69.01 GATA3 p.5408fs (uc001ijz.2)
HMSSLSHISA 1127 Breast Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06
CTNNB1 p.537F (uc010hia.1) YLDSGIHFG 1121 Uterine Corpus HLA.A02.01
Endometrial HLA.A02.02 Carcinoma HLA.A02.06 CTNNB1 p.537F
(uc010hia.1) YLDSGIHFGA 1120 Uterine Corpus HLA.A02.01 Endometrial
HLA.A02.03 Carcinoma HLA.A02.06 CTNNB1 p.537C (uc010hia.1)
YLDSGIHCGA 1111 Uterine Corpus HLA.A02.01 Endometrial HLA.A02.03
Carcinoma HLA.A02.06 SF3B1 p.K700E (uc002uue.2) GLVDEQQEV 1099
Breast Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 KRAS
p.G12R (uc001rgp.1) VVVGARGVGK 1082 Pancreatic Cancer HLA.A11.01
NRAS p.G12R (uc009wgu.2) EGFR p.L858R (uc003tqk.2) KITDFGRAK 1054
Lung HLA.A03.01 Adenocarcinoma HLA.A11.01 HLA.A30.01 TP53 p.E271K
(uc002ginn.2) NLLGRNSFK 1046 Bladder Cancer HLA.A03.01 HLA.A11.01
HLA.A68.01 TSPAN4 p.L92V (uc001lsd.1) FLLLLVVFL 1044 Prostate
Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 TSPAN4 p.L92V
(uc001lsd.1) LLVVFLLEA 1044 Prostate Cancer HLA.A02.01 HLA.A02.02
HLA.A02.03 HLA.A02.06 TSPAN4 p.L92V (uc001lsd.1) LLLLVVFLL 1030
Prostate Cancer HLA.A02.01 HLA.A02.02 HLA.A02.06 TSPAN4 p.L92V
(uc001lsd.1) FLLLLVVFLL 1027 Prostate Cancer HLA.A02.01 HLA.A02.03
HLA.A02.06 TSPAN4 p.L92V (uc001lsd.1) LLLVVFLLEA 1027 Prostate
Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06 TSPAN4 p.L92V (uc001lsd.1)
LLTFFLLLLV 1027 Prostate Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06
ARFGAP3 p.N299fs (uc003bdd.2) LEIAEVLFHI 1024 Prostate Cancer
HLA.B40.01 HLA.B44.02 FRG 1B p.110T (uc010ztl.1) TALKSGYGK 1020
Prostate Cancer HLA.A11.01 HLA.A68.01 RBM14 p.AAAAAAA286del
ATAAAVTAA 1020 Pancreatic Cancer HLA.A02.02 (uc009yrj.2) HLA.A02.03
HLA.A02.06 HLA.A68.02 HLA.A69.01 KRAS p.G12S (uc001rgp.1) VVGASGVGK
1019 Colorectal Cancer HLA.A03.01 HRAS p.G125 (uc001lpv.2)
HLA.A11.01 NRAS p.G12S (uc009wgu.2) UBC p.L149R (uc002gyy.3)
STLHLVLRR 1014 Prostate Cancer HLA.A11.01 HLA.A31.01 HLA.A33.01
HLA.A68.01 PIK3CA p.N345K (uc003fjk.2) ATYVKVNIR 1007 Breast Cancer
HLA.A11.01 HLA.A31.01 HLA.A33.01 HLA.A68.01 ERBB3 p.V104M
(uc001sjh.2) RMVRGTQVY 990 Colorectal Cancer HLA.A03.01 HLA.A29.02
HLA.A80.01 HLA.B15.01 HLA.B15.03 HLA.B15.17 GATA3 p.H435fs
(uc001ijz.2) AESKIMFAT 984 Breast Cancer HLA.B40.01 HLA.B40.02
HLA.B45.01 FRG 1B p.L525 (uc010ztl.1) ALSASNSCF 982 Prostate Cancer
HLA.B15.01 HLA.B15.03 TP53 p.E271K (uc002ginn.2) LLGRNSFKV 978
Bladder Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 TP53
p.E271K (uc002ginn.2) NLLGRNSFKV 969 Bladder Cancer HLA.A02.01
HLA.A02.03 HLA.A02.06 FRG1B p.A11T (uc010ztl.1) TLKSGYGKY 969
Prostate Cancer HLA.A26.02 HLA.A29.02 HLA.B15.01 HLA.B15.03 NFE2L2
p.E79Q (uc002ulh.3) QLDEQTGEFL 966 Lung Squamous HLA.A02.01 Cell
Carcinoma HLA.A02.06 TP53 p.K132N (uc002ginn.2) ALNNMFCQL 955
Bladder Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06
HLA.B15.01 HLA.B15.03 MAP2K1 p.P1245 (uc010bhq.2) NSSYIVGFY 943
Melanoma HLA.A01.01 HLA.A26.01 HLA.A26.02 HLA.A29.02 HLA.A68.01
HLA.A80.01 HLA.B15.03 HLA.B15.17 TSPAN9 p.550L (uc001qlp.2)
ATFSPSFPL 937 Melanoma HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06
HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA.A68.02 HLA.A69.01 HLA.B15.03
HLA.B15.17 HLA.B58.01 SF3B1 p.K700E (uc002uue.2) QEVRTISAL 936
Breast Cancer HLA.B15.03 HLA.B39.01 HLA.B40.01 HLA.B40.02
HLA.B44.02 HLA.B44.03 ZNF91 p.R333H (uc002nre.2) FSHSSTLAK 907
Prostate Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A68.01 FNBP4
p.TT58del (uc009ylv.2) APSAATTTA 905 Prostate Cancer HLA.B07.02
FNBP4 p.TT58del (uc009ylv.2) APSAATTTAV 905 Prostate Cancer
HLA.B07.02 RAC1 p.P29S (uc0035px.2) YTTNAFSGEY 901 Melanoma
HLA.A01.01 HLA.A68.01 ACADS p.R330H (uc001tza.3) LTWHAAMLK 896
Prostate Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A31.01
HLA.A68.01 TP53 p.C242F (uc002ginn.2) SSFMGGMNR 889 Lung Squamous
HLA.A03.01 Cell Carcinoma HLA.A11.01 HLA.A31.01 HLA.A33.01
HLA.A68.01 CNPY3 p.17_18LL>L (uc0030ta.3) LLLLPAPEL 878 Prostate
Cancer HLA.A02.01 HLA.A02.02 HLA.A02.06 CNPY3 p.17_18LL>L
(uc0030ta.3) LLLLLLLLPA 876 Prostate Cancer HLA.A02.01 HLA.A02.03
HLA.A02.06 CNPY3 p.17_18LL>L (uc0030ta.3) LLLLLLLPA 876 Prostate
Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06 CNPY3 p.17_18LL>L
(uc0030ta.3) LLLLLPAPEL 876 Prostate Cancer HLA.A02.01
HLA.A02.03
HLA.A02.06 ZMIZ2 AAAAAVAAL 855 Pancreatic Cancer HLA.A02.02
p.VAAAAATATATATAT153del HLA.A02.03 (uc003tlr.2) HLA.A02.06
HLA.A68.02 HLA.B07.02 HLA.B15.03 HLA.B15.17 PODXL p.28_30PSP>P
SPSPSQNAT 852 Prostate Cancer HLA.B07.02 (uc003vqw.3) PODXL
p.28_30PSP>P SPSQNATQTT 852 Prostate Cancer HLA.B07.02
(uc003vqw.3) AP3S1 p.K41fs (uc003krl.2) HLVSEMKMF 849 Pancreatic
Cancer HLA.A26.02 HLA.B15.01 HLA.B15.03 STK19 p.D89N (uc003nyv.2)
NPIFRFSSL 849 Melanoma HLA.A26.02 HLA.B07.02 HLA.B08.01 HLA.B39.01
NUF2 p.5340L (uc001gcq.1) NLFKRLMIV 845 Colorectal Cancer
HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.B08.01 FRG1B p.A53T
(uc010ztl.1) ALLTSNSCF 833 Prostate Cancer HLA.B15.01 HLA.B15.03
UBC p.L149R (uc002gyy.3) LVLRRRGGM 829 Prostate Cancer HLA.B08.01
TP53 p.A159P (uc002ginn.2) RVRPMAIYK 820 Lung HLA.A03.01
Adenocarcinoma HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA.A68.01 FRG1B
p.K13N (uc010ztl.1) IALNSGYGK 791 Prostate Cancer HLA.A03.01
HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA.A68.01 GATA3 p.H435fs
(uc001ijz.2) VPFDLHFCR 791 Breast Cancer HLA.A33.01 HLA.A68.01 UBC
p.L149R (uc002gyy.3) STLHLVLRRR 789 Prostate Cancer HLA.A11.01
HLA.A33.01 HLA.A68.01 ACADS p.R330H (uc001tza.3) LLTWHAAML 789
Prostate Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 GATA3
p.H435fs (uc001ijz.2) ATLQRSSLW 782 Breast Cancer HLA.B15.17
HLA.B57.01 HLA.B58.01 MAP2K1 p.P1245 (uc010bhq.2) VLHECNSSYI 779
Melanoma HLA.A02.01 HLA.A02.03 HLA.A02.06 ACADS p.R330H
(uc001tza.3) RLLTWHAAML 773 Prostate Cancer HLA.A02.01 HLA.A02.03
HLA.A02.06 RXRA p.S427F (uc004cfb.2) RLPALRFIGL 771 Bladder Cancer
HLA.A02.01 RXRG p.5428F (uc001gda.2) HLA.A02.03 HLA.A02.06 ERBB3
p.V104M (uc001sjh.2) LPLPNLRMV 765 Colorectal Cancer HLA.B07.02
TSPAN9 p.550L (uc001qlp.2) LLSAANLVI 759 Melanoma HLA.A02.01
HLA.A02.02 HLA.A02.03 HLA.B15.01 HLA.B15.03 HLA.B15.17 CTNNB1
p.533F (uc010hia.1) YLDFGIHSGA 755 Uterine Corpus HLA.A02.01
Endometrial HLA.A02.03 Carcinoma HLA.A02.06 CTNNB1 p.533F
(uc010hia.1) YLDFGIHSG 754 Uterine Corpus HLA.A02.01 Endometrial
HLA.A02.02 Carcinoma HLA.A02.06 PTEN p.R130G (uc001kfb.2) GTGVM
ICAY 751 Uterine Corpus HLA.A29.02 Endometrial HLA.B15.01 Carcinoma
HLA.B15.17 RXRA p.5427F (uc004cfb.2) LPALRFIGL 748 Bladder Cancer
HLA.B07.02 RXRG p.5428F (uc001gda.2) HLA.B08.01 NOTCH2 p.P6fs
(uc001eik.2) MPALRRSAV 747 Bladder Cancer HLA.B07.02 HLA.B08.01 JMY
p.PPPPPPPPPPPP811del LPPTPPPLPV 733 Pancreatic Cancer HLA.B07.02
(uc003kfx.3) JMY p.PPPPPPPPPPPP811del SPLPPTPPPL 733 Pancreatic
Cancer HLA.B07.02 (uc003kfx.3) ACADS p.R330H (uc001tza.3)
LLTWHAAMLK 729 Prostate Cancer HLA.A03.01 HLA.A11.01 HLA.A68.01
GATA3 p.H435fs (uc001ijz.2) RSSIMKPKR 703 Breast Cancer HLA.A30.01
HLA.A31.01 OGFOD1 p.G477fs (uc002ejb.2) FLLLTLPKV 702 Pancreatic
Cancer HLA.A02.01 HLA.A02.02 HLA.A02.03 HLA.A02.06 HERC2P3 p.A803V
(uc001ytg.2) RVRDMKCLM 699 Pancreatic Cancer HLA.A30.01 HLA.B07.02
HLA.B15.17 C1QB ESGDYKATQK 697 Pancreatic Cancer HLA.A68.01
p.GPKGPMGPKGGPGAPGAP90del (uc001bgd.2) SLC38A10 p.1071_107211>1
GLNPLPDVQV 689 Pancreatic Cancer HLA.A02.01 (uc002jzz.1) HLA.A02.03
UBB p.I188fs (uc002gpx.2) IPPTSRGSSL 686 Prostate Cancer HLA.B07.02
UBC p.I191T (uc002gyy.3) UBB p.I188fs (uc002gpx.2) PPTSRGSSL 686
Prostate Cancer HLA.B07.02 UBC p.I191T (uc002gyy.3) CTNNB1 p.D32N
(uc010hia.1) YLNSGIHSGA 672 Uterine Corpus HLA.A02.01 Endometrial
HLA.A02.03 Carcinoma HLA.A02.06 FRG1B p.K13N (uc010ztl.1)
ALNSGYGKYL 670 Prostate Cancer HLA.A02.01 HLA.A02.03 NBPF14 p.R25C
(uc001eqf.2) KLCPQLAENK 667 Pancreatic Cancer HLA.A03.01 HLA.A11.01
IARS2 p.R832C (uc001hnnc.2) VIVCSFAPI 662 Melanoma HLA.A02.01
HLA.A02.02 HLA.A02.03 HLA.A02.06 HLA.A68.02 HLA.A69.01 HLA.B15.03
PIK3CA p.H1047R (uc003fjk.2) KQMNDARHG 661 Breast Cancer HLA.B15.03
CTNNB1 p.D32N (uc010hia.1) YLNSGIHSG 658 Uterine Corpus HLA.A02.01
Endometrial HLA.A02.02 Carcinoma HLA.A02.03 51K3 p.950_951QQ>Q
QEYQELFRHM 653 Pancreatic Cancer HLA.B40.01 (uc001ppy.2) HLA.B44.02
IARS2 p.R832C (uc001hnnc.2) ILDVIVCSFA 651 Melanoma HLA.A02.01
HLA.A02.03 HLA.A02.06 AP3S1 p.K41fs (uc003krl.2) RETFHLVSEM 650
Pancreatic Cancer HLA.B40.01 PPP2R1A p.P179R (uc002pyp.2)
RMVRRAAASK 649 Uterine Corpus HLA.A03.01 Endometrial HLA.A11.01
Carcinoma ZMIZ2 AAAAAAVAAL 641 Pancreatic Cancer HLA.B07.02
p.VAAAAATATATATAT153del (uc003tlr.2) HSD17B7P2 p.N1755 (uc010qex.1)
SARKSNFSL 637 Prostate Cancer HLA.A30.01 HLA.B07.02 HLA.B08.01
HLA.B15.17 ARL16 p.G6R (uc002kbf.2) RVAGRRALSR 632 Melanoma
HLA.A03.01 HLA.A11.01 HLA.A33.01 HLA.A68.01 GATA3 p.5408fs
(uc001ijz.2) TTPPLQHGHR 623 Breast Cancer HLA.A33.01 HLA.A68.01
AP3S1 p.K41fs (uc003krl.2) FHLVSEMKM 619 Pancreatic Cancer
HLA.B38.01 HLA.B39.01 PLEKHA6 p.V328fs (uc001hau.2) SIMMSWMPPL 613
Colorectal Cancer HLA.A02.01 HLA.A02.03 HLA.A02.06 HLA.A68.02
HLA.B07.02 LZTS1 KLEGLELEV 609 Pancreatic Cancer HLA.A02.01
p.RTQDLEGALRTKGLEL432del HLA.A02.02 (uc003wzr.2) HLA.A02.03
HLA.A02.06 HSD17B7P2 p.N1755 (uc010qex.1) WTSSRSARK 607 Prostate
Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A68.01 RBM14
p.AAAAAAA286del GAAATAAAV 606 Pancreatic Cancer HLA.A02.03
(uc009yrj.2) HLA.A68.02 TP53 p.R249M (uc002ginn.2) MPILTIITL 606
Lung HLA.A69.01 Adenocarcinoma HLA.B07.02 HLA.B08.01 HLA.B15.03
HLA.B39.01 HLA.B53.01 IRF2BPL p.114_115QQ>Q QLNHVDGSSK 605
Prostate Cancer HLA.A03.01 (uc001xsy.2) HLA.A11.01 POLI p.D17del
(uc002lfj.3) EEDAEAWAM 599 Prostate Cancer HLA.B40.01 HLA.B44.02
HLA.B44.03 ZNF780A p.Q600H (uc010xvh.1) HMHLIRHQK 594 Prostate
Cancer HLA.A03.01 HLA.A11.01 HLA.A30.01 HLA.A31.01 HLA.A33.01
HLA.A68.01 FRG1B p.110T (ucO1Oztl.1) LSDSRTALK 589 Prostate Cancer
HLA.A11.01 PARG p.A584T (uc001jih.2) EETEAQHLY 585 Prostate Cancer
HLA.B44.02 HLA.B44.03 GATA3 p.5408fs (uc001ijz.2) SSLSHISAL 573
Breast Cancer HLA.A02.06 HLA.B08.01 HLA.B15.03 HLA.B15.17
HLA.B39.01 EGFR p.L858R (uc003tqk.2) FGRAKLLGA 564 Lung HLA.B08.01
Adenocarcinoma TP53 p.R249M (uc002ginn.2) RMPILTIITL 563 Lung
HLA.A02.01 Adenocarcinoma HLA.A02.03
HLA.A02.06 PARG p.A584T (uc001jih.2) TEAQHLYQSI 557 Prostate Cancer
HLA.B40.01 HLA.B44.02 CDC27 p.D555E (uc002ile.3) EVALSVLSK 557
Colorectal Cancer HLA.A11.01 HLA.A68.01 GATA3 p.H435fs (uc001ijz.2)
MFLKAESKI 554 Breast Cancer HLA.A23.01 FRG 1B p.K13N (uc010ztl.1)
RIALNSGYGK 546 Prostate Cancer HLA.A03.01 HLA.A11.01 CTNNB1 p.G34R
(uc010hia.1) YLDSRIHSGA 530 Uterine Corpus HLA.A02.01 Endometrial
HLA.A02.03 Carcinoma HLA.A02.06 FRG1B p.L525 (uc010ztl.1) LSASNSCFI
528 Prostate Cancer HLA.A68.02 HLA.B15.17 HLA.B58.01 AXIN2 p.W663fs
(uc002jfi.2) TPAPPPVPT 520 Colorectal Cancer HLA.B07.02 AXIN2
p.W663fs (uc002jfi.2) VPTCSPRTL 520 Colorectal Cancer HLA.B07.02
FCGBP p.A2493V (uc0020nnp.3) RPGLHRFVV 504 Pancreatic Cancer
HLA.B07.02 HLA.B08.01
Example 6
[0775] Therapeutic Targeting of Recurrent Mutations Expressed in
Genes Containing Extracellular Domains.
[0776] Tumor-specific mutations present in greater than 1% of a
population of cancer patients may be targeted with a drug or
therapy that recognizes the tumor-specific neoepitope resulting
from the mutation. The mutation is preferably within an
extracellular domain. The drug or therapy is an antibody, antibody
fragment, antibody drug conjugate, aptamer, CAR, or T cell
receptor. The antibody or fragment thereof may be humanized, fully
humanized, or chimeric. The antibody fragment may be a nanobody,
Fab, Fab', (Fab')2, Fv, ScFv, diabody, triabody, tetrabody,
Bis-scFv, minibody, Fab2, or Fab3 fragment.
[0777] A recurrent mutation that may be targeted is FGFR3:p.S249C.
Fibroblast growth factor receptor 3 (FGFR3) is a protein that in
humans is encoded by the FGFR3 gene. FGFR3 has also been designated
as CD333 (cluster of differentiation 333). The full-length protein
includes an extracellular region, composed of three
immunoglobulin-like domains, a single hydrophobic membrane-spanning
segment and a cytoplasmic tyrosine kinase domain. The mutation
occurs in the extracellular domain of the protein. The mutation is
present in 6.92% of bladder cancer (BLCA) patients analyzed and
1.12% of lung squamous cell carcinoma (LUSC) patients analyzed.
[0778] Another recurrent mutation that may be targeted is
ERBB3:p.V104M. Receptor tyrosine-protein kinase erbB-3, also known
as HER3 (human epidermal growth factor receptor 3), is a membrane
bound protein that in humans is encoded by the ERBB3 gene. ErbB3 is
a member of the epidermal growth factor receptor (EGFR/ERBB) family
of receptor tyrosine kinases. The mutation is present in 1.72% of
colorectal cancer (CRC), 2.86% of colon adenocarcinoma (COAD),
2.42% of stomach adenocarcinoma (STAD), and 2.06% of cervical
squamous cell carcinoma and endocervical adenocarcinoma (CESC)
patients analyzed.
[0779] Another recurrent mutation that may be targeted is
EGFR:p.L858R. The epidermal growth factor receptor (EGFR; ErbB-1;
HER1 in humans) is the cell-surface receptor for members of the
epidermal growth factor family (EGF-family) of extracellular
protein ligands. The mutation is present in 3.24% of lung
adenocarcinoma (LUAD) patients analyzed.
[0780] Another recurrent mutation that may be targeted is
MUC4:p.H4205Q. Mucin 4 (MUC 4) is a mucin protein that in humans is
encoded by the MUC4 gene. This gene encodes an integral membrane
glycoprotein found on the cell surface, although secreted isoforms
may exist. The mutation is present in 2.3% of prostate
adenocarcinoma (PRAD), 2.31% of bladder urothelial carcinoma
(BLCA), and 7.14% of uterine carcinosarcoma (UCS) patients
analyzed.
[0781] Another recurrent mutation that may be targeted is
PDGFRA:p.R483fs. Platelet-derived growth factor receptor, alpha
polypeptide is a protein that in humans is encoded by the PDGFRA
gene. This gene encodes a cell surface tyrosine kinase receptor for
members of the platelet-derived growth factor family. The mutation
is present in 1.92% of prostate adenocarcinoma (PRAD) patients
analyzed.
[0782] Another recurrent mutation that may be targeted is TMEM52
23_26LLPL>L. Transmembrane protein 52 is encoded by the TMEM52
gene. The mutation is present in 1.53% of prostate adenocarcinoma
(PRAD) patients analyzed.
[0783] Another recurrent mutation that may be targeted is PODXL
28_30PSP>P. Podocalyxin-like protein 1 is a protein that in
humans is encoded by the PODXL gene. The mutation is present in
1.53% of prostate adenocarcinoma (PRAD), 15.56% of adrenocortical
carcinoma (ACC), and 3.57% of uterine carcinosarcoma (UCS) patients
analyzed.
[0784] Having thus described in detail preferred embodiments of the
present invention, it is to be understood that the invention
defined by the above paragraphs is not to be limited to particular
details set forth in the above description as many apparent
variations thereof are possible without departing from the spirit
or scope of the present invention.
TABLE-US-LTS-00001 LENGTHY TABLES The patent application contains a
lengthy table section. A copy of the table is available in
electronic form from the USPTO web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20200368337A1).
An electronic copy of the table will also be available from the
USPTO upon request and payment of the fee set forth in 37 CFR
1.19(b)(3).
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20200368337A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20200368337A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References