U.S. patent application number 16/651460 was filed with the patent office on 2020-08-20 for method of prognosis.
This patent application is currently assigned to ALFRED HEALTH. The applicant listed for this patent is ALFRED HEALTH PEKING UNIVERSITY THIRD HOSPITAL. Invention is credited to ANTHONY DART, Wei GAO.
Application Number | 20200264196 16/651460 |
Document ID | 20200264196 / US20200264196 |
Family ID | 1000004845085 |
Filed Date | 2020-08-20 |
Patent Application | download [pdf] |
![](/patent/app/20200264196/US20200264196A1-20200820-D00000.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00001.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00002.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00003.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00004.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00005.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00006.png)
![](/patent/app/20200264196/US20200264196A1-20200820-D00007.png)
United States Patent
Application |
20200264196 |
Kind Code |
A1 |
DART; ANTHONY ; et
al. |
August 20, 2020 |
METHOD OF PROGNOSIS
Abstract
Provided is a method for prognosing ACS in a subject, the method
comprising determining plasma MIF and Nt-ProBNP (or BNP)
concentrations in a sample from the subject, diagnosing ACS when
the subject plasma concentrations are greater than a reference MIF
and Nt-proBNP (or BNP) plasma concentration, and prognosing the
magnitude of ACS from the subject plasma MIF and Nt-proBNP (or BNP)
concentrations. Also provided are a device, a kit and a cardiac
biomarker panel related to the methods of prognosing ACS.
Inventors: |
DART; ANTHONY; (Melbourne,
AU) ; GAO; Wei; (Beijing, CN) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ALFRED HEALTH
PEKING UNIVERSITY THIRD HOSPITAL |
Melbourne
Beijing |
|
AU
CN |
|
|
Assignee: |
ALFRED HEALTH
Melbourne
AU
PEKING UNIVERSITY THIRD HOSPITAL
Beijing
CN
|
Family ID: |
1000004845085 |
Appl. No.: |
16/651460 |
Filed: |
September 30, 2017 |
PCT Filed: |
September 30, 2017 |
PCT NO: |
PCT/CN2017/104752 |
371 Date: |
March 27, 2020 |
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
G16H 10/40 20180101;
G01N 2800/324 20130101; G01N 33/6893 20130101; G16H 40/63 20180101;
G01N 2800/52 20130101; G01N 2333/58 20130101; G16H 50/30 20180101;
G16H 50/20 20180101; G16H 50/70 20180101; G16H 70/60 20180101; G01N
2333/4712 20130101; G01N 2800/50 20130101 |
International
Class: |
G01N 33/68 20060101
G01N033/68; G16H 50/20 20060101 G16H050/20; G16H 10/40 20060101
G16H010/40; G16H 50/30 20060101 G16H050/30; G16H 70/60 20060101
G16H070/60; G16H 50/70 20060101 G16H050/70; G16H 40/63 20060101
G16H040/63 |
Claims
1. A method for providing a prognosis of acute coronary syndrome
(ACS) in a subject comprising determining the concentration of (a)
macrophage migration inhibitory factor (MIF) or fragment thereof,
and (b) N-terminal prohormone of brain natriuretic peptide
(Nt-proBNP) or a fragment thereof, in a sample from the subject,
and prognosing ACS when the subject plasma MIF and Nt-proBNP
concentration is greater than a reference plasma MIF and Nt-proBNP
concentration.
2. A method for providing a prognosis of a subject having acute
coronary syndrome (ACS), the method comprising: determining the
concentration of (a) macrophage migration inhibitory factor (MIF)
or fragment thereof, and (b) N-terminal prohormone of brain
natriuretic peptide (Nt-proBNP) or a fragment thereof, in a sample
from the subject, comparing the concentration of MIF or fragment
thereof to a reference MIF concentration, comparing the
concentration of Nt-proBNP or fragment thereof to a reference
Nt-proBNP concentration, wherein the concentration of MIF or
fragment thereof and Nt-proBNP or fragment thereof compared to
their respective reference concentrations is indicative of the
subject's prognosis.
3. A method for providing a prognosis of a subject having ACS, the
method comprising determining the concentration of (a) macrophage
migration inhibitory factor (MIF) or fragment thereof, and (b)
N-terminal prohormone of brain natriuretic peptide (Nt-proBNP) or a
fragment thereof, in a sample from the subject, comparing the
concentration of MIF or fragment thereof to a reference MIF
concentration, comparing the concentration of Nt-proBNP or fragment
thereof to a reference Nt-proBNP concentration, wherein the
reference concentrations of MIF and Nt-proBNP are concentrations
below which correlate with an increased probability of survival and
a decreased probability of non-fatal cardiac events at a later
time, and above which correlate with a decreased probability of
survival and an increased probability of non-fatal cardiac events
at a later time, thereby providing a prognosis of a subject having
ACS.
4. A method for providing a prognosis of a subject having ACS, the
method comprising analysing levels of (a) macrophage migration
inhibitory factor (MIF) or fragment thereof and (b) B N-terminal
prohormone of brain natriuretic peptide (Nt-proBNP) or a fragment
thereof, in a sample from the subject determining the concentration
of macrophage migration inhibitory factor (MIF) or fragment thereof
and N-terminal prohormone of brain natriuretic peptide (Nt-proBNP)
or a fragment thereof in the sample from the subject, comparing the
concentration of MIF or fragment thereof to a reference MIF
concentration, comparing the concentration of Nt-proBNP or fragment
thereof to a reference Nt-proBNP concentration, assigning the
subject to a risk group based on whether the concentration of MIF
or fragment thereof is higher or lower than the reference
concentration, and whether the concentration of Nt-proBNP or
fragment thereof is higher or lower than the reference
concentration, wherein a concentration of MIF or fragment thereof
that is higher than the reference MIF concentration indicates a low
likelihood of survival and high likelihood of non-fatal cardiac
events, wherein a concentration of Nt-proBNP or fragment thereof
that is higher than the reference Nt-proBNP concentration indicates
a low likelihood of survival and high likelihood of non-fatal
cardiac events, thereby providing a prognosis of a subject having
ACS.
5. A method for providing a prognosis of a subject having ACS, the
method comprising determining the concentration of macrophage
migration inhibitory factor (MIF) or a fragment thereof in a sample
from the subject, wherein if the concentration of MIF or fragment
thereof from the sample from the subject is equal to or higher than
about 70 ng/ml the subject is determined to have a decreased
probability of survival and an increased probability of non-fatal
cardiac events at a later time, wherein if the concentration of MIF
or fragment thereof from the sample from the subject is lower than
about 70 ng/ml the subject is determined to have an increased
probability of survival and a decreased probability of non-fatal
cardiac events at a later time, thereby providing a prognosis of a
subject having ACS.
6. A method for providing a prognosis of a subject having ACS, the
method comprising determining the concentration of macrophage
migration inhibitory factor (MIF) or a fragment thereof in a sample
from the subject, comparing the concentration of MIF or fragment
thereof to reference MIF concentrations of about 40 ng/ml and about
70 ng/ml, wherein if the concentration of MIF or fragment thereof
from the sample from the subject is equal to or lower than about 40
ng/ml the subject is determined to have a high probability of
survival and a low probability of non-fatal cardiac events at a
later time, wherein if the concentration of MIF or fragment thereof
from the sample from the subject is equal to or higher than about
70 ng/ml the subject is determined to have a low probability of
survival and a high probability of non-fatal cardiac events at a
later time, thereby providing a prognosis of a subject having
ACS.
7. The method according to any one of claims 1 to 6, further
comprising determining the concentration of troponin or a fragment
thereof.
8. The method according to any one of claims 1 to 7, wherein the
concentrations of MIF, Nt-proBNP and/or troponin or fragments
thereof are determined from plasma.
9. The method according to any one of claims 1 to 8, wherein ACS is
acute myocardial infarction (AMI).
10. The method according to claim 9, wherein the AMI is ST
elevation myocardial infarction (STEMI).
11. The method according to any one of claims 1 to 10, comprising
determining MIF concentration of the subject in a sample taken less
than 4 hours after symptom onset.
12. The method of claim 11, wherein the MIF sample is taken 3 hours
or less, 2 hours or less, 1 hour or less, or 30 minutes or less
after symptom onset.
13. The method of any one of claims 1 to 12, wherein instead of the
concentration of N-terminal prohormone of brain natriuretic peptide
(Nt-proBNP), the concentration of brain natriuretic peptide (BNP)
is determined.
14. The method of any one of claims 7 to 13, wherein the troponin
is high sensitive-troponin T (hs-TnT).
15. The method according to any one of claims 1 to 14, wherein
prognosis is determined by assessing MACE-Free survival, All-cause
mortality free survival, cardiac death free survival or HF
rehospitalisation free survival.
16. The method according to any one of claims 1 to 15, wherein
Nt-proBNP (or BNP) and MIF are measured in the same sample.
17. The method according to any one of claims 1 to 16, further
comprising performing a step of performing percutaneous coronary
intervention (PCI) and/or thrombinolysis on the subject.
18. A method of treating acute coronary syndrome (ACS) in a
subject, the method comprising: (a) determining macrophage
migration inhibitory factor (MIF) or fragment thereof and
N-terminal prohormone of brain natriuretic peptide (Nt-proBNP) or
fragment thereof concentration in a sample taken from the subject,
and prognosing ACS when the subject MIF and Nt-proBNP concentration
is greater than a reference MIF and Nt-proBNP concentration; and
(b) performing percutaneous coronary intervention (PCI) and/or
thrombinolysis on the subject.
19. A device comprising means for determining concentration of
macrophage migration inhibitory factor (MIF) or fragment thereof
and N-terminal prohormone of brain natriuretic peptide (Nt-proBNP)
or fragment thereof in a sample from a subject, for use in a method
according to any one of claims 1 to 18.
20. The device of claim 19, comprising means for performing an
immunoassay for determining concentrations of MIF and Nt-proBNP (or
BNP).
21. The device of claim 19 or 20, wherein the device is a point of
care device.
22. The method according to claim 18, or device according to any
one of claims 19 to 21, further comprising determining the
concentration of troponin or a fragment thereof.
23. The method or device of claim 22, wherein the troponin is high
sensitive-troponin T (hs-TnT).
24. The method according to any one of claims 7 to 17, wherein if
the concentration of troponin from the sample from the subject is
equal to or higher than about 4.5 ng/ml the subject is determined
to have a decreased probability of survival and an increased
probability of non-fatal cardiac events at a later time, wherein if
the concentration of troponin from the sample from the subject is
lower than about 4.5 ng/ml the subject is determined to have an
increased probability of survival and a decreased probability of
non-fatal cardiac events at a later time, thereby providing a
prognosis of a subject having ACS.
25. The method or device of any one of claims 19 to 23, wherein
instead of the concentration of N-terminal prohormone of brain
natriuretic peptide (Nt-proBNP), the concentration of BNP is
determined, or the device comprises a means for determining the
concentration of BNP.
26. The method according to any one of claims 1 to 18, wherein if
the concentration of Nt-proBNP (or BNP) from the sample from the
subject is equal to or higher than about 1200 pg/ml the subject is
determined to have a decreased probability of survival and an
increased probability of non-fatal cardiac events at a later time,
wherein if the concentration of Nt-proBNP (or BNP) from the sample
from the subject is lower than about 1200 pg/ml the subject is
determined to have an increased probability of survival and a
decreased probability of non-fatal cardiac events at a later time,
thereby providing a prognosis of a subject having ACS.
27. The method or device of any one of claims 18 to 26, wherein the
concentrations of MIF, Nt-proBNP (or BNP) and/or troponin are
determined from plasma.
28. A kit comprising a reagent for measuring macrophage migration
inhibitory factor (MIF) and Nt-proBNP (or BNP) concentrations in a
sample from a subject, for use in a method for prognosing ACS in
the subject, the method comprising determining MIF and Nt-proBNP
(or BNP) concentrations in the sample, prognosing ACS when the
subject MIF and Nt-proBNP (or BNP) concentrations are greater than
a reference MIF and Nt-proBNP (or BNP) concentration; and/or
comprising the device of any one of claims 19 to 21.
29. The kit of claim 28, further comprising determining the
concentration of troponin or a fragment thereof.
30. The kit of claim 28 or 29, wherein the reagent comprises an
anti-MIF antibody, an anti-Nt-proBNP (or BNP) antibody and/or and
anti-troponin antibody.
31. The kit of claim 29, wherein the troponin is high
sensitive-troponin T (hs-TnT).
32. The kit of any one of claims 28 to 31, wherein instead of the
concentration of N-terminal prohormone of brain natriuretic peptide
(Nt-proBNP), the concentration of BNP is determined, or the kit
comprises a reagent for measuring BNP.
33. A cardiac biomarker panel comprising plasma macrophage
migration inhibitory factor (MIF) and N-terminal prohormone of
brain natriuretic peptide (Nt-proBNP) in a sample from a subject,
wherein MIF and Nt-proBNP concentrations greater than reference MIF
and Nt-proBNP concentrations are prognostic of the magnitude of ACS
in the subject.
34. The cardiac biomarker panel of claim 33, further comprising
troponin in a sample from a subject, wherein MIF, Nt-proBNP and
troponin concentrations greater than reference MIF, Nt-proBNP and
troponin concentrations are prognostic of the magnitude of ACS in
the subject.
35. The cardiac biomarker panel of claim 33 or 34, wherein the ACS
is AMI.
36. The cardiac biomarker panel of any one of claims 33 to 35,
wherein the AMI is ST elevation myocardial infarction (STEMI).
37. The method according to any one of claims 1 to 18, or 22 to 27,
wherein the concentration of BNP is determined in plasma derived
from a blood sample obtained from a patient 3 days following
symptom onset.
38. The method according to any one of claims 1 to 18, 22 to 27 or
37, further comprising determining the concentration of another
biomarker selected from the group consisting of myoglobin, creatine
kinase (CK) or C reactive protein (CRP).
39. The method according to claim 5 or 6, wherein a MIF level
greater than about 70 ng/ml is indicative of a 5 year MACE
prognosis rate of about 35% and death prognosis rate of about
20%.
40. The method according to claim 26, wherein a MIF level greater
than about 70 ng/ml and a Nt-proBNP level greater than about 1200
pg/ml is indicative of a 5 year MACE prognosis rate of about 50%
and death prognosis rate of about 25%.
41. The method according to claim 40, wherein a troponin level
greater than about 4.5 ng/ml is indicative of a 5 year MACE
prognosis rate of about 50% and death prognosis rate of about 25%.
Description
FIELD OF THE INVENTION
[0001] The invention relates to a method for prognosing acute
coronary syndrome, and a cardiac biomarker for use in the methods.
The invention also relates to a device and a kit for use according
to the methods.
BACKGROUND OF THE INVENTION
[0002] Reference to any prior art in the specification is not an
acknowledgment or suggestion that this prior art forms part of the
common general knowledge in any jurisdiction or that this prior art
could reasonably be expected to be understood, regarded as
relevant, and/or combined with other pieces of prior art by a
skilled person in the art.
[0003] The use of plasma biomarkers has become central to the
diagnosis and prognosis of cardiovascular events. For example, the
prognostic impact of myoglobin elevation among patients with
coronary artery disease (CAD) is well established.
[0004] Current therapies and timely primary percutaneous coronary
intervention (PCI) have significantly improved the prognosis of
patients with ST-segment elevated myocardial infarction (STEMI)
during the last few decades. However, recurrent major adverse
cardiovascular events (MACE) after STEMI remains common. Early risk
stratification of patients with high risk of long-term MACE is
critical for allocation of aggressiveness of therapy and intensity
of care to improve their prognosis.
[0005] Existing plasma biomarkers that can be utilised to diagnose
and/or prognose STEMI or acute coronary syndrome include myoglobin,
creatine kinase-MB (CK-MB), and troponin. Each of these plasma
biomarkers however are associated with problems. For instance,
whilst myoglobin peaks in plasma approximately 2 hours after a
cardiac event, it has low cardiac-specificity. Also, whilst CK
peaks in plasma approximately 10 hours after a cardiac event,
cumulative plasma CK concentrations are not available until at
least 48 hours after the cardiac event. Furthermore, CK is not
cardiac-specific.
[0006] Troponin has become the predominant plasma biomarker for the
early detection of acute coronary syndrome such as myocardial
necrosis, and has largely superseded the measurement of CK. The
single measurement of plasma troponin is one of the most sensitive
and specific tests for myocardial necrosis at present. Whilst
current evidence suggests that a low single admission troponin can
be used to exclude (rule out) a diagnosis of ACS in subjects with a
low a probability of ACS, most patients require 5 serial measures
over 6 or more hours to safely exclude such a diagnosis.
[0007] Therefore, there is a need for a new or improved method for
prognosing acute coronary syndrome.
SUMMARY OF THE INVENTION
[0008] The present invention provides a method for providing a
prognosis of acute coronary syndrome (ACS) in a subject comprising:
[0009] determining the concentration of [0010] (a) macrophage
migration inhibitory factor (MIF) or a fragment thereof, and [0011]
(b) N-terminal prohormone of brain natriuretic peptide (Nt-proBNP)
or a fragment thereof, [0012] in a sample from the subject, [0013]
and [0014] prognosing ACS when the subject plasma MIF and Nt-proBNP
concentration is greater than a reference plasma MIF and a
reference plasma Nt-proBNP concentration.
[0015] The present invention provides a method for providing a
prognosis of acute coronary syndrome (ACS) in a subject comprising:
[0016] determining the concentration of [0017] (a) macrophage
migration inhibitory factor (MIF) or a fragment thereof, and [0018]
(b) B-type natriuretic peptide (BNP) or a fragment thereof, [0019]
in a sample from the subject, [0020] and [0021] prognosing ACS when
the subject plasma MIF and BNP concentration is greater than a
reference plasma MIF and a reference plasma BNP concentration.
[0022] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising [0023]
determining the concentration of [0024] (a) macrophage migration
inhibitory factor (MIF) or a fragment thereof, and [0025] (b)
N-terminal prohormone of brain natriuretic peptide (Nt-proBNP) or a
fragment thereof, [0026] in a sample from the subject,
[0027] comparing the concentration of MIF to a reference MIF
concentration,
[0028] comparing the concentration of Nt-proBNP to a reference
Nt-proBNP concentration,
[0029] wherein the concentration of MIF and Nt-proBNP compared to
their respective reference concentrations is indicative of the
subject's prognosis.
[0030] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0031] determining the concentration of [0032] (a) macrophage
migration inhibitory factor (MIF) or a fragment thereof, and [0033]
(b) B-type natriuretic peptide (BNP) or a fragment thereof, in a
sample from the subject,
[0034] comparing the concentration of MIF to a reference MIF
concentration,
[0035] comparing the concentration of BNP to a reference BNP
concentration,
[0036] wherein the concentration of MIF and BNP compared to their
respective reference concentrations is indicative of the subject's
prognosis.
[0037] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0038] determining the concentration of [0039] (a) macrophage
migration inhibitory factor (MIF) or fragment thereof, and [0040]
(b) N-terminal prohormone of brain natriuretic peptide (Nt-proBNP)
or a fragment thereof [0041] in a sample from the subject,
[0042] comparing the concentration of MIF to a reference MIF
concentration,
[0043] comparing the concentration of Nt-proBNP to a reference
Nt-proBNP concentration,
[0044] wherein the reference concentrations of MIF and Nt-proBNP
are concentrations below those which correlate with an increased
probability of survival and a decreased probability of non-fatal
cardiac events at a later time, and above those which correlate
with a decreased probability of survival and an increased
probability of non-fatal cardiac events at a later time,
[0045] thereby providing a prognosis of a subject having ACS.
[0046] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0047] determining the concentration of [0048] (c) macrophage
migration inhibitory factor (MIF) or fragment thereof, and [0049]
(d) B-type natriuretic peptide (BNP) or a fragment thereof [0050]
in a sample from the subject,
[0051] comparing the concentration of MIF to a reference MIF
concentration,
[0052] comparing the concentration of BNP to a reference BNP
concentration,
[0053] wherein the reference concentrations of MIF and BNP are
concentrations below those which correlate with an increased
probability of survival and a decreased probability of non-fatal
cardiac events at a later time, and above those which correlate
with a decreased probability of survival and an increased
probability of non-fatal cardiac events at a later time,
[0054] thereby providing a prognosis of a subject having ACS.
[0055] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0056] analysing levels of (a) macrophage migration inhibitory
factor (MIF) or fragment thereof, and (b) N-terminal prohormone of
brain natriuretic peptide (Nt-proBNP) or a fragment thereof, in a
sample from the subject,
[0057] determining the concentration of MIF or fragment thereof and
Nt-proBNP or a fragment thereof in the sample from the subject,
[0058] comparing the concentration of MIF or fragment thereof to a
reference MIF concentration,
[0059] comparing the concentration of Nt-proBNP or fragment thereof
to a reference Nt-proBNP concentration,
[0060] assigning the subject to a risk group based on whether the
concentration of MIF or fragment thereof is higher or lower than
the reference concentration, and whether the concentration of
Nt-proBNP or fragment thereof is higher or lower than the reference
concentration,
[0061] wherein a concentration of MIF or fragment thereof that is
higher than the reference MIF concentration indicates a low
likelihood of survival and/or high likelihood of non-fatal cardiac
events,
[0062] wherein a concentration of Nt-proBNP or fragment thereof
that is higher than the reference Nt-proBNP concentration indicates
a low likelihood of survival and/or high likelihood of non-fatal
cardiac events,
[0063] thereby providing a prognosis of a subject having ACS.
[0064] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0065] analysing levels of (a) macrophage migration inhibitory
factor (MIF) or fragment thereof, and (b) B-type natriuretic
peptide (BNP) or a fragment thereof, in a sample from the
subject,
[0066] determining the concentration of macrophage migration
inhibitory factor (MIF) or fragment thereof and B-type natriuretic
peptide (BNP) or a fragment thereof in the sample from the
subject,
[0067] comparing the concentration of MIF or fragment thereof to a
reference MIF concentration,
[0068] comparing the concentration of BNP or fragment thereof to a
reference BNP concentration,
[0069] assigning the subject to a risk group based on whether the
concentration of MIF or fragment thereof is higher or lower than
the reference concentration, and whether the concentration of BNP
or fragment thereof is higher or lower than the reference
concentration,
[0070] wherein a concentration of MIF or fragment thereof that is
higher than the reference MIF concentration indicates a low
likelihood of survival and/or high likelihood of non-fatal cardiac
events,
[0071] wherein a concentration of BNP or fragment thereof that is
higher than the reference BNP concentration indicates a low
likelihood of survival and/or high likelihood of non-fatal cardiac
events,
[0072] thereby providing a prognosis of a subject having ACS.
[0073] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0074] determining the concentration of macrophage migration
inhibitory factor (MIF) or a fragment thereof in a sample from the
subject,
[0075] wherein if the concentration of MIF from the sample from the
subject is equal to or higher than about 70 ng/ml the subject is
determined to have a decreased probability of survival and an
increased probability of non-fatal cardiac events at a later
time,
[0076] wherein if the concentration of MIF from the sample from the
subject is lower than about 70 ng/ml the subject is determined to
have an increased probability of survival and a decreased
probability of non-fatal cardiac events at a later time,
[0077] thereby providing a prognosis of a subject having ACS.
[0078] The present invention also provides a method for providing a
prognosis of a subject having ACS, the method comprising
[0079] determining the concentration of macrophage migration
inhibitory factor (MIF) or a fragment thereof in a sample from the
subject,
[0080] comparing the concentration of MIF to reference MIF
concentrations of about 40 ng/ml and about 70 ng/ml,
[0081] wherein if the concentration of MIF from the sample from the
subject is equal to or lower than about 40 ng/ml the subject is
determined to have a high probability of survival and a low
probability of non-fatal cardiac events at a later time,
[0082] wherein if the concentration of MIF from the sample from the
subject is equal to or higher than about 70 ng/ml the subject is
determined to have a low probability of survival and a high
probability of non-fatal cardiac events at a later time,
[0083] thereby providing a prognosis of a subject having ACS.
[0084] In any aspect of the invention, the prognosis is of
survival, preferably long term survival, or non-fatal cardiac
events. Survival may be selected from MACE-Free survival, all-cause
mortality free survival, cardiac death free survival or heart
failure (HF) rehospitalisation free survival, or any other survival
described herein. Non-fatal cardiac events may include MACE and
adverse improvement of LVEF.
[0085] In any aspect of the invention, the prognosis may be
indicative of survival 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22,
24, 26, 28, 30, 32, 34, 36, 28, 40, 42, 44, 46, 48, 50, 52, 54, 56,
58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80 or more, months
following diagnosis of ACS.
[0086] In any aspect of the invention, the present invention
further comprises determining the concentration of troponin or a
fragment thereof. Preferably, the troponin is high
sensitive-troponin T (hs-TnT). The method also further comprises
comparing the concentration of troponin or a fragment thereof to a
reference troponin concentration. The reference concentration of
troponin is a concentration below which correlates with an
increased probability of survival and a decreased probability of
non-fatal cardiac events at a later time, and above which
correlates with a decreased probability of survival and an
increased probability of non-fatal cardiac events.
[0087] In any aspect of the invention, the concentration of either
BNP, or a fragment thereof, or N-terminal prohormone of brain
natriuretic peptide (Nt-proBNP), or a fragment thereof, may be
measured, analysed or determined. BNP is synthesized as a 134-amino
acid preprohormone (preproBNP), encoded by the human gene NPPB.
Removal of the 25-residue N-terminal signal peptide generates the
prohormone, proBNP, which is stored intracellularly as an O-linked
glycoprotein; proBNP is subsequently cleaved between arginine-102
and serine-103 by a specific convertase into Nt-proBNP and the
biologically active 32-amino acid polypeptide BNP, which are
secreted into the blood in equimolar amounts.
[0088] In any aspect of the invention, the method comprises
determining the concentrations of MIF, Nt-proBNP (or BNP) and/or
troponin from plasma, blood or serum. Preferably, the method
comprises determining the concentrations of MIF, Nt-proBNP and/or
troponin from plasma.
[0089] In any aspect of the invention, the acute coronary syndrome
is acute myocardial infarction (AMI). The AMI may be ST elevation
myocardial infarction (STEMI) or non-ST elevation myocardial
infarction (non-STEMI). Preferably, the AMI is STEMI. In some
embodiments, the subject with STEMI may have been treated with
primary percutaneous coronary intervention (PCI).
[0090] In any aspect of the invention, the method further comprises
performing a step of performing percutaneous coronary intervention
(PCI) and/or thrombolysis on the subject. Preferably, the
performing a step of performing percutaneous coronary intervention
(PCI) and/or thrombolysis is only performed on those subjects
identified as having a poor prognosis, or in other words, a
decreased or low likelihood of survival and an increased or high
likelihood of non-fatal cardiac events.
[0091] In any aspect of the invention, the method comprises
determining MIF concentrations in a sample taken less than 4 hours
after symptom onset or hospital admission. Alternatively, a MIF
sample may be taken from a subject obtained 210 minutes, 180
minutes, 150 minutes, 120 minutes, 110 minutes, 100 minutes, 90
minutes, 80 minutes, 70 minutes, 60 minutes, 50 minutes, 40
minutes, 30 minutes, 20 minutes, 10 minutes or 5 minutes or less
after symptom onset or hospital admission.
[0092] In any aspect of the invention, the method comprises
determining Nt-proBNP or BNP concentration in a sample taken about,
or between, any of the following: 0.5 days, 1.0 day, 1.5 days, 2.0
days, 2.5 days, 3.0 days, 3.5 days, 4.0 days, 4.5 days, 5.0 days,
5.5 days, 6.0 days, 6.5 days or more after symptom onset or
hospital admission. Preferably, Nt-proBNP or BNP concentrations are
determined in a sample obtained from a patient about 3 days
following symptom onset or hospital admission.
[0093] In any aspect of the invention, the method comprises
determining troponin concentration in a sample taken about, or
between, any of the following: 0.5 days, 1.0 day, 1.5 days, 2.0
days, 2.5 days, 3.0 days, 3.5 days, 4.0 days, 4.5 days, 5.0 days,
5.5 days, 6.0 days, 6.5 days, 7.0 days, 7.5 days, 8.0 days, 8.5
days, 9.0 days, 9.5 days, 10.0 days, 10.5 days, 11 days, 11.5 days,
12 days or more after symptom onset or hospital admission.
Preferably, the troponin is high sensitive-troponin T (hs-TnT).
[0094] In any aspect of the invention, the concentration of MIF,
Nt-proBNP or BNP, and troponin are determined in the same sample.
Alternatively, Nt-proBNP or BNP, troponin and MIF may be determined
from different samples.
[0095] The present invention provides a method of providing a
prognosis of a subject following a diagnosis of acute coronary
syndrome (ACS) comprising determining the concentration of
macrophage migration inhibitory factor (MIF) and N-terminal
prohormone of brain natriuretic peptide (Nt-proBNP) or a fragment
thereof in a sample from the subject, and prognosing ACS when the
subject MIF and Nt-proBNP concentration is greater than a reference
MIF and Nt-proBNP concentration.
[0096] In any aspect of the invention, the method comprises
determining whether the concentration of MIF falls within the
concentration range of between about 40 ng/ml to 70 ng/ml, less
than about 40 ng/ml or more than about 70 ng/ml. Preferably, a MIF
concentration of more than about 70 ng/ml is associated with the
worst prognosis. In any aspect of the invention, the reference
concentration may be 40 ng/ml, 70 ng/ml or any one of the
concentrations described in Table 2.
[0097] In any aspect of the invention, the method comprises
determining whether the concentration of hs-TnT falls within the
range of about 2.5 ng/ml to about 4.5 ng/ml, equal to or less than
about 2.5 ng/ml, or equal to or more than about 4.5 ng/ml.
Preferably, a hs-TnT concentration of equal to or more than about
4.5 ng/ml is associated with the worst prognosis. In any aspect of
the invention, the reference concentration may be 2.5 ng/ml, 4.5
ng/ml or any one of the concentrations described in Table 2.
[0098] In any aspect of the invention, the method comprises
determining whether the concentrations of Nt-proBNP fall within the
range of between about 700 pg/ml to about 1200 pg/ml, equal to or
less than about 700 pg/ml, or equal to or more than about 1200
pg/ml. Preferably, a concentration of Nt-proBNP more than about
1200 pg/ml is associated with the worst prognosis. In any aspect of
the invention, the reference concentration may be 700 pg/ml, 1200
pg/ml or any one of the concentrations described in Table 2.
[0099] The present invention provides a method of treating acute
coronary syndrome (ACS) in a subject, the method comprising:
[0100] determining macrophage migration inhibitory factor (MIF) or
fragment thereof and N-terminal prohormone of brain natriuretic
peptide (Nt-proBNP) or fragment thereof concentration in a sample
taken from the subject, and prognosing ACS when the subject MIF and
Nt-proBNP concentration is greater than a reference MIF and
Nt-proBNP concentration, and
[0101] performing percutaneous coronary intervention (PCI) and/or
thrombinolysis on the subject.
[0102] In any aspect of the invention, the method further comprises
means for determining the concentration of troponin. Preferably,
the concentration of MIF, Nt-proBNP and/or troponin are determined
from plasma.
[0103] The present invention provides a device comprising means for
determining concentration of macrophage migration inhibitory factor
(MIF) and B-type natriuretic peptide (BNP) or N-terminal prohormone
of brain natriuretic peptide (Nt-proBNP), in a sample from a
subject, for use in any method described herein.
[0104] In any aspect of the invention, the device further comprises
means for determining the concentration of troponin. Preferably,
the device is a point of care device. Preferably, the concentration
of MIF, Nt-proBNP and/or troponin are determined from plasma.
[0105] In any aspect of the invention, concentration of MIF,
Nt-proBNP and/or troponin may be determined by immunoassay.
[0106] In any aspect of the invention, there is provided a kit
comprising a reagent for measuring macrophage migration inhibitory
factor (MIF) and N-terminal prohormone of brain natriuretic peptide
(Nt-proBNP) concentration in a sample from a subject, and/or
comprising the device defined above. Preferably, the kit is for use
in any method described herein.
[0107] In any aspect of the invention, there is provided a kit
comprising a reagent for measuring macrophage migration inhibitory
factor (MIF) and brain natriuretic peptide (BNP) concentration in a
sample from a subject, and/or comprising the device defined above.
Preferably, the kit is for use in any method described herein.
[0108] In any aspect of the invention, the kit further comprises
means for determining the concentration of troponin. Preferably,
the troponin is high sensitive-troponin T (hs-TnT). Preferably, the
concentrations of MIF, Nt-proBNP (or BNP) and/or troponin are
determined from plasma.
[0109] In any aspect of the invention, the reagent may comprise an
anti-MIF antibody, an anti-Nt-proBNP (or BNP) antibody and/or and
anti-troponin antibody.
[0110] In any aspect of the invention, there is provided a cardiac
biomarker panel comprising plasma MIF and Nt-proBNP (or BNP) in a
sample from a subject, wherein plasma MIF and Nt-proBNP (or BNP)
concentration greater than a reference plasma MIF and Nt-proBNP (or
BNP) concentration is prognostic of the magnitude of ACS in the
subject. The cardiac biomarker panel may further comprise plasma
troponin in a sample from a subject.
[0111] As used herein, except where the context requires otherwise,
the term "comprise" and variations of the term, such as
"comprising", "comprises" and "comprised", are not intended to
exclude further additives, components, integers or steps.
[0112] Further aspects of the present invention and further
embodiments of the aspects described in the preceding paragraphs
will become apparent from the following description, given by way
of example and with reference to the accompanying drawings.
BRIEF DESCRIPTION OF THE DRAWINGS
[0113] FIG. 1. Study flow chart. A total of 489 patients with
confirmed diagnosis of STEMI were initially recruited into this
prospective study. Of them, 35 patients were excluded based on
exclusion criteria and another 33 patients were omitted due to lack
of admission MIF measure (n=8) or lost during follow-up, leading to
the final study cohort of 421 patients. Echocardiography was
performed at day-3 and then at 12 months during follow-up period.
Biochemical assays include MIF (admission), hs-TnT and CK-MB
(within 48 hours), Nt-proBNP and Hs-CRP (both at day-3). CAG,
coronary angiography; PPCI, primary percutaneous coronary
intervention; hs-TnT, high sensitive troponin T; CK-MB, creatine
kinase MB; Nt-proBNP, N-terminal prohormone of brain natriuretic
peptide; CRP, C-reactive protein.
[0114] FIG. 2. Admission MIF correlated with 3-day/12-month LVEF
and improvement. (A-B) Admission MIF was negatively correlated with
LVEF by echocardiography performed on day-3 and 12 months (F12)
post STEMI. (C) MIF level was also divided into 3 groups according
to tertiles. After calculating differences of LVEF (.DELTA.LVEF) of
the two time-points, patients with high tertile MIF showed lack of
spontaneous improvement of LVEF relative to other two groups
(P<0.001).
[0115] FIG. 3. All-cause death, cardiovascular death, HF
re-hospitalisation and MACE according to tertiles of admission MIF
concentrations. Kaplan-Meier event-free survival curves for (A)
All-cause death, (B) Cardiovascular death, (C) Mace and (D) HF
re-hospitalisation admission in STEMI patients according to tertile
MIF. Patients of high tertile MIF levels (red line, 270.9 ng/ml;
n=140) were compared with those of median tertile (black line,
40.4-70.8 ng/ml; n=140) and low tertile (black dotted line,
<40.4 ng/ml; n=141)
[0116] FIG. 4. Risk stratification of MACE In STEMI patients
according to tertiles of plasma MIF and NT-proBNP concentrations.
Combination of admission MIF and Nt-proBNP (day-3) identified
sub-groups of patients with increased risk of MACE during the
follow-up period. Patients were separately divided into tertile
groups based on MIF and Nt-proBNP levels. The risk of MACE
significantly increased in patients with both biomarkers in high
tertile compared with patients with both biomarkers in the low
tertile (*P<0.001).
[0117] FIG. 5. All-cause mortality and MACE in patients according
to whether MIF, Nt-proBNP and/or hs-TnT in high tertiles.
Kaplan-Meier event-free survival curves for (A, C) All-cause death
and (B, D) Mace in patients with STEMI based on MIF, Nt-proBNP,
hs-TnT and proBNP levels. Patients were divided into tertile groups
separately and defined as positive (+) group with high tertile,
negative group with median or low tertile level. With respect to
(A-B), four groups came into being as triple (+)(red line; n=39),
single (+) (black line, median--MIF group; n=132) and double (+)
(red dotted line, median-MIF group; n=85) and none (+) group (black
dotted line; n=165). The relative degree of prognosis in order of
best to worst is none group, single (+), double (+), and triple
(+). With respect to (C-D), four groups came into being as
Nt-proBNP (+) MIF (+) (red line, n=59), Nt-proBNP (-) MIF (+)
(black line, n=81), Nt-proBNP (+) MIF (-) (dotted red line, n=81)
and Nt-proBNP (-) MIF (-) (dotted black line, n=200). P-values in
inserts indicate difference versus Nt-proBNP (-) MIF (-) group. The
reference groups (-/- or -/-/-) refer to those cases, for the
respective biomarker, that are not in the top tertile.
[0118] FIG. 6. Frequency distributions of MIF in STEMI patients,
healthy subjects and non-Ischemia chest pain patients. Non-ischemia
chest pain patients were patients presenting chest pain to
emergency department finally without evidence of cardiac ischemia,
infection, malignancy by following up through medical records or
direct telephone contact with patients.
DETAILED DESCRIPTION OF THE EMBODIMENTS
[0119] It will be understood that the invention disclosed and
defined in this specification extends to all alternative
combinations of two or more of the individual features mentioned or
evident from the text or drawings. All of these different
combinations constitute various alternative aspects of the
invention.
[0120] Reference will now be made in detail to certain embodiments
of the invention. While the invention will be described in
conjunction with the embodiments, it will be understood that the
intention is not to limit the invention to those embodiments. On
the contrary, the invention is intended to cover all alternatives,
modifications, and equivalents, which may be included within the
scope of the present invention as defined by the claims.
[0121] One skilled in the art will recognize many methods and
materials similar or equivalent to those described herein, which
could be used in the practice of the present invention. The present
invention is in no way limited to the methods and materials
described. It will be understood that the invention disclosed and
defined in this specification extends to all alternative
combinations of two or more of the individual features mentioned or
evident from the text or drawings. All of these different
combinations constitute various alternative aspects of the
invention.
[0122] All of the patents and publications referred to herein are
incorporated by reference in their entirety.
[0123] For purposes of interpreting this specification, terms used
in the singular will also include the plural and vice versa.
[0124] Long-term mortality and morbidity following acute myocardial
infarction (AMI) are largely determined by myocardial infarction
(MI) size, and the extent of left ventricular (LV) dysfunction.
Primary percutaneous coronary intervention (PPCI) is now the
established standard of treatment in patients with ST-elevation MI
(STEMI) to limit infarct size and mortality. The inventors have
surprisingly found that the determination of plasma concentration
of MIF alone, or concentration of MIF and Nt-proBNP that are
greater than normal (i.e. greater than a reference concentration)
can prognose ACS, particularly STEMI, and can prognose survival and
non-fatal cardiac events. The inventors have also advantageously
found that the plasma concentrations of admission MIF, Nt-proBNP
and troponin concentrations that are greater than normal (i.e.
greater than a reference concentration) can prognose ACS,
particularly STEMI, or prognose survival and non-fatal cardiac
events.
[0125] Most subjects diagnosed with ACS such as AMI are treated by
PPCI. In hospitals lacking PCI facilities, either permanently or
temporarily, the inventors propose that the determination of plasma
concentration of admission MIF alone; MIF and Nt-proBNP; or MIF,
Nt-proBNP and troponin that are greater than normal (i.e. greater
than a reference concentration) can establish whether or not a
given subject should be transferred to a hospital with PCI
facilities. Moreover, the inventors have found that the above
defined combinations have prognostic impact, and accordingly early
accurate prediction of MI size in patients with AMI is
advantageous, particularly in complex patients, or where local
health-care resources are limited.
[0126] The inventors unexpectedly found that the above defined
plasma biomarkers are prognostic for survival or non-fatal cardiac
events. The inventors herein show that the measurement of MIF alone
at certain concentrations; concentrations of MIF and Nt-proBNP; or
MIF, Nt-proBNP and troponin is an accurate approach to aid
prognosis of ACS. Concentrations of MIF and Nt-proBNP; or MIF,
Nt-proBNP and troponin are more indicative of prognostic outcome
when compared to MIF measurement alone. The inventors validated
their findings and in certain aspects provide at least the
following advantages: [0127] (1) Higher plasma MIF concentration
following diagnosis of ACS correlates with a more severe prognosis
in the short and long term following diagnosis; [0128] (2) Subjects
who experience higher plasma MIF concentration following diagnosis
of ACS are more likely to suffer from MACE, cardiac death, heart
failure or death due to any cause; [0129] (3) Higher plasma MIF and
Nt-proBNP is associated with a higher risk of an event such as MACE
or death and is a more accurate prognostic tool when compared to
the individual components; and/or [0130] (4) Higher plasma MIF,
Nt-proBNP and troponin is associated with a higher risk of an event
such as MACE or death and is a more accurate prognostic tool when
compared to the individual components.
[0131] In other words, higher plasma concentrations of MIF and
Nt-proBNP; or plasma MIF, Nt-proBNP and troponin can act as
independent indicators of adverse outcomes of ACS. This approach
may facilitate the identification of a high risk group that are
likely to be associated with a poor prognosis following ACS. Those
with higher levels of either plasma MIF and Nt-proBNP; or MIF,
Nt-proBNP and troponin can be identified as having a poor prognosis
following ACS. Elevated plasma concentrations of MIF and Nt-proBNP;
or MIF, Nt-proBNP and troponin therefore have implications for
prognosis and patient management.
[0132] The current invention provides the clinician or physician
caring for a subject with information about the likelihood of
non-fatal cardiac events and survival. On the basis of the results
of the method of the invention, the clinician or physician can do,
amongst other things, (i) enroll the patient in clinical trials for
new therapies for ACS, (ii) treat the subject with alternative
therapies, such as those which target the biomarkers, (iii) discuss
the likely treatment and outcome scenarios with the subject, (iv)
provide more regular or extensive post-treatment surveillance for a
subject identified as having a low likelihood of survival and/or
high likelihood of non-fatal cardiac event, and/or (v) proceed to
treat a subject identified as high risk with added confidence the
treatment is likely to provide benefit to the subject.
[0133] In any embodiment of the invention, the method may comprise
a further treatment step such as PCI and/or thrombinolysis.
Thrombinolysis and PCI can be critical in reducing morbidity and
mortality in STEMI. Early knowledge of prognosis during the
decision-making process about patient management provides numerous
advantages. Firstly, clinicians assessing patients in whom the
diagnosis of STEMI is not obvious or stuttering may benefit from
the knowledge that an elevated biomarker is predictive of patient
prognosis, which would facilitate the decision-making process about
the timeliness of treatment, reperfusion, as well as post
reperfusion supportive cardiac care required in coronary care unit
or intensive care. Secondly, in regions where health-care resources
are limited, early knowledge of prognosis may influence whether to
transport the patient to a PCI-capable hospital, or trial
thrombinolysis first, especially in those with significant
co-morbidities. When used in combination with Nt-proBNP, or
alternatively with Nt-proBNP and troponin, MIF is useful in the
clinical setting, especially in the emergency room setting as
valuable prognostic indicators.
[0134] The combination measurement of MIF and Nt-proBNP; or MIF,
Nt-proBNP and troponin will therefore be highly valuable in the
ongoing management, including the use of adjunctive therapy, and of
patients post PPCI, as it provides further prognostic information
on MI size, in addition to the advantages outlined above.
[0135] The person skilled in the art will appreciate that the
magnitude of plasma MIF concentration may vary depending on the
characteristics of the assay used to measure MIF (e.g. different
antibodies). Nevertheless, the person skilled in the art will also
appreciate that, provided the appropriate control samples are
analysed, the appropriate reference plasma MIF concentration can be
determined.
[0136] A plasma MIF, Nt-proBNP (or BNP) or troponin concentration
is greater than a reference plasma MIF concentration when it
exceeds the reference plasma MIF, Nt-proBNP (or BNP) or troponin
concentration by 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%,
25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%,
90%, 95% or 100% or more. A plasma MIF, Nt-proBNP (or BNP) or
troponin concentration that exceeds the reference plasma MIF,
Nt-proBNP (or BNP) or troponin concentration by 50% is equivalent
to a 1.5-fold greater plasma MIF, Nt-proBNP (or BNP) or troponin
concentration, and a plasma MIF, Nt-proBNP (or BNP) or troponin
concentration that exceeds the reference plasma MIF, Nt-proBNP (or
BNP) or troponin concentration by 100% is equivalent to a 2-fold
greater plasma MIF, Nt-proBNP (or BNP) or troponin concentration,
and so on. Accordingly, a plasma MIF, Nt-proBNP (or BNP) or
troponin concentration is greater than a reference plasma MIF,
Nt-proBNP (or BNP) or troponin concentration when it is 2-fold,
2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold,
6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold,
9.5-fold, 10-fold or more than the reference plasma MIF, Nt-proBNP
(or BNP) or troponin concentration. In another embodiment, a plasma
MIF, Nt-proBNP (or BNP) or troponin concentration is greater than a
reference plasma MIF, Nt-proBNP (or BNP) or troponin concentration
when it exceeds the reference plasma MIF, Nt-proBNP (or BNP) or
troponin concentration and the difference is statistically
significant as determined by methods known to the person skilled in
the art.
[0137] A skilled person will understand that concentrations of
about 40 ng/ml to 70 ng/ml MIF are associated with a moderate
severity prognosis, concentrations higher than about 70 ng/ml MIF
are associated with the worst prognosis, whilst concentrations less
than about 40 ng/ml MIF are associated with the best prognosis. A
subject with a MIF level greater than about 70 ng/ml is indicative
of a prognosis of a 5 year MACE rate of about 35% and death rate of
about 20%.
[0138] A skilled person will understand that concentrations of
troponin of about 2.5 ng/ml to about 4.5 ng/ml are associated with
a moderate severity prognosis, concentrations higher than about 4.5
ng/ml are associated with the worst prognosis, whilst
concentrations less than about 2.5 ng/ml are associated with better
prognosis; with the best prognosis in combination with levels of
MIF less than 40 ng/ml or levels of Nt-proBNP (or BNP) less than
700 pg/ml.
[0139] A subject with a troponin level greater than about 4.5 ng/ml
in combination with MIF greater than about 70 ng/ml and BNP greater
than about 1200 pg/ml is indicative of a 5 year MACE prognosis rate
of about 50% and death prognosis rate of about 25%.
[0140] A subject with a MIF level greater than about 70 ng/ml and
Nt-proBNP (or BNP) greater than about 1200 pg/ml is indicative of a
5 year MACE prognosis rate of about 50% and death prognosis rate of
about 25%.
[0141] A skilled person will understand that concentrations of
Nt-proBNP (or BNP) of about 700 pg/ml to about 1200 pg/ml are
associated with a moderate severity prognosis, concentrations
higher than about 1200 pg/ml are associated with the worst
prognosis, whilst concentrations less than about 700 pg/ml are
associated with better prognosis; with the best prognosis in
combination with levels of MIF less than 40 ng/ml or levels of
troponin less than 2.5 ng/ml.
[0142] Whilst MIF is an important early indicator of the prognosis
of cardiovascular or acute myocardial ischaemic events, as shown
herein, it is the combination of MIF and Nt-proBNP (or BNP); or
MIF, Nt-proBNP (or BNP) and troponin that is the most clinically
relevant measurement of prognosis of ACS, when compared to the
individual components alone. Thus, in certain aspects present
invention relates to a method for prognosing ACS, and a method for
treating ACS by determining concentrations of MIF and Nt-proBNP (or
BNP); or MIF, Nt-proBNP (or BNP) and troponin.
[0143] As used herein, a "method" for prognosing or treating ACS in
a subject comprising determining plasma MIF and Nt-proBNP (or BNP);
or MIF, Nt-proBNP (or BNP) and troponin concentration may be
presented in an alternative form. In one example, the method may be
in the form of "use" of plasma MIF concentration for diagnosing,
prognosing or treating ACS in a subject. In a second example, the
method may be in the form of plasma MIF concentration "for use" in
prognosing or treating ACS in a subject. In another form, the
method may be in the Swiss form "use of plasma MIF concentration in
the manufacture" of a prognostic agent or a medicament.
[0144] In a preferred embodiment, the method of prognosis of ACS in
a subject is performed in vitro on a plasma (or serum or blood)
sample. In other words, any method of the invention may be an in
vitro method.
[0145] In one embodiment, the methods of the invention do not
comprise a step of taking a sample from the subject.
[0146] Subsequent to prognosis of ACS in the subject, the method
may further comprise treating the subject by percutaneous coronary
intervention (PCI) and/or thrombolysis.
[0147] The currently recommended treatment for STEMI is primary PCI
(ie PCI delivered as soon as possible after diagnosis) if this is
available and can be delivered in a timely fashion. PCI Involves
the placement in the femoral, radial (or occasionally) brachial
artery of a catheter with a lumen which is then introduced, under X
ray imaging, into the coronary artery containing the
stenosis/thrombosis responsible for the STEMI. The narrowing is
then expanded with a fluid filled balloon. In some cases this is
followed by the placement of a stent (a cylindrical metal scaffold)
at the site of the region which has been dilated. The stent may or
may not be impregnated with a drug to prevent recurrence of
narrowing (this depends on clinical circumstances and angiographic
findings). If primary PCI cannot be performed then the STEMI
patient is usually treated with a fibrinolytic agent to dissolve
the clot present at the culprit site. The fibrinolytic agent is
delivered by peripheral venous cannulation. In some cases there are
residual symptoms or physical signs persisting (or recurring)
despite fibrinolytic treatment and in these cases the patient may
undergo subsequent "rescue" PCI.
[0148] Treatment may further comprise administration of an
anti-thrombotic, anti-platelet drug, for example, a glycoprotein
IIB/IIIA inhibitor (e.g. abciximab, eptifibatide, or tirofiban), or
an adenosine diphosphate (ADP) receptor inhibitor (e.g.
clopidogrel, prasugrel, ticagrelor, or ticlopidine).
[0149] Preferably, the sample from which MIF, Nt-proBNP (or BNP)
and troponin is measured is plasma. Plasma may be obtained by
anti-coagulating blood with EDTA, sodium heparin, lithium heparin,
sodium citrate or sodium oxalate. Alternatively, the sample in
which MIF, Nt-proBNP (or BNP) and troponin is measured from is
serum or blood. In one embodiment, the sample may be whole
blood.
[0150] "Acute coronary syndrome" or "ACS" refers to a spectrum of
conditions involving chest discomfort or other symptoms caused by
lack of oxygen to the heart. The symptom is consequent upon
erosion, fissuring or rupture of a pre-existing atherosclerotic
plaque, and occurs spontaneously. In the absence of evidence of
myocardial necrosis, unstable angina is diagnosed, but in the
presence of evidence of myocardial necrosis (e.g. a plasma
biomarker), AMI is diagnosed. Thus, ACS may comprise unstable
angina or AMI. "ACS" does not include stable angina.
[0151] "Acute myocardial infarction" or "AMI" refers to the
interruption of blood supply to a part of the heart, causing
restriction in blood supply ("ischaemia"), lack of oxygen, and cell
death ("necrosis"), and is a type of ACS. This may result in damage
or death of heart muscle tissue (myocardium). Thus, "myocardial
necrosis" refers to the death of heart cells. AMI may be divided
into ST elevation myocardial infarction (STEMI), diagnosed by
elevation of the ST segment of the electrocardiogram, and non-ST
elevation myocardial infarction (non-STEMI), diagnosed by absence
of such electrocardiographic changes. STEMI may be treated with
thrombolysis or PCI. Non-STEMI may be managed with medication,
although PCI is often performed during hospital admission.
[0152] As used herein, the term MACE (`major adverse cardiac
events) refers to cardiac death and other non-fatal cardiovascular
outcomes. Non-exhaustive examples of MACE include myocardial
infarction, unstable angina, heart failure, percutaneous cardiac
intervention, coronary artery bypass grafting, malignant
dysrhythmia, cardiac shock, implantable cardiac defibrillator, and
malignant dysrhythmia.
[0153] As used herein, the term "HF-rehospitalisation free
survival" refers to the prognosis of those patients not readmitted
to hospital due to heart failure, following diagnosis of ACS. In
other words, re-hospitalisation for HF can be defined as a hospital
readmission for which HF was the primary reason.
[0154] As used herein, the term "all-cause mortality free survival"
refers to prognosis of those patients who have not died from any
underlying condition.
[0155] As used herein, the term "cardiac death free survival"
refers to prognosis of those patients who have not died from any
cardiac related condition.
[0156] In any aspect of the invention, prognosis may be indicative
of survival or non-fatal cardiac events 1, 2, 4, 6, 8, 10, 12, 14,
16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 28, 40, 42, 44, 46, 48,
50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80 or
more, months following diagnosis of ACS.
[0157] A "coronary event" refers to any severe or acute
cardiovascular condition including AMI, unstable angina, or cardiac
mortality.
[0158] "Left ventricular hypertrophy" or "LVH" refers to thickening
of the myocardium (muscle) of the left ventricle of the heart.
[0159] "Left ventricular end-diastolic volume" or "LVEDV" is
defined as the volume of blood within the left ventricle
immediately before contraction.
[0160] "Left ventricular end-systolic volume" or "LVESV" is defined
as the volume of blood remaining within the left ventricle at the
end of contraction.
[0161] "Stroke volume" is defined as the difference between LVEDV
and LVESV and refers to the volume of blood ejected from the left
ventricle with each contraction (heartbeat).
[0162] "Left ventricular ejection fraction" or "LVEF" is defined as
the fraction of the LVEDV that is ejected with each contraction
(heartbeat); that is, "stroke volume" divided by LVEDV. LVEF may be
expressed as a percentage.
[0163] As used herein, "infarct size" is measured by cardiac
magnetic resonance (CMR), integrated biomarker levels or
echocardiography and is defined as the area of hyperenhanced
myocardium (bounded by manually traced endocardial and epicardial
contours) on each short axis slice multiplied by the slice
thickness and the myocardial density of 1.05 g/ml to obtain the
infarct mass, and expressed as a percentage of left ventricular
mass.
[0164] As used herein, "left ventricular mass indexed" refers to
the left ventricular mass in g divided by the square of the height
in m of a subject, and is expressed in units g/m.sup.2.
[0165] As used herein, "biomarker" refers to a measurable
substance, detection of which typically indicates a particular
cardiac disease. A "biomarker" may indicate a change in expression
or state of the measurable substance that correlates with the
prognosis of a disease. A "biomarker" may be a protein or peptide.
A "biomarker" may be measured in a bodily fluid such as plasma,
blood or serum. As used herein, "biomarkers" include plasma
macrophage migration inhibitory factor (MIF), B-type natriuretic
peptide (BNP) and troponin, and may further include myoglobin, C
reactive protein or creatine kinase (CK).
[0166] In one embodiment, MIF, Nt-proBNP (or BNP) and troponin are
full length. In another embodiment, MIF, BNP and troponin comprise
a fragment thereof. Preferably, the MIF, Nt-proBNP (or BNP) and
troponin are human.
[0167] Troponin may be troponin I, including cardiac troponin I
(cTnI), troponin T or high sensitivity troponin T (hs-TnT). A
skilled person will understand that hs-TnT is a form of troponin
that allows for very low concentrations of troponin to be measured
accurately and early following ACS.
[0168] Preferably, MIF is human MIF for clinical prognosis and
comprises the amino acid sequence provided as NCBI Reference
Sequence: NP 002406.1 (SEQ ID NO: 1):
TABLE-US-00001 MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAF
GGSSEPCALCSLHSIGKIGGQNRSYSKLLCGLLAERLRISPDRVYINYYD
MNAANVGWNNSTFA
[0169] Alternatively, MIF may be from another mammal, for example
primate, murine, bovine, ovine, equine, porcine, canine or feline,
for veterinarian prognosis.
[0170] As used herein, "prognosis" and related terms refer to the
description of the likely outcome of ACS. This may include risk of
MACE, MACE-free survival, HF-rehospitalisation free survival,
all-cause mortality free survival and cardiac death free survival.
Prognosis may also include prediction of favorable responses to ACS
treatments, such as thrombolysis. As measurement of plasma
biomarker concentration correlates with the magnitude of AMI (e.g.
quantification of infarct size), plasma concentration of the
biomarkers defined above enables assessment of the likely morbidity
and mortality arising from the infarct (prognosis). As will be
understood by those skilled in the art, the prediction may need not
be correct for 100% of the subjects evaluated. The term, however,
requires that a statistically significant portion of subjects can
be identified as having an increased probability of having a given
outcome.
[0171] Furthermore, measurement of plasma MIF, BNP and/or troponin
concentration may quantify the ACS, thereby enabling prognosis of
the ACS.
[0172] As used herein, "onset of symptoms" or "symptom onset" is
the time at which a subject begins to experience a departure from
normal physiology.
[0173] As used herein, "admission" refers to the formal acceptance
by a hospital or other health care facility of a subject who is to
be provided with medical treatment. In particular, "admission" will
be associated with an accurate time at which the subject is
accepted for medical treatment.
[0174] As used herein, admission plasma MIF concentration refers to
the MIF concentration measured in plasma derived from a blood
sample obtained as soon as practicable after admission, but
typically less than 4 hours after symptom onset. Alternatively,
admission plasma MIF concentration may refer to the MIF
concentration measured in plasma derived from a blood sample
obtained 210 minutes, 180 minutes, 150 minutes, 120 minutes, 110
minutes, 100 minutes, 90 minutes, 80 minutes, 70 minutes, 60
minutes, 50 minutes, 40 minutes, 30 minutes, 20 minutes, 10 minutes
or 5 minutes or less after symptom onset.
[0175] If a subject has not been accepted for medical treatment,
but is at home or place of work for example, admission plasma MIF
concentration is understood to mean less than 240 minutes, or 210
minutes, 180 minutes, 150 minutes, 120 minutes, 110 minutes, 100
minutes, 90 minutes, 80 minutes, 70 minutes, 60 minutes, 50
minutes, 40 minutes, 30 minutes, 20 minutes, 10 minutes or 5
minutes or less after symptom onset.
[0176] As used herein, plasma Nt-proBNP (or BNP) concentration
refers to the Nt-proBNP (or BNP) concentration measured in plasma
derived from a blood sample obtained from a patient following
symptom onset or hospital admission. In particular, the sample may
be plasma derived from a blood sample obtained less than about, or
between, any of the following: about 0.5 days, 1.0 day, 1.5 days,
2.0 days, 2.5 days, 3.0 days, 3.5 days, 4.0 days, 4.5 days, 5.0
days, 5.5 days, 6.0 days, 6.5 days or more after symptom onset.
Preferably Nt-proBNP (or BNP) concentrations are determined in
plasma derived from a blood sample obtained from a patient 3 days
following symptom onset or hospital admission.
[0177] As used herein, plasma troponin concentration refers to the
troponin measured in plasma derived from a blood sample obtained
from a patient following symptom onset or hospital admission. In
particular, the sample may be plasma derived from a blood sample
obtained less than about, or between, any of the following: about
0.5 days, 1.0 day, 1.5 days, 2.0 days, 2.5 days, 3.0 days, 3.5
days, 4.0 days, 4.5 days, 5.0 days, 5.5 days, 6.0 days, 6.5 days,
7.0 days, 7.5 days, 8.0 days, 8.5 days, 9.0 days, 9.5 days, 10.0
days, 10.5 days, 11 days, 11.5 days, 12 days or more after symptom
onset or hospital admission.
[0178] The time at which a sample may be taken from a subject is
applicable to all aspects of the invention.
[0179] As used herein, "means for measuring" plasma MIF, Nt-proBNP
(or BNP) or troponin refers to any mechanism by which MIF,
Nt-proBNP (or BNP) or troponin can be determined (assayed or
quantified). For instance, plasma MIF, Nt-proBNP (or BNP) or
troponin may be determined in a sample using any method known to
those skilled in the art for detecting proteins including, but not
limited to, for example immunoassays such as, for example ELISA,
enzyme immunoassay (EIA), Western blot, slot blot, dot blot, or
immunoprecipitation followed by sodium dodecyl sulfate
polyacrylamide gel electrophoresis, (SDS-PAGE), chromatography and
the like. Dendrimer-enhanced radial partition immunoassays and
immunofluorescence assays, for example, are known in the art and
are commercially available. Troponin may also be measured using a
highly sensitive troponin assay.
[0180] As used herein, "assay", and variants thereof, refers to
measurement or quantification of the concentration of plasma MIF,
Nt-proBNP (or BNP) or troponin or other biomarkers herein
defined.
[0181] One exemplary agent for detecting a protein of interest is
an antibody, or fragment thereof, capable of specifically binding
to plasma MIF, Nt-proBNP (or BNP) or troponin. The antibody may
detectably labelled, either directly or indirectly.
[0182] Anti-MIF antibodies are commercially available from
suppliers such as Abcam and include: chicken polyclonal anti-MIF
antibody (ab34644); goat polyclonal anti-MIF antibody (ab36146,
ab14574); rabbit polyclonal anti-MIF (C-terminus) antibody
(ab65869); rabbit polyclonal anti-MIF antibody (ab86670); mouse
monoclonal anti-MIF antibody (ab55445); and mouse anti-MIF
monoclonal antibody [2Ar3] (ab14575).
[0183] Troponin and anti-hsTnT antibodies are commercially
available from suppliers such as Roche. Approaches to measure
hs-TnT include fragment antigen binding of two hs-TnT specific
monoclonal antibodies, detectable in a sandwich format. Antibodies
recognise epitopes corresponding to amino acids 125-131 and 135-147
of hs-TnT. Detection can be performed by chemiluminesence using
Tris (bipyridol)-ruthenium (II).
[0184] Anti-Nt-proBNP (or BNP) and Nt-proBNP antibodies are
available from commercial suppliers. Polyclonal antibodies bind to
epitopes on residues 1-21 and 29-50 and expression can be detected
through routine means in the art including labelling with biotin
followed by ruthenium. The complex binds nTproBNP which is detected
through streptavidin labelled microparticles.
[0185] Immunoassays for plasma MIF, Nt-proBNP (or BNP) or troponin
may comprise incubating a sample with a detectably labelled
antibody, or antibody fragment, capable of specifically binding
plasma MIF, Nt-proBNP (or BNP) or troponin, and detecting the bound
antibody by any of a number of techniques well-known in the art. As
discussed in more detail, below, the term "labelled" can refer to
direct labelling of the antibody via, e.g., coupling (i.e.,
physically linking) a detectable substance to the antibody, and can
also refer to indirect labelling of the antibody by reactivity with
another reagent that is directly labelled. An example of indirect
labelling includes detection of a primary antibody using a
fluorescently labelled secondary antibody.
[0186] The sample can be brought in contact with and immobilised on
a solid support or carrier, or other solid support, which is
capable of immobilising soluble proteins. The support can then be
washed with suitable buffers followed by treatment with the
detectably labelled antibody. The solid support can then be washed
with the buffer a second time to remove unbound antibody. The
amount of bound label on solid support can then be detected by
conventional methods.
[0187] By "solid support or carrier" is intended to be any support
capable of binding an antigen or an antibody. Well-known supports
or carriers include nitrocellulose, glass, polystyrene,
polypropylene, polyethylene, dextran, nylon, amylases, natural and
modified celluloses, polyacrylamides and magnetite. The nature of
the solid support or carrier can be either soluble to some extent
or insoluble.
[0188] The solid support can have virtually any possible structural
configuration so long as the coupled molecule is capable of binding
to an antigen or antibody. Thus, the support configuration can be
spherical, as in a bead, or cylindrical, as in the inside surface
of a test tube, or the external surface of a rod. Alternatively,
the surface can be flat such as a sheet, test strip, etc. Those
skilled in the art will know many other suitable carriers for
binding antibody or antigen, or will be able to ascertain the same
by use of routine experimentation.
[0189] One of the ways in which an antibody specific for plasma
MIF, Nt-proBNP (or BNP) or troponin can be detectably labelled is
by linking the antibody to an enzyme for use in an enzyme
immunoassay. The enzyme bound to the antibody will react with an
appropriate substrate, preferably a chromogenic substrate, in such
a manner as to produce a chemical moiety which can be detected, for
example, by spectrophotometric, fluorimetric or by visual means.
Enzymes that can be used to detectably label the antibody include,
but are not limited to, malate dehydrogenase, staphylococcal
nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase,
alpha-glycerophosphate dehydrogenase, triose phosphate isomerase,
horseradish peroxidase, alkaline phosphatase, asparaginase, glucose
oxidase, beta-galactosidase, ribonuclease, urease, catalase,
glucose-6-phosphate dehydrogenase, glucoamylase and
acetylcholinesterase. The detection and measurement can be
accomplished by colorimetric methods which employ a chromogenic
substrate for the enzyme. Detection and measurement can also be
accomplished by visual comparison of the extent of enzymatic
reaction of a substrate in comparison with similarly prepared
standards.
[0190] Detection and measurement can also be accomplished using any
of a variety of other immunoassays. For example, by radioactively
labelling the antibody or functional antibody fragment, it is
possible to detect plasma levels of biomarkers through the use of a
radioimmunoassay (RIA). The radioactive isotope (e.g., .sup.125I,
.sup.131I, .sup.35S, .sup.32P or .sup.3H) can be detected by such
means as the use of a gamma counter or a scintillation counter or
by autoradiography.
[0191] It is also possible to label the antibody with a fluorescent
or luminescent compound. When the fluorescently labelled antibody
is exposed to light of the appropriate wavelength, its presence can
then be detected due to fluorescence. Among the most commonly used
fluorescent labelling compounds are fluorescein isothiocyanate,
rhodamine, phycoerythrin, phycocyanin, allophycocyanin,
o-phthaldehyde and fluorescamine.
[0192] The antibody can also be detectably labelled using
fluorescence emitting metals such as .sup.152Eu, or others of the
lanthanide series. These metals can be attached to the antibody
using such metal chelating groups as diethylenetriaminepentacetic
acid (DTPA) or ethylenediaminetetraacetic acid (EDTA). Fluorescence
energy transfer compounds may also be employed.
[0193] The antibody also can be detectably labelled by coupling it
to a chemiluminescent compound. The presence of the
chemiluminescent-tagged antibody is then determined by detecting
the presence of luminescence that arises during the course of a
chemical reaction. Examples of particularly useful chemiluminescent
labelling compounds are luminol, isoluminol, theromatic acridinium
ester, imidazole, acridinium salt and oxalate ester. Likewise, a
bioluminescent compound can be used to label the antibody.
Bioluminescence is a type of chemiluminescence found in biological
systems in, which a catalytic protein increases the efficiency of
the chemiluminescent reaction. The presence of a bioluminescent
protein is determined by detecting the presence of luminescence.
Important bioluminescent compounds for purposes of labelling are
luciferin, luciferase and aequorin.
[0194] In another embodiment, specific binding molecules other than
antibodies, such as aptamers, may be used to bind plasma MIF,
Nt-proBNP (or BNP) or troponin.
[0195] Other "means for measuring" plasma MIF, Nt-proBNP (or BNP)
or troponin include chromatography or electrophoresis with
dye-based detection, or proteomics approaches employing
spectrometry such as mass spectrometry.
[0196] Spectrometry may be used to measure dye-based assays,
including visible dyes, and fluorescent or luminescent agents.
[0197] A protein chip assay may be used to measure plasma MIF,
Nt-proBNP (or BNP) or troponin.
[0198] Plasma MIF, Nt-proBNP (or BNP) or troponin can also be
measured or assayed using of one or more of the following methods.
For example, methods may include nuclear magnetic resonance (NMR)
spectroscopy, a mass spectrometry method, such as electrospray
ionization mass spectrometry (ESI-MS), ESI-MS/MS, ESI-MS/(MS)n (n
is an integer greater than zero), matrix-assisted laser desorption
ionization time-of-flight mass spectrometry (MALDI-TOF-MS),
surface-enhanced laser desorption/ionization time-of-flight mass
spectrometry (SELDI-TOF-MS), desorption/ionization on silicon
(DIOS), secondary ion mass spectrometry (SIMS)3 quadrupole
time-of-flight (Q-TOF), atmospheric pressure chemical ionization
mass spectrometry (APCI-MS), APCI-MS/MS, APCI-(MS), atmospheric
pressure photoionization mass spectrometry (APPI-MS), APPI-MS/MS,
and APPI-(MS). Other mass spectrometry methods may include
quadrupole, Fourier transform mass spectrometry (FTMS) and ion
trap. Other suitable methods may include chemical extraction
partitioning, column chromatography, ion exchange chromatography,
hydrophobic (reverse phase) liquid chromatography, isoelectric
focusing, one-dimensional polyacrylamide gel electrophoresis
(PAGE), two-dimensional polyacrylamide gel electrophoresis
(2D-PAGE) or other chromatography, such as thin-layer, gas or
liquid chromatography, or any combination thereof.
[0199] In one embodiment, LDI-TOF-MS allows the generation of large
amounts of information in a relatively short period of time. A
biological sample is applied to one of several varieties of a
support that binds MIF, BNP or troponin in the sample. Samples are
applied directly to these surfaces in volumes as small as 0.5
.mu.L, with or without prior purification or fractionation. The
sample can be concentrated or diluted prior to application onto the
support surface. Laser desorption/ionization is then used to
generate mass spectra of the sample in as little as three
hours.
[0200] A bead assay may also be used to measure plasma MIF,
Nt-proBNP (or BNP) or troponin concentrations.
[0201] As used herein, "device" refers to a physical arrangement of
components for performing an assay for measuring plasma MIF,
Nt-proBNP (or BNP) or troponin. The device may be a point-of-care
device used by a medical practitioner to measure plasma MIF,
Nt-proBNP (or BNP) or troponin without the need for laboratory
measurement.
[0202] Alternatively, a point-of-care device may be used
domestically, for example in a subject at risk of a first or
subsequent coronary event. Alternatively, the device may be in a
laboratory located separately to the subject in whom plasma MIF,
Nt-proBNP (or BNP) or troponin is to be measured.
[0203] The device may employ an electrochemical cell.
Electrochemical cells may use electrodes positioned within the cell
in a side-by-side or "coplanar" layout to minimize the electrical
interference between the electrodes. Alternatively, electrochemical
cells may use non coplanar electrodes that exploit the electrical
interference between the electrodes to yield additional information
about the sample including information that can correct for patient
to patient variations in hematocrit and interfering chemical
substances that may be present in a sample.
[0204] The device may provide a qualitative output (e.g. yes/no,
presence/absence/, high/low), a numerical or quantified output
(e.g. concentration), or an output for visual inspection (e.g. a
colour for comparison with a reference scale).
[0205] As used herein, "kit" refers to a physical arrangement of
components, one of which may be the device for measuring plasma
MIF, Nt-proBNP (or BNP) and/or troponin. The kit may include a
reagent such as an anti-MIF, anti-Nt-proBNP (or BNP) or
anti-troponin immunogenic moiety, a secondary detection agent for
detecting the immunogenic moiety, or a reagent for sample
preparation and/or processing, for example a buffer. The kit may
include means, such as reagents, to perform a highly sensitive
assay, such as for the detection of hs-TnT.
[0206] The device or kit may be accompanied by instructions or
directions for use of the device or kit in any method described
herein.
[0207] As used herein, a device or kit may be in alternative forms.
One form designates either suitability for or restriction to a
specific use and is indicated by the word "for". Another form is
restricted to a specific use only and is indicated by the words
"when used for" or similar. In one embodiment of the method for
treating ACS in a subject, plasma MIF, Nt-proBNP (or BNP) or
troponin is measured using the device disclosed herein.
[0208] Survival analysis can be performed using the Kaplan-Meier
method (as described in the Example herein and shown in FIGS. 3 and
5). The Kaplan-Meier method estimates the survival function from
life-time data. In medical research, it can be used to measure the
fraction of patients living for a certain amount of time after
treatment. A plot of the Kaplan-Meier method of the survival
function is a series of horizontal steps of declining magnitude
which, when a large enough sample is taken, approaches the true
survival function for that population. The value of the survival
function between successive distinct sampled observations
("clicks") is assumed to be constant.
[0209] An important advantage of the Kaplan-Meier curve is that the
method can take into account "censored" data-losses from the sample
before the final outcome is observed (for instance, if a patient
withdraws from a study). On the plot, small vertical tick-marks
indicate losses, where patient data has been censored. When no
truncation or censoring occurs, the Kaplan-Meier curve is
equivalent to the empirical distribution.
[0210] In statistics, the log-rank test (also known as the
Mantel-Cox test) is a hypothesis test to compare the survival
distributions of two groups of patients. It is a nonparametric test
and appropriate to use when the data are right censored. It is
widely used in clinical trials to establish the efficacy of new
drugs compared to a control group when the measurement is the time
to event. The log-rank test statistic compares estimates of the
hazard functions of the two groups at each observed event time. It
is constructed by computing the observed and expected number of
events in one of the groups at each observed event time and then
adding these to obtain an overall summary across all time points
where there is an event. The log-rank statistic can be derived as
the score test for the Cox proportional hazards model comparing two
groups. It is therefore asymptotically equivalent to the likelihood
ratio test statistic based from that model.
[0211] It will be understood that the invention disclosed and
defined in this specification extends to all alternative
combinations of two or more of the individual features mentioned or
evident from the text or drawings. All of these different
combinations constitute various alternative aspects of the
invention.
[0212] It will be understood that these examples are intended to
demonstrate these and other aspects of the invention and although
the examples describe certain embodiments of the invention, it will
be understood that the examples do not limit these embodiments to
these things. Various changes can be made and equivalents can be
substituted and modifications made without departing from the
aspects and/or principles of the invention mentioned above. All
such changes, equivalents and modifications are intended to be
within the scope of the claims set forth herein.
EXAMPLES
Example 1
[0213] This study was conducted to determine whether a single
measurement of admission MIF alone or in combination with BNP
and/or troponin, could provide predictive information of long-term
survival and nonfatal cardiovascular events in patients with
STEMI.
Methods
Study Population and Design
[0214] The inventors consecutively recruited during June 2010 to
April 2015 patients with STEMI who received treatment with PCI at
the Department of Cardiology, Third Hospital of Peking University.
Inclusion criteria were: (1) presentation with STEMI (typical
symptoms for >30 minutes and <12 hours plus persistent
ST-segment elevation of >2 mV in at least two contiguous
precordial ECG-leads or al mV in at least two contiguous limb
ECG-leads or a newly developed left bundle branch Block); (2) with
invasive treatment by PCI; (3) availability of MIF measurements
from blood samples on admission. Patients having one or more of the
following criteria were excluded: (1) previous ACS within 1 month;
(2) rescue angioplasty; (3) current infections, known malignant,
inflammatory or autoimmune disease; (4) end-stage renal disease
(estimated Glomerular Filtration Rate <30 ml/min/kg) and (5)
unwillingness. The process of recruitment and study protocol are
illustrated in FIG. 1.
[0215] Baseline clinical data such as history of disease and
medication were collected from medical records. Hypertension was
diagnosed in the presence of active treatment with antihypertensive
agents or otherwise as a systolic blood pressure of 2140 mmHg
and/or diastolic blood pressure of 290 mmHg on at least 2 separate
occasions. Hypercholesterolemia was diagnosed in the presence of
active treatment with lipid-lowering drugs or value of total
cholesterol .gtoreq.6.22 mmol/L or low density lipoprotein
cholesterol .gtoreq.4.14 mmol/L. Current smokers were defined as
those currently smoking any tobacco. Diagnosis of diabetes mellitus
was confirmed by the active treatment with antidiabetic medicine or
with a fasting plasma glucose level .gtoreq.7 mmol/L or a
nonfasting level of .gtoreq.11.1 mmol/L. Patients were
prospectively classified according to maximum Killip class by 3
clinicians on admission and during hospitalisation. This
prospective cohort study was approved by the Human Ethics
Committee, Peking University Health Science Centre and performed in
accordance with the requirements of the Declaration of Helsinki.
Informed consent was obtained from all participants.
PPCI and Medication
[0216] After a previous loading dose of 300 mg aspirin and 600 mg
clopidogrel, coronary angiogram was performed. Quantitative
coronary angiographic analysis was performed on analysis before and
after interventions. Culprit lesion, numbers of significantly
stenosed vessels, TIMI reclassification pre- and post-PCI were
recorded. Interventions were performed according to current
guidelines. Thrombus aspiration, use of Glycoprotein IIb/IIIa
inhibitors (Tirofiban), intra-aortic balloon pump (IABP) implanting
were administered at the discretion of the operator. There were two
independent observers blinded to our trial calculating ST-segment
resolution by predefined criteria at 60 min after revascularization
with a cutoff value <50% defined as incomplete ST-segment
resolution.
[0217] Following the PCI procedure, patients were prescribed
Enoxaparin Sodium (100 U/kg/q12 h for 3 days), and other secondary
preventions as aspirin (100 mg/day), clopidogrel (75 mg/day for 12
months), cholesterol-lowering treatment (statins), .beta.-receptor
antagonists and Angiotensin-Converting Enzyme Inhibitors or
angiotensin receptor blocker (ACEI/ARB). All patients received
standard and individualized medical treatment and management at the
discretion of an attending cardiologist.
Study End Points and Follow Up
[0218] The short-term endpoint of our study was incomplete
ST-segment resolution post primary PCI as a surrogate of
inefficient myocardial reperfusion. Long-term following up was
accomplished by reviewing the hospital records, contacting patients
or their relatives by telephone individually. Information was
collected on occurrence of death due to cardiovascular causes
(CVD), major adverse cardiac events (MACE) consisting of all-cause
mortality, recurrent MI, and re-hospitalisation for heart failure
(HF). The long-term end points were all-cause mortality and the
composite endpoint of MACE. Recurrent MI was defined as accordance
with the universal definition proposed in 2012. Re-hospitalisation
for HF was defined as a hospital readmission due to HF as the
primary reason.
Echocardiography
[0219] Echocardiography was performed at day-3 and around 12 months
of follow-up period after MI using Vivid 7 (Vingmed, GE, Horten,
Norway) with a 3.3-MHz multiphase array probe. Standard
echocardiographic views were acquired under supervision of
experienced cardiologists. Left ventricular end-diastolic dimension
and ejection fraction (LVEF) was obtained using the modified
biplane Simpson method.
Routine Laboratory Measurements
[0220] Venous blood samples were collected at admission and then
every 6 hours for the first two days for assay of CK-MB and Hs-TnT.
Peak concentrations were identified to estimate infarct size.
Nt-proBNP and hs-CRP concentrations were determined on median day 3
post-MI, since their prognostic value at this time outperformed
those of other timings during the acute phase.
[0221] All routine biochemical assays were performed immediately
after collection of blood samples using commercially available
automated platform. CK-MB, hs-CRP, blood lipids and plasma
creatinine concentration were analyzed using an AU5400 automatic
chemical analyzer (Beckman Coulter, California, USA). Both of
Hs-TnT and NT-pro-BNP were measured using E601 immunoassay analyzer
(Roche Diagnostics, Mannheim, Germany). Estimated glomerular
filtration rate (eGFR) was calculated according to Cockcroft-Gault
formula. All the results of tests were obtained at the Clinical
Biochemistry Department of Beijing University Third Hospital based
on manufacturers' recommendation or literature.
Measurement of Plasma MIF Concentration
[0222] Immediately after admission, blood samples were collected
prior to antiplatelet drugs and primary PCI by venepuncture into
vacutainer tubes containing heparin lithium. Plasma was isolated
from whole blood by centrifugation at 3000 rpm for 10 min at
4.degree. C., then divided into aliquots and stored at -80.degree.
C. until analysis. Repeated freeze-thaw cycles were avoided. Plasma
MIF was measured, in duplicates, using Quantikine MIF ELISA kits
(DMF00B, R&D Systems) according to manufacturer's
specifications. The coefficient of variation for intra- and
inter-assay variation was 2.8.+-.1.6% and 5.8.+-.1.3% respectively.
For comparison, we also measured MIF level of healthy people (n=65)
and of patients presenting to the emergency department with chest
pain not to be due to cardiac ischemia (n=600). All these assays
were performed by personnel blinded to patient's identity and
outcome.
Statistical Analysis
[0223] Aorta was primarily analysed by identifying 3 tertiles of
initial MIF measurement. Categorical variables were summarized as
percentage and compared using chi-squared test to compare between
tertile MIF groups. Continuous variables are presented as
means.+-.SD or median with interquartile range (IQR) and the
association between tertile MIF with them were tested by one-way
ANOVA or Kruskal-Wallis rank-sum test. The association between MIF
level and other continuous variables (e.g. biomarkers, LVEF) was
tested by Spearman's rank order correlation. Due to non-normal
distribution, all biomarkers were logarithmically or log-2
transformed prior to entry into the statistical models. The primary
endpoint (complete ST-segment resolution) was analyzed with a
logistic regression model.
[0224] Kaplan-Meier curves were generated to visualize the
relationship of tertile MIF level with long-term prognosis.
Univariate and multivariate analyses were performed using the Cox
proportional hazard models. Four models for the adjustment of
covariates were utilized: Model 1, adjusted for age, sex, eGFR and
log 2MIF; Model 2, adjusted for all factors in model 1 plus other
characteristics as body BMI, haemoglobin, previous MI, diabetes
mellitus, hypertension, current smoking, hypocholesteremia,
symptom-admission time <6 h, 3 vessel disease, Killip
class>1, culprit lesion of left anterior descending (LAD),
ST-segment resolution, thrombus aspiration, use of Glycoprotein
IIb/IIIa inhibitor during the PCI, TIMI reclassification pre- and
post-PCI; Model 3, adjusted for all factors in Model 2 plus
conventional biomarkers including hs-TnT peak, Nt-proBNP and
hs-CRP; Model-4, adjusted for all factors in Model 3 plus day-3
LVEF.
[0225] Patients were defined separately with individual biomarker
in high tertile as positive group (+), while in median and low
tertile as negative group (-) to study prognostic value of
different combinations including Nt-proBNP/MIF, hs-TnT peak/MIF,
Nt-proBNP/hs-TnT peak and Triple groups. Discrimination was
evaluated using C-statistic. Continuous net reclassification
improvement (NRI) and integrated discrimination improvement (IDI)
were also calculated to quantify the degree of correct
reclassification as a result of adding admission MIF to the
clinical risk models. All probability values are two-tailed and was
considered statistically significant <0.05. Calculations of
C-statistics, NRI and IDI were performed using package "surviC1"
and "survIDINRI" in R programming 3.4.0 for Windows (R Development
Core Team, 2016), other data analyses were performed using SPSS
(version 22.0; SPSS, Inc. Chicago, Ill.).
Results
Clinical Characteristics
[0226] A total of 489 patients with confirmed diagnosis of STEMI
were initially recruited into this prospective study. Of them, 35
patients were excluded based on exclusion criteria and another 33
patients were lost to follow-up (n=25) whilst 8 patients did not
have available blood samples or lacked admission MIF measures
(n=8), leading to the final study cohort of 421 patients (FIG. 1).
Their median age was 60 years and 81% were male. The median
(interquartile range) of admission MIF was 53.90 (35.51-82.13)
ng/ml, significantly higher than other two reference groups:
healthy control 16.9(12.8-22.9) ng/ml and chest pain patients
presented at emergency department without ischaemic etiology
26.8(21.7-34.6) ng/ml (FIG. 6).
[0227] The characteristics of this patient cohort are summarized
according to MIF tertile in Tables 1 and Table 2. MIF levels were
not associated with neither age, gender or eGFR, BMI, nor diastolic
blood pressure or heart rate. STEMI patients in the high MIF
tertile group tended to have a higher prevalence of hypertension
(P=0.088), higher systolic blood pressure (P=0.066), and were more
likely to have culprit vessel lesion in the LAD (P=0.062). Other
conditions of previous risk factors of coronary heart diseases and
CAG results were similar in three groups (Table 1). There was also
no significant difference between the 3 groups in the proportion of
patients treated with secondary prevention of aspirin, clopidogrel,
statins, ACEI or ARBs, and P-blockers, on admission (not shown) or
at discharge (Table 1) between the 3 groups.
[0228] Moderate but highly significant correlations were observed
between concentrations of admission MIF and necrosis markers, peak
levels of hsTnT (r=0.458, P<0.001) and CK-MB (r=0.305,
P<0.001). Meanwhile, MIF level was also associated with
inflammatory markers such as white blood cell count (r=0.210,
P<0.001), non-fasting glucose (r=0.137, P<0.001) at initial
presentation and CRP at Day 3(r=0.132, P<0.001), while not with
hemoglobin, serum cholesterol or HbA1c %.
TABLE-US-00002 TABLE 1 Characteristics of basic clinical date of
patients with STEMI Tertiles of admission MlF (ng/ml) <40.4
40.4-70.9 .gtoreq.70.9 Total (Low) (Median) (High) P value number
421 140 140 141 age 60.4 .+-. 13.1 60.8 .+-. 12.3 59.2 .+-. 13.4
61.3 .+-. 13.7 0.780 gender, % 81 78 85 80 0.327 Systolic BP, mmHg
133 .+-. 20 132 .+-. 19 130 .+-. 19 136 .+-. 21 0.066 Diastolic BP,
mmHg 78 .+-. 13 79 .+-. 13 77 .+-. 12 79 .+-. 13 0.216 Heart rate,
bpm 4 .+-. 19 74 .+-. 13 74 .+-. 23 75 .+-. 20 0.887 Body mass
index, kg/M.sup.2 25.6 .+-. 4.3 25.6 .+-. 5.7 25.4 .+-. 3.6 25.8
.+-. 3.2 0.692 eGFR, mmol/L 90.34 .+-. 34 86 .+-. 32 91 .+-. 30 94
.+-. 37 0.655 Admission time <6 h, % 77.9 83.0 72.9 77.9 0.142
History, % Hypertension 57.2 56.0 51.4 64.3 0.088 Diabetes 24.9
26.2 27.1 21.4 0.493 Hypocholesteremia 32.5 34.8 31.4 31.4 0.790
Current smoking 67.5 65.2 68.6 68.1 0.752 Previous Myocardial 6.7
8.5 7.2 4.3 0.349 infarction Family history of 21.2 19.9 21.4 22.1
0.891 Angiographic data, % Culprit vessel LAD 46.2 45.4 39.6 53.6
0.062 3-vessel lesion 35.4 32.6 35.7 37.9 0.653 Stents 96.4 96.5
95.7 97.1 0.868 Thrombus aspiration 15.7 15.6 18.6 12.9 0.421
Tirofiban 33.0 35.5 33.6 30.0 0.614 IABP in situ 3.6 2.9 2.9 5.0
0.532 Timi = 0, before PCI 78.9 79.4 84.3 72.9 0.663 Timi <3,
After PCI 3.1 2.8 2.9 3.6 0.921 ST-segment resolution <50% 25.9
15.6 22.9 39.3 <0.001 LVEDD >55 mm, % 33.1 37.5 46.7 39.1
0.062 LVEF <50%, % 35.3 23.4 30.2 51.5 <0.001 Killip class
II-IV, % 18.1 12.8 18.6 22.9 0.087 Medication, % Clopidogrel 99.5
98.5 100.0 99.3 0.663 Aspirin 98.1 98.6 97.1 98.6 0.597 Statins
96.4 97.2 97.9 94.3 0.232 ACEI/ARBs 72.7 77.3 66.9 73.7 0.578
.beta.-blocker 71.8 76.6 69.6 69.1 0.297
[0229] Data are presented either as mean.+-.SD, percentage or
median (25th percentile; 75th percentile). Categorical variables
are indicated as percentage (%) of patients. eGFR: estimated
glomerular filtration rate. LAD, left anterior descending; IABP,
intra-aortic balloon pump; LDL, low-density lipoprotein; LVEF, left
ventricular ejection fraction; LVEDD, left ventricular
end-diastolic diameter; PCI, Percutaneous coronary intervention.
P-values were derived from Mann-Whitney U statistics, One-way ANOVA
test, or Chi-squire test for comparison among MIF tertile
groups.
TABLE-US-00003 TABLE 2 Baseline laboratory measurements Tertiles of
admission MIF (ng/ml) <40.4 40.4-70.9 .gtoreq.70.9 Total (Low)
(Median) (High) P value number 421 140 140 141 White blood cells,
10.2 .+-. 03.3 9.4 .+-. 3.0 9.9 .+-. 3.0 11.2 .+-. 3.7 0.001
10.sup.9/L Hemoglobin, g/L 143 .+-. 21 141 .+-. 21 143 .+-. 18 144
.+-. 23 0.396 Platelets, 10.sup.9/L 218 .+-. 58 211 .+-. 50 216
.+-. 60 219 .+-. 63 0.060 Blood glucose, mmol/L 6.0, 5.1-7.6 5.7,
4.9-7.5 5.9, 5.3-7.7 6.4, 5.1-8.1 0.076 CKMB Peak, U/L 195, 134-309
165, 109-268 180, 129-295 271, 168-377 <0.001 Hs-TnT Peak, ng/ml
4.1, 2.2-6.3 2.7, 1.5-4.0 4.2, 2.1-6.0 6.2, 3.9-7.1 <0.001
Day-3, 931, 376-2029 772, 251-1896 709, 378-1687 1272, 589-2882
0.004 Nt-proBNP, pg/ml Day-3 6.60, 3.60-12.16 4.71, 2.02-12.81
6.15, 2.79-17.85 8.08, 3.20-16.32 0.007 Hs-CPR, pg/ml Day-3 HbA1c,
mmol/L 6.3 .+-. 1.6 6.1 .+-. 1.4 6.4 .+-. 1.7 6.3 .+-. 1.6 0.355
Day-3 LDL-c, mmol/L 2.93 .+-. 1.24 2.96 .+-. 0.94 2.92 .+-. 1.00
2.9 .+-. 1.66 0.854 Day-3 HDL-c, mmol/L 0.95 .+-. 0.23 0.94 .+-.
0.20 0.94 .+-. 0.19 0.95 .+-. 0.30 0.887
[0230] Data are mean.+-.SD, percentage or median (25th percentile;
75th percentile). NT-proBNP, indicates N-terminal prohormone of
brain natriuretic peptide; LDL-c, low-density
lipoprotein-cholesterol; HDL-c, high-density
lipoprotein-cholesterol; CK-MB, Creatine kinase MB fraction; CRP,
C-reactive protein; hs-TnT, high sensitive-troponin T. P-values
were derived from Mann-Whitney U test or One-way ANOVA for
comparison among MIF tertile groups.
Admission MIF and Cardiac Function at Acute and 12-Month Phase.
[0231] Patients in the high tertile admission MIF group had a
higher proportion of maximum Killip class >1 during
hospitalisation in comparison with those with low tertile (22.9% VS
12.9%, p=0.027). Admission MIF level was associated with elevated
Nt-proBNP levels (r=0.182, P<0.001), impaired LVEF [r=-0.288,
95% CI (-0.195,-0.376), P<0.001] and enlarged LVDD (r=0.132,
<0.001) on Day-3 after MI. Repeated echocardiography was
performed at 12 months during follow-up and MIF had a stronger
correlation with F12 LVEF[r=-0.469, 95% CI (-0.387,-0.565),
P<0.001] and LVDD (r=0.271, P<0.001). Importantly, after
calculating changes in LVEF, our data revealed that high tertile
MIF was associated with lack of improvement of LVEF % (P<0.001)
at 12-month post-MI compared with the 3 day value (FIG. 2).
MIF and Incomplete ST-Segment Resolution
[0232] In the subgroup of high tertile MIF patients, the incidence
of ST-segment resolution <50% at 60 mins post-PCI was 2.5 and
1.7-fold higher than that of the low- or median-tertile groups
(p<0.001, Table 1). In contrast, admission hs-TnT, CK-MB were
not associated with incomplete ST-segment resolution (P=0.34 &
P=0.48). In multivariable logistics analyses, as log-2 transformed
continuous variables, admission MIF was an independent predictor
for incomplete resolution of ST-segment elevation with OR 1.75 (95%
CI 1.30-2.34; P<0.001) per doubling in MIF concentration after
adjustment of age, gender, eGFR, symptom to admission time<6 h,
infarct location, previous history of diabetes, current smoking and
WBC levels at initial presentation. Another remaining-significant
predictor was anterior infarction location was with OR of 1.30 (95%
CI 1.02-1.66; P=0.033).
MIF and Long-Term Adverse Outcomes
[0233] 107 patients had a MACE during a median follow-up period of
58 months (ranging from 0.1 to 83 months), there were 107 patients
who had MACE. Of them, 41 patients died with 31 due to
cardiovascular causes. There were 33 patients re-admitted due to
HF, and 33 experienced recurrent MI. The admission MIF level was
found to be closely associated with long-term adverse outcomes. As
shown in FIG. 3, Kaplan-Meier survival curves and log-rank analyses
demonstrated different incidence distributions, according to MIF
tertiles, of all-cause mortality, cardiovascular death, HF
re-hospitalisation and MACE (all P<0.05). To explore the
independency of MIF in prognostic prediction, we applied univariate
and multi-variate Cox-regression analyses using different models
(Table 3). In all 4 clinical risk models tested including clinical
characteristics and conventional biomarkers such as Nt-ptoBNP, peak
hs-TnT, hs-CRP, and Day-3 LVEF, MIF remained as an independent
predictor of all-cause mortality, cardiovascular death and
MACE.
TABLE-US-00004 TABLE 3 Multivariable Cox Regression Analyses for
admission MIF in Ail-Cause Mortality, Cardiovascular death, HF
re-hospitalisation and MACE log2 All-cause HF re- MIF MACE
immortality CVD hospitalisation un- HR 1.60 2.52 2.83 1.74 adjusted
(95% Cl) (1.27-2.03) (1.69-3.75) (1.78-4.50) (1.13-2.67) P value
<0.001 <0.001 <0.001 0.012 Model 1 HR 1.59 2.51 3.09 1.62
(95% Cl) (1.26-2.02) (1.66-3.81) (2.02-4.71) (1.07-2.46) P value
<0.001 <0.001 <0.001 0.024 Model 2 HR 1.49 2.36 2.62 1.61
(95% Cl) (1.16-1.94) (1.52-3.67) (1.56-4.40) (1.05-2.48) P value
0.002 <0.001 <0.001 0.028 Model 3 HR 1.46 2.25 2.55 1.62 (95%
Cl) (1.13-1.89) (1.48-3.44) (1.53-4.26) (1.05-2.25) P value 0.004
0.001 0.001 0.03 Model 4 HR 1.33 2.20 2.49 1.44 (95% Cl)
(1.01-1.77) (1.42-3.41) (1.52-4.24) (0.93-2.22) P value 0.043 0.002
0.004 0.098 Model 1: adjusted for age, sex, eGFR and log2MIF; Model
2: model 1 plus other characteristics as body mass index (BMI),
hemoglobin, previous MI, diabetes mellitus, hypertension, current
smoking, hypocholesteremia, symptom-admission time <6 h, 3
vessel disease, Killip class >1, culprit lesion of LAD,
ST-segment resolution, use of Glycoprotein libillla inhibitor
(Tirofiban) during the PCI, Timi class pre and post PPCI; Model 3:
model 2 plus logNt-proBNP, logTnT peak and loghs-CRP; Model 4:
model 3 plus LVEF.
[0234] We used a clinical risk model consisting of the followings:
age, sex, eGFR, hemoglobin, previous MI, diabetes mellitus,
hypertension, current smoking, symptom-admission time <6 h,
culprit lesion of LAD, 3 vessel disease, Killip class >1,
culprit lesion of LAD, ST-segment resolution, TIMI class pre- and
post-PCI, hs-TnT peak and day-3 LVEF. Our data showed that
inclusion of MIF significantly improved predictive ability
estimated by C-statistics of total death [0.84 (0.77-0.90) vs. 0.88
(0.83-0.93), P=0.006] and MACE [0.75 (0.70-0.79) vs. 0.77
(0.72-0.81), P=0.037]. Meanwhile, we calculated how many patients
were re-classified after the addition of continuous log 2MIF using
continuous NRI 0.48 (95% CI: 0.20-0.62) for all-cause mortality and
0.36 (95% CI: 0.11-0.54) for MACE. Calculated IDI yielded similar
improvement with 0.03 (95% CI: 0.02-0.11) for all-cause mortality
and 0.02 (95% CI: 0.01-0.05) for MACE (Table 4).
TABLE-US-00005 TABLE 4 Discrimination and Reclassification
Performance of the Addition of admission MIF Concentrations in
Predicting end points, based on C-Statistics, continuous NRI and
IDI All-cause mortality MACE log2 MIF Clinical model Clinical model
+ MIF P Clinical model Clinical model + MIF P C statistics 0.835
0.876 0.006 0.747 0.763 0.037 (95% CI) (0.767-0.904) (0.827-0.927)
(0.703-0.792) (0.720-0.806) Continuous NRI Reference 0.476 0.002
Reference 0.362 0.026 (95% CI) (0.204-0.620) (0.112-0.542) IDI
Reference 0.027 0.003 Reference 0.020 0.010 (95% CI) (0.018-0.107)
(0.005-0.049) Clinical Model: Age, sex, eGFR, BMI, hemoglobin,
previous MI, diabetes mellitus, hypertension, current smoking,
hypocholesteremia, symptom-admission time <6 h, 3 vessel
disease, Killip class >1, culprit lesion of LAD, ST-segment
resolution, use of Glycoprotein IIb/IIIa inhibitor (Tirofiban)
during the PCI, Timi class pre and post PPCI, hs-TnT peak and
LVEF.
Combined Prognostic Value of MIF and Nt-proBNP
[0235] The prognostic merit of MIF relative to hs-TnT peak, CRP,
and Nt-proBNP was compared by C-statistics. We found that MIF (C
statistics: 0.70, 95% CI: 0.66-0.76) provided better prognostic
information than peak hs-TnI (C statistics: 0.66, 95% CI:
0.60-0.70, P<0.05) and hs-CRP (C statistics: 0.59, 95% CI:
0.55-0.76, P<0.001), but was comparable to Nt-proBNP (C
statistics: 0.71, 95% CI: 0.66-0.78, P=0.79) in all-cause
mortality. Cox regression analysis revealed that, after adjustment
for Model 3 (including MIF and golden standard biomarkers as
Nt-proBNP, peak hs-TnT and hs-CRP), only admission MIF and
Nt-proBNP were independent predictors for adverse outcomes of STEMI
patients. However, after adjustment for Model 4 with addition of
day-3 LVEF, Nt-proBNP remains significant only for cardiovascular
death (Table 5).
TABLE-US-00006 TABLE 5 Multivariable Cox Regression Analyses for
day 3 Nt-proBNP in All-Cause Mortality, Cardiovascular death, HF
re-hospitalisation and MACE All-cause log Nt-proBNP MACE mortality
CVD HF re-hospitalisation unadjusted HR(95% CI) 2.41(1.68-3.44)
3.85(2.13-6.96) 4.84(2.42-9.66) 3.65(1.91-6.97) P value <0.001
<0.001 <0.001 <0.001 model 1 HR(95% CI) 1.91(1.32-2.76)
2.40(1.28-4.5) 3.39(1.60-7.21) 2.89(1.47-5.67) P value 0.001 0.006
0.003 0.002 model 2 HR(95% CI) 1.49(1.01-2.20) 2.25(1.18-4.30)
3.12(1.35-7.18) 2.51(1.21-5.23) P value 0.044 0.015 0.008 0.014
model 3 HR(95% CI) 1.60(1.08-2.39) 1.98(1.10-3.87 3.10(1.35-7.18)
2.26(1.08-4.71) P value 0.02 0.045 0.008 0.03 model 4 HR(95% CI)
1.30(0.82-2.06) 1.54(0.75-3.16) 2.64(1.15-5.99) 1.30(0.55-3.04) P
value 0.271 0.238 0.022 0.358 Model 1: adjusted for age, sex, eGFR
and logNt-proBNP; Model 2: model 1 plus other characteristics as
body mass index (BMI), hemoglobin, previous MI, diabetes mellitus,
hypertension, current smoking, hypocholesteremia, symptom-admission
time <6 h, 3 vessel disease, Killip class >1, culprit lesion
of LAD, ST-segment resolution, use of Glycoprotein IIb/IIIa
inhibitor (Tirofiban) during the PCI, TIMI class pre and post PPCI;
Model 3: model 2 plus log2MIF. logTnT peak and loghs-CRP; Model 4:
model 3 plus LVEF.
[0236] To investigate additive prognostic value of combination of
MIF and Nt-proBNP, risk stratification of STEMI patients for the
endpoints was made according to tertiles of MIF and NT-proBNP
levels. The risk of the all-cause mortality (25.4% vs 0.0%,
P<0.001) and MACE (47.5% vs 5.6%, P<0.001; FIG. 4) increased
significantly in patients with both biomarkers in the highest
tertile compared with other counterparts with both biomarkers in
the low tertile. Furthermore, to study prognostic value of
different combinations, STEMI patients were divided into two
subgroups with positive group (+) if individual biomarkers in high
tertile and as negative group (-) if in median or low tertile.
Compared with those in both negative groups, the hazard ratio of
patients in Nt-proBNP (+) MIF (+) group [HR (95% CI):
9.29(3.60-23.94), p<0.001], was more than 9 in total mortality
(FIG. 5), higher than Hs-TnT peak (+) MIF (+)[HR (95% CI): 3.94
(1.81-8.57), P<0.001] and Nt-proBNP (+) hs-TnT peak (+) [HR (95%
CI): 5.99 (2.62-13.69)] groups, similar to Triple (+) groups [HR
(95% CI): 9.58 (3.27-28.04)]. Similar results were shown in
Nt-proBNP (+) MIF (+) group with respect to risk of MACE (FIG. 5
& Table 6).
TABLE-US-00007 TABLE 6 Univariate Cox regression for All-cause
mortality and MACE in STEMI patients grouped according to MIF,
Nt-proBNP or hs-TnT peak in high tertile separately. Univariate Cox
regression Combined Groups HR (95% CI) P value All-cause Nt-proBNP
(-) MIF (-) 1 mortality Nt-proBNP (+) MIF (+) 9.29 <0.001
(3.60-23.94) Nt-proBNP (-) TnT peak (-) 1 Nt-proBNP (+) TnT peak
(+) 5.99 <0.001 (2.62-13.69) MW (-) TnT peak (-) 1 M-IF(+) TnT
peak (+) 3.94 0.001 (1.81-8.57) Ttiple (-) 1 Triple (+) 9.55
<0.001 (3.27-28.04) Nt-proBNP (-) MIF (-) 1 Nt-proBNP (+)MIF (+)
4.72 <0.001 (2.53-8.80) Nt-proBNP (-) TnT peak (-) 1 Nt-proBNP
(+) TnT peak (+) 2.79 <0.001 (1.75-4.45) MACE MIF (-) TnT peak
(-) 1 MIF (+) TnT peak (+) 3.90 <0.001 (2.41-6.33) Triple (-) 1
Triple (+) 4.11 <0.001 (2.28-7.40)
[0237] Patients grouped according to MIF, Nt-proBNP or hs-TnT peak
in high tertile separately.
[0238] In summary, these findings demonstrate that in patients with
STEMI admission MIF has prognostic value for adverse progression of
LV systolic dysfunction, long-term mortality and MACE, independent
of clinical established risk factors, acute LVEF and routinely
measured biomarkers. In addition, admission MIF together with
Nt-proBNP and/or hs-TnT facilitates a better prognostic prediction.
The current study establishes admission MIF as a useful biomarker
for short- and long-term prognosis in STEMI patients. Admission MIF
can accordingly allow for risk stratification of high-risk STEMI
patients, who may potentially benefit from more comprehensive
diagnostic evaluation and more intensive therapy for secondary
prevention. These findings establish the utility of
biomarker-guided management strategies to patients who may have
poor long-term prognosis.
* * * * *