U.S. patent application number 16/897001 was filed with the patent office on 2020-09-24 for monoclonal antibodies and cocktails for treatment of ebola infections.
The applicant listed for this patent is Adimab, LLC, Albert Einstein College of Medicine, Inc., MAPP BIOPHARMACEUTICAL, INC.. Invention is credited to Zachary A. Bornholdt, Kartik Chandran, Laura Walker, Anna Wec, Larry Zeitlin.
Application Number | 20200299361 16/897001 |
Document ID | / |
Family ID | 1000004872322 |
Filed Date | 2020-09-24 |
View All Diagrams
United States Patent
Application |
20200299361 |
Kind Code |
A1 |
Bornholdt; Zachary A. ; et
al. |
September 24, 2020 |
MONOCLONAL ANTIBODIES AND COCKTAILS FOR TREATMENT OF EBOLA
INFECTIONS
Abstract
Described herein are compositions and methods for the prevention
and treatment of ebolavirus infection. In certain embodiments of
the present invention, monoclonal antibodies substantially similar
to those described herein, as well as affinity matured variants
thereof, alone or in combination, provide therapeutic efficacy in a
patient against multiple species of ebolavirus.
Inventors: |
Bornholdt; Zachary A.;
(Encinitas, CA) ; Zeitlin; Larry; (San Diego,
CA) ; Chandran; Kartik; (Brooklyn, NY) ; Wec;
Anna; (Lebanon, NH) ; Walker; Laura; (Norwich,
VT) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
MAPP BIOPHARMACEUTICAL, INC.
Albert Einstein College of Medicine, Inc.
Adimab, LLC |
San Diego
Bronx
Lebanon |
CA
NY
NH |
US
US
US |
|
|
Family ID: |
1000004872322 |
Appl. No.: |
16/897001 |
Filed: |
June 9, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15898524 |
Feb 17, 2018 |
|
|
|
16897001 |
|
|
|
|
62460200 |
Feb 17, 2017 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/62 20130101;
A61K 2039/55 20130101; A61P 31/14 20180101; A61K 39/42 20130101;
A61K 2039/545 20130101; A61K 2039/6075 20130101; C07K 2317/76
20130101; A61K 2039/505 20130101; A61K 2039/57 20130101; C07K 16/10
20130101 |
International
Class: |
C07K 16/10 20060101
C07K016/10; A61P 31/14 20060101 A61P031/14 |
Goverment Interests
STATEMENT REGARDING FEDERALLY FUNDED RESEARCH
[0002] This invention was made with government support under U19
AI109762 awarded by NIH and HDTRA-13-C-0018 awarded by DTRA. The
government has certain rights in the invention.
Claims
1. A composition for the treatment of Ebola, the composition
comprising: a therapeutically effective combination of i. a first
monoclonal antibody or antigen binding fragment thereof comprising
a heavy chain variable region comprising an amino acid sequence at
least 90% identical to SEQ ID NO: 11, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 13, and affinity
matured variants thereof, wherein said first monoclonal antibody or
antigen binding fragment thereof has a heavy chain CDR1 comprising
SEQ ID NO: 71, a heavy chain CDR2 comprising SEQ ID NO: 72, a heavy
chain CDR3 comprising SEQ ID NO: 73, a light chain CDR1 comprising
SEQ ID NO: 74, a light chain CDR2 comprising SEQ ID NO: 75, and a
light chain CDR3 comprising SEQ ID NO: 76 and amino acid sequences
90% identical thereto, and wherein the antigen to which the antigen
binding fragment binds comprises Ebola glycoprotein; and ii. a
pharmaceutically acceptable excipient or carrier.
2. The composition of claim 1, wherein said first monoclonal
antibody or antigen binding fragment thereof binds at least two
species of Filovirus glycoprotein.
3. The composition of claim 1, wherein the first monoclonal
antibody or antigen binding fragment that binds to the Ebola
glycoprotein antigen thereof comprises predominantly a single
glycoform.
4. The composition of claim 3, wherein the predominantly single
glycoform is one of GnGn, G1/G2, and NaNa.
5. The composition of claim 3, wherein the predominantly single
glycoform substantially lacks at least one of fucose and
xylose.
6. The composition of claim 2 further comprising a second
monoclonal antibody or antigen binding fragment thereof, wherein
said second monoclonal antibody or antigen binding fragment thereof
binds Ebola glycoprotein.
7. A composition for the treatment of Ebola, the composition
comprising: a therapeutically effective combination of i. a first
monoclonal antibody or antigen binding fragment thereof comprising
a heavy chain variable region comprising an amino acid sequence at
least 90% identical to SEQ ID NO: 11, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 13, and affinity
matured variants thereof, wherein said first monoclonal antibody or
antigen binding fragment thereof binds at least two species of
Filovirus, and wherein the antigen to which the antigen binding
fragment binds comprises Ebola glycoprotein; and ii. a
pharmaceutically acceptable excipient or carrier.
8. The composition of claim 7, wherein said first monoclonal
antibody or antigen binding fragment thereof has a heavy chain CDR1
comprising SEQ ID NO: 71, a heavy chain CDR2 comprising SEQ ID NO:
72, a heavy chain CDR3 comprising SEQ ID NO: 73, a light chain CDR1
comprising SEQ ID NO: 74, a light chain CDR2 comprising SEQ ID NO:
75, and a light chain CDR3 comprising SEQ ID NO: 76 and amino acid
sequences 90% identical thereto.
9. The composition of claim 7, wherein the first monoclonal
antibody or antigen binding fragment that binds to the Ebola
glycoprotein antigen thereof comprises predominantly a single
glycoform.
10. The composition of claim 9, wherein the predominantly single
glycoform is one of GnGn, G1/G2, and NaNa.
11. The composition of claim 9, wherein the predominantly single
glycoform substantially lacks at least one of fucose and
xylose.
12. The composition of claim 7 further comprising a second
monoclonal antibody or antigen binding fragment thereof, wherein
said second monoclonal antibody or antigen binding fragment thereof
binds the Ebola glycoprotein.
13. A monoclonal antibody or antigen binding fragment thereof
effective to treat Ebola comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ ID
NO: 11, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 13, and affinity matured variants thereof,
wherein said first monoclonal antibody or antigen binding fragment
thereof comprises predominantly a single glycoform that binds at
least two species of Filovirus, and wherein the antigen to which
the antigen binding fragment binds comprises Ebola
glycoprotein.
14. The monoclonal antibody or antigen binding fragment thereof of
claim 13, wherein said first monoclonal antibody or antigen binding
fragment thereof has a heavy chain CDR1 comprising SEQ ID NO: 71, a
heavy chain CDR2 comprising SEQ ID NO: 72, a heavy chain CDR3
comprising SEQ ID NO: 73, a light chain CDR1 comprising SEQ ID NO:
74, a light chain CDR2 comprising SEQ ID NO: 75, and a light chain
CDR3 comprising SEQ ID NO: 76 and amino acid sequences 90%
identical thereto.
15. The monoclonal antibody or antigen binding fragment thereof of
claim 13, wherein the predominantly single glycoform is one of
GnGn, G1/G2, and NaNa.
16. The monoclonal antibody or antigen binding fragment thereof of
claim 13, wherein the predominantly single glycoform substantially
lacks at least one of fucose and xylose.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 15/898,524, filed Feb. 17, 2018, which claims
the benefit of U.S. Provisional Patent Application No. 62/460,200,
filed Feb. 17, 2017, each of which is incorporated by reference
herein in their entirety.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference. Said ASCII copy, created on May 20,
2020, is named 1123-2007-ST25 and is 34,674 bytes in size.
BACKGROUND
[0004] Ebolaviruses are members of the family Filoviridae which
infect humans and non-human primates (NHPs) causing hemorrhagic
fever with mortality rates up to 90%. Ebolaviruses include Ebola
virus (EBOV), Sudan virus (SUDV), Bundibugyo virus (BDBV), Reston
virus (RESTV), and Tai Forest virus (TAFV), which are causative
agents of the hemorrhagic fever [1, 2]. A summary of the
ebolaviruses can be found in Burk, et. al., Neglected Filoviruses.
FEMS Microbiology Reviews, 40, 494-519 (May, 2016), and the
differences between the viruses have been well characterized and
well known in the art. Between 1967 and 2013, 31 filovirus disease
outbreaks have occurred, mainly in central Africa with around 2,000
confirmed cases. Of these 31 outbreaks, 16 were caused by EBOV. The
unprecedented 2013-2016 Ebola virus disease epidemic led to more
than 27,000 cases and 11,100 deaths in the first 14 months. There
are currently no approved treatments or vaccines for filoviruses,
and most advanced experimental treatments focus only on EBOV. Given
that other filoviruses have caused sizeable outbreaks broadly
protective treatment options are urgently needed.
[0005] Several studies have shown that filovirus glycoprotein
(GP)-specific neutralizing antibodies (nAbs) can reduce mortality
following experimental inoculation of animals with a lethal dose of
EBOV [3-9]. The primary target of these neutralizing antibodies,
the filovirus surface GP, is a trimer composed of three heavily
glycosylated GP1-GP2 heterodimers. The GP1 subunit can be divided
further into base, head, glycan cap and mucin-like domains [10].
During viral entry, the mucin-like domain and glycan cap mediate
binding to multiple host attachment factors present on the cell
membrane. After the virus enters the host cell by macropinocytosis
[11, 12] the GP is cleaved by host proteases that remove
approximately 80% of the mass of the GP1 subunit, including the
mucin-like domain and glycan cap [13, 14]. After cleavage of GP in
the endosome, the receptor binding sites on GP become exposed, and
the GP1 head then is able to bind its receptor, the Niemann-Pick C1
(NPC1) protein [13, 15, 16]. Subsequent conformational changes in
GP facilitate fusion between viral and endosomal membranes.
Recognition of NPC1 by a cleaved GP species (hereafter, GP.sub.CL),
together with one or more unknown host signals, is proposed to
trigger GP refolding and the membrane fusion reaction that is
coupled to it. Endosomal GP.fwdarw.GP.sub.CL cleavage is a
prerequisite for GP-NPC1 binding and therefore essential for
filovirus entry.
[0006] The dense clustering of glycans on the glycan cap and
mucin-like domain likely shield much of the surface of EBOV GP from
humoral immune surveillance, leaving only a few sites on the EBOV
GP protein where nAbs could bind without interference by glycans
[17]. Most of our knowledge about humoral response against
filovirus infections has come from studies of murine Abs that
recognize EBOV GP. From those studies, it has become clear that
mouse neutralizing Abs preferentially target peptides exposed in
upper, heavily glycosylated domains or lower areas (the GP1 base)
where rearrangements occur that drive fusion of viral and host
membranes [18]. Abs have not been identified that target protein
features of the membrane proximal external region (MPER) subdomain,
which likely rearranges during fusion. KZ52, the first reported
human EBOV GP-specific monoclonal antibody (mAb), was obtained from
a phage display library that was constructed from bone marrow RNA
obtained from a survivor [19]. KZ52 binds a site at the base of the
GP and neutralizes EBOV, most likely by blocking GP-GP.sub.CL
cleavage and/or inhibiting the conformational changes required for
fusion of viral and endosomal membranes [10]. Some murine Abs also
have been reported to bind to the base region of Ebola virus GPs
[20, 21].
[0007] The most divergent ebolavirus species (EBOV and SUDV)
exhibit 56% GP sequence identity. The sequence identity between
filovirus GPs is highest within the receptor binding region (RBR)
[23] and GP2, suggesting that shared epitopes may exist within
these domains. Several mAbs against EBOV GP with protective
efficacy in rodents and non-human primates (NHPs) have been
reported [3, 5-9, 24, 25]. Neutralizing antibodies have also been
described for SUDV with efficacy in a recently developed rodent
model [20, 26]. However, these antibodies bind the same epitope as
KZ52, and like KZ52 are viral species-specific and lack
cross-neutralizing or cross-protective properties.
SUMMARY OF THE INVENTION
[0008] Described herein are a number of mAbs that are capable of
neutralizing Ebola viruses both in vitro and in vivo. Surprisingly,
the disclosed human antibodies possess pan-ebolavirus
cross-reactivity and cross-neutralizing activity, and are thus
capable of binding and neutralizing all known species of the Ebola
virus.
[0009] According to a first aspect of the present invention, there
are provided novel monoclonal antibodies capable of binding to and
neutralizing an Ebola virus in a patient. In certain embodiments of
the present invention, said monoclonal antibodies bind to GP
proteins from ebolaviruses belonging to at least two different
species, thereby neutralizing the infectivity of viral particles or
targeting infected cells for destruction.
[0010] According to a second aspect of the invention, there is
provided monoclonal antibodies comprising the following heavy and
light chain CDR3 amino acid sequences:
[0011] mAb PE-87-heavy CDR3: SEQ ID No. 1; mAb PE-87-light CDR3:
SEQ ID No. 2
[0012] mAb PE-24-heavy CDR3: SEQ ID No. 3; mAb PE-24-light CDR3:
SEQ ID No. 4
[0013] mAb PE-47-heavy CDR3: SEQ ID No. 5; mAb PE-47 light CDR3:
SEQ ID No. 6
[0014] mAb PE-16-heavy CDR3: SEQ ID No. 7; mAb PE-16-light CDR3:
SEQ ID No. 8
[0015] mAb PE-05-heavy CDR3: SEQ ID No. 9; mAb PE-05-light CDR3:
SEQ ID No. 10
[0016] In one embodiment, the critical residues in PE-87 and PE-24
heavy chain CDR3 are D95, W99, and Y100C (Kabat numbering).
[0017] In another embodiment of the invention, an antibody isolated
as described in Methods (below) from the peripheral B cells of a
survivor of a filovirus infection, is modified so that the VH and
VL region nucleotide sequences encode modified V region amino acids
that confer enhanced binding capabilities to the mAb. There is
provided a method of preparing a recombinant antibody comprising:
providing a nucleotide sequence selected from the group consisting
of
[0018] PE-24, PE-87, PE-47, PE-16, PE-64 and PE-05 VH and VL
nucleotides;
[0019] modifying said nucleic acid sequence such that at least one
but fewer than about 30 of the amino acid residues encoded by said
nucleic acid sequence has been changed or deleted without
disrupting antigen binding of said peptide; and expressing and
recovering said modified nucleotide sequence.
[0020] In yet other embodiments, immunoreactive fragments of any of
the herein described monoclonal antibodies are prepared using means
known in the art, for example, by preparing nested deletions using
enzymatic degradation or convenient restriction enzymes.
[0021] It is another aspect of the present invention to provide
modified variants of the disclosed mAb sequences, wherein the
sequences have been affinity matured or otherwise mutated to
increase the therapeutic effectiveness of the mAb.
[0022] Thus, it is one embodiment of the present invention to
provide a composition for the treatment of Ebola, the composition
comprising: a therapeutically effective combination of a first
monoclonal antibody or antigen binding fragment comprising a heavy
chain variable region comprising an amino acid sequence at least
90% identical to SEQ. ID NO: 12, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 14, and affinity
matured variants thereof; and a pharmaceutically acceptable
excipient or carrier.
[0023] It is another embodiment of the present invention to provide
such a composition, wherein said first monoclonal antibody is binds
at least two species of the Flivovirus glycoprotein.
[0024] It is yet another embodiment of the present invention to
provide such a composition, wherein the first monoclonal antibody
or antigen binding fragment comprises predominantly a single
glycoform.
[0025] It is still another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform is one of GnGn, G1/G2, and NaNa.
[0026] It is yet another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform substantially lacks at least one of fucose and
xylose.
[0027] It is second embodiment of the present invention to provide
a composition for the treatment of Ebola, the composition
comprising: a therapeutically effective combination of a first
monoclonal antibody or antigen binding fragment selected from a
list consisting of: [0028] a. a monoclonal antibody or antigen
binding fragment comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ. ID
NO: 15, and affinity matured variants thereof, and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 18, and affinity matured variants thereof;
[0029] b. a monoclonal antibody or antigen binding fragment
comprising a heavy chain variable region comprising an amino acid
sequence at least 90% identical to SEQ. ID NO: 21, and affinity
matured variants thereof; and a light chain variable region
comprising an amino acid sequence at least 90% identical to SEQ ID
NO: 23, and affinity matured variants thereof; [0030] c. a
monoclonal antibody or antigen binding fragment comprising a heavy
chain variable region comprising an amino acid sequence at least
90% identical to SEQ. ID NO: 29, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 900 identical to SEQ ID NO: 31, and affinity
matured variants thereof; [0031] d. a monoclonal antibody or
antigen binding fragment comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ. ID
NO: 33, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 900
identical to SEQ ID NO: 35, and affinity matured variants thereof;
[0032] e. a monoclonal antibody or antigen binding fragment
comprising a heavy chain variable region comprising an amino acid
sequence at least 90% identical to SEQ. ID NO: 11, and affinity
matured variants thereof; and a light chain variable region
comprising an amino acid sequence at least 900/o identical to SEQ
ID NO: 13, and affinity matured variants thereof; and a
pharmaceutically acceptable excipient or carrier; wherein said
first monoclonal antibody or antigen binding fragment binds at
least two species of the Flivovirus glycoprotein.
[0033] It is another embodiment of the present invention to provide
such a composition, wherein the first monoclonal antibody or
antigen binding fragment comprises predominantly a single
glycoform.
[0034] It is yet another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform is one of GnGn, G1/G2, and NaNa.
[0035] It is still another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform substantially lacks at least one of fucose and
xylose.
[0036] It is third embodiment of the present invention to provide a
composition for the treatment of Ebola, the composition comprising:
a therapeutically effective combination of a first monoclonal
antibody or antigen binding fragment is selected from a list
consisting of: [0037] a. a monoclonal antibody or antigen binding
fragment comprising a heavy chain variable region comprising an
amino acid sequence at least 90% identical to SEQ. ID NO: 12, and
affinity matured variants thereof; and a light chain variable
region comprising an amino acid sequence at least 90% identical to
SEQ ID NO: 14, and affinity matured variants thereof; [0038] b. a
monoclonal antibody or antigen binding fragment comprising a heavy
chain variable region comprising an amino acid sequence at least
90% identical to SEQ. ID NO: 15, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 18, and affinity
matured variants thereof; [0039] c. a monoclonal antibody or
antigen binding fragment comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ. ID
NO: 21, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 23, and affinity matured variants thereof;
[0040] d. a monoclonal antibody or antigen binding fragment
comprising a heavy chain variable region comprising an amino acid
sequence at least 90% identical to SEQ. ID NO: 29, and affinity
matured variants thereof; and a light chain variable region
comprising an amino acid sequence at least 90% identical to SEQ ID
NO: 31, and affinity matured variants thereof; [0041] e. a
monoclonal antibody or antigen binding fragment comprising a heavy
chain variable region comprising an amino acid sequence at least
90% identical to SEQ. ID NO: 33, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 35, and affinity
matured variants thereof; [0042] f. a monoclonal antibody or
antigen binding fragment comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ. ID
NO: 11, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 13, and affinity matured variants thereof;
a second monoclonal antibody or antigen binding fragment, wherein
said second monoclonal antibody or antigen binding fragment binds
the Ebola glycoprotein; and a pharmaceutically acceptable excipient
or carrier.
[0043] It is another embodiment of the present invention to provide
such a composition, wherein at least one of the first monoclonal
antibody or antigen binding fragment and the second antibody or
antigen binding fragment comprises predominantly a single
glycoform.
[0044] It is yet another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform is one of GnGn, G1/G2, and NaNa.
[0045] It is still another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform substantially lacks at least one of fucose and
xylose.
[0046] It is yet another embodiment of the present invention to
provide such a composition, wherein said therapeutically effective
combination further comprises a third monoclonal antibody or
antigen binding fragment that binds to the Ebola glycoprotein.
[0047] It is still another embodiment of the present invention to
provide such a composition, wherein said first monoclonal antibody
or antigen binding fragment comprises a heavy chain variable region
comprising an amino acid sequence at least 90%, identical to SEQ.
ID NO: 12, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 14, and affinity matured variants thereof;
and wherein said second monoclonal antibody or antigen binding
fragment comprises a heavy chain variable region comprising an
amino acid sequence at least 90% identical to SEQ. ID NO: 15, and
affinity matured variants thereof; and a light chain variable
region comprising an amino acid sequence at least 90% identical to
SEQ ID NO: 18, and affinity matured variants thereof.
[0048] It is yet another embodiment of the present invention to
provide such a composition wherein said therapeutically effective
combination further comprises a third monoclonal antibody or
antigen binding fragment, wherein said third antibody or antigen
binding fragment comprises a heavy chain variable region comprising
an amino acid sequence at least 90% identical to SEQ. ID NO: 21,
and affinity matured variants thereof; and a light chain variable
region comprising an amino acid sequence at least 90% identical to
SEQ ID NO: 23, and affinity matured variants thereof.
[0049] It is fourth embodiment of the present invention to provide
a method for treating at least one species of flivovirus infection
in a patient, the method comprising: identifying a patient in need
of treatment; and administering to the patient a therapeutically
effective amount of a composition comprising a combination of: a
first monoclonal antibody or antigen binding fragment, wherein said
first monoclonal antibody or antigen binding fragment is selected
from a list consisting of: [0050] i. a monoclonal antibody or
antigen binding fragment comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ. ID
NO: 12, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 14, and affinity matured variants thereof;
[0051] ii. a monoclonal antibody or antigen binding fragment
comprising a heavy chain variable region comprising an amino acid
sequence at least 90% identical to SEQ. ID NO: 15, and affinity
matured variants thereof; and a light chain variable region
comprising an amino acid sequence at least 90% identical to SEQ ID
NO: 18, and affinity matured variants thereof; [0052] iii. a
monoclonal antibody or antigen binding fragment comprising a heavy
chain variable region comprising an amino acid sequence at least
90% identical to SEQ. ID NO: 21, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 23, and affinity
matured variants thereof; [0053] iv. a monoclonal antibody or
antigen binding fragment comprising a heavy chain variable region
comprising an amino acid sequence at least 90% identical to SEQ. ID
NO: 29, and affinity matured variants thereof; and a light chain
variable region comprising an amino acid sequence at least 90%
identical to SEQ ID NO: 31, and affinity matured variants thereof;
[0054] v. a monoclonal antibody or antigen binding fragment
comprising a heavy chain variable region comprising an amino acid
sequence at least 90% identical to SEQ. ID NO: 33, and affinity
matured variants thereof; and a light chain variable region
comprising an amino acid sequence at least 90% identical to SEQ ID
NO: 35, and affinity matured variants thereof; [0055] vi. a
monoclonal antibody or antigen binding fragment comprising a heavy
chain variable region comprising an amino acid sequence at least
90% identical to SEQ. ID NO: 11, and affinity matured variants
thereof; and a light chain variable region comprising an amino acid
sequence at least 90% identical to SEQ ID NO: 13, and affinity
matured variants thereof; and a pharmaceutically acceptable
excipient or carrier.
[0056] It is another embodiment of the present invention to provide
such a method, wherein the patient is a mammal.
[0057] It is yet another embodiment of the present invention to
provide such a method, wherein the first monoclonal antibody or
antigen binding fragment comprises predominantly a single
glycoform.
[0058] It is still another embodiment of the present invention to
provide such a method, wherein the predominantly single glycoform
substantially lacks at least one of fucose and xylose.
[0059] It is fifth embodiment of the present invention to provide a
composition for the treatment of Ebola, the composition comprising:
a therapeutically effective combination of a first monoclonal
antibody or antigen binding fragment is selected from a list
consisting of: [0060] a. a monoclonal antibody or antigen binding
fragment comprising a heavy chain variable region at least 90%
identical to a heavy chain variable region comprising a CDR1
comprising the amino acid sequence as set forth in SEQ. ID NO: 53,
a CDR2 comprising the amino acid sequence as set forth in SEQ. ID
NO: 54, and a CDR3 comprising the amino acid sequence as set forth
in SEQ. ID NO: 55, and affinity matured variants thereof, and a
light chain variable region at least 90% identical to a light chain
variable region comprising a CDR1 comprising the amino acid
sequence as set forth in SEQ. ID NO: 56, a CDR2 comprising the
amino acid sequence as set forth in SEQ. ID NO: 57, and a CDR3
comprising the amino acid sequence as set forth in SEQ. ID NO: 58,
and affinity matured variants thereof; [0061] b. a monoclonal
antibody or antigen binding fragment comprising a heavy chain
variable region at least 90% identical to a heavy chain variable
region comprising a CDR1 comprising the amino acid sequence as set
forth in SEQ. ID NO: 41, a CDR2 comprising the amino acid sequence
as set forth in SEQ. ID NO: 42, and a CDR3 comprising the amino
acid sequence as set forth in SEQ. ID NO: 43, and affinity matured
variants thereof; and a light chain variable region at least 90%
identical to a light chain variable region comprising a CDR1
comprising the amino acid sequence as set forth in SEQ. ID NO: 44,
a CDR2 comprising the amino acid sequence as set forth in SEQ. ID
NO: 45, and a CDR3 comprising the amino acid sequence as set forth
in SEQ. ID NO: 46, and affinity matured variants thereof; [0062] c.
a monoclonal antibody or antigen binding fragment comprising a
heavy chain variable region at least 90% identical to a heavy chain
variable region comprising a CDR1 comprising the amino acid
sequence as set forth in SEQ. ID NO: 47, a CDR2 comprising the
amino acid sequence as set forth in SEQ. ID NO: 48, and a CDR3
comprising the amino acid sequence as set forth in SEQ. ID NO: 49,
and affinity matured variants thereof; and a light chain variable
region at least 90% identical to a light chain variable region
comprising a CDR1 comprising the amino acid sequence as set forth
in SEQ. ID NO: 50, a CDR2 comprising the amino acid sequence as set
forth in SEQ. ID NO: 51, and a CDR3 comprising the amino acid
sequence as set forth in SEQ. ID NO: 52, and affinity matured
variants thereof; [0063] d. a monoclonal antibody or antigen
binding fragment comprising a heavy chain variable region at least
90% identical to a heavy chain variable region comprising a CDR1
comprising the amino acid sequence as set forth in SEQ. ID NO: 59,
a CDR2 comprising the amino acid sequence as set forth in SEQ. ID
NO: 60, and a CDR3 comprising the amino acid sequence as set forth
in SEQ. ID NO: 61, and affinity matured variants thereof; and a
light chain variable region at least 90% identical to a light chain
variable region comprising a CDR1 comprising the amino acid
sequence as set forth in SEQ. ID NO: 62, a CDR2 comprising the
amino acid sequence as set forth in SEQ. ID NO: 63, and a CDR3
comprising the amino acid sequence as set forth in SEQ. ID NO: 64,
and affinity matured variants thereof; [0064] e. a monoclonal
antibody or antigen binding fragment comprising a heavy chain
variable region at least 90% identical to a heavy chain variable
region comprising a CDR1 comprising the amino acid sequence as set
forth in SEQ. ID NO: 65, a CDR2 comprising the amino acid sequence
as set forth in SEQ. ID NO: 66, and a CDR3 comprising the amino
acid sequence as set forth in SEQ. ID NO: 67, and affinity matured
variants thereof, and a light chain variable region at least 90%
identical to a light chain variable region comprising a CDR1
comprising the amino acid sequence as set forth in SEQ. ID NO: 68,
a CDR2 comprising the amino acid sequence as set forth in SEQ. ID
NO: 69, and a CDR3 comprising the amino acid sequence as set forth
in SEQ. ID NO: 70, and affinity matured variants thereof; [0065] f.
a monoclonal antibody or antigen binding fragment comprising a
heavy chain variable region at least 90% identical to a heavy chain
variable region comprising a CDR1 comprising the amino acid
sequence as set forth in SEQ. ID NO: 71, a CDR2 comprising the
amino acid sequence as set forth in SEQ. ID NO: 72, and a CDR3
comprising the amino acid sequence as set forth in SEQ. ID NO: 73,
and affinity matured variants thereof; and a light chain variable
region at least 90% identical to a light chain variable region
comprising a CDR1 comprising the amino acid sequence as set forth
in SEQ. ID NO: 74, a CDR2 comprising the amino acid sequence as set
forth in SEQ. ID NO: 75, and a CDR3 comprising the amino acid
sequence as set forth in SEQ. ID NO: 76, and affinity matured
variants thereof; and a pharmaceutically acceptable excipient or
carrier.
[0066] It is another embodiment of the present invention to provide
such a composition, further comprising a second monoclonal antibody
or antigen binding fragment, wherein said second monoclonal
antibody or antigen binding fragment binds the Ebola
glycoprotein.
[0067] It is yet another embodiment of the present invention to
provide such a composition, wherein said first monoclonal antibody
is binds at least two species of the Flivovirus glycoprotein.
[0068] It is still another embodiment of the present invention to
provide such a composition, wherein the first monoclonal antibody
or antigen binding fragment comprises predominantly a single
glycoform.
[0069] It is yet another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform is one of GnGn, G1/G2, and NaNa.
[0070] It is still another embodiment of the present invention to
provide such a composition, wherein the predominantly single
glycoform substantially lacks at least one of fucose and
xylose.
[0071] These, and other, embodiments of the invention will be
better appreciated and understood when considered in conjunction
with the following description and the accompanying drawings. It
should be understood, however, that the following description,
while indicating various embodiments of the invention and numerous
specific details thereof, is given by way of illustration and not
of limitation. Many substitutions, modifications, additions and/or
rearrangements may be made within the scope of the invention
without departing from the spirit thereof, and the invention
includes all such substitutions, modifications, additions and/or
rearrangements.
DESCRIPTION OF THE FIGURES AND TABLES
[0072] Table 1. Amino acid residues comprising CDRs of anti-Ebola
mAbs.
[0073] FIG. 1 shows a neutralization curve for affinity matured
variants of one embodiment of the present invention.
[0074] FIG. 2 shows the binding sites on the EBOV-GP of various
embodiments of the monoclonal antibodies of the present
invention.
[0075] FIG. 3 shows the location of the mutations that result in
escape mutant resistance to two monoclonal antibodies of the
present invention.
[0076] FIG. 4 shows neutralization assays preformed against the
escape mutants.
[0077] FIG. 5 shows survival data for ebolavirus infected guinea
pigs treated with certain embodiments of the present invention.
[0078] FIG. 6 shows immune system response data from ebolavirus
infected guinea pigs treated with certain embodiments of the
present invention.
[0079] FIG. 7 shows survival data for ebolavirus infected guinea
pigs treated with certain embodiments of the present invention.
[0080] FIG. 8 shows survival data for ebolavirus infected guinea
pigs treated with certain embodiments of the present invention.
[0081] FIG. 9 survival data for ebolavirus infected guinea pigs
treated with certain embodiments of the present invention.
[0082] FIG. 10 survival data for ebolavirus infected non-human
primates treated with certain embodiments of the present
invention.
[0083] FIG. 11 survival data for ebolavirus infected non-human
primates treated with certain embodiments of the present
invention.
[0084] FIG. 12 survival data for ebolavirus infected non-human
primates treated with certain embodiments of the present
invention.
[0085] FIG. 13 shows a neutralization curves for certain
embodiments of the present invention created using differing
production methods.
[0086] Table 2 shows the efficiency of anti-GP antibody isolation
from peripheral B cells.
[0087] Table 3 shows the cross-reactivity of candidate
pan-ebolavirus mAbs against different ebolavirus species.
Reactivity was measured by ELISA.
[0088] Table 4 shows the in vitro neutralization activity and
affinities of candidate pan-ebolavirus mAbs.
[0089] Table 5 shows that mice infected with EBOV and subsequently
treated with the monoclonal antibodies described above showed
increased survival compared to mice treated with PBS.
[0090] Table 6 is a summary of rVSV-GP neutralization by
cross-neutralizing human mAbs.
[0091] Table 7 is a summary of authentic ebolavirus neutralization
by cross-neutralizing human mAbs.
[0092] Table 8 shows K.sub.D values for recognition of EBOV
GP.DELTA.TM by mature PE-87 bearing the indicated mutations in the
CDR-H3 loop were determined by BLI. 95% confidence intervals are
reported for each binding constant. IC.sub.50 values for
neutralization of rVSVs bearing ebolavirus GPs by mature PE-87
bearing the indicated mutations in the CDR-H3 loop.
[0093] Table 9 shows the mAb protection of mice after challenge
with EBOV or SUDV.
DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0094] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which the invention belongs. Although
any methods and materials similar or equivalent to those described
herein can be used in the practice or testing of the present
invention, the preferred methods and materials are now described.
All publications mentioned above and hereunder are incorporated
herein by reference.
Definitions
[0095] As used herein, "neutralizing antibody" (NAb) refers to an
antibody, for example, a monoclonal antibody, capable of disrupting
a formed viral particle or inhibiting formation of a viral particle
or prevention of binding to or infection of mammalian cells by a
viral particle. As used herein, "diagnostic antibody" or "detection
antibody" or "detecting antibody" refers to an antibody, for
example, a monoclonal antibody, capable of detecting the presence
of an antigenic target within a sample. As will be appreciated by
one of skill in the art, such diagnostic antibodies preferably have
high specificity for their antigenic target. As used herein, "human
antibodies" refer to antibodies that were isolated from the B cells
of a human or directly from the sequence of serum antibodies.
[0096] A "therapeutically effective" treatment refers a treatment
that is capable of producing a desired effect. Such effects
include, but are not limited to, enhanced survival, reduction in
presence or severity of symptoms, reduced time to recovery, and
prevention of initial infection. "Therapeutically effective"
permutations of a mAb may enhance any of the above characteristics
in a manner that is detectable by routine analysis of patient data.
In certain embodiments, such therapeutically effective mutations
include mutations that improve the stability, solubility, or
production of the mAb, including mutations to the framework regions
of the mAb sequence.
[0097] As used herein, `immunoreactive fragment` refers in this
context to an antibody fragment reduced in length compared to the
wild-type or parent antibody which retains an acceptable degree or
percentage of binding activity to the target antigen. As will be
appreciated by one of skill in the art, what is an acceptable
degree will depend on the intended use.
[0098] As used herein, a mAb has "pan-Ebola" binding
characteristics if it is capable of binding to at least 2, but
preferable more, ebolavirus species.
[0099] The basic antibody structural unit is known to comprise a
tetramer. Each tetramer is composed of two identical pairs of
polypeptide chains, each pair having one "light" (about 25 kDa) and
one "heavy" chain (about 50-70 kDa). The amino-terminal portion of
each chain includes a variable region of about 100 to 110 or more
amino acids primarily responsible for antigen recognition. The
carboxy-terminal portion of each chain defines a constant region
primarily responsible for effector function.
[0100] Light chains are classified as kappa and lambda. Heavy
chains are classified as gamma, mu, alpha, delta, or epsilon, and
define the antibody's isotype as IgG, IgM, IgA, IgD and IgE,
respectively. Within each isotype, there may be subtypes, such as
IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, etc. Within light and
heavy chains, the variable and constant regions are joined by a "J"
region of about 12 or more amino acids, with the heavy chain also
including a "D" region of about 3 or more amino acids. The
particular identity of constant region, the isotype, or subtype
does not impact the present invention. The variable regions of each
light/heavy chain pair form the antibody binding site.
[0101] Thus, an intact antibody has two binding sites. The chains
all exhibit the same general structure of relatively conserved
framework regions (FR) joined by three hypervariable regions, also
called complementarity determining regions or CDRs. The CDRs from
the two chains of each pair are aligned by the framework regions,
enabling binding to a specific epitope. From N-terminal to
C-terminal, both light and heavy chains comprise the domains FR1,
CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids
to each domain is in accordance with well known conventions [Kabat
"Sequences of Proteins of Immunological Interest" National
Institutes of Health, Bethesda, Md..sub.s 1987 and 1991; Chothia,
et al., J. Mol. Biol. 196:901-917 (1987); Chothia, et al., Nature
342:878-883 (1989)].
[0102] In another embodiment of the invention, there are provided
glycoengineered variants of the monoclonal antibodies that contain
predominantly a single glycoform. These glycans can be GnGn
(GIcNAc.sub.2-Man.sub.3-GlcNAc.sub.2), mono- or di-galactosylated
(Gal.sub.(1/2)-GlcNAc.sub.2-Man.sub.3-GlcNAc.sub.2) (hereinafter
mono-galactosylated="G1", di-galactosylated="G2", and a combination
of the two, in any proportion="G1/G2"), mono- or di-sialylated
(NaNa.sub.(1,2)-Gal.sub.(1/2)-GIcNAc.sub.2-Man.sub.3-GIcNAc.sub.2)
containing little or no fucose or xylose. A predominantly single
glycoform is any glycoform that represents more than half (e.g.
greater than 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%) of
all glycoforms present in the antibody solution.
[0103] The RAMP system has been used for glycoengineering of
antibodies, antibody fragments, idiotype vaccines, enzymes, and
cytokines. Dozens of antibodies have been produced in the RAMP
system by Mapp (5, 6) and others (7, 8). These have predominantly
been IgGs but other isotypes, including IgM (9, 10), have been
glycoengineered. Glycoengineering has also been extended to human
enzymes in the RAMP system (11, 12). Since the RAMP system has a
rapid turn-around time from Agrobacterium infection to harvest and
purification (13) patient specific idiotype vaccines have been used
in clinical trials for non-Hodgkins lymphoma (7).
[0104] For glycoengineering, recombinant Agrobacterium containing a
mAb cDNA is used for infection of N. benthamiana in combination
with the appropriate glycosylation Agrobacteria to produce the
desired glycan profile. For wild-type glycans (i.e. native,
plant-produced glycosylation) wild-type N. benthamiana is
inoculated with only the Agrobacterium containing the anti-M2e
cDNA. For the GnGn glycan, the same Agrobacterium is used to
inoculate plants that contain little or no fucosyl or xylosyl
transfrases (.DELTA.XF plants). For galactosylated glycans,
.DELTA.XF plants are inoculated with the Agrobacterium containing
the mAb cDNA as well as an Agrobacterium containing the cDNA for
.beta.-1,4-galactosyltransferase expression contained on a binary
Agrobacterium vector to avoid recombination with the TMV and PVX
vectors (14). For sialylated glycans, six additional genes are
introduced in binary vectors to reconstitute the mammalian sialic
acid biosynthetic pathway. The genes are UDP-N-acetylglucosamine
2-epimerase/N-acetylmannosamine kinase, N-acetylneuraminic acid
phosphate synthase, CMP-N-acetylneuraminic acid synthetase,
CMP-NeuAc transporter, .beta.-1,4-galactosylatransferase, and
.alpha.2,6-sialyltransferase (14).
[0105] Glycanalysis of glycoengineered mAbs involved release of
N-linked glycans by digestion with N-glycosidase F (PNGase F), and
subsequent derivatization of the free glycan is achieved with
anthranilic acid (2-AA). The 2-AA-derivatized oligosaccharide is
separated from any excess reagent via normal-phase HPLC. The column
is calibrated with 2-AA-labeled glucose homopolymers and glycan
standards. The test samples and 2-AA-labeled glycan standards are
detected fluorometrically. Glycoforms are assigned either by
comparing their glucose unit (GU) values with those of the
2-AA-labeled glycan standards or by comparing with the theoretical
GU values (15). Confirmation of glycan structure was accomplished
with LC/MS.
[0106] While the RAMP system is an effective method of producing
various glycoengineered and wild-type mABs, it will be recognized
that other expression systems may be used to accomplish the same
result. For example, mammalian cell lines (such as CHO or NSO cells
[Davies, J., Jiang, L., Pan, L. Z., LaBarre, M. J., Anderson, D.,
and Reff, M. 2001. Expression of GnTIII in a recombinant anti-CD20
CHO production cell line: Expression of antibodies with altered
glycoforms leads to an increase in ADCC through higher affinity for
FCyRIII. Biotechnol Bioeng 74:288-294]), yeast cells (such as
Pichia pastoris [Gerngross T. Production of complex human
glycoproteins in yeast. Adv Exp Med Biol. 2005; 564]) and bacterial
cells (such as E. Coli) have been used produce such mABs.
[0107] Described herein are mAbs, designated PE-24, PE-87, PE-47,
PE-16, PE-64 and PE-05, which have surprisingly exhibited pan-Ebola
neutralizing characteristics. The preferred antibodies of the
present invention comprise mAbs with amino acid sequences
sufficiently identical to referenced amino acid sequences. By
"sufficiently identical" is intended an amino acid sequence that
has at least about 60% or 65% sequence identity, about 70% or 75%
sequence identity, about 80% or 85% sequence identity, about 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence
identity compared to a reference sequence using one of the
alignment programs known in the art.
[0108] The sequences below show the amino acid modifications to mAb
PE-64 VH and VL amino acids to yield mAb PE-47 (Modifications are
shown in Bold, CDR sequences are Underlined).
TABLE-US-00001 mAb PE-64 VH amino acids: SEQ ID No. 11
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGR
IKSKTDGGTIDYAAPVKGRFTISRDDSKNTVYLQMTSLKTEDTAVYYCTT
YTEDMRYFDWLLRGGETFDYWGQGTLVTVSS mAb PE-47 VH amino acids: SEQ ID
No. 12 EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGEGLEWVGR
IKSKTDGGTIDYAAPVKGRFTISRDDSKNTVYLQMTSLKTEDTAVYYCTT
YTEDMQYFDWLLRGGETFDYWGQGTLVTVSS mAb PE-64 VL amino acids: SEQ ID
No. 13 DIRLTQSPSSLSASVGDRVTITCRASHYISTYLNWYQQKPGKAPKLLIYA
ASNLQSGVPSRFSGSGFGTDFSLTISSLQPEDFATYHCQQSYSTPGRYTF GQGTKVEIK mAb
PE-47 VL amino acids: SEQ ID No. 14
DIQMTQSPSSLSASVGDRVTITCRASQYISTYLNWYQQKPGKAPKLLIYA
AYNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPGRYTF GQGTKVEIK
[0109] The antibodies displayed below were isolated from the
peripheral B cells of a survivor of the 2014 Ebola virus outbreak
in West Africa (CDR amino acids are disclosed in Table 1).
[0110] PE-87 VH amino acids: SEQ ID No. 15
[0111] PE-87 VH nucleotides: SEQ ID No. 16
[0112] An alternative PE-87 VH amino acid sequence is: SEQ ID No.
17 (alterations shown in Bold and Underlined)
TABLE-US-00002 EVQLVESGGGLVQPGGSLRVSCAASGFTFSSYAMSWVRQAPGKGLEWV
SAISGLGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC
AKDHRVWAAGYHFDYWGQGTLVTVSS
[0113] PE-87 VL amino acids: SEQ ID No. 18
[0114] PE-87 VL nucleotides: SEQ ID No. 19
[0115] An alternative PE-87 VL amino acid sequence is: SEQ ID No.
20 (alterations shown in Bold and Underlined)
TABLE-US-00003 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGEAPKLLISD
ASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYYSSPTFGGG TKVEIK
[0116] PE-24 VH amino acids: SEQ ID No. 21
[0117] PE-24 VH nucleotides: SEQ ID No. 22
[0118] PE-24 VL amino acids: SEQ ID No. 23
[0119] PE-24 VL nucleotides: SEQ ID No. 24
[0120] PE-47 VH amino acids: SEQ ID No. 25
[0121] PE-47 VH nucleotides: SEQ ID No. 26
[0122] PE-47 VL amino acids: SEQ ID No. 27
[0123] PE-47 VL nucleotides: SEQ ID No. 28
[0124] PE-16 VH amino acids: SEQ ID No. 29
[0125] PE-16 VH nucleotides: SEQ ID No. 30
[0126] PE-16 VL amino acids: SEQ ID No. 31
[0127] PE-16 VL nucleotides: SEQ ID No. 32
[0128] PE-05 VH amino acids: SEQ ID No. 33
[0129] PE-05 VH nucleotides: SEQ ID No. 34
[0130] PE-05 VL amino acids: SEQ ID No. 35
[0131] PE-05 VL nucleotides: SEQ ID No. 36
[0132] PE-64 VH amino acids: SEQ ID No. 37
[0133] PE-64 VH nucleotides: SEQ ID No. 38
[0134] PE-64 VL amino acids: SEQ ID No. 39
[0135] PE-64 VL nucleotides: SEQ ID No. 40
TABLE-US-00004 TABLE 1 Amino acid residues comprising CDRs of
anti-Ebola mAbs (SEQ ID Nos. indicated in parenthesis) Mab V region
CDR 1 CDR 2 CDR 3 PE-87 VH GFTFSSYAMS (41) AISGLGGSTYYADSV (42)
DHRVWAAGYHFDY (43) PE-87 VL RASQSISSWLA (44) DASSLES (45) QQYYSSPT
(46) PE-24VH GFTFSSYAMS (47) EISGLGGSTYYADSAK (48) DHRVWAPGYYFDH
(49) PE-24 VL RASQSISSWLA (50) DASSLES (51) QQYNRSPT (52) PE-47 VH
GFTFSNAWMS (53) RIKSKTDGGTIDYAAPVK (54) YTEDMQYFDWLLRGGETFDY (55)
PE-47 VL RASQYISTYLN (56) AAYNLQS (57) QQSYSTPGRYT (58) PE-16 VH
GYTFTTYYMH (59) IINPSGGITRYAQKFQ (60) DRYPVLFATDYGMDV (61) PE-16 VL
RASQSVSGYLA (62) DASNRAT (63) QQRSIWPPGVT (64) PE-05 VH GFTFGDYAMS
(65) FLRSKAYGGTAEYAASVK (66) DGFRGSSWGYSYYGMDV (67) PE-05 VL
SGSSSNIGGNTVS (68) TNDQRPS (69) WDDSLNGPVFGGGT (70) PE-64 VH
GFTFSNAWMS (71) RIKSKTDGGTIDYAAPVK (72) YTEDMRYFDWLLRGGETFDY (73)
PE-64 VL RASHYISTYLN (74) AASNLQS (75) QQSYSTPGRYT (76)
[0136] In certain embodiments of the present invention, the above
mAb sequences are affinity matured to enhance binding or otherwise
improve the therapeutic efficacy of the antibody. In one
embodiment, optimization of antibodies was performed via a light
chain diversification protocol, and then by introducing diversities
into the heavy chain and light chain variable regions as described
below:
[0137] CDRL1 and CDRL2 selection: The CDRL3 of a single antibody
was recombined into a premade library with CDRL1 and CDRL2 variants
of a diversity of 1.times.10.sup.8 and selections were performed
with one round of MACS and four rounds of FACS. For each FACS round
the libraries were affinity pressured using titrating amounts of an
ebolavirus GP (for example, SUDV GP) and sorting was performed in
order to obtain a population with the desired characteristics.
[0138] VH Mut selection: The heavy chain variable region (VH) was
mutagenized via error prone PCR. The library was then created by
transforming this mutagenized VH and the heavy chain expression
vector into yeast already containing the light chain plasmid of the
parent. Selections were performed similar to previous cycles using
FACS sorting for two rounds. For each FACS round the libraries were
affinity pressured using titrating amounts of Sudan GP and sorting
was performed in order to obtain a population with the desired
characteristics.
[0139] ADI-23774 (PE-47) was generated by combining the most
improved HC (from the VH mut selection) with the most improved LC
(from the L1/L2 selection).
[0140] FIG. 1 illustrates the enhanced neutralization potential of
the parent (PE-64), best VH mutant, best VL mutant, and best VH/VL
mutant (PE-47).
[0141] It will be apparent to those having skill in the art that
these or alternate methods of affinity maturation may be used to
rapidly and efficiently improve upon the desired characteristics of
the mAb sequences described herein, and that routine analytical
tools may be used to identify if any potential variant developed
using these techniques possess the desired characteristic.
[0142] These antibodies have high affinity and avidity for Ebola
glycoproteins, which means that in certain embodiments they can be
used as therapeutic reagents administered to an individual with an
ebolavirus infection or as prophylactic reagents to prevent an
ebolavirus infection or as highly sensitive diagnostic tools. In
particular, we have found that PE-87 and PE-47 act primarily at a
step that follows GP.fwdarw.GP.sub.CL cleavage and receptor
engagement. Endosomally generated GP.sub.CL species (either alone
or in complex with NPC1) is the presumptive final target of these
mAbs. Strikingly, GP cleavage to GP.sub.CL enhanced the antiviral
potencies of PE-64, PE-87, and PE-47 by 50-200 fold. Together,
these results suggest that the broadly neutralizing mAbs PE-87 and
PE-47 differ from previously described monospecific mAbs (KZ52,
c2G4, and 4G7), in their ability to target and neutralize a cleaved
GP species that is generated deep in the endocytic pathway.
Conversely, the latter mAbs appear to act principally at and/or
prior to the GP.fwdarw.GP.sub.CL cleavage step. PE-64 displayed a
dual behavior, and may act both upstream, to block GP cleavage, and
downstream, to target one or more GP.sub.CL-like species at or near
the membrane fusion step. We assessed the protective efficacy of
these broadly neutralizing human mAbs in three small-animal models
of lethal ebolavirus challenge. First, wild type (WT) BALB/c mice
were exposed to mouse-adapted EBOV (EBOV-MA), and then administered
a single dose of each mAb at 2 days post-infection (300
.mu.g/animal). Cross-neutralizing mAbs were highly (.gtoreq.80%)
protective against EBOV in this stringent post-exposure setting,
with little or no weight loss apparent in mAb-treated animals.
[0143] FIG. 2 illustrates negative stain EM reconstructions of
broadly neutralizing ebolavirus mAbs. A structure of ebolavirus GP
(based on PDB IDs:5JQ3) displaying the antigenic surfaces and
corresponding structural regions of interest. The disordered mucin
domain (dashed lines), GP1, GP2, fusion loop, glycan cap in, CHR2
region and the N563-linked glycan. Top and side views are shown for
negative stain EM 3D reconstructions of Fab models of PE-87, PE-47,
PE-24 and PE-16 (shown in dark gray) in complex with EBOV GP.
We next evaluated the NAbs in the Type I interferon .alpha./.beta.
receptor-deficient mouse model for SUDV challenge. Mice were
exposed to WT SUDV, and then dosed with each NAb on days 1 and 3
post-infection (300 .mu.g/animal/dose). The pan-ebolavirus mAbs
PE-87 and PE-47 afforded .gtoreq.95% survival and greatly reduced
weight loss, relative to the PBS control group. By contrast, PE-16
and PE-64, both weak SUDV neutralizers, provided little or no
protection against SUDV.
[0144] Finally, we tested the anti-BDBV efficacy of the two
pan-ebolavirus human mAbs, PE-87 and PE-47, in the domestic ferret,
which is the only described non-NHP model for BDBV challenge.
Animals received two doses of each NAb (15 mg and 10 mg per animal
on days 3 and 6 post-challenge, respectively). As observed
previously, BDBV infection was uniformly lethal, with PBS-treated
animals succumbing between days 8-10 following challenge. By
contrast, both mAbs afforded highly significant levels of survival
(3 of 4 animals for PE-87; 2 of 4 for PE-24). Furthermore, peak
viremia levels correlated with mAb treatment and survival outcome,
with lower viral titers observed in the surviving animals relative
to those that succumbed to infection (p<0.001), and in
mAb-treated animals relative to PBS-treated controls (p<0.001).
Viremia also trended lower in animals receiving PE-87 relative to
those receiving PE-47, but this difference did not reach
statistical significance. In sum, our findings demonstrate that the
pan-ebolavirus mAbs PE-87 and PE-47 can afford post-exposure
protection against challenge by the three divergent ebolaviruses
currently associated with lethal disease outbreaks in humans.
[0145] In another embodiment of the present invention, the mAbs of
the present invention have been shown to provide complete
protection to a non-human primate model of Ebola virus challenge.
Four days after exposure to a lethal challenge of EBOV virus, a
group of rhesus macaque monkeys were treated with either one dose
of an NAb cocktail (comprising 25 mg/kg each of PE-87 and PE-47) or
two doses of the same NAb cocktail (one at 4 days post infection,
comprising 50 mg/kg of the NAbs, and another at 7 days post
infection, comprising 25 mg/kg of the NAbs). As previously
observed, EBOV infection was uniformly lethal, with the all
PBS-treated animals succumbing by the 7.sup.th day post infection.
By contrast, every animal from the NAb treatment groups survived,
with no detectable viral RNA present in the blood of the treatment
groups 10 days following the initial treatment, as assayed via
qRT-PCR.
[0146] The NAb cocktail of PE-87 and PE-47 (also referred to herein
as MBP134) was further tested as follows. First, escape mutants
that were resistant to the individual components of MBP134 were
generated. Escape mutant selections were performed by serial
passage of rVSV-GP particles in the presence of test antibody.
Briefly, serial 3-fold dilutions of virus were preincubated for one
hour with a concentration of antibody corresponding to the
IC.sub.90 value derived from neutralization assays, and then added
to confluent monolayers of Vero cells in 12-well plates, in
duplicate. Infection was allowed to proceed to completion (>90%
cell death by eye), and supernatants were harvested from the
infected wells that received the highest dilution (i.e., the least
amount) of viral inoculum. Following three subsequent passages
under antibody selection with virus-containing supernatants as
above, supernatants from passage 4 were tested for viral
neutralization escape. If resistance was evident, individual viral
clones were plaque-purified on Vero cells, and their GP gene
sequences were determined as described previously (Wong et al.,
2010).
[0147] FIG. 3 illustrates the mutations to the rVSV-GP and their
relative locations within the three-dimensional structure of the
viral glycoprotein for the two escape mutants that were most
resistant to PE-47 (MBPO47) and PE-87 (MBP087) respectively.
Namely, the PE-87 escape mutant contained a G528E substitution,
while the PE-47 escape mutant contained a N514D substitution.
[0148] FIG. 4 illustrates the dose response curves of the
above-mentioned escape mutants and the wild-type SUDV virus to
concentrations PE-47 and PE-87. Importantly with regard to the
efficacy of a multi-mAb cocktail, the escape mutations which
provided resistance to one mAb resulted in significantly enhanced
neurtralization by the other. As such, in certain embodiments of
the present invention, a combination of multiple antibodies is
provided which significantly reduce the risk of viral resistance
development.
[0149] As noted above, antibodies comprising a substantially single
glycan and lacking fucose show enhanced efficacy in patients. To
determine if afucosylated MBP134 has increased efficacy in mammals,
fucosylated and afucosylated versions of the cocktail were used to
treat guinea pigs challenged with a lethal dose of EBOV. All guinea
pigs were healthy and immune competent as per vendor's
representation. All guinea pigs were drug and test naive. Animals
were monitored daily for food and water consumption and given
environmental enrichment according to the guidelines for the
species. Cleaning of the animals was completed three times per week
which included a complete cage and bedding material change. Animals
were kept two or three per cage in the large shoe box cages from
IVC Alternative Design. Each unit is ventilated with a HEPA blower
system. 4-6 week old female Hartley guinea pigs (250-300 g) were
randomly assigned to experimental groups and challenged via IP with
a 1000.times.LD50 of guinea pig adapted EBOV/Mayinga in 1 mL of
DMEM. Either MBP134 or the afucosylated MBP134-N was given IP at
indicated time points and doses, with 6 guinea pigs/group (n=6).
Control guinea pigs with 4 animals/group (n=4), were given PBS
treatment. Animals were observed for clinical signs of disease,
survival and weight change for 15-16 days, while survival was
monitored for an additional 12 days.
[0150] FIG. 5 illustrates the survival curves of the afucosylated
vs. fucosylated MBP134 at various doses. The afucosylated cocktail
showed dramatically improved survival, even at the lowest dosage
tested. Furthermore, blood drawn from the animals showed
significantly increased immune reactions in response to treatment
with afucosylated PE-47 and PE-87, as compared to their fucosylated
counterparts and other anti-EBOV mAbs c13C6 (also afucosylated) and
2G12, as illustrated in FIG. 6. Thus, in certain embodiments of the
present invention, there is provided a monoclonal antibody that
substantially lacks fucose.
[0151] To determine the ability of the afucoslyated MBP134 to
neutralize multiple strains of the ebolavirus, a dose down study of
guinea pigs infected with a lethal dose of SUDV was conducted. As
illustrated in FIG. 7, animals treated at three and four days post
infection had 100% survival, while even treatment at 5 dpi resulted
in a dramatic increase in survival. To determine if a lower dose of
MBP134 would be effective at 4 dpi, and if a higher dose would lead
to increased survival if administered at 5 dpi, further tests were
conducted. As illustrated in FIG. 8, reduced doses of MBP134
administered at 4 dpi resulted in excellent, though not perfect,
survival rates among the treated animals. Furthermore, doubling the
dose administered at 5 dpi resulted in all of the infected animals
surviving. In certain embodiments of the present invention, the
increase dosage of the monoclonal antibodies at later dates post
infection allows the host animals to overcome the increased viral
load associated with the infection.
Thus, in certain embodiments of the present invention, a patient is
treated with an effective dose of a monoclonal antibody or
combination of monoclonal antibodies. An effective dose includes,
but is not limited to, 0.01 mg/kg, 0.05 mg/kg, 0.1 mg/kg, 0.25
mg/kg, 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 2 mg/kg, 5 mg/kg, 10 mg/kg,
25 mg/kg, 50 mg/kg, and 100 mg/kg
[0152] To further explore the ability of the monoclonal antibodies
disclosed herein to protect against multiple strains of the
ebolavirus in mammals, female ferrets were infected with various
strains of ebolavirus and treated with different dosages of MBP134.
Female ferrets weighing 0.75-1 kg were housed 2-3 per cage per
study. Ferrets were anesthetized by intramuscular injection with a
ketamine-acepromazine-xylazine cocktail prior to all procedures.
Prior to challenge, transponder chips (Bio-Medic Data Systems) were
subcutaneously implanted for identification and temperature
monitoring. Subjects were challenged intranasally with a lethal
dose of 1000 plaque-forming units (PFU) of ZEBOV strain Kikwit,
SEBOV strain Gulu, or BDBV and treated with MBP134-N at the times
and dosing shown in FIG. 9. As shown in FIG. 9, two doses of 15 mg
at two or three dpi and five or six dpi were sufficient to offer
full survival to the infected mammals. Furthermore, the results
illustrated here, combined with those discussed above, indicate
that the MBP134 cocktail provides protection against many different
stains of ebolavirus in mammals.
[0153] To determine if this protection extends to primates, rhesus
macaques were infected with a lethal dose of EBOV/Kikwit and
treated with the monoclonal antibodies of the present invention.
Rhesus macaques at UTMB were challenged by intramuscular injection
(IM) with 1,000 PFU of EBOV/Kikwit. Two treatment groups
(n=4/group) were treated either with a single 25 mg/kg dose of
MBP134-N on day 4 or two doses of MBP134-N day 4 (50 mg/kg) and day
7 (25 mg/kg) post infection. Control animals (n=2) were treated
with PBS. All the macaques were given physical examinations and
blood was collected at the time of viral challenge; and on days 4,
7, 10, 14, 21, and 28 after challenge. The macaques were monitored
daily and scored for disease progression with an internal filovirus
scoring protocol approved by the UTMB Institutional Animal Care and
Use Committee (IACUC) in accordance with state and federal statutes
and regulations relating to experiments involving animals and by
the UTMB Institutional Biosafety Committee. The scoring changes
measured from baseline included posture/activity level;
attitude/behavior; food and water intake; weight; respiration; and
disease manifestations, such as visible rash, hemorrhage,
ecchymosis, or flushed skin, with increased scores resulting in
euthanasia. As illustrated in FIG. 10, all of the treated primates
survived the lethal challenge of ebolavirus.
[0154] As illustrated in FIG. 11, the protection offered to
primates by the antibodies of the present invention extends to
multiple strains of ebolavirus. Even a single dose of MBPl34 is
sufficient to protect from a lethal challenge of both
SUDV/Nza-Boniface and SUDV/Gulu in rhesus macaques.
[0155] Furthermore, the monoclonal antibodies of the present
invention provide protection from ebolavirus challenge in different
species of primate. Cynomolgus monkeys at UTMB were challenged by
intramuscular injection (IM) with 1,000 PFU of BDBV (200706291
Uganda isolate, Vero E6 passage 2). One treatment group (n=6) was
treated with a single 25 mg/kg dose of MBP134 (from CHOK1-AF) on
day 7 post infection via IV infusion. Control animals (n=3) were
untreated. All the animals were given physical examinations and
blood was collected at the time of viral challenge; and on days 4,
7, 10, 14, 21, and 28 after challenge (or at time of euthanasia).
All animals were monitored daily and scored for disease progression
with an internal filovirus scoring protocol approved by the UTMB
Institutional Animal Care and Use Committee. The scoring changes
measured from baseline included posture/activity level,
attitude/behavior, food intake, respiration, and disease
manifestations such as visible rash, hemorrhage, ecchymosis, or
flushed skin. A score of >9 indicated that an animal met
criteria for euthanasia. As illustrated in FIG. 12, a single dose
of MBP134 as late as one-week post infection is sufficient to offer
excellent protection.
[0156] In order to optimize the production methodology of the
monoclonal antibodies disclosed herein, the ability of PE-87 and
PE-47 produced in plants or CHO cells to neutralize numerous
strains of ebolavirus were tested. As illustrated in FIG. 13,
monoclonal antibodies produced in both plant and CHO based systems
possess similar neurtralization characteristics. As such, these, or
other systems known in the art, may be used to produce the
monoclonal antibodies of the present invention.
[0157] It is of note that as discussed herein, any of the above
described antibodies may be formulated into a pharmaceutical
treatment for providing passive immunity for individuals suspected
of or at risk of developing hemorrhagic fever comprising a
therapeutically effective amount of said antibody. The
pharmaceutical preparation may include a suitable excipient or
carrier. See, for example, Remington: The Science and Practice of
Pharmacy, 1995, Gennaro ed. As will be apparent to one
knowledgeable in the art, the total dosage will vary according to
the weight, health and circumstances of the individual as well as
the efficacy of the antibody. While the preferred embodiments of
the invention have been described above, it will be recognized and
understood that various modifications may be made therein, and the
appended claims are intended to cover all such modifications which
may fall within the spirit and scope of the invention.
Materials and Methods 1
Human Subjects
[0158] Human blood samples were collected after Institutional
Review Board (IRB) approval of a protocol to isolate B cells from
healthy adult volunteers to identify antibodies elicited from prior
immunization or infections. Eligible subjects were determined based
on immunization and infection history recorded on a self-reported
questionnaire completed prior to sample collection. Peripheral
blood mononuclear cells were obtained from a survivor of the 2014
EBOV outbreak three months after the patient had been diagnosed
with EBOV infection.
B Cell and Plasma Isolation
[0159] Approximately 85 ml of whole blood was collected in 8.5 ml
ACD Solution A Vacutainer.RTM. venous blood collection tubes
(Becton Dickinson) per the manufacturer's protocol. Blood was
transported at room temperature and distributed into 50 ml conical
tubes before addition of 300 .mu.l of RosetteSep.TM. human B cell
enrichment cocktail (StemCell Technologies) per 21 ml of blood,
mixed by inversion and incubated for 20 minutes at room
temperature. The total volume was brought to 50 ml with Hank's
Balanced Salt Solution (HBSS), layered over Ficoll-Paque Plus (GE
Healthcare) and centrifuged following the manufacturer's protocol.
The B cell layer was removed from the density gradient by pipette,
washed twice in HBSS by centrifugation at 400.times.g, frozen at
6.5.times.106 cells/ml in a 1:1 mixture of FBS (Life Technologies)
and cryoprotective medium (Lonza) and stored under liquid nitrogen.
Plasma was collected from the top layer of the density gradient and
stored at -80.degree. C. until use.
TABLE-US-00005 TABLE 2 Efficiency of anti-GP mAb isolation from
peripheral B cells. Total number of IgG+ B cells sorted: 600 Number
of antibodies cloned: 420 (70%) Number of clones expressing IgG:
378 (63%) Number of EBOV GP binders: 349 (58%)
Anti-EBOV GP Plasma ELISA
[0160] A high-binding ELISA plate was coated with 1 .mu.g/ml of
EBOV rGP.DELTA.TM (IBT BioSciences) diluted in PBS overnight at
4.degree. C. After washing, wells were blocked with 1% BSA in PBS
and 0.05% Tween-20 for 2 hours at room temperature. Wells were
washed and serial dilutions of human plasma (diluted in blocking
buffer) were added and incubated for 1.5 hours at room temperature.
As positive and negative controls, serial dilutions of mAb KZ52
(IBT BioSciences) or an irrelevant human mAb, respectively, were
added to appropriate wells. After washing, HRP-conjugated donkey
anti-human IgG (Jackson ImmunoResearch) or HRP-conjugated goat
anti-human IgA (Southern Biotech) secondary antibody was incubated
in appropriate wells for 1.25 hours at room temperature. Wells were
washed twice and developed with SureBlue TMB substrate (KPL). The
reaction was stopped with 1M HCl and wells were read on an EMax
Microplate Reader (Molecular Devices) at 450 nm wavelength. Plasma
endpoint titers were determined by calculating the highest serum
dilution that gives a reading above the blank including three
standard deviations.
Single B Cell Sorting
[0161] Purified B cells were stained using anti-human IgM (BV605),
IgD (BV605), IgG (BV421), CD8 (APC-Cy7), CD14 (AF700), CD19
(PerCP-Cy5.5), CD20 (PerCP-Cy5.5) and biotinylated EBOV
GP.DELTA.TM. Biotinylated GP.DELTA.TM was used at a concentration
of 50 nM and detected using streptavidin-APC (Life Technologies) at
a dilution of 1:500. Single cells were sorted on a MoFlo cytometer
(Beckman-Coulter) into 96-well PCR plates (BioRad) containing 20
.mu.l/well of lysis buffer [5 .mu.l of 5.times. first strand cDNA
buffer (Invitrogen), 0.5 .mu.l RNaseOUT (Invitrogen), 1.25 .mu.l
dithiothreitol (Invitrogen), 0.625 .mu.l NP-40 (New England
Biolabs), and 12.6 .mu.l dH2O]. Plates were immediately frozen on
dry ice before storage at -80.degree. C.
Amplification and Cloning of Antibody Variable Genes
[0162] Single B cell PCR was performed essentially as previously
described [27]. Briefly, IgH, Ig.lamda. and Ig.kappa. variable gene
transcripts were amplified by RT-PCR and nested PCR reactions using
cocktails of primers specific for IgG [27]. The primers used in the
second round of PCR contained 40 base pairs of 5' and 3' homology
to the cut expression vectors to allow for cloning by homologous
recombination into Saccharomyces cerevisiae [28]. PCR products were
cloned into S. cerevisiae using the lithium acetate method for
chemical transformation [29]. Each transformation reaction
contained 20 .mu.l of unpurified heavy chain and light chain PCR
product and 200 ng of cut heavy and light chain plasmids.
Individual yeast colonies were picked for sequencing and
down-stream characterization.
Expression and Purification of Antibodies and Fab Fragments
[0163] Antibodies used for binding experiments, competition assays,
neutralization assays, and structural studies were expressed in
Saccharomyces cerevisiae cultures grown in 24 well plates. After 6
days of growth, the yeast cell culture supernatant was harvested by
centrifugation and subject to purification. IgGs used in protection
experiments were expressed by transient co-transfection of heavy
and light chain plasmids into HEK293 cells. One day prior to
transfection, HEK293 cells were passaged at 2.0-2.5.times.106
cells/ml. On the day of transfection, cells were pelleted by
centrifuging at 400 g for 5 min, and cell pellets were resuspended
in fresh FreeStyle F17 medium at a density of 4.times.106 cells/ml
and returned to the incubator. A transfection mixture was prepared
by first diluting the plasmid DNA preparations in FreeStyle F17
medium (1.33 .mu.g total plasmid DNA per ml of culture).
Transfection agent, PEIpro.TM. (Polyplus Transfection, Illkirch,
France), was then added to the diluted DNA at a DNA-to-PEI ratio of
1:2, and the mixture was incubated at room temperature for 10 min.
The transfection mixture was then added to the culture. Cultures
were harvested six days post transfection by two rounds of
centrifugation, each at 2000.times.g for 5 min, and the clarified
conditioned medium subject to antibody purification. Cell
supernatents were purified by passing over Protein A agarose
(MabSelect SuRe.TM. from GE Healthcare Life Sciences). The bound
antibodies were washed with PBS, eluted with 200 mM acetic acid/50
mM NaCl pH 3.5 into 1/8.sup.th volume 2M Hepes pH 8.0, and
buffer-exchanged into PBS pH 7.0. Fabs were generated by digesting
the IgGs with papain for 2 h at 30.degree. C. The digestion was
terminated by the addition of iodoacetamide, and the Fab and Fc
mixtures were passed over Protein A agarose to remove Fc fragments
and undigested IgG. The flowthrough of the Protein A resin was then
passed over CaptureSelect.TM. IgG-CH1 affinity resin (ThermoFischer
Scientific), and eluted with 200 mM acetic acid/50 mM NaCl pH 3.5
into 1/8th volume 2M Hepes pH 8.0. Fab fragments then were
buffer-exchanged into PBS pH 7.0.
Expression and Purification of EBOV GPs
[0164] Recombinant EBOV GP ectodomains containing the mucin-like
domain (EBOV GP.DELTA.TM) or lacking residues 312-463 of the
mucin-like domain (EBOV GP.DELTA.muc) were produced as described
previously [10, 30].
EBOV GP.DELTA.TM Biotinylation
[0165] EBOV GP.DELTA.TM was biotinylated using EZ-Link.TM.
Sulfo-NHS-LC-Biotin (Life Technologies) followed by a desalting
step by a Zeba.TM. Spin Desalting Column (Life Technologies).
Biolayer Interferometry Binding Analysis
[0166] IgG binding to the different GP antigens was determined by
BLI measurements using a ForteBio Octet HTX instrument (Pall Life
Sciences). For high-throughput KD screening, IgGs were immobilized
on AHQ sensors (Pall Life Sciences) and exposed to 100 nM antigen
in PBS containing 0.1% BSA (PBSF) for an association step, followed
by a dissociation step in PBSF buffer. Data was analyzed using the
ForteBio Data Analysis Software 7. The data was fit to a 1:1
binding model to calculate an association and dissociation rate,
and KD was calculated using the ratio kd/ka.
Anti-GP mAb ELISAs
[0167] ELISA plates were coated with 50 .mu.l PBS containing 4
.mu.g/mL EBOV GP antigens for 1 h at room temperature. After
washing, wells were blocked with 3% BSA for 1 h at room
temperature. After removal of the blocking solution, mAbs were
applied to the plates at a concentration of 0.2 .mu.g/ml and
incubated at room temperature for 1 h. After washing, binding was
detected with an anti-human HRP-conjugated secondary antibody and
TMB substrate. Optical density was read at 450 nm.
TABLE-US-00006 TABLE 3 Cross-reactivity of pan ebolavirus mAbs
(elisa) mAb EBOV SUDV BDBV RESTV TAFV MARV sGP GPcl PE-24 YES YES
YES YES YES NO NO YES PE-05 YES YES YES YES YES NO YES NO PE-87 YES
YES YES YES YES NO NO YES PE-16 YES WEAK YES NO YES NO NO YES PE-47
YES YES YES NP YES NO NO YES
Antibody Competition Assays
[0168] Antibody competition assays were performed essentially as
previously described [31]. Antibody competition was measured by the
ability of a control anti-EBOV GP Fab to inhibit binding of yeast
surface-expressed anti-GP IgGs to GP.DELTA.muc. 50 nM biotinylated
GP.DELTA.muc was pre-incubated with 1 .mu.M competitor Fab for 30
min at RT and then added to a suspension of yeast-expressed anti-GP
IgG. Unbound antigen was removed by washing with PBSF. After
washing, bound antigen was detected using Streptavidin Alexa Fluor
633 at a 1:500 dilution (Life Technologies) and analyzed by flow
cytometry using a BD FACS Canto II. Results are expressed as the
fold reduction in antigen binding in the presence of competitor Fab
relative to an antigen-only control.
Neutralization Assays
[0169] Virus-specific neutralizing antibody responses were titrated
essentially as previously described [32]. Briefly, plasma or
antibodies were diluted serially in Minimal Essential Medium
(Corning Cellgro, Manassas, Va.) containing 5% heat-inactivated
fetal bovine serum (Gibco-Invitrogen, Gaithersburg, Md.), 1.times.
Anti-Anti (Gibco-Invitrogen, Gaithersburg, Md.) (MEM complete) and
incubated 1 hour at 37.degree. C. with virus. After incubation, the
antibody-virus or plasma-virus mixture was added in duplicate to
6-well plates containing 90-95% confluent monolayers of Vero E6
cells. Plates were incubated for 1 hour at 37.degree. C. with
gentle rocking every 15 minutes. Following the incubation, wells
were overlaid with 0.5% agarose in supplemented EBME media, 10%
heat-inactivated fetal bovine serum (Gibco-Invitrogen,
Gaithersburg, Md.), 2.times. Anti-Anti (Gibco-Invitrogen,
Gaithersburg, Md.), and plates were incubated at 37.degree. C., 5%
CO2 for 7 days. On day 7, cells were stained by the addition of a
second overlay prepared as above containing 4-5% neutral red.
Plates were incubated for 18-24 hours at 37.degree. C., 5% CO2. The
endpoint titer was determined to be the highest dilution with a 50%
or greater or 80% or greater reduction (PRNT50, PRNT80) in the
number of plaques observed in control wells. The assay limit of
detection was calculated to be 5 plaque forming units (p.f.u.)/ml
by this method.
TABLE-US-00007 TABLE 4 Candidate pan-Ebolavirus mAbs in vitro
activity Neutralization Neut. (VSV-GP IC.sub.50, nM) WT EBOV
Microneut. WT Affinity EBOV PRNT.sub.50 IC.sub.50 (nM) mAb Epitope
(KD, nM) EBOV SUDV BDBV RESTV TAFV GP.sub.CL (nM) EBOV SUDV BDBV
PE-05 GC 44 8.8 34 3.7 22 0.8 NR 4.0 7.7 NR NR PE-87 IFL <0.01
0.5 0.3 0.5 0.2 1.0 0.2 <0.05 0.3 0.3 0.4 PE-16 Stalk 0.16 0.2
NR 0.6 NR 4.8 5.7 <0.02 0.05 NR 0.2 PE-47 Other 3.5 6.6 5.1 0.4
NR 6.1 0.08 NT 0.7 <0.1 0.5 PE-24 IFL 1 1.8 0.5 0.8 0.2 1.5 0.6
0.4 1 0.4 0.3 Epitope analyses and affinity measurements were
performed by both Mapp and Integrated BioTherapeutics. VSV-GP
assays were performed in Dr. K. Chandran's laboratory (Albert
Einstein); neutralization assays with wildtype virus were performed
in Dr. J. Dye's lab (USAMRIID); IFL = internal fusion loop; GC =
glycan cap; RBS = receptor binding site; GP.sub.CL = cleaved GP,
the form of GP exposed in the endosome when virus is internalized
by the cell in preparation for fusion with the host cell receptor;
P = in progress; NR = non-reactive; NT = not tested; WT =
wildtype.
Single-Particle Electron Microscopy
[0170] For all EM studies the EBOV GP.DELTA.TM construct described
above was used. Fabs were generated as described above and
incubated with the EBOV GP.DELTA.TM trimer at a ratio of 1:10 for
overnight at 4.degree. C. Complexes were then deposited onto a
carbon coated copper mesh grid and stained with 1% uranyl formate.
Samples were imaged on a Tecnai F12 microscope using the automated
image acquisition software Leginon [33]. Images were collected at
52,000.times. magnification resulting in a final pixel size at the
specimen level of 2.05 A using a Tietz 4K CMOS detector. Images
were automatically uploaded to and processed within our Appion
database [34]. Individual complexes were extracted from raw images
using DogPicker [35] binned by 2 and placed into a stack. The stack
was then subjected to reference free 2 dimensional classification
using MRA/MSA [PMID 14572474]. Class averages that did not respond
to Fab-EBOV.DELTA.TM complexes were removed from all subsequent
analyses. A subset of 2D class averages was used to create an
initial model using common lines within EMAN2 [36]. The raw
particle stack was then refined against the initial model using
EMAN2 to yield the final 3D volumes. UCSF Chimera was used for
modeling and figure generation [37].
EBOV Challenge Studies in Mice
[0171] The lethal mouse-adapted EBOV mouse model was developed at
the U.S. Army Medical Research Institute of Infectious Diseases
(USAMRIID) by serial passages of EBOV (Zaire) in progressively
older suckling mice [38]. Female BALB/c mice, aged 6 to 8 weeks,
were purchased from Charles River Laboratory. Upon arrival, mice
were housed in microisolator cages in an animal biosafety level 4
containment area and provided chow and water ad libitum. On day 0,
mice were infected intraperitoneally (i.p.) with 100 p.f.u. of
mouse-adapted EBOV. Two days post-infection, groups of mice (10
mice per group) were treated i.p. with a single dose (100 .mu.g) of
antibody. Negative control mice received PBS. Mice were monitored
daily (twice daily if there were clinical signs of disease) for 28
days post-infection. Group weights were taken on days 0-14, and on
days 21 and 28 post-infection. Survival was compared using the
log-rank test in GraphPad PRISM 5. Differences in survival were
considered significant when the P value was less than 0.05.
Research was conducted under an IACUC approved protocol in
compliance with the Animal Welfare Act, PHS Policy, and other
Federal statutes and regulations relating to animals and
experiments involving animals. The facility where this research was
conducted is accredited by the Association for Assessment and
Accreditation of Laboratory Animal Care, International and adheres
to principles stated in the Guide for the Care and Use of
Laboratory Animals, National Research Council, 2011.
TABLE-US-00008 TABLE 5 Therapeutic efficacy of mAbs in a mouse
model of EBOV infection. No. Average mAb Treatment survivors/
weight loss competition group.sup.# total (%)* P value group PBS
2/10 8.8 N/A N/A 2G4 4/10 7.2 0.095 KZ52 competitor ADI-15956 7/10
8.6 0.008 HR2 PE-16 7/10 9.1 0.008 HR2 ADI-15974 8/10 8.0 0.002 HR2
ADI-15758 8/10 9.8 0.009 HR2 ADI-15999 10/10 8.1 <0.0001 HR2
ADI-15820 6/10 9.9 0.026 HR2 ADI-15848 7/10 8.2 0.008 HR2 ADI-15960
5/10 15.4 0.073 Undefined ADI-15903 4/10 8.4 0.079 Undefined
ADI-15959 5/10 8.4 0.040 Undefined ADI-15765 4/10 5.9 0.102
Undefined ADI-15818 3/10 13.8 0.164 KZ52 competitor PE-87 8/10 10.4
0.005 KZ52 competitor ADI-15734 6/10 7.3 0.026 KZ52 competitor
ADI-15784 8/10 9.1 0.002 KZ52 competitor ADI-15772 7/10 11.8 0.011
KZ52 competitor PE-24 10/10 10.5 0.0003 KZ52 competitor ADI-15731
4/10 9.2 0.059 13C6 competitor ADI-15932 4/10 12.1 0.139 13C6
competitor ADI-15940 4/10 11.0 0.059 13C6 competitor ADI-15744 4/10
12.3 0.095 13C6 competitor ADI-16037 8/10 7.0 0.005 13C6 competitor
ADI-16044 2/10 9.9 0.263 13C6 competitor ADI-15817 4/10 9.9 0.095
13C6 competitor PE-47 9/10 10.1 0.006 Undefined PE-05 9/10 8.2
0.008 Undefined .sup.#Mice were given 100 .upsilon.g of the
indicated antibody, or PBS, two days post infection. *Average
weight change from the pre-injection baseline to the peak of
clinical disease. Mice were weighed as groups.
SUDV Challenge Studies in Mice
[0172] 4-5 week old, IFNa/bR KO mice will be inoculated I.P. with
SUDV (1000 pfu). Experimental group will be treated with mAbs (0.3
ml volume) at indicated dose on days 1 and 4 post-infection.
Control mice will vehicle control I.P. (0.3 ml volume) on the same
schedule as experimental mice. Mice will be observed daily for 21
days for moribund condition. Moribund mice will be promptly
euthanized (IAW SOP AC-11-07) when they meet euthanasia criteria
(score sheet).
Reagents and Animals Required:
TABLE-US-00009 [0173] Number # of Treat- Dose of Animals to
Challenge Challenge Group ment (ug) Animals Challenge Dose Virus
Grp 1 PE-87 300 10 10 1000 pfu SUDV Grp 2 PE-24 300 10 10 1000 pfu
SUDV Grp 3 PE-16 300 10 10 1000 pfu SUDV Grp 4 PBS n/a 10 10 1000
pfu SUDV Total 40 40
Species: IFNa/bR KO; Number of pans: 4; Days Required: 21; mAb: 300
ug/dose (20 mg/kg): 300 ul of stock mAb per mouse
TABLE-US-00010 Time Line Day Date Task 0 4 Feb. 2016 Challenge I.P.
1 5 Feb. 2016 Treat I.P. with 300 ul per mouse 4 8 Feb. 2016 Treat
I.P. with 300 ul per mouse 21 25 Feb. 2016 Terminate Study
Materials and Methods 2
Cells
[0174] Vero African grivet monkey cells and 293T human embryonic
kidney fibroblast cells were maintained in high-glucose Dulbecco's
modified Eagle medium (DMEM; Thermo Fisher) supplemented with 10%
fetal bovine serum (Atlanta Biologicals), 1% GlutaMAX (Thermo
Fisher), and 1% penicillin-streptomycin (Thermo Fisher). Cells were
maintained in a humidified 37.degree. C., 5% CO2 incubator.
Vesicular Stomatitis Virus (VSV) Recombinants and Pseudotypes
[0175] Recombinant vesicular stomatitis Indiana viruses (rVSV)
expressing eGFP in the first position, and encoding representative
GP proteins from EBOV/Mayinga
(EBOV/H.sap-tc/COD/76/Yambuku-Mayinga), EBOV/Makona
(EBOV/H.sap-rec/LBR/14/Makona-L2014), BDBV
(BDBV/H.sap/UGA/07/But-811250), SUDV/Boneface
(SUDV/C.por-lab/SSD/76/Boneface), RESTV
(RESTV/M.fas-tc/USA/89/Phi89-AZ-1435), and LLOV
(LLOV/M.sch-wt/ESP/03/Asturias-Bat86), in place of VSV G have been
described previously [1-3]. VSV pseudotypes bearing eGFP and GP
proteins from TAFV (TAFV/H.sap-tc/CIV/94/CDC807212) and MARV
(MARV/H.sap-tc/KEN/80/Mt. Elgon-Musoke) were generated as described
[4].
Generation of cleaved VSV-GP particles and GP.DELTA.TM ectodomain
proteins
[0176] In some experiments, cleaved viral particles bearing
GP.sub.CL were first generated by incubation with thermolysin (200
.mu.g/mL, pH 7.5, 37.degree. C. for 1 h; Sigma-Aldrich) or
recombinant human cathepsin L (CatL, 2 ng/.mu.L, pH 5.5, 37.degree.
C. for 1 h; R&D Systems), as described previously [1].
Reactions were stopped by removal onto ice and addition of
phosphoramidon (1 mM) or E-64 (10 .mu.M), respectively, and viral
particles were used immediately for infectivity assays. A
recombinant, soluble GP.DELTA.TM protein [5] was also essentially
as described above.
VSV Infectivity Measurements and Neutralization Assays
[0177] Viral infectivities were measured by automated counting of
eGFP+ cells (infectious units; IU) using a CellInsight CX5 imager
(Thermo Fisher) at 12-14 h post-infection. For mAb neutralization
experiments, pre-titrated amounts of VSV-GP particles
(MOI.apprxeq.1 IU per cell) were incubated with increasing
concentrations of test mAb at room temp for 1 h, and then added to
confluent cell monolayers in 96-well plates. Viral neutralization
data were subjected to nonlinear regression analysis to derive
EC.sub.50 values (4-parameter, variable slope sigmoidal
dose-response equation; GraphPad Prism).
TABLE-US-00011 TABLE 6 rVSV-GP neutralization IC50 (nM).sup.1 mAb
EBOV BDBV TAF SUDV RESTV PE-16 0.2 0.6 4.8 --.sup.2 -- PE-05 9.0
4.0 0.8 34 22 PE-24 2.0 1.0 1.5 0.5 0.2 PE-87 0.5 0.5 1.0 0.3 0.2
PE-64 2.5 0.4 8 40 -- .sup.1IC.sub.50 (nM), mAb concentration that
affords half-maximal neutralization of viral infectivity. .sup.2No
detectable neutralizing activity.
Authentic Filoviruses and Microneutralization Assays
[0178] The authentic filoviruses EBOV/"Zaire 1995"
(EBOV/H.sap-tc/COD/95/Kik-9510621) [6], mouse-adapted EBOV/Mayinga
(EBOV-MA) [7], SUDV/Boneface-USAMRIIDI11808, and BDBV/200706291 [8]
were used in this study. Antibodies were diluted to indicated
concentrations in culture media and incubated with virus for 1 h.
Vero E6 cells were exposed to antibody/virus inoculum at an MOI of
0.2 (EBOV, BDBV) or 0.5 (SUDV) plaque-forming unit (PFU)/cell for 1
h. Antibody/virus inoculum was then removed and fresh culture media
was added. At 48 h post-infection, cells were fixed, and infected
cells were immunostained and quantitated by automated fluorescence
microscopy, as described [3].
TABLE-US-00012 TABLE 7 Authentic virus neutralization IC50
(nM).sup.1 mAb EBOV BDBV SUDV PE-16 0.1 0.3 300 PE-05 5.2 --.sup.2
-- PE-24 0.7 0.6 0.2 PE-87 0.2 0.6 0.2 PE-64 0.6 1.5 120
.sup.1IC.sub.50 (nM), mAb concentration that affords half-maximal
neutralization of viral infectivity. .sup.2No detectable
neutralizing activity.
Generation of mAbs
[0179] Recombinant mAbs from the human EBOV disease survivor, as
well as germline-reverted (IGL) mAb constructs and WT:IGL chimeras
of PE-87 were expressed in Saccharomyces cerevisiae and purified
from cell supernatants by protein A affinity chromatography, as
described previously [5]. Other recombinant mAbs were produced in
293F cells by transient transfection, and purified by protein A
affinity chromatography, as described previously [3].
ELISAs for GP:mAb Binding
[0180] To identify GP cross-reactive mAbs, normalized amounts of
rVSVs bearing EBOV, BDBV, and SUDV GP were coated onto plates at
4'C. Plates were then blocked with PBS containing 3% bovine serum
albumin (PBSA), and incubated with dilutions of test antibody (5,
50 nM). Bound Abs were detected with anti-human IgG conjugated to
horseradish peroxidase (Santa Cruz Biotechnology) and Ultra-TMB
colorimetric substrate (Thermo Fisher). All incubations were
performed for 1 h at 37.degree. C.
Competition ELISAs for GP/mAb Binding to NPC1
[0181] The viral lipid envelopes of rVSV-EBOV GP particles were
labeled with biotin using a function-spacer-lipid construct
(FSL-biotin) (Sigma-Aldrich) for 1 h at pH 7.5 and 37.degree. C.,
as described [2]. Biotinylated viral particles bearing GP.sub.CL
were generated by incubation with thermolysin, and then captured
onto high-binding 96-well ELISA plates precoated with recombinant
streptavidin (0.65 .mu.g/mL; Sigma-Aldrich). Plates were then
blocked with PBSA, and incubated with serial dilutions of test
mAbs. Washed plates were then incubated with a pre-titrated
concentration of soluble, FLAG epitope-tagged, NPC1 domain C
(NPC1-C) protein [9], and bound NPC1-C was detected with an
anti-FLAG antibody conjugated to horseradish peroxidase
(Sigma-Aldrich). All incubations were performed for 1 h at
37.degree. C.
ELISAs and Immunoblots to Detect mAb Inhibition of GP Cleavage
[0182] We used exposure of the NPC1-binding site in EBOV GP.sub.CL
as a proxy for successful GP.fwdarw.GP.sub.CL cleavage by CatL.
rVSV-EBOV GP particles, biotinylated as above, were preincubated
with mixtures of test mAb and irrelevant human IgG (test mAb at 50,
250, or 1000 nM; 1000 nM total IgG per reaction) for 1 h at pH 5.5
and 37.degree. C. Reactions were then incubated with CatL (4
ng/.mu.L and 37.degree. C. for 30 min). Reactions were then stopped
with E-64, readjusted to neutral pH with PBS, and captured onto
streptavidin-coated ELISA plates. NPC1-C binding was measured as
above.
[0183] Samples treated with the highest concentration of test mAb
were also subjected to western blotting. Cleaved GP1 species were
detected by immunoblotting with h21D10 mAb (a gift from Dr. Javad
Aman) directly conjugated to horseradish peroxidase.
Selection of Viral Neutralization Escape Mutants
[0184] Escape mutant selections were performed by serial passage of
rVSV-GP particles in the presence of test mAb. Briefly, serial
3-fold dilutions of virus were preincubated with a concentration of
mAb corresponding to the IC.sub.90 value derived from
neutralization assays, and then added to confluent monolayers of
Vero cells in 12-well plates, in duplicate. Infection was allowed
to proceed to completion (>90% cell death by eye), and
supernatants were harvested from the infected wells that received
the highest dilution (i.e., the least amount) of viral inoculum.
Following three subsequent passages under mAb selection with
virus-containing supernatants as above, supernatants from passage 4
were tested for viral neutralization escape. If resistance was
evident, individual viral clones were plaque-purified on Vero
cells, and their GP gene sequences were determined as described
previously [1]. The following escape mutant selections were
performed: PE-16 with rVSV-EBOV GP/Makona, PE-24 with rVSV-SUDV
GP/Boneface, PE-05 with rVSV-EBOV/Mayinga, and PE-64 with
rVSV-BDBVAMuc.
Single-Particle Electron Microscopy
[0185] Antibody Fabs and a EBOV GP.DELTA.TM ectodomain protein were
prepared as described previously [5], and incubated at a ratio of
10:1 (Fab:GP) overnight at 4'C. Complexes were then deposited onto
a carbon-coated copper mesh grid, and stained with 1% uranyl
formate. Samples were imaged on a Tecnai F12 microscope using the
automated image acquisition software Leginon [10]. Images were
collected with a Tietz 4K CMOS detector at 52,000.times.
magnification, resulting in a final pixel size of 2.05 .ANG. at the
specimen level. Images were automatically uploaded to and processed
within our Appion database [11]. Individual complexes were
extracted from raw images using DoG Picker [12], binned by 2, and
placed into a stack. The stack was then subjected to reference-free
2D classification using MRA/MSA [13]. Class averages that did not
respond to Fab:EBOV GP.DELTA.TM complexes were removed from all
subsequent analyses. A subset of 2D class averages was used to
create an initial model using common lines within EMAN2 [14]. The
raw particle stack was then refined against the initial model using
EMAN2 to yield the final 3D volumes. UCSF Chimera was used for
modeling and figure generation [15].
GP:mAb Kinetic Binding Binding Analysis by Biolayer Interferometry
(BLI)
[0186] The OctetRed.TM. system (ForteBio, Pall LLC) was used to
determine the binding properties of different IgGs to various forms
of EBOV GP. Anti-human Fc (AHC) capture sensors (ForteBio) were
used for initial mAb loading at 25 mg/mL in 1.times. kinetics
buffer (PBS supplemented with 0.002% Tween-20 and 1 mg/mL of BSA).
Binding to GP was performed across two-fold serial dilutions of
EBOV GP.DELTA.TM or GP.sub.CL. The baseline and dissociation steps
were carried out in the 1.times. kinetics buffer as per the
instrument manufacturer's recommendations. For analysis of binding
at pH 5.5, a 1.times. pH 5.5 kinetics buffer (50 mM sodium citrate
dihydrate[pH 5.5], 150 mM sodium chloride, 0.002% Tween-20 and 1
mg/mL BSA) was used in place of the PBS-based 1.times. kinetic
buffer for all steps. For all of the kinetics experiments, a global
data fitting to a 1:1 binding model was used to estimate values for
the k.sub.on (association rate constant), k.sub.off (dissociation
rate constant), and K.sub.D (equilibrium dissociation
constant).
TABLE-US-00013 TABLE 8 K.sub.D and IC.sub.50 values for PE-87 and
PE-87 CDR-H3 mutations Ligand Analyte K.sub.D(nM) EBOV.sup.1
BDBV.sup.1 TAFV.sup.1 SUDV.sup.1 RESTV.sup.1 PE-87 GP/GP.sub.CL
<0.001 1.0 0.4 0.9 0.8 0.1 D99A.sup.2 GP 74 .+-. 1 >500 nn
>350 nn nn H100A.sup.2 GP 4.5 .+-. 0.2 1.0 0.4 0.8 1.0 0.2
R101A.sup.2 GP 9.4 .+-. 0.3 3.2 0.4 1.9 1.5 0.2 V102A.sup.2 GP 4.0
.+-. 0.1 0.6 0.2 1.0 1.1 0.2 W103A.sup.2 GP 1.3 .+-. 0.1 nn >200
>150 nn nn G106A.sup.2 GP .03 .+-. .01 0.8 0.4 0.8 0.9 0.2
Y107A.sup.2 GP 30 .+-. 1 3.0 0.8 0.8 >350 1.3 H108A.sup.2 GP 18
.+-. 0.4 3.2 0.6 2.2 2.1 0.5 F109A.sup.2 GP 37 .+-. 1 4.2 0.3 2.8
2.1 0.4 D110A.sup.2 GP 1.3 .+-. 0.3 2.0 0.9 2.1 1.5 0.4 Y111A.sup.2
GP 5.9 .+-. 0.3 0.8 0.4 1.1 0.8 0.1 .sup.1IC.sub.50 (nM), mAb
concentration that affords half-maximal neutralization of vira
infectivity. .sup.2Mutation in CDR3 of PE87.
EBOV and SUDV Challenge Studies in Mice
[0187] 10-12 week old female BALB/c mice (Jackson Labs) were
challenged via the intraperitoneal (i.p.) route with EBOV-MA (100
PFU; .about.3,000 LD.sub.50). Mice were treated i.p. 2 days
post-challenge with PBS vehicle or 300 .mu.g of each mAb (0.3 mL
volume, =15 mg mAb/kg). Animals were observed daily for clinical
signs of disease and lethality. Daily observations were increased
to a minimum of twice daily while mice were exhibiting signs of
disease. Moribund mice were humanely euthanized on the basis of
IACUC-approved criteria.
[0188] 6-8 week old male and female Type 1 IFN .alpha./.beta.
receptor knockout mice (Type 1 IFN.alpha./.beta. R-/-) (Jackson
Labs) were challenged with WT SUDV (1000 PFU i.p.). Animals were
treated i.p. 1 and 4 days post-challenge with PBS vehicle or 300
.mu.g (.apprxeq.15 mg mAb/kg) per dose, and monitored and
euthanized as above.
TABLE-US-00014 TABLE 9 Activity in mouse models Mouse efficacy (%
survival) mAb EBOV SUDV PE-05 90 -- PE-87 80 100 PE-16 70 20 PE-47
90 100 PE-24 100 90-100 EBOV mouse studies (n = 10-30) were
performed by Dr. J. Dye or P. Glass (USAMRIID) with mAb dosing
(5-20 mg/kg) two days post-infection; SUDV mouse studies (n = 10)
were performed by Dr. Dye with 10-20 mg/kg of mAb dosed one and
four days post-infection.
BDBV Challenge Studies in Ferrets
[0189] Six-month-old female ferrets (Mustela putorius furo) were
challenged via the intramuscular (i.m.) route with WT BDBV
(BDBV/H.sap-tc/UGA/07/Butalya-811250; 1000 TCID.sub.50 in 0.5 mL
volume), as described previously [16]. Animals were treated i.p. 3
and 6 days post-challenge with either PBS vehicle or 15 mg (day 3)
and 10 mg (day 6) of each mAb (2 mL volume/dose). Additionally, 1
mL blood was taken from each animal on days 0, 3, 6, 10, 14, 21, 28
days post-infection to determine viral load, measure complete blood
counts, and evaluate biochemical markers. Animals were monitored
twice daily for signs of disease during the course of the
experiment.
Animal Welfare Statement
[0190] Murine challenge studies were conducted under IACUC-approved
protocols in compliance with the Animal Welfare Act, PHS Policy,
and other applicable federal statutes and regulations relating to
animals and experiments involving animals. The dfacility where
these studies was conducted (USAMRIID) is accredited by the
Association for Assessment and Accreditation of Laboratory Animal
Care, International (AAALAC) and adhere to principles stated in the
Guide for the Care and Use of Laboratory Animals, National Research
Council, 2011.
[0191] Ferret challenge studies were approved by the Animal Care
Committee (ACC) of the Canadian Science Centre for Human and Animal
Health (CSCHAH) in Winnipeg, Canada, in accordance with guidelines
from the Canadian Council on Animal Care (CCAC).
Statistical Analysis
[0192] Dose-response neutralization curves were fit to a logistic
equation by nonlinear regression analysis. 95% confidence intervals
(95% CI) for the extracted IC.sub.50 parameter were estimated under
the assumption of normality. Analysis of survival curves was
performed with the Mantel-Cox (log-rank) test. Statistical
comparisons of viral titers were carried out with an unpaired
t-test. Testing level (alpha) was 0.05 for all statistical tests.
All analyses were carried out in GraphPad Prism.
REFERENCES FOR MATERIALS AND METHODS 2
[0193] 1. Wong, A. C., et al., A forward genetic strategy reveals
destabilizing mutations in the Ebolavirus glycoprotein that alter
its protease dependence during cell entry. J Viral, 2010. 84(1): p.
163-75. [0194] 2. Ng, M., et al., Cell entry by a novel European
filovirus requires host endosomal cysteine proteases and
Niemann-Pick C1. Virology, 2014. 468-470: p. 637-46. [0195] 3. Wec,
A. Z., et al., A "Trojan horse" bispecific antibody strategy for
broad protection against eboloviruses. Science, 2016. [0196] 4.
Takada, A., et al., A system for functional analysis of Ebolo virus
glycoprotein. Proc Natl Acad Sci USA, 1997. 94(26): p. 14764-9.
[0197] 5. Bornholdt, Z. A., et al., Isolation of potent
neutralizing antibodies from a survivor of the 2014 Ebola virus
outbreak. Science, 2016. 351(6277): p. 1078-83. [0198] 6. Jahrling,
P. B., et al., Evaluation of immune globulin and recombinant
interferon-alpha2b for treatment of experimental Ebola virus
infections. J Infect Dis, 1999. 179 Suppl 1: p. 5224-34. [0199] 7.
Bray, M., et al., A mouse model for evaluation of prophylaxis and
therapy of Ebola hemorrhagic fever. J Infect Dis, 1998. 178(3): p.
651-61. [0200] 8. Towner, J. S., et al., Newly discovered ebola
virus associated with hemorrhagic fever outbreak in Uganda. PLoS
Pathog, 2008. 4(11): p. e1000212. [0201] 9. Bornholdt, Z. A., et
al., Host-Primed Ebola Virus GP Exposes a Hydrophobic NPC1
Receptor-Binding Pocket, Revealing a Target for Broadly
Neutralizing Antibodies. M Bio, 2015. 7(1). [0202] 10. Suloway, C.,
et al., Automated molecular microscopy: the new Leginon system. J
Struct Biol, 2005. 151(1): p. 41-60. [0203] 11. Lander, G. C., et
al., Appion: an integrated, database-driven pipeline to facilitate
EM image processing. J Struct Biol, 2009. 166(1): p. 95-102. [0204]
12. Voss, N. R., et al., DoG Picker and TiltPicker: software tools
to facilitate particle selection in single particle electron
microscopy. J Struct Biol, 2009. 166(2): p. 205-13. [0205] 13.
Ogura, T., K. Iwasaki, and C. Sato, Topology representing network
enables highly accurate classification of protein images taken by
cryo electron-microscope without masking. J Struct Biol, 2003.
143(3): p. 185-200. [0206] 14. Tang, G., et al., EMAN2: an
extensible image processing suite for electron microscopy. J Struct
Biol, 2007. 157(1): p. 38-46. [0207] 15. Goddard, T. D., C. C.
Huang, and T. E. Ferrin, Visualizing density maps with UCSF
Chimera. J Struct Biol, 2007. 157(1): p. 281-7. [0208] 16. Kozak,
R., et al., Ferrets Infected with Bundibugyo Virus or Ebola Virus
Recapitulate Important Aspects of Human Filovirus Disease. J Virol,
2016. 90(20): p. 9209-23.
REFERENCES FOR BACKGROUND, SUMMARY, MATERIALS AND METHODS 1
[0208] [0209] 1. Kuhn, J. H., et al., Nomenclature- and
database-compatible names for the two Ebola virus variants that
emerged in Guinea and the Democratic Republic of the Congo in 2014.
Viruses, 2014. 6(11): p. 4760-99. [0210] 2. Feldmann, H. and M. P.
Kiley, Classification, structure, and replication of filoviruses.
Curr Top Microbial Immunol, 1999. 235: p. 1-21. [0211] 3. Dye, J.
M., et al., Postexposure antibody prophylaxis protects nonhuman
primates from filovirus disease. Proc Natl Acad Sci USA, 2012.
109(13): p. 5034-9. [0212] 4. Garbutt, M., et al., Properties of
replication-competent vesicular stomatitis virus vectors expressing
glycoproteins of filoviruses and arenaviruses. J Viral, 2004.
78(10): p. 5458-65. [0213] 5. Marzi, A., et al., Protective
efficacy of neutralizing monoclonal antibodies in a nonhuman
primate model of Ebola hemorrhagic fever. PLoS One, 2012. 7(4): p.
e36192. [0214] 6. Olinger, G. G., Jr., et al., Delayed treatment of
Ebola virus infection with plant-derived monoclonal antibodies
provides protection in rhesus macaques. Proc Natl Acad Sci USA,
2012. 109(44): p. 18030-5. [0215] 7. Qiu, X., et al., Successful
treatment of ebola virus-infected cynomolgus macaques with
monoclonal antibodies. Sci Transl Med, 2012. 4(138): p. 138ra81.
[0216] 8. Pettitt, J., et al., Therapeutic intervention of Ebola
virus infection in rhesus macaques with the MB-003 monoclonal
antibody cocktail. Sci Transl Med, 2013. 5(199): p. 199ra113.
[0217] 9. Qiu, X., et al., Reversion of advanced Ebola virus
disease in nonhuman primates with ZMapp. Nature, 2014. 514(7520):
p. 47-53. [0218] 10. Lee, J. E., et al., Structure of the Ebola
virus glycoprotein bound to an antibody from a human survivor.
Nature, 2008. 454(7201): p. 177-82. [0219] 11. Nanbo, A., et al.,
Ebolavirus is internalized into host cells via macropinocytosis in
a viral glycoprotein-dependent manner. PLoS Pathog, 2010. 6(9): p.
e1001121. [0220] 12. Saeed, M. F., et al., Cellular entry of ebola
virus involves uptake by a macropinocytosis-like mechanism and
subsequent trafficking through early and late endosomes. PLoS
Pathog, 2010. 6(9): p. e1001110. [0221] 13. Chandran, K., et al.,
Endosomal proteolysis of the Ebolo virus glycoprotein is necessary
for infection. Science, 2005. 308(5728): p. 1643-5. [0222] 14.
Dube, D., et al., The primed ebolavirus glycoprotein (19-kilodolton
GP1,2): sequence and residues critical for host cell binding. J
Virol, 2009. 83(7): p. 2883-91. [0223] 15. Carette, J. E., et al.,
Ebola virus entry requires the cholesterol transporter Niemann-Pick
C1. Nature, 2011. 477(7364): p. 340-3. [0224] 16. Cote, M., et al.,
Small molecule inhibitors reveal Niemann-Pick C1 is essential for
Ebola virus infection. Nature, 2011. 477(7364): p. 344-8. [0225]
17. Cook, J. D. and J. E. Lee, The secret life of viral entry
glycoproteins: moonlighting in immune evasion. PLoS Pathog, 2013.
9(5): p. e1003258. [0226] 18. Saphire, E. O., An update on the use
of antibodies against the filoviruses. Immunotherapy, 2013. 5(11):
p. 1221-33. [0227] 19. Maruyama, T., et al., Ebola virus can be
effectively neutralized by antibody produced in natural human
infection. J Virol, 1999. 73(7): p. 6024-30. [0228] 20. Dias, J.
M., et al., A shared structural solution for neutralizing
ebolaviruses. Nat Struct Mol Biol, 2011. 18(12): p. 1424-7. [0229]
21. Murin, C. D., et al., Structures of protective antibodies
reveal sites of vulnerability on Ebola virus. Proc Natl Acad Sci
USA, 2014. 111(48): p. 17182-7. [0230] 22. Volchkov, V. E., et al.,
Processing of the Ebola virus glycoprotein by the proprotein
convertase furin. Proc Natl Acad Sci USA, 1998. 95(10): p. 5762-7.
[0231] 23. Kuhn, J. H., et al., Conserved receptor-binding domains
of Lake Victoria marburgvirus and Zaire ebolovirus bind a common
receptor. J Biol Chem, 2006. 281(23): p. 15951-8. [0232] 24. Qiu,
X., et al., Characterization of Zaire ebolovirus
glycoprotein-specific monoclonal antibodies. Clin Immunol, 2011.
141(2): p. 218-27. [0233] 25. Qiu, X., et al., Ebolo GP-specific
monoclonal antibodies protect mice and guinea pigs from lethal
Ebolo virus infection. PLoS Negl Trop Dis, 2012. 6(3): p. e1575.
[0234] 26. Chen, G., et al., Synthetic antibodies with a human
framework that protect mice from lethal Sudan ebolovirus challenge.
ACS Chem Biol, 2014. 9(10): p. 2263-73. [0235] 27. Tiller, T., et
al., Efficient generation of monoclonal antibodies from single
human B cells by single cell RT-PCR and expression vector cloning.
J Immunol Methods, 2008. 329(1-2): p. 112-24. [0236] 28. Swers, J.
S., B. A. Kellogg, and K. D. Wittrup, Shuffled antibody libraries
created by in vivo homologous recombination and yeast surface
display. Nucleic Acids Res, 2004. 32(3): p. e36. [0237] 29. Gietz,
R. D. and R. H. Schiestl, High-efficiency yeast transformation
using the LiAc/SS carrier DNA/PEG method. Nat Protoc, 2007. 2(1):
p. 31-4. [0238] 30. Hashiguchi, T., et al., Structural basis for
Marburg virus neutralization by a cross-reactive human antibody.
Cell, 2015. 160(5): p. 904-12. [0239] 31. Bowley, D. R., et al.,
Antigen selection from on HIV-1 immune antibody library displayed
on yeast yields many novel antibodies compared to selection from
the some library displayed on phage. Protein Eng Des Sel, 2007.
20(2): p. 81-90. [0240] 32. Honnold, S. P., et al., Second
generation inactivated eastern equine encephalitis virus vaccine
candidates protect mice against a lethal aerosol challenge. PLoS
One, 2014. 9(8): p. e104708. [0241] 33. Suloway, C., et al.,
Automated molecular microscopy: the new Leginon system. J Struct
Biol, 2005. 151(1): p. 41-60. [0242] 34. Lander, G. C., et al.,
Appion: an integrated, database-driven pipeline to facilitate EM
image processing. J Struct Biol, 2009. 166(1): p. 95-102. [0243]
35. Voss, N. R., et al., DoG Picker and TiltPicker: software tools
to facilitate particle selection in single particle electron
microscopy. J Struct Biol, 2009. 166(2): p. 205-13. [0244] 36.
Tang, G., et al., EMAN2: an extensible image processing suite for
electron microscopy. J Struct Biol, 2007. 157(1): p. 38-46. [0245]
37. Goddard, T. D., C. C. Huang, and T. E. Ferrin, Visualizing
density maps with UCSF Chimera. J Struct Biol, 2007. 157(1): p.
281-7. [0246] 38. Bray, M., et al., A mouse model for evaluation of
prophylaxis and therapy of Ebola hemorrhagic fever. J Infect Dis,
1999. 179 Suppl 1: p. 5248-58.
Sequence CWU 1
1
76115PRTHomo sapiens 1Ala Lys Asp His Arg Val Trp Ala Ala Gly Tyr
His Phe Asp Tyr1 5 10 1528PRTHomo sapiens 2Gln Gln Tyr Tyr Ser Ser
Pro Thr1 5315PRTHomo sapiens 3Ala Lys Asp His Arg Val Trp Ala Pro
Gly Tyr Tyr Phe Asp His1 5 10 1548PRTHomo sapiens 4Gln Gln Tyr Asn
Arg Ser Pro Thr1 5522PRTHomo sapiens 5Thr Thr Tyr Thr Glu Asp Met
Gln Tyr Phe Asp Trp Leu Leu Arg Gly1 5 10 15Gly Glu Thr Phe Asp Tyr
20611PRTHomo sapiens 6Gln Gln Ser Tyr Ser Thr Pro Gly Arg Tyr Thr1
5 10717PRTHomo sapiens 7Ala Arg Asp Arg Tyr Pro Val Leu Phe Ala Thr
Asp Tyr Gly Met Asp1 5 10 15Val811PRTHomo sapiens 8Gln Gln Arg Ser
Ile Trp Pro Pro Gly Val Thr1 5 10919PRTHomo sapiens 9Thr Arg Asp
Gly Phe Arg Gly Ser Ser Trp Gly Tyr Ser Tyr Tyr Gly1 5 10 15Met Asp
Val1011PRTHomo sapiens 10Ala Ala Trp Asp Asp Ser Leu Asn Gly Pro
Val1 5 1011131PRTHomo sapiens 11Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30Trp Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Arg Ile Lys Ser Lys
Thr Asp Gly Gly Thr Ile Asp Tyr Ala Ala 50 55 60Pro Val Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80Val Tyr Leu
Gln Met Thr Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95Tyr Cys
Thr Thr Tyr Thr Glu Asp Met Arg Tyr Phe Asp Trp Leu Leu 100 105
110Arg Gly Gly Glu Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr
115 120 125Val Ser Ser 13012131PRTHomo sapiens 12Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ala 20 25 30Trp Met
Ser Trp Val Arg Gln Ala Pro Gly Glu Gly Leu Glu Trp Val 35 40 45Gly
Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Ile Asp Tyr Ala Ala 50 55
60Pro Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65
70 75 80Val Tyr Leu Gln Met Thr Ser Leu Lys Thr Glu Asp Thr Ala Val
Tyr 85 90 95Tyr Cys Thr Thr Tyr Thr Glu Asp Met Gln Tyr Phe Asp Trp
Leu Leu 100 105 110Arg Gly Gly Glu Thr Phe Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr 115 120 125Val Ser Ser 13013109PRTHomo sapiens
13Asp Ile Arg Leu Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser His Tyr Ile Ser Thr
Tyr 20 25 30Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Ala Ala Ser Asn Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Phe Gly Thr Asp Phe Ser Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr His Cys Gln Gln
Ser Tyr Ser Thr Pro Gly 85 90 95Arg Tyr Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys 100 10514109PRTHomo sapiens 14Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser Gln Tyr Ile Ser Thr Tyr 20 25 30Leu Asn Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ala
Ala Tyr Asn Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75
80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Gly
85 90 95Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100
10515122PRTHomo sapiens 15Gln Val Gln Leu Val Gln Ser Gly Val Thr
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Val Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Leu Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp
His Arg Val Trp Ala Ala Gly Tyr His Phe Asp Tyr Trp 100 105 110Gly
Gln Gly Ala Leu Val Thr Val Ser Ser 115 12016366DNAHomo sapiens
16caggtccagc tggtgcagtc tggggtaacc ttggtacagc ctggggggtc cctgagagtc
60tcctgtgcag cctctggatt cacctttagc agctatgcca tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcagct attagtggtc ttggcggaag
cacatactac 180gcagactccg tgaagggccg gttcaccatc tccagagaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgag agccgaggac
acggccgtat attactgtgc gaaagatcat 300cgggtttggg cagctggata
ccactttgac tactggggcc agggagccct ggtcaccgtc 360tcctca
36617122PRTHomo sapiens 17Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Val Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Leu Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp
His Arg Val Trp Ala Ala Gly Tyr His Phe Asp Tyr Trp 100 105 110Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 115 12018106PRTHomo sapiens
18Asp Ile Val Leu Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser
Trp 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Glu Ala Pro Lys Leu
Leu Ile 35 40 45Ser Asp Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Tyr Tyr Ser Ser Pro Thr 85 90 95Phe Gly Gly Gly Thr Lys Val Glu Ile
Lys 100 10519318DNAHomo sapiens 19gatattgtgc tgacccagtc tccttccacc
ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc gggccagtca gagtattagt
agctggttgg cctggtatca gcagaaacca 120ggggaagccc ctaaactcct
gatctctgat gcctccagtt tggaaagtgg ggtcccatca 180aggttcagcg
gcagtggatc tgggacagaa ttcactctca ccatcagcag cctgcagcct
240gatgattttg caacttatta ctgccaacag tattatagtt cccccacttt
cggcggaggg 300accaaggtgg aaatcaaa 31820106PRTHomo sapiens 20Asp Ile
Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly1 5 10 15Asp
Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp 20 25
30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Glu Ala Pro Lys Leu Leu Ile
35 40 45Ser Asp Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu
Gln Pro65 70 75 80Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr
Ser Ser Pro Thr 85 90 95Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100
10521122PRTHomo sapiens 21Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Glu Ile Ser Gly Leu Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Ala 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Ser Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp
His Arg Val Trp Ala Pro Gly Tyr Tyr Phe Asp His Trp 100 105 110Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 115 12022366DNAHomo sapiens
22gaggtgcagc tggtggagtc ggggggaggc ttggtacagc cgggggggtc cctgagactc
60tcctgtgcag cctctggatt cacctttagc agctatgcca tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcggaa attagcggtc ttggtggtag
cacatactac 180gcagactccg cgaagggccg gttcaccatc tccagagaca
attccaagag caccctgtat 240ctgcaaatga acagcctgag agccgaagac
acggccgtat attactgtgc gaaagatcat 300cgcgtttggg cacctggata
ttactttgac cactggggcc agggaaccct ggtcactgtc 360tcctca
36623106PRTHomo sapiens 23Asp Ile Val Leu Thr Gln Ser Pro Ser Thr
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Ser Ile Ser Ser Trp 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Asp Ala Ser Ser Leu Glu
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Asp Asp Phe Ala
Thr Tyr Phe Cys Gln Gln Tyr Asn Arg Ser Pro Thr 85 90 95Phe Gly Gly
Gly Thr Lys Val Glu Ile Lys 100 10524318DNAHomo sapiens
24gatattgtgc tgacgcagtc tccttccacc ctgtctgcat ctgtaggaga cagagtcacc
60atcacttgcc gggccagtca gagtattagt agctggttgg cctggtatca gcagaaacca
120gggaaagccc ctaaactcct gatctatgat gcctccagtt tggaaagtgg
ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa ttcactctca
ccatcagcag cctgcagcct 240gatgattttg caacttattt ctgccaacag
tataataggt cccccacttt cggcggaggg 300accaaggtgg aaatcaaa
31825131PRTHomo sapiens 25Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Asn Ala 20 25 30Trp Met Ser Trp Val Arg Gln Ala
Pro Gly Glu Gly Leu Glu Trp Val 35 40 45Gly Arg Ile Lys Ser Lys Thr
Asp Gly Gly Thr Ile Asp Tyr Ala Ala 50 55 60Pro Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr65 70 75 80Val Tyr Leu Gln
Met Thr Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95Tyr Cys Thr
Thr Tyr Thr Glu Asp Met Gln Tyr Phe Asp Trp Leu Leu 100 105 110Arg
Gly Gly Glu Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr 115 120
125Val Ser Ser 13026393DNAHomo sapiens 26gaggttcagc ttgttgaatc
tggtggtggt cttgtgaagc ctggtggttc tcttagactt 60agctgtgctg ctagcggttt
caccttctct aacgcttgga tgtcttgggt tagacaggct 120cctggtgaag
gtcttgaatg ggtgggaagg atcaagagca agaccgatgg tggtactatc
180gattacgctg ctcctgttaa gggaaggttc accatcagca gggatgatag
caagaacacc 240gtgtacctgc agatgacctc tcttaagact gaggataccg
ctgtgtacta ctgcactacc 300tacaccgagg atatgcagta cttcgattgg
cttcttaggg gtggtgagac tttcgattat 360tggggtcagg gtactctggt
gaccgtgtca tct 39327109PRTHomo sapiens 27Asp Ile Gln Met Thr Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Tyr Ile Ser Thr Tyr 20 25 30Leu Asn Trp Tyr
Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ala Ala
Tyr Asn Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75
80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Gly
85 90 95Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100
10528327DNAHomo sapiens 28gatattcaga tgacccagtc acctagcagc
ctgtctgctt ctgttggtga tagggtgacc 60attacctgca gggcttctca gtacatcagc
acctacctga attggtacca gcagaagcct 120ggtaaggctc ctaagcttct
tatctacgct gcttacaacc tgcagagcgg tgttccttct 180aggttctctg
gttctggaag cggaaccgat ttcaccctga ccatttcttc actgcagcct
240gaggatttcg ctacctatta ctgccagcag agctactcta ctcctggtag
gtacactttc 300ggtcagggta ctaaggttga gatcaag 32729124PRTHomo sapiens
29Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Thr Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Thr
Tyr 20 25 30Tyr Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Val 35 40 45Gly Ile Ile Asn Pro Ser Gly Gly Ile Thr Arg Tyr Ala
Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Leu Thr Arg Asp Thr Ser Thr
Thr Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Arg Tyr Pro Val Leu Phe
Ala Thr Asp Tyr Gly Met Asp 100 105 110Val Trp Gly Gln Gly Thr Thr
Val Thr Val Ser Ser 115 12030372DNAHomo sapiens 30caggtccagc
ttgtacagtc tggggctgag gtgacgaagc ctggggcctc agtgaaggtt 60tcctgcaagg
catctggata caccttcacc acctactata tgcactgggt gcgccaggcc
120cctggacaag ggcttgagtg ggtgggaata atcaacccta gtggtggtat
cacacggtac 180gcacagaagt tccagggcag agtcaccttg accagggaca
cgtccacgac cacagtctac 240atggagctga gcagcctgag atctgaggac
acggccgtgt attactgtgc gagagatcga 300taccccgtcc tttttgcgac
cgactacggt atggacgtct ggggccaagg gaccacggtc 360accgtctcct ca
37231109PRTHomo sapiens 31Asp Ile Val Met Thr Gln Ser Pro Ala Thr
Leu Ser Leu Ser Pro Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala
Ser Gln Ser Val Ser Gly Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn Arg Ala
Thr Gly Ile Pro Ala Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala
Val Tyr Tyr Cys Gln Gln Arg Ser Ile Trp Pro Pro 85 90 95Gly Val Thr
Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 10532326DNAHomo sapiens
32gatattgtga tgacacagtc tccagccacc ctgtctttgt ctccagggga aagagccacc
60ctctcctgca gggccagtca gagtgttagc ggctacttag cctggtacca acagaaacct
120ggccaggctc ccagactcct catctatgat gcatccaaca gggccactgg
catcccagcc 180aggttcagcg gcagtgggtc tgggacagac ttcactctca
ccatcagcag cctagagcct 240aagattttgc agtttattac tgtcagcagc
gaagcatctg gcctccgggg gtcactttcg 300gcggagggac caaggtggaa atcaaa
32633128PRTHomo sapiens 33Gln Val Gln Leu Gln Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Thr Ala Ser
Gly Phe Thr Phe Gly Asp Tyr 20 25 30Ala Met Ser Trp Phe Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Gly Phe Leu Arg Ser Lys Ala
Tyr Gly Gly Thr Ala Glu Tyr Ala Ala 50 55 60Ser Val Lys Gly Arg Phe
Thr Met Ser Arg Asp Asp Ser Lys Ser Ile65 70 75 80Ala Tyr Leu Gln
Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95Phe Cys Thr
Arg Asp Gly Phe Arg Gly Ser Ser
Trp Gly Tyr Ser Tyr 100 105 110Tyr Gly Met Asp Val Trp Gly Gln Gly
Thr Thr Val Thr Val Ser Ser 115 120 12534384DNAHomo sapiens
34caggtgcagc tgcaggagtc ggggggaggc ttggtaaagc cagggcggtc cctgagactc
60tcctgtacag cttctggatt cacctttggt gattatgcta tgagctggtt ccgccaggct
120ccagggaagg ggctggagtg ggtaggtttc cttagaagca aagcttatgg
tgggacagca 180gaatacgccg cgtctgtgaa aggcagattc accatgtcaa
gagatgattc caaaagcatc 240gcctatctgc aaatgaacag cctgaaaacc
gaggacacag ccgtgtattt ctgtactaga 300gatggatttc ggggcagcag
ctgggggtac tcctactacg gtatggacgt ctggggccaa 360gggaccacgg
tcaccgtctc ctca 38435110PRTHomo sapiens 35Ser Tyr Glu Leu Thr Gln
Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser
Cys Ser Gly Ser Ser Ser Asn Ile Gly Gly Asn 20 25 30Thr Val Ser Trp
Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45Ile Tyr Thr
Asn Asp Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60Gly Ser
Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Gln65 70 75
80Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Ala Ala Trp Asp Asp Ser Leu
85 90 95Asn Gly Pro Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100
105 11036330DNAHomo sapiens 36tcctatgagc tgactcagcc accctcagcg
tctgggaccc ccgggcagag ggtcaccatc 60tcttgttctg gaagcagctc caatatcgga
ggtaatactg taagctggta ccagcagctc 120ccaggaacgg cccccaaact
cctcatctat actaatgatc agcggccctc aggggtccct 180gaccgattct
ctggctccaa gtctggcacc tcagcctccc tggccatcag tgggctccag
240tctgaggatg aggctgatta ttattgtgca gcatgggatg acagcctgaa
tggtccggtg 300ttcggcggag ggaccaagct caccgtccta 33037131PRTHomo
sapiens 37Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Asn Ala 20 25 30Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val 35 40 45Gly Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr
Ile Asp Tyr Ala Ala 50 55 60Pro Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Asn Thr65 70 75 80Val Tyr Leu Gln Met Thr Ser Leu
Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95Tyr Cys Thr Thr Tyr Thr Glu
Asp Met Arg Tyr Phe Asp Trp Leu Leu 100 105 110Arg Gly Gly Glu Thr
Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr 115 120 125Val Ser Ser
13038393DNAHomo sapiens 38gaggtgcagc tggtggagtc tgggggaggc
ttggtaaagc ctggggggtc ccttagactc 60tcctgtgcag cctctggatt cactttcagt
aacgcctgga tgagctgggt ccgccaggct 120ccagggaagg ggctggagtg
ggttggccgg attaaaagca aaactgatgg tgggacaata 180gactacgctg
cacccgtgaa aggcagattc accatctcaa gagatgattc aaaaaacacg
240gtgtatctgc aaatgaccag cctgaaaacc gaggacacag ccgtgtatta
ctgtaccaca 300tacacggaag atatgcgata ttttgactgg ttattgcggg
gtggggaaac ctttgactac 360tggggccagg gaaccctggt caccgtctcc tca
39339109PRTHomo sapiens 39Asp Ile Arg Leu Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser His Tyr Ile Ser Thr Tyr 20 25 30Leu Asn Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ala Ala Ser Asn Leu Gln
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Phe Gly Thr Asp
Phe Ser Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala
Thr Tyr His Cys Gln Gln Ser Tyr Ser Thr Pro Gly 85 90 95Arg Tyr Thr
Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10540327DNAHomo sapiens
40gacatccggt tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc
60atcacttgcc gggcaagtca ctacattagc acctatttaa attggtatca gcagaaacca
120gggaaagccc ctaagctcct gatctatgct gcatccaatt tacaaagtgg
ggtcccatca 180aggttcagtg gcagtggatt tgggacagat ttctctctca
ccatcagcag tctgcaacct 240gaagatttcg caacttacca ctgtcaacag
agttacagta ccccagggag gtacactttt 300ggccagggga ccaaggtgga aatcaaa
3274110PRTHomo sapiens 41Gly Phe Thr Phe Ser Ser Tyr Ala Met Ser1 5
104215PRTHomo sapiens 42Ala Ile Ser Gly Leu Gly Gly Ser Thr Tyr Tyr
Ala Asp Ser Val1 5 10 154313PRTHomo sapiens 43Asp His Arg Val Trp
Ala Ala Gly Tyr His Phe Asp Tyr1 5 104411PRTHomo sapiens 44Arg Ala
Ser Gln Ser Ile Ser Ser Trp Leu Ala1 5 10457PRTHomo sapiens 45Asp
Ala Ser Ser Leu Glu Ser1 5468PRTHomo sapiens 46Gln Gln Tyr Tyr Ser
Ser Pro Thr1 54710PRTHomo sapiens 47Gly Phe Thr Phe Ser Ser Tyr Ala
Met Ser1 5 104816PRTHomo sapiens 48Glu Ile Ser Gly Leu Gly Gly Ser
Thr Tyr Tyr Ala Asp Ser Ala Lys1 5 10 154913PRTHomo sapiens 49Asp
His Arg Val Trp Ala Pro Gly Tyr Tyr Phe Asp His1 5 105011PRTHomo
sapiens 50Arg Ala Ser Gln Ser Ile Ser Ser Trp Leu Ala1 5
10517PRTHomo sapiens 51Asp Ala Ser Ser Leu Glu Ser1 5528PRTHomo
sapiens 52Gln Gln Tyr Asn Arg Ser Pro Thr1 55310PRTHomo sapiens
53Gly Phe Thr Phe Ser Asn Ala Trp Met Ser1 5 105418PRTHomo sapiens
54Arg Ile Lys Ser Lys Thr Asp Gly Gly Thr Ile Asp Tyr Ala Ala Pro1
5 10 15Val Lys5520PRTHomo sapiens 55Tyr Thr Glu Asp Met Gln Tyr Phe
Asp Trp Leu Leu Arg Gly Gly Glu1 5 10 15Thr Phe Asp Tyr
205611PRTHomo sapiens 56Arg Ala Ser Gln Tyr Ile Ser Thr Tyr Leu
Asn1 5 10577PRTHomo sapiens 57Ala Ala Tyr Asn Leu Gln Ser1
55811PRTHomo sapiens 58Gln Gln Ser Tyr Ser Thr Pro Gly Arg Tyr Thr1
5 105910PRTHomo sapiens 59Gly Tyr Thr Phe Thr Thr Tyr Tyr Met His1
5 106016PRTHomo sapiens 60Ile Ile Asn Pro Ser Gly Gly Ile Thr Arg
Tyr Ala Gln Lys Phe Gln1 5 10 156115PRTHomo sapiens 61Asp Arg Tyr
Pro Val Leu Phe Ala Thr Asp Tyr Gly Met Asp Val1 5 10 156211PRTHomo
sapiens 62Arg Ala Ser Gln Ser Val Ser Gly Tyr Leu Ala1 5
10637PRTHomo sapiens 63Asp Ala Ser Asn Arg Ala Thr1 56411PRTHomo
sapiens 64Gln Gln Arg Ser Ile Trp Pro Pro Gly Val Thr1 5
106510PRTHomo sapiens 65Gly Phe Thr Phe Gly Asp Tyr Ala Met Ser1 5
106618PRTHomo sapiens 66Phe Leu Arg Ser Lys Ala Tyr Gly Gly Thr Ala
Glu Tyr Ala Ala Ser1 5 10 15Val Lys6717PRTHomo sapiens 67Asp Gly
Phe Arg Gly Ser Ser Trp Gly Tyr Ser Tyr Tyr Gly Met Asp1 5 10
15Val6813PRTHomo sapiens 68Ser Gly Ser Ser Ser Asn Ile Gly Gly Asn
Thr Val Ser1 5 10697PRTHomo sapiens 69Thr Asn Asp Gln Arg Pro Ser1
57014PRTHomo sapiens 70Trp Asp Asp Ser Leu Asn Gly Pro Val Phe Gly
Gly Gly Thr1 5 107110PRTHomo sapiens 71Gly Phe Thr Phe Ser Asn Ala
Trp Met Ser1 5 107218PRTHomo sapiens 72Arg Ile Lys Ser Lys Thr Asp
Gly Gly Thr Ile Asp Tyr Ala Ala Pro1 5 10 15Val Lys7320PRTHomo
sapiens 73Tyr Thr Glu Asp Met Arg Tyr Phe Asp Trp Leu Leu Arg Gly
Gly Glu1 5 10 15Thr Phe Asp Tyr 207411PRTHomo sapiens 74Arg Ala Ser
His Tyr Ile Ser Thr Tyr Leu Asn1 5 10757PRTHomo sapiens 75Ala Ala
Ser Asn Leu Gln Ser1 57611PRTHomo sapiens 76Gln Gln Ser Tyr Ser Thr
Pro Gly Arg Tyr Thr1 5 10
* * * * *