U.S. patent application number 16/820656 was filed with the patent office on 2020-07-30 for apelin peptides and uses thereof.
The applicant listed for this patent is THE GOVERNORS OF THE UNIVERSITY OF ALBERTA. Invention is credited to Conrad FISCHER, Shaun MCKINNIE, Gavin OUDIT, John VEDERAS.
Application Number | 20200239537 16/820656 |
Document ID | 20200239537 / |
Family ID | 1000004954550 |
Filed Date | 2020-07-30 |
![](/patent/app/20200239537/US20200239537A1-20200730-C00001.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00002.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00003.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00004.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00005.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00006.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00007.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00008.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00009.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00010.png)
![](/patent/app/20200239537/US20200239537A1-20200730-C00011.png)
View All Diagrams
United States Patent
Application |
20200239537 |
Kind Code |
A1 |
OUDIT; Gavin ; et
al. |
July 30, 2020 |
APELIN PEPTIDES AND USES THEREOF
Abstract
The disclosure relates to modified apelin polypeptides having
increased stability against kallikrein, NEP and ACE2 degradation
and/or potency relative to the native apelin-13 and apelin-17
polypeptides. Embodiments also disclose methods of using the
polypeptides for treating cardiovascular disorders.
Inventors: |
OUDIT; Gavin; (Edmonton,
CA) ; VEDERAS; John; (Edmonton, CA) ;
MCKINNIE; Shaun; (Edmonton, CA) ; FISCHER;
Conrad; (Edmonton, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
THE GOVERNORS OF THE UNIVERSITY OF ALBERTA |
Edmonton |
|
CA |
|
|
Family ID: |
1000004954550 |
Appl. No.: |
16/820656 |
Filed: |
March 16, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16027237 |
Jul 3, 2018 |
10640545 |
|
|
16820656 |
|
|
|
|
62528379 |
Jul 3, 2017 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 47/60 20170801;
C07K 14/47 20130101; C07K 14/575 20130101; A61K 47/542 20170801;
A61P 9/12 20180101; A61K 9/0019 20130101; A61P 9/10 20180101; A61K
38/22 20130101; A61P 9/00 20180101 |
International
Class: |
C07K 14/575 20060101
C07K014/575; A61K 38/22 20060101 A61K038/22; A61K 47/54 20060101
A61K047/54; A61P 9/10 20060101 A61P009/10; A61K 9/00 20060101
A61K009/00; A61P 9/00 20060101 A61P009/00; A61P 9/12 20060101
A61P009/12; A61K 47/60 20060101 A61K047/60; C07K 14/47 20060101
C07K014/47 |
Claims
1. (canceled)
2. (canceled)
3. (canceled)
4. (canceled)
5. (canceled)
6. (canceled)
7. (canceled)
8. A peptidomimetic having the formula:
Cbz-NHCH.sub.2CH.sub.2--(OCH.sub.2CH.sub.2).sub.m--CO-Lys-Phe-Arg-Arg-Gln-
-aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17,
or pharmaceutically acceptable salts thereof, wherein m is 3 to 10;
wherein each of aa'6, aa'7, aa'8, aa'9, aa'10, aa'11, aa'12, aa'13,
aa'14, aa'15, aa'16 and aa'17 is independently an amino acid,
wherein: aa'6 comprises Arg or a conservative variant thereof; aa'7
comprises Pro or a conservative variant thereof; aa'8 comprises an
amino acid or a conservative variant thereof selected from the
group consisting of Arg, Arg-D, .alpha.MeArg and azaArg; aa'9
comprises an amino acid or a conservative variant thereof selected
from the group consisting of Leu, NMeLeu, .alpha.MeLeu and azaLeu;
aa'10 comprises Ser or a conservative variant thereof; aa'11
comprises His or a conservative variant thereof; aa'12 comprises
Lys or a conservative variant thereof; aa'13 comprises Gly or a
conservative variant thereof; aa'14 comprises Pro or a conservative
variant thereof; aa'15 is comprises Nle or a conservative variant
thereof, wherein Nle is norleucine; aa'16 is comprises Aib or a
conservative variant thereof, wherein Aib is
.alpha.-aminoisobutryic acid; and aa'17 is comprises paraBrPhe or a
conservative variant thereof.
9. (canceled)
10. (canceled)
11. (canceled)
12. (canceled)
13. The peptidomimetic of claim 8, wherein
aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17
is Arg-Pro-Arg-D-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
14. The peptidomimetic of claim 8, wherein
aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17
is Arg-Pro-Arg-NMeLeu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
15. The peptidomimetic of claim 8, wherein
aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17
is
Arg-Pro-.alpha.MeArg-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
16. The peptidomimetic of claim 8, wherein
aa'6-aa'7-aa'8-aa'9-aa1l-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17
is
Arg-Pro-Arg-.alpha.MeLeu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
17. The peptidomimetic of claim 8, wherein
aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17
is Arg-Pro-azaArg-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
18. The peptidomimetic of claim 8, wherein
aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17
is Arg-Pro-Arg-azaLeu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
19. (canceled)
20. The peptidomimetic of claim 8 having the following structure:
##STR00012## wherein m is from 3 to 10.
21. (canceled)
22. (canceled)
23. (canceled)
24. (canceled)
25. A composition comprising the peptidomimetic having the formula:
Cbz-NHCH.sub.2CH.sub.2--(OCH.sub.2CH.sub.2).sub.m--CO-Lys-Phe-Arg-Arg-Gln-
-aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'15-aa'16-aa'17,
or pharmaceutically acceptable salts thereof; wherein m is 3 to 10;
wherein each of aa'6, aa'7, aa'8, aa'9, aa'10, aa'11, aa'12, aa'13,
aa'14, aa'15, aa'16 and aa'17 is independently an amino acid,
wherein: aa'6 comprises Arg or a conservative variant thereof; aa'7
comprises Pro or a conservative variant thereof; aa'8 comprises an
amino acid or a conservative variant thereof selected from the
group consisting of Arg, Arg-D, .alpha.MeArg and azaArg; aa'9
comprises an amino acid or a conservative variant thereof selected
from the group consisting of Leu, NMeLeu, .alpha.MeLeu and azaLeu;
aa'10 comprises Ser or a conservative variant thereof; aa'11
comprises His or a conservative variant thereof; aa'12 comprises
Lys or a conservative variant thereof; aa'13 comprises Gly or a
conservative variant thereof; aa'14 comprises Pro or a conservative
variant thereof; aa'15 is comprises Nle or a conservative variant
thereof, wherein Nle is norleucine; aa'16 is comprises Aib or a
conservative variant thereof, wherein Aib is
.alpha.-aminoisobutryic acid; and aa'17 is comprises paraBrPhe or a
conservative variant thereof.
26. The composition of claim 25, wherein the composition is a
pharmaceutical composition.
27. A method of modulating an apelin pathway disorder in a subject
comprising administering to the subject a therapeutically effective
amount of an apelin peptide comprising a peptidomimetic having the
formula of claim 8, or pharmaceutically acceptable salts
thereof.
28. The method of claim 27, wherein the apelin peptide is an apelin
receptor agonist.
29. The method of claim 27, wherein the apelin pathway disorder is
a cardiac disease.
30. The method of claim 27, wherein the cardiac disease is selected
from the group consisting of systemic arterial hypertension,
abdominal aortic aneurysm, pulmonary arterial hypertension, heart
failure, myocardial ischemic-reperfusion injury, cardiac allograft
vasculopathy, myocardial infarction, and high blood pressure.
31. The method of claim 30, wherein the cardiac disease is
abdominal aortic aneurysm.
32. The method of claim 30, wherein the cardiac disease is cardiac
allograft vasculopathy.
33. The method of claim 27, wherein the administering is carried
out intravenously.
34. A method of modulating vascular tone in a subject comprising
administering to the subject an effective amount of an apelin
receptor agonist comprising a peptidomimetic of Formula (I) or
Formula (II), or pharmaceutically acceptable salts thereof.
35. The method of claim 34, wherein the administering is carried
out intravenously.
36. A method of reducing cardiac reperfusion injury following
myocardial infarction in a subject comprising administering to the
subject an effective amount of an apelin receptor agonist
comprising an apelin peptide comprising a peptidomimetic having the
formula of claim 8, or pharmaceutically acceptable salts
thereof.
37. The method of claim 36, wherein the cardiac reperfusion injury
is due to an ischemic condition.
38. The method of claim 36, wherein the ischemic condition is
selected from the group consisting of acute coronary syndromes,
thomboembolic events, surgery or resuscitation from cardiac arrest,
and combinations thereof.
39. The method of claim 36, wherein the administering step is
carried out intravenously.
40. A method of reducing blood pressure in a subject comprising
administering to the subject an effective amount of an apelin
receptor agonist comprising an apelin peptide comprising a
peptidomimetic having the formula of claim 8, or pharmaceutically
acceptable salts thereof.
41. The method of claim 40, wherein the administering step is
carried out intravenously.
Description
RELATED APPLICATION INFORMATION
[0001] This application is a continuation application of U.S.
patent application Ser. No. 16/027,237 filed Jul. 3, 2018, which
claims priority to U.S. Provisional Patent Application No.
62/528,379, filed Jul. 3, 2017. The entire contents of the
foregoing applications are incorporated herein by reference,
including all text, tables, sequence listing and drawings.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Sep. 25, 2018, is named UofAlberta0459694_ST25.txt and is 28.9
KB in size.
BACKGROUND
[0003] Apelin (APLN), the endogenous mammalian peptide ligand of
the apelin receptor has been indicated as a regulator of the
cardiovascular system. Human apelin is a pre-proprotein of 77 amino
acids (MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPW
QGGRRKFRRQRPRLSHKGPMPF (SEQ ID NO: 6)), with a secretory signal
sequence in the N-terminal region. After cleavage of the signal
peptide at the endoplasmic reticulum, the remaining 55 amino acid
residue may undergo further cleavage to several active isoforms
including a 36 amino acid peptide corresponding to apelin sequence
residues 42-77 (apelin-36, LVQPRGSRNGPGPWQGGRRKFRR-QRPRLSHKGPMPF,
(SEQ ID NO:3)) (3), a 17 amino acid peptide corresponding to the
apelin sequence residues 61-77 (apelin-17, KFRRQRPRLSHKGPMPF (SEQ
ID NO:2)) (2) and a 13 amino acid peptide corresponding to the
apelin sequence residues 65-77 (apelin-13, QRPRLSHKGPMPF (SEQ ID
NO:7)), which all possess a conserved C-terminal amino acid (FIG.
1). The apelin-13 fragment may also undergo subsequent
pyroglutamylation at its N-terminal glutamine residue to provide
(pyr.sup.1) apelin-13 ((Pyr)RPRLSHKGPMPF (SEQ ID NO:1) (1).
[0004] Apelin pathway mediates a positive effect on cardiac
contractility and vasodilator activity that counteracts
angiotensin-II-induced vasoconstriction. Moreover, apelin
administration has been indicated to reduce the progression of
cardiac hypertrophy, while apelin knockout mice have been shown to
be susceptible to heart failure. Apelin also has a beneficial role
in the cardiovascular system, such as initiating vasodilation
through a NO-mediated mechanism, positive inotropy, angiogenesis,
and the prevention of myocardial ischemic reperfusion injury.
[0005] Despite the beneficial physiological effects of the
apelinergic system, the lifespan of apelin peptides is heavily
regulated and limited via proteolysis. The (pyr1) apelin-13
fragment (SEQ ID NO:1), for example, has been indicated as an
endogenous ligand for the apelin receptor with an EC50 about 0.37
nM, while (pyr1) apelin-13 exhibits potent vascular effects in
vivo. However, (pyr1) apelin-13 stability is quite low in human
plasma, with a t.sub.1/2 of about one minute.
[0006] Angiotensin converting enzyme 2 (ACE2) is a well-known
monocarboxypeptidase that efficiently catalyzes the removal of the
conserved C-terminal phenylalanine from apelin isoforms in vitro
and in vivo. Des-phenylalanine apelin isoforms behave as biased
agonists by retaining native binding and forskolin-induced cAMP
inhibition, but abolishing apelin receptor internalization and
.beta.-arrestin recruitment. Studies have shown that truncated
peptides demonstrate a diminished capacity to lower blood pressure
and have no ability to protect against myocardial ischemic
reperfusion injury, making the C-terminal Phe residue essential for
full agonist activity. Therefore, there exists a need to negate the
impact of ACE2 degradation on apelin isoforms, and to improve the
overall stability of the apelin isoforms. Given the therapeutic
potential of (pyr1) apelin-13 and related apelin peptides, there is
a continued interest in stabilizing the peptide structures while
preserving their biological profiles.
SUMMARY
[0007] The present disclosure relates to peptide and peptide-like
therapeutic agents for the treatment of various diseases and
conditions related to the apelin/apelin receptor system. In
particular, the present disclosure relates to apelin-based
therapeutics and their use in treating various diseases and
disorders of the cardiovascular system.
[0008] Embodiments disclosed herein relate to apelin peptides, in
particular, apelin peptides comprising peptidomimetic of Formula
(I): Z1-pGlu-aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10-aa11-aa12-aa13,
or pharmaceutically acceptable salts thereof, wherein Z1 is H or a
long chain moiety, wherein each of aa2, aa3, aa4, aa5, aa6, aa7,
aa8, aa9, aa10, aa11, aa12, and aa13 is independently an amino
acid, wherein: aa2 comprises Arg or a conservative variant thereof;
aa3 comprises Pro or a conservative variant thereof; aa4 comprises
an amino acid or a conservative variant thereof selected from the
group consisting of Arg, Arg-D, .alpha.MeArg and azaArg; aa5
comprises an amino acid or a conservative variant thereof selected
from the group consisting of Leu, NMeLeu, .alpha.MeLeu and azaLeu;
aa6 comprises Ser or a conservative variant thereof; aa7 comprises
His or a conservative variant thereof; aa8 comprises Lys or a
conservative variant thereof; aa9 comprises Gly or a conservative
variant thereof; aa10 comprises Pro or a conservative variant
thereof; aa11 comprises Nle or a conservative variant thereof,
wherein Nle comprises norleucine; aa12 comprises Aib or a
conservative variant thereof, wherein Aib comprises
.alpha.-aminoisobutyric acid; and aa13 comprises paraBrPhe or a
conservative variant thereof.
[0009] Embodiments disclosed herein relate to apelin peptides, in
particular, apelin peptides comprising peptidomimetic of Formula
(II):
Z2-Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14--
aa'15-aa'16-aa'17, or pharmaceutically acceptable salts thereof,
wherein Z2 is H or a long chain moiety, wherein each of aa'6, aa'7,
aa'8, aa'9, aa'10, aa'11, aa'12, aa'13, aa'14, aa'15, aa'16 and
aa'17 is independently an amino acid, wherein: aa'6 comprises Arg
or a conservative variant thereof; aa6 comprises Arg or a
conservative variant thereof; aa'7 comprises Pro or a conservative
variant thereof; aa'8 comprises an amino acid or a conservative
variant thereof selected from the group consisting of Arg, Arg-D,
.alpha.MeArg and azaArg; aa'9 comprises an amino acid or a
conservative variant thereof selected from the group consisting of
Leu, NMeLeu, .alpha.MeLeu and azaLeu; aa'10 comprises Ser or a
conservative variant thereof; aa'11 comprises His or a conservative
variant thereof; aa'12 comprises Lys or a conservative variant
thereof; aa13 comprises Gly or a conservative variant thereof;
aa'14 comprises Pro or a conservative variant thereof; aa'15
comprises Nle or a conservative variant thereof, wherein Nle i
comprises norleucine; aa'16 comprises Aib or a conservative variant
thereof, wherein Aib comprises .alpha.-aminoisobutyric acid; and
aa'17 comprises paraBrPhe or a conservative variant thereof.
[0010] Embodiments disclosed herein relate to methods of modulating
an apelin pathway disorder in a subject comprising administering to
the subject a therapeutically effective amount of an apelin peptide
comprising a peptidomimetic of Formula (I) of claim 1 or Formula
(II) of the present disclosure or pharmaceutically acceptable salts
thereof.
[0011] Embodiments disclosed herein relate to methods of modulating
vascular tone in a subject comprising administering to the subject
an effective amount of an apelin receptor agonist comprising a
peptidomimetic of Formula (I) or Formula (II), or pharmaceutically
acceptable salts thereof.
[0012] Embodiments disclosed herein relate to methods of reducing
cardiac reperfusion injury following myocardial infarction in a
subject comprising administering to the subject an effective amount
of an apelin receptor agonist comprising a peptidomimetic of
Formula (I) or Formula (II), or pharmaceutically acceptable salts
thereof.
[0013] Embodiments disclosed herein relate to methods of reducing
blood pressure in a subject comprising administering to the subject
an effective amount of an apelin receptor agonist comprising a
peptidomimetic of Formula (I) or Formula (II), or pharmaceutically
acceptable salts thereof.
BRIEF DESCRIPTION OF DRAWINGS
[0014] Various embodiments of the present disclosure will be
described herein below with reference to the figures wherein:
[0015] FIG. 1 shows apelin isoforms: (pyr.sup.1) apelin-13 fragment
(SEQ ID NO:1) (1), apelin-17 (SEQ ID NO:2) (2), and apelin-36 (SEQ
ID NO:3) (3), with identified sites of NEP and ACE2 proteolytic
degradation.
[0016] FIG. 2 illustrates certain syntheric modifications into both
the pyr-1-apelin-13 A2,
pGlu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe (SEQ ID
NO:4) (4), and apelin-17 A2,
Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe
(SEQ ID NO:5) (5), in accordance with embodiments of the present
disclosure.
[0017] FIG. 3 is a synthetic reaction scheme showing the general
SPPS approach for the divergent syntheses of Arg/Leu modified
apelin A2 peptides.
[0018] FIG. 4 is a synthetic scheme of dipeptide 22 for the
preparation of N-methyl leucine apelin A2 peptides 10 and 11.
[0019] FIG. 5 is a synthetic scheme of dipeptide 29 for the
preparation of .alpha.-methyl arginine apelin A2 peptides 12 and
13.
[0020] FIG. 6 is a synthetic scheme of dipeptide 33 for the
preparation of .alpha.-methyl leucine apelin A2 peptides 14 and
15.
[0021] FIG. 7 is a synthetic scheme of dipeptide 39 for the
preparation of aza-arginine apelin A2 peptides 16 and 17.
[0022] FIG. 8 is a synthetic scheme of dipeptide 45 for the
preparation of aza-arginine apelin A2 peptides 18 and 19.
[0023] FIGS. 9 A-B demonstrate in vitro NEP degradation trends for
pyr-1-apelin-13 peptides (FIG. 9A) and apelin-17 peptides (FIG. 9B)
according to embodiments of the disclosure.
[0024] FIGS. 10 A-H demostrates in vivo systolic (SBP, FIG.
10A/FIG. 10E), diastolic (DBP, FIG. 10B/FIG. 10F) and mean arterial
blood pressure (MABP, FIG. 10C/FIG. 10G) and heart rate analyses
(HR, FIG. 10D/FIG. 10H) following injection of pyr-1-apelin-13 A2
(left) and apelin-17 A2 (right) peptides in anesthetized mice.
[0025] FIGS. 11 A-E demostrates ex vivo heart assessment: heart
rate (HR, FIG. 11 A); maximum derivative of change in systolic
pressure over time (max dP/dt, FIG. 11 B); left ventricle developed
pressure (LVDP, FIG. 11 C), minimum derivative of change in
diastolic pressure over time (min dP/dt, FIG. 11 D); and
rate-pressure product (RPP, FIG. 11 E), using Langendorff
experiments following reperfusion of saline (negative control,
sham), native 2 (positive control) and peptides 11, 17-19 after a
30-minute period of ischemia.
[0026] FIG. 12 shows the KLKB1 cleavage between Arg3 and Arg4 of
the native Apelin-17 (2).
[0027] FIGS. 13 A-B show the breakdown-fragments 1-3 (FIG. 13A) and
4-17 FIG. 13B) after plasma incubation of apelin-17A2 (peptide
5).
[0028] FIGS. 14A-G show the concentration response curves of apelin
peptides of the certain embodiments of the disclosure.
[0029] FIGS. 15A-D demostrates in vivo systolic (SBP, FIG. 15B),
diastolic (DBP, FIG. 15C) and mean arterial blood pressure (MABP,
FIG. 15A) and heart rate analyses (HR, FIG. 15D) following
injection of Apelin-NMe17A2 (peptide 11), and apelin peptides 55-59
in anesthetized mice.
[0030] FIGS. 16A-B demostrates blood pressure data of KLKB1
fragments 54 and 55.
[0031] FIG. 17A-B are micrographs of the cross-sectional area of
the intimal/lumen with Verhoeff-van Gieson-stained saline-treated
control carrier compared to an apelin peptide (11) treated coronary
arteries.
[0032] FIG. 18 is a bar chart of showing the ratio of luminal/lumen
areas for coronary arteries 2 and 6 weeks after heart transplant of
the model.
[0033] FIG. 19 is a curve showing the survival rate of mortality
due to aortic rupture in the indicated groups.
[0034] FIG. 20 shows representative ultrasound images of the
abdominal aorta and averaged measurement for abdominal aorta
diameter (during systole and diastole), and Aortic Expansion Index,
a measure of aortic wall compliance in Ldlr.sup.-/- mice that
received vehicle or Ang II for 4 weeks, or Ang II+apelin peptide
11. n=8 per group.
[0035] FIG. 21 shows representative images of immunostaining for
abdominal aorta sections for calponin (SMC, red), TUNEL (green),
DAPI (blue) and elastin fibers' autofluorescence (green) in the
indicated group. Averaged quantification for Calponin levels
(measure of viable SMCs), and apoptotic cells (TUNEL-positive) for
each group is shown on the right.
[0036] FIG. 22 shows representative Western blot for cleaved and
total caspase 3, and averaged cleaved-to-total ratio for Caspase
3.
[0037] FIG. 23 shows representative immunostaining for ACE2 and
averaged quantification in the abdominal aorta of Ldlr-/- mice
receiving saline, Ang II or Ang II+apelin peptide 11, n=6 per
group.
[0038] FIG. 24 shows representative Western blot and averaged
quantification for ACE2 in abdominal aorta of Ldlr.sup.-/- mice
receiving saline, Ang II or Ang II+apelin peptide 11. Aortic
protein from Ace2.sup.-/- mouse was used as the negative
control.
[0039] FIG. 25 shows DHE fluorescence and NADPH oxidase activity
showing suppression of oxidative stress by the apelin peptide 11.
*p<0.05 compared to vehicle group. A.U.=arbitrary units.
Averaged values represent Mean.+-.SEM.
DETAILED DESCRIPTION
[0040] As used herein, the native human full length 77 amino acid
(SEQ ID NO: 6) may be referred to generally as "apelin" or "APLN,"
while "apelin peptides" will be used in reference to peptides
encompassing both naturally occurring cleavage products of apelin
such as apelin-36, apelin 17, apelin-13, pyr.sup.1 apelin-13, as
well as stabilized synthetic peptide derivatives, in accordance
with embodiments herein.
[0041] The role of APLN and the therapeutic use of the novel
stabilized apelin peptides disclosed herein in myocardial
infarction (MI) and ischemia-reperfusion (IR) injury is provided.
Myocardial APLN levels were reduced in subjects with ischemic heart
failure. Loss of APLN increased MI-related mortality, infarct size,
and inflammation with substantial reductions in pro-survival
pathways resulting in greater systolic dysfunction and heart
failure. APLN deficiency decreased vascular sprouting, impaired
sprouting of human endothelial progenitor cells and compromised in
vivo myocardial angiogenesis. Lack of APLN enhanced susceptibility
to ischemic injury and compromised functional recovery following ex
vivo and in vivo IR injury. Advantageously, the stabilized apelin
peptides disclosed herein may provide improved apelin proteolytic
stability against NEP and improved resistance to angiotensin
converting enzyme 2 (ACE2) cleavage and may mimic the function of
APLN, while demonstrating protection against ex vivo and in vivo
myocardial IR injury linked to greater activation of survival
pathways and promotion of angiogenesis. The short half-life of
native apelin peptides (Japp A G, et al. Circulation.
121:1818-1827, (2010); Vickers C, et al. J Biol Chem.
277:14838-14843, (2002); Japp A G, et al. J Am Coil Cardiol.
52:908-913, (2008)) prompted the development of the apelin peptides
disclosed herein which are more potent and less susceptible to
degradation.
[0042] Since the APLN system is compromised in human heart failure
(Chen M. M., et al. Circulation. 108:1432-1439, (2003); Chong K S,
et al. Eur J Heart Fail. 8:355-360, (2006)), the integrative
physiological role of the APLN system indicates that enhancing
apelin action may serve to minimize myocardial ischemic damage and
the progression to advanced HF (hear failure disease). Enhancing
apelin action represents a new approach for the treatment of
ischemic heart failure.
[0043] As discussed, there exists a need to negate the impact of
ACE2 degradation on apelin isoforms, and to improve the overall
stability of the apelin isoforms. To negate the impact of ACE2
degradation on apelin isoforms, an ACE2 resistant `A2` C-terminus
may be incorporated into the peptidomimetic of the presence
embodiments. The ACE2 resistant `A2` C-terminus denotes the last
three amino acids of the apelin peptides. In some embodiments, the
peptidomimetic of the present embodiments comprises unnatural
residues substituted at the C-terminal Met-Pro-Phe portion of
(pyr.sup.1) apelin-13 (SEQ ID NO:1). In some embodiments, the
peptidomimetic of the present embodiments comprises unnatural
residues substituted at the C-terminal Met-Pro-Phe portion of
apelin-17. The term "apelin A2 peptides," as used herein, refers to
peptides comprise unnatural residues substituted at the C-terminal
Met-Pro-Phe.
[0044] To further improve the overall stability of the apelin
isoforms, it is necessary to stabilize, or to improve the
metalloprotease neutral endopeptidase 24.11 (neprilysin, NEP)
stability. The inventors of the present disclosure discovered that
the NEP has a role in the in vitro proteolysis of apelin. NEP is a
significant protease implicated in the degradation and inactivation
of vasoactive peptides bradykinin, angiotensins, atrial natriuretic
factor (ANP), and endothelins in addition to many other peptide
hormones in other organ systems. The site of NEP proteolysis may be
structurally and functionally an essential feature for apelin
binding and subsequent physiological activity. Without being bound
by theory, the amino acid residues surrounding the site of NEP
proteolysis (the `RPRL` motif) has an enhanced rigidity and is
suggested to induce a p-turn conformation upon binding (Langelaan,
et al. Biochemistry 48:537-548 (2009)), and the two Arg residues
have been proposed to form key electrostatic interactions with
acidic amino acids on the exterior of the apelin receptor to
facilitate ligand binding (Gerbier, R., et al., FASEB J.: 29,
314-322 (2015)).
[0045] The inventors of the present disclosure discovered a way to
improve apelin proteolytic stability against NEP while at the same
time negating the impact of ACE2 degradation on apelin isoforms.
This approach includes altering the amino acids residues
surrounding both the NEP cleavage site and the ACE2 degradation
site. FIG. 1 shows apelin isoforms: (pyr.sup.1) apelin-13 fragment
(SEQ ID NO:1) (1), apelin-17 (SEQ ID NO:2) (2), and apelin-36 (SEQ
ID NO:3) (3), with identified sites of NEP and ACE2 proteolytic
degradation. In certain embodiments, the disclosure provides
peptidomimetic comprises unnatural residues substituted at the
C-terminal Met-Pro-Phe portion. In certain embodiments, the
disclosure provides peptidomimetic comprises unnatural residues
substituted at the C-terminal Met-Pro-Phe portion and optionally at
any one or more of amino acids at the "RPRL" motif (e.g., amino
acid 2 "aa2", amino acid 3 "aa3", amino acid 4 "aa4", and/or amino
acid 5 "aa5") of (pyr.sup.1) apelin-13. In certain embodiments,
apelin peptides comprising peptidomimetic of Formula (I), wherein
Z1 is H, having the following formula:
pGlu-aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10-aa11-aa12-aa13, or
pharmaceutically acceptable salts thereof, wherein aa2 to aa13 are
defined herein. pGlu refers to pyroglutamic acid.
[0046] In certain embodiments, the disclosure provides
peptidomimetic comprises unnatural residues substituted at the
C-terminal Met-Pro-Phe portion and optionally at any one or more of
amino acids at the RPRL motif (e.g., amino acid 6 "aa'6", amino
acid 7 "aa'7", amino acid 8 "aa'8", and/or amino acid 9 "aa'9") of
apelin-17. In certain embodiments, the disclosure provides apelin
peptides comprising peptidomimetic of Formula (II), wherein Z2 is
H, having the following formula:
Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-aa10-aa'11-aa'12-aa'13-aa'14-aa'1-
5-aa'16-aa'17, or pharmaceutically acceptable salts thereof,
wherein aa''9 to aa''20 are defined herein.
[0047] The inventors of the present disclosure further discovered
that the human plasma kallikrein (KLKB1) also has a role in the in
vitro proteolysis of apelin. The inventors discovered that KLKB1
cleaves after the first three N-terminal amino acids (KFR) of the
apelin-17 (i.e., cleavage between Arg3-Arg4). The KLKB1 cleavage
produces the C-terminal 14-mer lacking the polar basic KFR head
group. FIG. 12 shows the KLKB1 cleavage between Arg3 and Arg4 of
the native Apelin-17 (2).
[0048] In the human body, KLKB1 circulates as zymogen bound to
high-molecular-weight kininogen and is activated by coagulation
factor XIIa. (Kaplan, et. al.; Bradykinin formation. Plasma and
tissue pathways and cellular interactions. Clin. Rev. Allergy
Immunol. 1998, 16, 403-429.). Once activated, KLKB1 possesses a
trypsin like activity, cleaving at a basic residue in P1 position
(Arg), whereas the bulky hydrophobic Phe side chain at P2 can be
accommodated in the S2 pocket of this enzyme. (Tang, et. al.;
Expression, crystallization, and three-dimensional structure of the
catalytic domain of human plasma kallikrein. J. Biol. Chem. 2005,
280, 41077-41089.).
[0049] To improve apelin in vivo half-life, the inventors of the
present disclosure discovered that this can be accomplished by the
attachment of a long chain moiety to the N-terminus of the apelin
A2 peptides. Examples of long chain moieties and techniques to
increase plasma half-life include, but are not limited to,
N-terminal fatty acid chain (PALMitoylation), and polyethylene
glycol chain (PEGylation), XTEN (an 83.5 kDa) recombinant
polypeptide consisting only of the amino acids Ala, Asp, Gly Pro,
Ser, and Thr, detran conjugation, HESylation (Hydroxyethyl Starch,
HES, is a modified natural polymer obtained by controlled
hydroxyethylation of the plant polysaccharide amylopectin),
polysialylation, HAylation, N- and O-Glycosylation, and lipidation,
all of which are disclosed in Witteloostuijn, et. al., "Half-life
extension of biopharmaceuticals using chemical methods:
alternatives to PEGylation;" ChemMedChem 2016, 11, 2474-2495, the
disclosure of which is incorporated herein by reference in its
entirety.
[0050] In certain embodiments, the disclosure provides apelin
peptides comprising peptidomimetic of Formula (I) having the
following formula:
Z1-pGlu-aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10-aa11-aa12-aa13, or
pharmaceutically acceptable salts thereof, wherein Z1 is a long
chain moiety, wherein aa2 to aa13 are defined herein. In some
embodiments, Z1 is PALM or PEG.
[0051] In certain embodiments, the disclosure provides apelin
peptides comprising peptidomimetic of Formula (II) having the
following formula:
Z2-Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14--
aa15-aa'16-aa17, or pharmaceutically acceptable salts thereof,
wherein Z2 is a long chain moiety, wherein aa'6 to aa'17 are
defined herein. In some embodiments, Z2 is PALM or PEG.
[0052] In some embodiments, PALM may be
##STR00001##
wherein n is from 8 to 20, from 10 to 18, or from 12 to 16. In some
embodiments, any one or more carbon atom of the PALM may be
independently optionally substituted with a lower alkyl (e.g.,
methyl, ethyl, or propyl), PEG may be linear or branched and the
end groups may be either a hydroxyl group, amino group, a methoxy
group, or a protecting group, such as, Fmoc
(fluorenylmethyloxycarbonyl), Boc (tert-butyloxycarbonyl), and the
like.
[0053] In some embodiments, PEG is
##STR00002##
wherein m is from 3 to 10, from 4 to 8, or from 5 to 7, wherein W
may be H, a lower alkyl (e.g., methyl, ethyl, propyl, etc.), or a
protecting grou. In some embodiments, PEG is
Fmoc-NH(CH.sub.2).sub.p--, wherein p is 1 to 5, or 2 to 4. In a
specific embodiment, PEG is
##STR00003##
[0054] Both the PEG and PALM groups are attached to the apelin
peptide via an amide bond through the N-terminus. By way of
example, the following illustrates that the PALM group attaches to
the N-terminus amino acid through an amide bond:
##STR00004##
[0055] In specific embodiments, the disclosure provides specific
apelin peptides having the following structures:
TABLE-US-00001 ##STR00005## Compound No. R3 R4 5
NH.sub.2-Lys-Phe-Arg H 11 NH.sub.2-Lys-Phe-Arg CH.sub.3 54 H H 55 H
CH.sub.3 56 PALM-Lys-Phe-Arg H 57 PEG-Lys-Phe-Arg CH.sub.3 58
PALM-Lys-Phe-Arg H 59 PEG-Lys-Phe-Arg CH.sub.3 ##STR00006##
##STR00007##
[0056] In some embodiments, the disclosure provides apelin peptide
(54):
TABLE-US-00002 (SEQ ID NO: 35)
Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0057] In some embodiments, the disclosure provides apelin peptide
(55):
TABLE-US-00003 (SEQ ID NO: 36)
Arg-Gln-Arg-Pro-Arg-NMeLeu-Ser-His-Lys-Gly-Pro-
Nle-Aib-paraBrPhe.
[0058] In some embodiments, the disclosure provides apelin peptide
(56):
TABLE-US-00004 (SEQ ID NO: 37)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0059] In some embodiments, the disclosure provides apelin peptide
(57):
TABLE-US-00005 (SEQ ID NO: 38)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0060] In some embodiments, the disclosure provides apelin peptide
(58):
TABLE-US-00006 (SEQ ID NO: 39)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-NMeLeu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0061] In some embodiments, the disclosure provides apelin peptide
(59):
TABLE-US-00007 (SEQ ID NO: 40)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-NMeLeu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0062] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00008 (SEQ ID NO: 41)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-D-Leu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0063] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00009 (SEQ ID NO: 42)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-.alpha.MeArg-Leu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0064] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00010 (SEQ ID NO: 43)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-.alpha.MeLeu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0065] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00011 (SEQ ID NO: 44)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-azaArg-Leu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0066] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00012 (SEQ ID NO: 45)
PALM-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-azaLeu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0067] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00013 (SEQ ID NO: 46)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-D-Leu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0068] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00014 (SEQ ID NO: 47)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-.alpha.MeArg-Leu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0069] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00015 (SEQ ID NO: 48)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-.alpha.MeLeu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0070] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00016 (SEQ ID NO: 49)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-azaArg-Leu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0071] In some embodiments, the disclosure provides apelin
peptide:
TABLE-US-00017 (SEQ ID NO: 50)
PEG-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-azaLeu-Ser-
His-Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0072] The term "peptidomimetic," as used herein, refers to a
peptide-like molecule that has the activity of the peptide upon
which it is structurally based. A peptidomimetic includes the
substitution of one or more naturally occuring amino acids for any
chemically modified amino acids, individual unnatural amino acids,
peptide-like molecules containing non-naturally occurring amino
acids, and peptoids, and have an activity of the peptide upon which
the peptidomimetic is derived (see, for example, Goodman and Ro,
Peptidomimetics for Drug Design, in "Burger's Medicinal Chemistry
and Drug Discovery" Vol. 1 (ed. M. E. Wolff; John Wiley & Sons
(1995), pages 803-861).
[0073] The term "amino acid," as used herein, refers to naturally
occurring and synthetic amino acids, as well as amino acid analogs
and amino acid mimetics that function in a manner similar to the
naturally occurring amino acids. Naturally occurring amino acids
are those encoded by the genetic code, as well as those amino acids
that are later modified, e.g., hydroxyproline,
.gamma.-carboxyglutamate, selenocysteine, pyrrolysine, and
O-phosphoserine. "Amino acid analogs" refers to compounds that have
the same basic chemical structure as a naturally occurring amino
acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl
group, an amino group, and an R group, e.g., homoserine,
norleucine, methionine sulfoxide, methionine methyl sulfonium. Such
analogs have modified R groups (e.g., norleucine) or modified
peptide backbones, but retain the same basic chemical structure as
a naturally occurring amino acid. Amino acid mimetics refers to
chemical compounds that have a structure that is different from the
general chemical structure of an amino acid, but that functions in
a manner similar to a naturally occurring amino acid. Amino acids
may be referred to herein by either their commonly known three
letter symbols or by the one-letter symbols recommended by the
IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides,
likewise, may be referred to by their commonly accepted
single-letter codes.
[0074] The number after "amino acid" or "aa" or aa'" denotes the
position of the amino acid residue in the polypeptide chain when
counted from the amino terminal.
[0075] The terms "compounds," "peptides," and "peptidomimetic" are
used interchangeably in the disclosure.
[0076] In some of such embodiments, the peptidomimetics may be
selected to provide non-hydrolyzable residues at these positions.
Non-natural peptidomimetic residues may include, without
limitation, D-amino acids, beta amino acids, homo amino acids,
proline derivatives, para-substituted phenylalanines, amino
alcohols, N-substituted amides, bridging amides, quaternary alpha
amino acids, N-alkyl amino acids, alpha-alkyl amino acids, and aza
peptides. D-amino acids involve the mirror image of the naturally
occurring L-isomers, which are mostly to increase resistance
against a range of degradation enzymes. Homo amino acids include
the addition of a methylene (CH.sub.2) group to the .alpha.-carbon
of an amino acid, which are used to creating peptides that may have
altered biological characteristics, such as enhanced biological
activity or better biological stability. N-alkyl amino acids are
amino acids that carry an alkyl group at the nitrogen instead of a
proton. Introducing an N-alkyl amino acid (exemplified by
methylation) may create a sterically hindered environment about a
susceptible amide bond, which may increase the enzymatic stability
of a peptide, thus increasing its biological half-life.
Substitution with N-alkyl amino acids may also improve peptidase
stability and enhance intestinal permeability. Alpha-alkyl amino
acids are amino acids in which the proton on the .alpha.-carbon
atom of the natural original (in between the amino and carboxy
group) has been substituted by an alkyl group. Alpha-methyl amino
acids are stable to racemization/epimerization since there is no
longer the possibility for abstracting the .alpha.-proton. Bridging
amide and aza peptide are strategies for stabilizing amide
bonds.
[0077] In certain embodiments, peptidomimetics disclosed herein may
modify any amino acid residues about an amide bond according to the
following chemical structural modifications to enhance stability
against enzymatic (or non-enzymatic) hydrolytic activity as
indicated in Scheme I. One skilled in the art will appreciate that
any of these techniques may be used in combination and that any
other amide stabilizing strategies may be employed. R.sub.1 and
R.sub.2 shown in Scheme I denote the side chains of the amino acids
according to the present embodiments. Scheme I illustrates the
modification by substituting H with a methyl group. However, one
skilled in the art will appreciate that the use of methyl
functional groups in Scheme I is merely exemplary and that other
functional chemical moieties may fulfill substantially the same
role.
##STR00008##
[0078] By way of example only, a peptidomimetic of pyr-1-apelin-13
A2 peptide having the formula:
pGlu-aa2-aa3-aa4-aa5-Ser-His-Lys-Gly-Pro-Nle-Aib-paraBrPhe (SEQ ID
NO:52), a peptidomimetic of apelin-17 A2 peptide having the
formula:
Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-Ser-His-Lys-Gly-Pro-Nle-Aib-paraB-
rPhe (SEQ ID NO:53), and a peptidomimetic of N-terminus modified
apelin-17 A2 peptide having the formula:
Z2-Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-Ser-His-Lys-Gly-Pro-Nle-Aib-pa-
raBrPhe (SEQ ID NO:54) are shown below identifying the ACE2
resistant `A2` C-terminus Nle11, Aib12, and para-BrPhe13 amino acid
substitutions and Nle15, Aib16, and para-BrPhe17 amino acid
substitutions respectively.
##STR00009##
where Z2 is a long chain moiety as defined herein.
[0079] In some embodiments, the pyr-1-apelin-13 A2 peptide (SEQ ID
NO: 4) includes substitution of native methionine for norleucine at
amino acid 11 (aa11). In some embodiments, the apelin-17 A2 peptide
(SEQ ID NO: 5) includes substitution of native methionine for
norleucine at amino acid 15 (aa'15). Without being bound by theory,
the inventors believe that the native methionine residue is
susceptible to oxidation. Thus, replacement with a simple
hydrophobic residue may serve to circumvent this oxidative problem.
One skilled in the art will appreciate that substantially similar
residues can replace norleucine by conservative substitution to
provide an apelin peptide with substantially similar enhancement in
stability. For example, other residues that may function in a
manner similar to norleucine may include alanine, homoalanine,
valine, leucine, and isoleucine.
[0080] Similarly, the inventors believe that a modest electron
withdrawing group on C-terminal Phe may enhance apelin stability
and/or activity. Thus, the bromo on Phe may be replaced with other
electron withdrawing groups to similar effect. Such groups may
include, without limitation, chloro, nitro, ester, and the like. In
certain embodiments, the electron withdrawing group need not appear
in the para position, although from a synthetic standpoint this may
be one of the easier positions to modify. In some embodiments, the
pyr-1-apelin-13 A2 peptide (SEQ ID NO: 4) includes substitution of
native phenylanlanine for bromophenylanlanine, BrPhe (e.g.,
orth-BrPhe, meta-BrPhe, para-BrPhe) at amino acid 13 (aa13). In
some embodiments, the apelin-17 A2 peptide (SEQ ID NO: 5) includes
substitution of native phenylanlanine for bromophenylanlanine,
BrPhe (e.g., orth-BrPhe, meta-BrPhe, para-BrPhe) at amino acid 17
(aa'17).
[0081] In some embodiments, the pyr-1-apelin-13 A2 peptide (SEQ ID
NO: 4) includes substitution of native proline for aminoisobutyryl
(Aib) at amino acid 12 (aa12). In some embodiments, the apelin-17
A2 peptide (SEQ ID NO: 5) includes substitution of native proline
for aminoisobutyryl (Aib) at amino acid 16 (aa'16). The sterically
hindered aminoisobutyryl (Aib) residue present in the apelin
peptides may slow C-terminal hydrolytic processes. Other hindered
alpha amino acids may achieve nominally the same effect. Thus, for
example, any alpha, alpha-dialkylamino acid may be employed for
this purpose. The preparation and coupling of hindered amino acids
has been described in Fu et al. J. Org. Chem. 66(21):7118-24
(2001), which is incorporated herein by reference in its
entirety.
[0082] In similar embodiments, such substitutions as decribed above
may be introduced into apelin-36 or even in the native full apelin
protein having 77 amino acid residues. Those skilled in the art
will appreciate that with the full length apelin protein,
non-linear synthetic strategies for protein preparation may be
advantageous. Such proteins may also be achieved by incorporation
of unnatural amino acids by engineering the requisite tRNA for its
incorporation in a biosynthesis approach. Such methods are well
known to those skilled in the art.
[0083] In some embodiments, apelin peptides comprising serine may
be stabilized against the activity of serine proteases. In some
such embodiments, the serine residue may be replaced with
homoalanine, for example. Other conservative substitutions for
serine may be employed including any neutral alkyl substituted
amino acids such as alanine, leucine, or isoleucine. Other
modifications may include the blocking of the serine hydroxyl
group, such as by formation of a methyl ether.
[0084] Thus, N-alkylation (exemplified by methylation),
C-quaternization (also exemplified by methylation) or both may be
employed to create a sterically hindered environment at a
susceptible amide bond. Also shown are bridging amide and aza
peptide strategies for stabilizing amide bonds. One skilled in the
art will appreciate that any of these techniques may be used in
combination and that any other amide stabilizing strategies may be
employed.
[0085] In some embodiments, the peptidomimetic contains an ACE2
resistant `A2` C-terminus Nle, Aib, and para-BrPhe amino acid
substitutions.
[0086] In embodiments, the present disclosure provides
peptidomimetic with enhanced stability to NEP based on the apelin
`A2` peptides of (pyr1) apelin-13 A2 (SEQ ID NO:4)(4) and apelin-17
A2 (SEQ ID NO:5)(5). FIG. 2 illustrates certain syntheric
modifications of both the pyr-1-apelin-13 A2 (SEQ ID NO:4) (4) and
apelin-17 A2 (SEQ ID NO:5) (5), in accordance with embodiments of
the present disclosure. The modifications include replacing the
dipeptide Arg/Leu with various dipeptides as shown in FIG. 2 to
produce apelin peptides (8)-(19).
[0087] In some embodiments, the disclosure provides apelin peptide
(8):
TABLE-US-00018 (SEQ ID NO: 24)
pGlu-Arg-Pro-Arg-D-Leu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0088] In some embodiments, the disclosure provides apelin peptide
(9):
TABLE-US-00019 (SEQ ID NO: 25)
Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-D-Leu-Ser-His-Lys-
Gly-Pro-Nle-Aib-paraBrPhe.
[0089] In some embodiments, the disclosure provides apelin peptide
(10):
TABLE-US-00020 (SEQ ID NO: 26)
pGlu-Arg-Pro-Arg-NMeLeu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0090] In some embodiments, the disclosure provides apelin peptide
(11):
TABLE-US-00021 (SEQ ID NO: 27)
Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-NMeLeu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0091] In some embodiments, the disclosure provides apelin peptide
(12):
TABLE-US-00022 (SEQ ID NO: 28)
pGlu-Arg-Pro-aMeArg-Leu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0092] In some embodiments, the disclosure provides apelin peptide
(13):
TABLE-US-00023 (SEQ ID NO: 29)
Lys-Phe-Arg-Arg-Gln-Arg-Pro-aMeArg-Leu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0093] In some embodiments, the disclosure provides apelin peptide
(14):
TABLE-US-00024 (SEQ ID NO: 30)
pGlu-Arg-Pro-Arg-aMeLeu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0094] In some embodiments, the disclosure provides apelin peptide
(15):
TABLE-US-00025 (SEQ ID NO: 31)
Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-aMeLeu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0095] In some embodiments, the disclosure provides apelin peptide
(16):
TABLE-US-00026 (SEQ ID NO: 51)
pGlu-Arg-Pro-azaArg-Leu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0096] In some embodiments, the disclosure provides apelin peptide
(17):
TABLE-US-00027 (SEQ ID NO: 32)
Lys-Phe-Arg-Arg-Gln-Arg-Pro-azaArg-Leu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0097] In some embodiments, the disclosure provides apelin peptide
(18):
TABLE-US-00028 (SEQ ID NO: 33)
pGlu-Arg-Pro-Arg-azaLeu-Ser-His-Lys-Gly-Pro-Nle- Aib-paraBrPhe.
[0098] In some embodiments, the disclosure provides apelin peptide
(16):
TABLE-US-00029 (SEQ ID NO: 34)
Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-azaLeu-Ser-His-
Lys-Gly-Pro-Nle-Aib-paraBrPhe.
[0099] In some embodiments, synthetic modifications may be made at
any one or more amino acids of the "RPRL" motif portion of the
apelin `A2` peptides. In some embodiments, synthetic modifications
may be made at any one or more amino acid 2, amino acid 3, amino
acid 4, and/or amino acid 5 (aa2, aa3, aa4 and/or aa5) of the
pyr-1-apelin-13 A2 peptide (SEQ ID NO: 4). In some embodiments,
synthetic modifications may be made at any one or more amino acid
6, amino acid 7, amino acid 8, and/or amino acid 9 (aa'6, aa'7,
aa'8 and/or aa'9) of the apelin-17 A2 peptide (SEQ ID NO: 5).
[0100] In embodiments, the peptidomimetic of Formula (I):
Z1-pGlu-aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10-aa11-aa12-aa13, or
pharmaceutically acceptable salts thereof, wherein Z1 is defined
herein, wherein the sequence
aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10-aa11-aa12-aa13 is any one of
the sequences listed in Table 1.
[0101] In embodiments, the peptidomimetic of Formula (II):
Z2-Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14--
aa'15-aa'16-aa'17, or pharmaceutically acceptable salts thereof,
wherein Z2 is defined herein, wherein the sequence
aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14-aa'115-aa'16-aa'17
is any one of the sequences listed in Table 1.
TABLE-US-00030 TABLE 1
Arg-Pro-Arg-D-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib- paraBrPhe (Seq ID
NO: 12) Arg-Pro-Arg-NMeLeu-Ser-His-Lys-Gly-Pro-Nle-Aib- paraBrPhe
(Seq ID NO: 13) Arg-Pro-aMeArg-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib-
paraBrPhe (Seq ID NO: 14)
Arg-Pro-Arg-aMeLeu-Ser-His-Lys-Gly-Pro-Nle-Aib- paraBrPhe (Seq ID
NO: 15) Arg-Pro-azaArg-Leu-Ser-His-Lys-Gly-Pro-Nle-Aib- paraBrPhe
(Seq ID NO: 16) Arg-Pro-Arg-azaLeu-Ser-His-Lys-Gly-Pro-Nle-Aib-
paraBrPhe (Seq ID NO: 17)
[0102] In embodiments, the peptidomimetic of Formula (I):
Z1-pGlu-aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10-aa11-aa12-aa13, or
pharmaceutically acceptable salts thereof, wherein Z1 is defined
herein, wherein the sequence aa2-aa3-aa4-aa5-aa6-aa7-aa8-aa9-aa10
is any one of the sequences listed in Table 2.
[0103] In embodiments, the peptidomimetic of Formula (II):
Z2-Lys-Phe-Arg-Arg-Gln-aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14--
aa'115-aa'16-aa'17, or pharmaceutically acceptable salts thereof,
wherein Z2 is defined herein, wherein Z2 is defined herein, wherein
the sequence aa'6-aa'7-aa'8-aa'9-aa'10-aa'11-aa'12-aa'13-aa'14 is
any one of the sequences listed in Table 2.
TABLE-US-00031 TABLE 2 Arg-Pro-Arg-D-Leu-Ser-His-Lys-Gly-Pro (Seq
ID NO: 18) Arg-Pro-Arg-NMeLeu-Ser-His-Lys-Gly-Pro (Seq ID NO: 19)
Arg-Pro-aMeArg-Leu-Ser-His-Lys-Gly-Pro (Seq ID NO: 20)
Arg-Pro-Arg-aMeLeu-Ser-His-Lys-Gly-Pro (Seq ID NO: 21)
Arg-Pro-azaArg-Leu-Ser-His-Lys-Gly-Pro (Seq ID NO: 22)
Arg-Pro-Arg-azaLeu-Ser-His-Lys-Gly-Pro (Seq ID NO: 23)
[0104] In embodiments, the peptidomimetic disclosed herein
comprises a suitable sequence having at least 80%, at least 85%, at
least 90% or at least 95% identical to any one of the sequences
disclosed in Table 1 or 2. In embodiments, the peptidomimetic
disclosed herein comprises a suitable sequence having at least 80%,
at least 85%, at least 90% or at least 95% to any one of the
sequences disclosed in Table 1 or 2, wherein a desired function of
the peptidomimetic is conserved or retained.
[0105] The term "percent identical" refers to sequence identity
between two amino acid sequences. Identity can be determined by
comparing a position in each sequence which may be aligned for
purposes of comparison. When an equivalent position in the compared
sequences is occupied by the same amino acid, then the molecules
are identical at that position. When the equivalent site is
occupied by the same or a similar amino acid residue (e.g., similar
in steric and/or electronic nature), then the molecules can be
referred to as homologous (similar) at that position. Expression as
a percentage of homology, similarity, or identity refers to a
function of the number of identical or similar amino acids at
positions shared by the compared sequences. Expression as a
percentage of homology, similarity, or identity refers to a
function of the number of identical or similar amino acids at
positions shared by the compared sequences. Various alignment
algorithms and/or programs may be used to determine percent
identity or percent homology, including FASTA, BLAST, or ENTREZ.
FASTA and BLAST are available as a part of the GCG sequence
analysis package (University of Wisconsin, Madison, Wis.), and can
be used with, e.g., default settings. ENTREZ is available through
the National Center for Biotechnology Information, National Library
of Medicine, National Institutes of Health, Bethesda, Md. In one
embodiment, the percent identity of two sequences can be determined
by the GCG program with a gap weight of 1, e.g., each amino acid
gap is weighted as if it were a single amino acid or mismatch
between the two sequences.
[0106] Conservative variation of amino acid residues entails the
replacement of one amino acid for another with like
characteristics, or biologically similar residue. For a detailed
description of protein chemistry and structure, see Schulz, G. E.
et al., Principles of Protein Structure, Springer-Verlag, New York,
1979, and Creighton, T. E., Proteins: Structure and Molecular
Principles, W. H. Freeman & Co., San Francisco, 1984, which are
hereby incorporated by reference. The types of substitutions which
may be made in the apelin peptides which are conservative
substitutions are exemplified by exchanges within one of the
following groups: 1. Small aliphatic, nonpolar or slightly polar
residues: e.g., Ala, Ser, Thr, Gly; 2. Polar, negatively charged
residues and their amides: e.g., Asp, Asn, Glu, Gin; and 3. Polar,
positively charged residues: e.g., His, Arg, Lys. 4. Hydrophobic
residues: e.g., lie, Val, Leu, Met. For example, the replacement of
a polar residue for another, such as the substitution of arginine
for lysine, glutamic for aspartic acids, or glutamine for
asparagine; the replacement of a hydrophobic residue such as
isoleucine, valine, leucine or methionine for another, and the
like. In a particular sequence, e.g., aa2-aa3-aa4-aa5, a
conservative variation means any one of more of the amino acids
within the sequence can be replaced. As used herein "variant" and
grammatical variations thereof, refers to a protein or peptide that
deviates from a reference protein or peptide sequence. Modified and
variant proteins or peptides may therefore have greater or less
activity or function than a reference protein or peptide but at
least retain partial activity or function of the reference protein
or peptide.
[0107] Most substitutions which are conservative are those which do
not produce substantial changes in the characteristics of the
apelin peptide, although some changes disclosed herein are
purposely designed to confer prolonged peptide stability in vitro
and/or in vivo as explained herein. Even when it is difficult to
predict the exact effect of a substitution in advance of doing so,
one skilled in the art will appreciate that the effect can be
evaluated by routine screening assays, including the biological
assays described herein. Modifications of apelin peptide properties
including redox or thermal stability, hydrophobicity,
susceptibility to proteolytic degradation or the tendency to
aggregate with carriers or into multimers may be assayed by methods
well known to the ordinarily skilled artisan.
[0108] In some embodiments, the positions at amino acid 2 (aa2) and
amino acid 3 (aa3) of Formula (I) is Arg-Pro. In embodiments, the
positions at amino acid 4 (aa4) and amino acid 5 (aa5) of Formula
(I) is Arg-D-Leu. In embodiments, the positions at amino acid 4
(aa4) and amino acid 5 (aa5) of Formula (I) is Arg-NMeLeu. In
embodiments, the positions at amino acid 4 (aa4) and amino acid 5
(aa5) of Formula (I) is .alpha.MeArg-Leu. In embodiments, the
positions at amino acid 4 (aa4) and amino acid 5 (aa5) of Formula
(I) is Arg-.alpha.MeLeu. In embodiments, the positions at amino
acid 4 (aa4) and amino acid 5 (aa5) of Formula (I) is azaArg-Leu.
In embodiments, the positions at amino acid 4 (aa4) and amino acid
5 (aa5) of Formula (I) is Arg-azaLeu.
[0109] In some embodiments, the positions at amino acid 6 (aa'6)
and amino acid 7 (aa'7) of Formula (II) is Arg-Pro. In embodiments,
the positions at amino acid 8 (aa'8) and amino acid 9 (aa'9) of
Formula (II) is Arg-D-Leu. In embodiments, the positions at amino
acid 8 (aa'8) and amino acid 9 (aa'9) of Formula (II) is
Arg-NMeLeu. In embodiments, the positions at amino acid 8 (aa'8)
and amino acid 9 (aa'9) of Formula (II) is .alpha.MeArg-Leu. In
embodiments, the positions at amino acid 8 (aa'8) and amino acid 9
(aa'9) of Formula (II) is Arg-.alpha.MeLeu. In embodiments, the
positions at amino acid 8 (aa'8) and amino acid 9 (aa'9) of Formula
(II) is azaArg-Leu. In embodiments, the positions at amino acid 8
(aa'8) and amino acid 9 (aa'9) of Formula (II) is Arg-azaLeu. In
some embodiments, apelin peptides disclosed herein may be provided
in a prodrug form. The term "prodrug" refers to a compound that is
made more active (or simply just released) in vivo through
metabolism of a precursor drug. Apelin peptides can exist as
prodrugs, as described in Hydrolysis in Drug and Prodrug
Metabolism: Chemistry, Biochemistry, and Enzymology (Testa, Bernard
and Mayer, Joachim M. Wiley-VHCA, Zurich, Switzerland 2003).
Prodrugs of the apelin peptides described herein are structurally
modified forms of the peptide that readily undergo chemical changes
under physiological conditions to provide the active apelin
peptides. Additionally, prodrugs can be converted to the active
peptide by chemical or biochemical methods in an ex vivo
environment. For example, prodrugs can be slowly converted to an
active peptide when placed in a transdermal patch reservoir with a
suitable enzyme or chemical reagent. Prodrugs are often useful
because, in some situations, they can be easier to administer than
the parent peptide. They may, for example, provide enhanced
bioavailability by oral administration whereas the parent peptide
may be unavailable through such administration routes. The prodrug
can also have improved solubility in pharmaceutical compositions
over the parent apelin peptide. A wide variety of prodrug
derivatives are known in the art, such as those that rely on
hydrolytic cleavage or oxidative activation of the prodrug. An
example, without limitation, of a prodrug would be an apelin
peptide which is administered as a C-terminal ester (the
"prodrug"), but then is metabolically hydrolyzed to the C-terminal
carboxylic acid, the active entity.
[0110] In some embodiments, the disclosure provides compositions
containing the apelin peptides disclosed herein. In some
embodiments, the composition is a pharmaceutical composition. In
certain embodiments, there are provided pharmaceutical compostions
containing apelin peptides for use in medicine.
[0111] In certain embodiments, apelin peptides disclosed herein may
be provided as "pharmaceutically acceptable salts," which may
include salts or zwitterionic forms of the peptides which may be
water or oil-soluble or dispersible and therapeutically acceptable.
Pharmaceutically acceptable salts can also be included therein, for
example, hydrochloride, hydrobromide, phosphate, sulfate, maleate,
fumarate, tartrates, acetate, propionate, malonate, benzoate,
sulfonate, lactate, citrate, succinate, and the like. The salts can
be prepared during the final isolation and purification of the
peptides or separately by adjusting the pH of the appropriate
peptide formulation with a suitable acid or base. The term
"pharmaceutically acceptable" means a biologically acceptable
formulation, gaseous, liquid or solid, or mixture thereof, which is
suitable for one or more routes of administration, in vivo delivery
or contact. A "pharmaceutically acceptable" composition is a
material that is not biologically or otherwise undesirable, e.g.,
the material may be administered to a subject without causing
substantial undesirable biological effects. Thus, such a
pharmaceutical composition may be used, for example, in
administering an apelin peptide of the present disclosure to a
subject.
[0112] Pharmaceutical compositions include solvents (aqueous or
non-aqueous), solutions (aqueous or non-aqueous), emulsions (e.g.,
oil-in-water or water-in-oil), suspensions, syrups, elixirs,
dispersion and suspension media, coatings, isotonic and absorption
promoting or delaying agents, compatible with pharmaceutical
administration or in vivo contact or delivery. Aqueous and
non-aqueous solvents, solutions and suspensions may include
suspending agents and thickening agents. Such pharmaceutically
acceptable carriers include tablets (coated or uncoated), capsules
(hard or soft), microbeads, powder, granules and crystals.
Supplementary active compounds (e.g., preservatives, antibacterial,
antiviral and antifungal agents) can also be incorporated into the
compositions.
[0113] Pharmaceutical compositions can be formulated to be
compatible with a particular route of administration or delivery
known to one of skill in the art. Thus, pharmaceutical compositions
may include carriers, diluents, or excipients suitable for
administration by various routes. Pharmaceutically acceptable
excipients include, but are not limited to, liquids such as water,
saline, glycerol, sugars and ethanol. Additionally, pharmaceutical
compositions may also include auxiliary substances, such as wetting
or emulsifying agents, pH buffering substances, and the like.
[0114] Apelin peptide may be formulated for parenteral
administration by injection. Formulations for injection may be
presented in unit dosage form, e.g., in ampoules or in multi-dose
containers, with an added preservative. The compositions may take
such forms as suspensions, solutions or emulsions in oily or
aqueous vehicles, and may contain formulatory agents such as
suspending, stabilizing and/or dispersing agents. The formulations
may be presented in unit-dose or multi-dose containers, for example
sealed ampoules and vials, and may be stored in powder form or in a
freeze-dried (lyophilized) condition requiring only the addition of
the sterile liquid carrier, for example, saline or sterile
pyrogen-free water, immediately prior to use. Extemporaneous
injection solutions and suspensions may be prepared from sterile
powders, granules and tablets of the kind previously described.
[0115] Formulations for parenteral administration include aqueous
and non-aqueous (oily) sterile injection solutions of the active
compounds which may contain antioxidants, buffers, bacteriostats
and solutes which render the formulation isotonic with the blood of
the intended recipient; and aqueous and non-aqueous sterile
suspensions which may include suspending agents and thickening
agents. Suitable lipophilic solvents or vehicles include fatty oils
such as sesame oil, or synthetic fatty acid esters, such as ethyl
oleate or triglycerides, or liposomes. Aqueous injection
suspensions may contain substances which increase the viscosity of
the suspension, such as sodium carboxymethyl cellulose, sorbitol,
or dextran. Optionally, the suspension may also contain suitable
stabilizers or agents which increase the solubility of the
compounds to allow for the preparation of highly concentrated
solutions.
[0116] Apelin peptide may also be formulated for oral
administration, such as, in the form of tablets, capsules.
[0117] In certain embodiments, the pharmaceutical composition may
be formulated to contain a concentration of at least about 0.01%
w/w up to about 90% w/w or more of apelin peptide. Apelin peptides
of the invention may be administered orally or via injection at a
therapeutically effective dosage, such as a dose of from 0.01 to
500 mg/kg per day, from 1 to 400 mg/kg per day, or from 2 to 300
mg/kg per day. The dose range for humans is generally from 5 mg to
2 g per day. The term "therapeutically effective amount," as used
herein, when used in connection with treating a subject is intended
to qualify the amount of peptides used in the treatment of a
particular cardiovascular condition and/or prophylaxis against a
particular cardiovascular condition. This amount will achieve the
goal of preventing, reducing, or eliminating the damage of
myocardial infarction, systemic hypertension, ischemic hear
disease, abdominal aortic aneurysm, cardiac allograft vasculopathy,
or the like. The therapeutically effective amount will vary
depending upon the specific activity of the therapeutic agent
(i.e., peptidomimetic of the present disclosure) being used, the
severity of the patient's disease state, and the age, physical
condition, existence of other disease states, and nutritional
status of the patient. Additionally, other medication the patient
may be receiving will effect the determination of the
therapeutically effective amount of the therapeutic agent to
administer.
[0118] The unit dosage form may be provided in discrete units may
conveniently contain an amount of apelin peptide of the invention
which is effective at such dosage or as a multiple of the same, for
instance, units containing 5 mg to 500 mg, usually around 10 mg to
200 mg.
[0119] A "unit dosage form," as used herein, refers to physically
discrete units suited as unitary dosages for the subject to be
treated; each unit containing a predetermined quantity optionally
in association with a pharmaceutical carrier (excipient, diluent,
vehicle or filling agent) which, when administered in one or more
doses, is calculated to produce a desired effect (e.g.,
prophylactic or therapeutic effect). Unit dosage forms may be
within, for example, ampules and vials, which may include a liquid
composition, or a composition in a freeze-dried or lyophilized
state; a sterile liquid carrier, for example, can be added prior to
administration or delivery in vivo.
[0120] Further, the apelin peptide of the invention may be
administered on a daily basis or on a schedule containing days
where dosing does not take place. In certain embodiments, dosing
may take place every other day. In other embodiments, dosing may
take place for five consecutive days of a week, then be followed by
two non-dosing days. The choice of dosing schedule will depend on
many factors, including, for example, the formulation chosen, route
of administration, and concurrent pharmacotherapies, and may vary
on a patient-to-patient basis. It is considered within the capacity
of one skilled in the art to select a schedule that will maximize
the therapeutic benefit and minimize any potential side effects in
a subject.
[0121] Compositions may be sterile. The compositions may be made in
containers suitable for such processes. Such containers include
dishes, flasks, roller bottles, bags, bioreactors, vessels, tubes,
vials, etc. Containers may be made of materials that include but
are not limited to glass, plastic and polymers, such as
polystyrene, polybutylene, polypropylene, etc.
Synthesis of Apelin Peptides
[0122] The apelin peptides of the present disclosure may be
produced by conventional automated peptide synthesis methods. FIG.
3 shows the general SPPS (solid phase peptide synthesis) approach
for the divergent syntheses of Arg/Leu modified apelin A2 peptides
of the present disclosure.
[0123] Diagnostic and Prognostic Compositions
[0124] In some embodiments, the apelin peptides disclosed herein
can be labeled for detection and used, for example, to detect a
binding site for the peptide on the surface or in the interior of a
cell. Thus, the fate of the peptide can be followed in vitro or in
vivo by using the appropriate method to detect the label. The
labeled apelin peptide may also be utilized in vivo for diagnosis
and prognosis, or for other types of in situ evaluations.
[0125] Examples of suitable detectable labels include radioactive,
fluorogenic, chromogenic, or other chemical labels. Useful
radiolabels, which are detected by a gamma counter or a
scintillation counter or by autoradiography include 3H, 125I, 131I,
35S and 14C. In addition, 131I is also useful as a therapeutic
isotope (see below).
[0126] Common fluorescent labels include fluorescein
isothiocyanate, rhodamine, phycoerythrin, phycocyanin,
allophycocyanin, o-phthaldehyde and fluorescamine.
[0127] The fluorophore, such as the dansyl group, must be excited
by light of a particular wavelength to fluoresce. See, for example,
Haugland, Handbook of Fluorescent Probes and Research Chemicals,
Sixth Edition, Molecular Probes, Eugene, Oreg., 1996). In general,
a fluorescent reagent is selected based on its ability to react
readily with an amino function. Examples of such fluorescent probes
include the Bodipy (4,4-difluoro-4-bora-3a,4a-diaza-s-indacene)
fluorophores which span the visible spectrum (U.S. Pat. Nos.
4,774,339; 5,187,288; 5,248,782; 5,274,113; 5,433,896; 5,451,663).
One such member of this group is
4,4-difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene-3-propionic
acid.
[0128] Fluorescein, fluorescein derivatives and fluorescein-like
molecules such as Oregon Green and its derivatives, Rhodamine Green
and Rhodol Green, are coupled to amine groups using the isocyanate,
succinimidyl ester or dichlorotriazinyl-reactive groups. The long
wavelength rhodamines, which are basically Rhodamine Green
derivatives with substituents on the nitrogens, are among the most
photostable fluorescent labeling reagents known. Their spectra are
not affected by changes in pH between 4 and 10, an important
advantage over the fluoresceins for many biological applications.
This group includes the tetramethylrhodamines, X-rhodamines and
Texas Red derivatives. Other fluorophores for derivatizing the
peptide are those which are excited by ultraviolet light. Examples
include cascade blue, coumarin derivatives, naphthalenes (of which
dansyl chloride is a member), pyrenes and pyridyloxazole
derivatives.
[0129] In yet another approach, one or more amino groups is allowed
to react with reagents that yield fluorescent products, for
example, fluorescamine, dialdehydes such as o-phthaldialdehyde,
naphthalene-2,3-dicarboxylate and anthracene-2,3-dicarboxylate.
7-nitrobenz-2-oxa-1,3-diazole (NBD) derivatives, both chloride and
fluoride, are useful to modify amines to yield fluorescent
products.
[0130] Those skilled in the art will recognize that known
fluorescent reagents modify groups other than amines, such as
thiols, alcohols, aldehydes, ketones, carboxylic acids and amides.
Hence, fluorescent substrates can readily be designed and
synthesized using these other reactive groups.
[0131] The peptide can also be labeled for detection using
fluorescence-emitting metals such as 152 Eu, or others of the
lanthanide series. These metals can be attached to the peptide
using such metal chelating groups as diethylenetriaminepentaacetic
acid (DTPA) or ethylenediaminetetraacetic acid (EDTA). The peptide
can be made detectable by coupling it to a chemiluminescent
compound. The presence of the chemiluminescent-tagged peptide is
then determined by detecting the presence of luminescence that
arises during the course of a chemical reaction. Examples of
particularly useful chemiluminescers are luminol, isoluminol,
theromatic acridinium ester, imidazole, acridinium salt and oxalate
ester. Likewise, a bioluminescent compound may be used to label the
peptide. Bioluminescence is a type of chemiluminescence found in
biological systems in which a catalytic protein increases the
efficiency of the chemiluminescent reaction. The presence of a
bioluminescent protein is determined by detecting the presence of
luminescence. Important bioluminescent compounds for purposes of
labeling are luciferin, luciferase and aequorin.
[0132] In yet another embodiment, colorimetric detection is used,
based on chromogenic compounds (chromophores) with high extinction
coefficients.
[0133] In situ detection of the labeled peptide may be accomplished
by removing a histological specimen from a subject and examining it
by microscopy under appropriate conditions to detect the label.
Those of ordinary skill will readily perceive that any of a wide
variety of histological methods (such as staining procedures) can
be modified in order to achieve such in situ detection.
[0134] The term "diagnostically labeled" means that the peptide has
attached to it a diagnostically detectable label. There are many
different labels and methods of labeling known to those of ordinary
skill in the art. Examples of the types of labels which can be used
in conjunction with apelin peptides include radioactive isotopes,
paramagnetic isotopes, and compounds which can be imaged by
positron emission tomography (PET). Those of ordinary skill in the
art will know of other suitable labels for binding to the apelin
peptides disclosed herein, or will be able to ascertain such, by
routine experimentation. Furthermore, the binding of these labels
to the peptide or derivative can be done using standard techniques
known to those of ordinary skill in the art.
[0135] For diagnostic in vivo radioimaging, the type of detection
instrument available is a major factor in selecting a given
radionuclide. The radionuclide chosen must have a type of decay
which is detectable by a given type of instrument. In general, any
conventional method for visualizing diagnostic imaging can be
utilized in accordance with embodiments disclosed herein. Another
factor in selecting a radionuclide for in vivo diagnosis is that
the half-life of a radionuclide be long enough so that it is still
detectable at the time of maximum uptake by the target issue, but
short enough so that deleterious radiation of the host is
minimized. In one embodiment, a radionuclide used for in vivo
imaging does not emit particles, but produces a large number of
photons in a 140-200 keV range, which may be readily detected by
conventional gamma cameras.
[0136] For in vivo diagnosis, radionuclides may be bound to peptide
either directly or indirectly by using an intermediary functional
group. Intermediary functional groups that are often used to bind
radioisotopes, which exist as metallic ions, to peptides are the
chelating agents, DTPA and EDTA. Examples of metallic ions which
can be bound to peptides are 99Tc, 123I, 111In, 131I, 97Ru, 67Cu,
67Ga, 125I, 68Ga, 72As, 89Zr, and 201Tl. Generally, the dosage of
peptide labeled for detection for diagnostic use will vary
depending on considerations such as age, condition, sex, and extent
of disease in the patient, counterindications, if any, and other
variables, to be adjusted by the individual physician.
[0137] In another embodiment, the apelin peptides disclosed herein
may be used as affinity ligands for binding the peptide's receptor
in assays, preparative affinity chromatography or solid phase
separation. Such compositions may also be used to enrich, purify or
isolate cells to which the peptide or derivative binds, preferably
through a specific receptor-ligand interaction. The peptide or
derivative may be immobilized using common methods known in the
art, e.g. binding to CNBr-activated Sepharose or Agarose,
NHS-Agarose or Sepharose, epoxy-activated Sepharose or Agarose,
EAH-Sepharose or Agarose, streptavidin-Sepharose or Agarose in
conjunction with biotinylated peptide or derivatives. In general
the apelin peptides may be immobilized by any other method which is
capable of immobilizing these compounds to a solid phase for the
indicated purposes. See, for example Affinity Chromatography:
Principles and Methods (Pharmacia LKB Biotechnology). Thus, one
embodiment is a composition comprising any of the peptides,
derivatives or peptidomimetics described herein, bound to a solid
support or a resin. The compound may be bound directly or via a
spacer, such as an aliphatic chain having about 2-12 carbon
atoms.
[0138] By "solid phase" or "solid support" or "carrier" is intended
any support or carrier capable of binding the peptide or
derivative. Well-known supports, or carriers, in addition to
Sepharose or Agarose described above are glass, polystyrene,
polypropylene, polyethylene, dextran, nylon, amylases, natural and
modified celluloses such as nitrocellulose, polyacrylamides,
polyvinylidene difluoride, other agaroses, and magnetite, including
magnetic beads. The carrier can be totally insoluble or partially
soluble. The support material may have any possible structural
configuration so long as the coupled molecule is capable of binding
to receptor material. Thus, the support configuration may be
spherical, as in a bead, or cylindrical, as in the inside surface
of a test tube or microplate well, or the external surface of a
rod. Alternatively, the surface may be flat such as a sheet, test
strip, bottom surface of a microplate well, etc.
[0139] Production of Peptides and Derivatives
[0140] The peptides disclosed herein may be prepared using
recombinant DNA technology. However, given their length, they may
be more easily prepared using solid-phase synthesis, such as that
generally described by Merrifield, J. Amer. Chem. Soc., 85:2149-54
(1963), although other equivalent chemical syntheses known in the
art are also useful. Solid-phase peptide synthesis may be initiated
from the C-terminus of the peptide by coupling a protected
alpha-amino acid to a suitable resin. Such a starting material can
be prepared by attaching an alpha-amino-protected amino acid by an
ester linkage to a chloromethylated resin or to a hydroxymethyl
resin, or by an amide bond to a BHA resin or MBHA resin.
[0141] The preparation of the hydroxymethyl resin is described by
Bodansky et al., 1966. Chloromethylated resins are commercially
available from BioRad Laboratories, Richmond, Calif. and from Lab.
Systems, Inc. The preparation of such a resin is described by
Stewart et al., 1969. BHA and MBHA resin supports are commercially
available and are generally used only when the desired polypeptide
being synthesized has an unsubstituted amide at the C-terminus.
[0142] The amino acids can be coupled to the growing peptide chain
using techniques well known in the art for the formation of peptide
bonds. For example, one method involves converting the amino acid
to a derivative that will render the carboxyl group of the amino
acid more susceptible to reaction with the free N-terminal amino
group of the growing peptide chain. Specifically, the C-terminal of
the protected amino acid can be converted to a mixed anhydride by
the reaction of the C-terminal with ethyl chloroformate, phenyl
chloroformate, sec-butyl chloroformate, isobutyl chloroformate, or
pivaloyl chloride or the like acid chlorides. Alternatively, the
C-terminal of the amino acid can be converted to an active ester,
such as a 2,4,5-trichlorophenyl ester, a pentachlorophenyl ester, a
pentafluorophenyl ester, a p-nitrophenyl ester, a
N-hydroxysuccinimide ester, or an ester formed from
1-hydroxybenzotriazole. Another coupling method involves the use of
a suitable coupling agent, such as N,N'-dicyclohexylcarbodiimide or
N,N'-diisopropylcarbodiimide. Other appropriate coupling agents,
apparent to those skilled in the art, are disclosed in Gross et al.
1979, which is hereby incorporated by reference.
[0143] The alpha-amino group of each amino acid employed in the
peptide synthesis must be protected during the coupling reaction to
prevent side reactions involving their active alpha-amino function.
Certain amino acids contain reactive side-chain functional groups
(e.g., sulfhydryl, amino, carboxyl, and hydroxyl) and such
functional groups must also be protected with suitable protecting
groups to prevent a chemical reaction from occurring at either (1)
the alpha-amino group site or (2) a reactive side chain site during
both the initial and subsequent coupling steps.
[0144] In the selection of a particular protecting group to be used
in synthesizing the peptides, the following general rules are
typically followed. Specifically, an alpha-amino protecting group
(1) should render the alpha-amino function inert under the
conditions employed in the coupling reaction, (2) should be readily
removable after the coupling reaction under conditions that will
not remove side-chain protecting groups and will not alter the
structure of the peptide fragment, and (3) should substantially
reduce the possibility of racemization upon activation, immediately
prior to coupling.
[0145] On the other hand, a side-chain protecting group (1) should
render the side chain functional group inert under the conditions
employed in the coupling reaction, (2) should be stable under the
conditions employed in removing the alpha-amino protecting group,
and (3) should be readily removable from the desired
fully-assembled peptide under reaction conditions that will not
alter the structure of the peptide chain.
[0146] It will be apparent to those skilled in the art that the
protecting groups known to be useful for peptide synthesis vary in
reactivity with the agents employed for their removal. For example,
certain protecting groups, such as triphenylmethyl and
2-(p-biphenyl)isopropyloxycarbonyl, are very labile and can be
cleaved under mild acid conditions. Other protecting groups, such
as t-butyloxycarbonyl (BOC), t-amyloxycarbonyl,
adamantyl-oxycarbonyl, and p-methoxybenzyloxycarbonyl, are less
labile and require moderately strong acids for their removal, such
as trifluoroacetic, hydrochloric, or boron trifluoride in acetic
acid. Still other protecting groups, such as benzyloxycarbonyl (CBZ
or Z), halobenzyloxycarbonyl, p-nitrobenzyloxycarbonyl
cycloalkyloxycarbonyl, and isopropyloxycarbonyl, are even less
labile and require even stronger acids, such as hydrogen fluoride,
hydrogen bromide, or boron trifluoroacetate in trifluoroacetic
acid, for their removal. Suitable protecting groups, known in the
art are described in Gross et al. 1981.
[0147] Among the classes of amino acid protecting groups useful for
protecting the alpha-amino group or for protecting a side chain
group are included the following:
[0148] (1) For an alpha-amino group, three typical classes of
protecting groups are: (a) aromatic urethane-type protecting
groups, such as fluorenylmethyloxycarbonyl (FMOC), CBZ, and
substituted CBZ, such as, p-chlorobenzyloxycarbonyl,
p-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl, and
p-methoxybenzyloxycarbonyl, o-chlorobenzyloxycarbonyl,
2,4-dichlorobenzyloxycarbonyl, 2,6-dichlorobenzyloxycarbonyl, and
the like; (b) aliphatic urethane-type protecting groups, such as
BOC, t-amyloxycarbonyl, isopropyloxycarbonyl,
2-(p-biphenyl)isopropyloxycarbonyl, allyloxycarbonyl and the like;
and (c) cycloalkyl urethane-type protecting groups, such as
cyclopentyloxycarbonyl, adamantyloxycarbonyl, and
cyclohexyloxycarbonyl. The alpha-amino protecting groups BOC and
FMOC are commonly used and may provide the widest selection for
commericially available protected amino acids.
[0149] (2) For the side chain amino group present in Lys,
protection may be by any of the groups mentioned above in (1) such
as BOC, 2-chlorobenzyloxycarbonyl and the like.
[0150] (3) For the guanidino group of Arg, protection may be
provided by nitro, tosyl, CBZ, adamantyloxycarbonyl,
2,2,5,7,8-pentamethylchroman-6-sulfonyl,
2,3,6-trimethyl-4-methoxyphenylsulfonyl, or BOC groups.
[0151] (4) For the hydroxyl group of Ser or Thr, protection may be,
for example, by t-butyl; benzyl (BZL); or substituted BZL, such as
p-methoxybenzyl, p-nitrobenzyl, p-chlorobenzyl, o-chlorobenzyl, and
2,6-dichlorobenzyl.
[0152] (5) For the carboxyl group of Asp or Glu, protection may be,
for example, by esterification using such groups as BZL, t-butyl,
cyclohexyl, cyclopentyl, and the like.
[0153] (6) For the imidazole nitrogen of His, the benzyloxymethyl
(BOM) or tosyl moiety is suitably employed as a protecting
group.
[0154] (7) For the phenolic hydroxyl group of Tyr, a protecting
group such as tetrahydropyranyl, tert-butyl, trityl, BZL,
chlorobenzyl, 4-bromobenzyl, and 2,6-dichlorobenzyl are suitably
employed. One such protecting group is bromobenzyloxycarbonyl.
[0155] (8) For the side chain amino group of Asn or Gin, xanthyl
(Xan) may be employed.
[0156] (9) For Met, the amino acid may be left unprotected.
[0157] (10) For the thio group of Cys, p-methoxybenzyl is typically
employed.
[0158] The first C-terminal amino acid of the growing peptide chain
is typically protected at the alpha-amino position by an
appropriately selected protecting group such as BOC and the
carboxyl residue attached to a support, such as an amine
functionalized support. Following the coupling of the BOC-protected
amino acid to the resin support, the alpha-amino protecting group
is usually removed, typically by using trifluoroacetic acid (TFA)
in methylene chloride or TFA alone. The alpha-amino group
de-protection reaction can occur over a wide range of temperatures,
but is usually carried out at a temperature between about 0.degree.
C. and room temperature.
[0159] Other standard alpha-amino group de-protecting reagents,
such as HCl in dioxane, and conditions for the removal of specific
alpha-amino protecting groups are within the skill of those working
in the art, such as those described in Lubke et al., 1975, which is
hereby incorporated by reference. Following the removal of the
alpha-amino protecting group, the unprotected alpha-amino group,
generally still side-chain protected, can be coupled in a stepwise
manner in the intended sequence.
[0160] An alternative to the stepwise approach is the fragment
condensation method in which pre-formed peptides of short length,
each representing part of the desired sequence, are coupled to a
growing chain of amino acids bound to a solid phase support. For
this stepwise approach, a particularly suitable coupling reagent is
N,N'-dicyclohexylcarbodiimide or diisopropylcarbodiimide. Also, for
the fragment approach, the selection of the coupling reagent, as
well as the choice of the fragmentation pattern needed to couple
fragments of the desired nature and size are important for success
and are known to those skilled in the art.
[0161] Each protected amino acid or amino acid sequence is usually
introduced into the solid-phase reactor in amounts in excess of
stoichiometric quantities, and the coupling is suitably carried out
in an organic solvent, such as dimethylformamide (DMF),
CH.sub.2Cl.sub.2 or mixtures thereof. If incomplete coupling
occurs, the coupling procedure is customarily repeated before
removal of the N-amino protecting group in preparation for coupling
to the next amino acid. Following the removal of the alpha-amino
protecting group, the remaining alpha-amino and
side-chain-protected amino acids can be coupled in a stepwise
manner in the intended sequence. The success of the coupling
reaction at each stage of the synthesis may be monitored. A method
of monitoring the synthesis is by the ninhydrin reaction, as
described by Kaiser et al., 1970. The coupling reactions can also
be performed automatically using well-known commercial methods and
devices, for example, a Beckman 990 Peptide Synthesizer.
[0162] Upon completion of the desired peptide sequence, the
protected peptide may be cleaved from the resin support, and all
protecting groups removed. The cleavage reaction and removal of the
protecting groups may be suitably accomplished concomitantly or
consecutively with de-protection reactions. When the bond anchoring
the peptide to the resin is an ester bond, it can be cleaved by any
reagent that is capable of breaking an ester linkage and of
penetrating the resin matrix. One especially useful method is by
treatment with liquid anhydrous hydrogen fluoride. This reagent
will usually not only cleave the peptide from the resin, but will
also remove all acid-labile protecting groups and, thus, will
directly provide the fully de-protected peptide. When additional
protecting groups that are not acid-labile are present, additional
de-protection steps must be carried out. These steps can be
performed either before or after the hydrogen fluoride treatment
described above, according to specific needs and circumstances.
[0163] When a chloromethylated resin is used, the hydrogen fluoride
cleavage/de-protection treatment generally results in the formation
of the free peptide acids. When a benzhydrylamine resin is used,
the hydrogen fluoride treatment generally results in the free
peptide amides. Reaction with hydrogen fluoride in the presence of
anisole and dimethylsulfide at 0.degree. C. for one hour will
typically remove the side-chain protecting groups and,
concomitantly, release the peptide from the resin.
[0164] When it is desired to cleave the peptide without removing
protecting groups, the protected peptide-resin can be subjected to
methanolysis, thus yielding a protected peptide in which the
C-terminal carboxyl group is methylated. This methyl ester can be
subsequently hydrolyzed under mild alkaline conditions to give the
free C-terminal carboxyl group. The protecting groups on the
peptide chain can then be removed by treatment with a strong acid,
such as liquid hydrogen fluoride. A particularly useful technique
for methanolysis is that of Moore et al., 1977, in which the
protected peptide-resin is treated with methanol and potassium
cyanide in the presence of a crown ether.
[0165] Other methods for cleaving a protected peptide from the
resin when a chloromethylated resin is employed include (1)
ammoniolysis and (2) hydrazinolysis. If desired, the resulting
C-terminal amide or hydrazide can be hydrolyzed to the free
C-terminal carboxyl moiety, and the protecting groups can be
removed conventionally. The protecting group present on the
N-terminal alpha-amino group may be removed either before, or
after, the protected peptide is cleaved from the support.
Purification of the apelin peptides disclosed herein may be
achieved using chromatographic techniques, such as preparative HPLC
(including reverse phase HPLC), gel permeation, ion exchange,
partition chromatography, affinity chromatography (including
monoclonal antibody columns), and the like, or other conventional
techniques such as countercurrent distribution or the like.
[0166] An aspect of the present apelin peptides includes a method
of treating an apelin pathway disorder by administering the apelin
peptide or a pharmaceutical formulation thereof to a subject having
the apelin pathway disorder.
[0167] The term "subject" refers to an animal, typically a mammal,
such as humans, non-human primates (apes, gibbons, gorillas,
chimpanzees, orangutans, macaques), a domestic animal (dogs and
cats), a farm animal (poultry such as chickens and ducks, horses,
cows, goats, sheep, pigs), and experimental animals (mouse, rat,
rabbit, guinea pig). Human subjects include fetal, neonatal,
infant, juvenile and adult subjects.
[0168] The term "apelin pathway disorder," as used herein, refers
to a disorder resulting from the abnormality of the apelin pathway.
In some embodiments, the apelin pathway disorder is a cardiac
disease, such as, but are not limited to, systemic arterial
hypertension, systemic hypertension, abdominal aortic aneurysm,
pulmonary arterial hypertension, heart failure, myocardial
ischemic-reperfusion injury, ischemic heart disease, cardiac
allograft vasculopathy, myocardial infarction, and high blood
pressure.
Reducing Cardiac Reperfusion Injury Following Myocardial
Infarction
[0169] In some embodiments, there are provided methods of reducing
cardiac reperfusion injury following myocardial infarction in a
subject comprising administering to the subject an effective amount
of an apelin receptor agonist comprising a peptidomimetic of
Formula (I) or Formula (II) of the disclosure, or pharmaceutically
acceptable salts thereof. In some embodiments, the apelin peptide
to prevent damage following myocardial infarction may be a
peptidomimetic of Formula (I) or Formula (II) of the disclosure, or
pharmaceutically acceptable salts thereof. In some embodiments,
combinations of apelin peptides may be employed. In some
embodiments, the administering step is carried out
intravenously.
[0170] As used herein, the term "cardiac reperfusion injury" refers
to an injury of a heart, caused by putting the heart into an
ischemic condition such as by acute coronary syndromes,
thomboembolic events, surgery or resuscitation from cardiac
arrest.
[0171] As disclosed herein, APLN is a central regulator of the
myocardial response to infarction and ischemia and
pharmacologically targeting this pathway provides a means of
developing new therapeutic agents. Apelin is predominantly
expressed in the endocardial and vascular endothelial cells while
the APJ receptor (apelin receptor) is localized to endothelial and
smooth muscle cells as well as cardiomyocytes, allowing for
autocrine and paracrine effects of apelin in the heart (Pitkin S.
L., et al. Pharmacol. Rev. 62:331-342, (2010); Chen M. M., et al.
Circulation. 108:1432-1439, (2003); Kleinz M J, et al. Regul Pept.
126:233-240, (2005)). Apelin mediates positive inotropic effect on
isolated cardiomyocytes (Wang C, et al. Am J Physiol Heart Circ
Physiol. 294:H2540-2546, (2008)), isolated perfused rat heart
(Szokodi I, et al. Circ Res. 91:434-440, (2002)) and in vivo (Berry
M F, et al. Circulation. 110:11187-193, (2004)) and mediates
endothelium-dependent vasodilation (Pitkin S L et al. Br J
Pharmacol. 160:1785-1795, (2010)). Genetic variation in the APJ
receptor modifies the progression of heart failure in patients with
dilated cardiomyopathy (Sarzani R, et al. J Card Fail. 13:521-529,
(2007)) and the apelin/APJ system is compromised in human heart
failure (Chen M. M., et al. Circulation. 108:1432-1439, (2003);
Chong K S, et al. Eur J Heart Fail. 8:355-360, (2006)). In patients
with chronic heart failure, apelin administration increased cardiac
index and lowered peripheral vascular resistance in the absence of
hypotension providing a promising new drug target for heart failure
(Japp A G, et al. Circulation. 121:1818-1827, (2010)).
[0172] Apelin promotes the phosphorylation of Akt and increases the
proliferation of endothelial cells in vitro indicating a
pro-angiogenic role (Kidoya H, et al. EMBO J. 27:522-534, (2008);
Kidoya H, et al. Blood. 115:3166-3174, (2010); Tao J, et al. Am J
Physiol Heart Circ Physiol. 301:H1471-1486, (2011)). Given the
plethora of biochemical and cellular effects of apelin, it was
postulated that loss of apelin might enhance the susceptibility to
myocardial ischemic injury. Apelin peptides disclosed herein may
prevent myocardial ischemic reperfusion injury, which can be
demonstrated using the Langendorff protocol (described in Example
section). Apelin peptides disclosed herein may rescue the heart
from ischemic reperfusion injury compared to native isoforms (e.g.,
native isoform 2).
[0173] Tachycardia is directly correlated with native apelin
isoforms binding to the receptor. (Cheng, X., et al., European
Journal of Pharmacology, 470, 171-175 (2003)). Apelin peptides
disclosed herein may demonstrate an ability to induce
tachycardia.
Modulating Vascular Tone and Blood Pressure
[0174] Native apelin peptides have been shown to play a central
role in vascular disease in other pathological states including
pulmonary hypertension (Alastalo, supra; Kim, J., et al. Nat. Med.
19:74-82 (2013)) and diabetes (Sawane, M., et al. Diabetes
62:1970-80 (2013); Day, R. T., et al. Am. J. Physiol. Renal
Physiol. 304:F788-800 (2013)) It was indicated that a loss of
apelin function is associated with worsening vascular disease with
direct implications that apelin peptides can reverse or prevent the
progression of these disorders. Vascular tone refers to the degree
of constriction experienced by a blood vessel relative to its
maximally dilated state.
[0175] In some embodiments, there are provided methods of
modulating vascular tone in a subject comprising administering to
the subject an effective amount of an apelin receptor agonist
comprising an apelin peptide comprising a peptidomimetic of Formula
(I) or Formula (II) of the disclosure, or pharmaceutically
acceptable salts thereof. In some embodiments, combinations of
apelin peptides may be employed.
[0176] In some embodiments, there are provided methods of reducing
blood pressure in a subject comprising administering to the subject
an effective amount of an apelin receptor agonist comprising an
apelin peptide comprising a peptidomimetic of Formula (I) or
Formula (II), or pharmaceutically acceptable salts thereof. In some
embodiments, the administering step is carried out
intravenously.
Modulating Apelin Receptor
[0177] In some embodiments, there are provided methods of
modulating an apelin pathway disorder comprising contacting the
apelin receptor with an apelin peptide comprising a peptidomimetic
of Formula (I) or Formula (II) of the disclosure, or
pharmaceutically acceptable salts thereof. In some embodiments,
combinations of apelin peptides may be employed. In some such
emobdiments, the contacting step is performed in vivo. In some such
embodiments, the apelin peptide is an apelin receptor agonist.
[0178] In some embodiments, there are provided methods of
modulating an apelin pathway disorder in a subject comprising
administering to the subject a therapeutically effective amount of
an apelin peptide comprising a peptidomimetic of Formula (I) or
Formula (II) of the disclosure, or pharmaceutically acceptable
salts thereof. In some embodiments, combinations of apelin peptides
may be employed. In some embodiments, the administering step is
carried out intravenously.
[0179] Modulating apelin receptor may be useful in numerous
biological contexts where the receptor is expressed. In some
embodiments, apelin peptides disclosed herein may be used to treat
and/or reduce HIV-1 infection. Cayabyab et al., J. Virol. 74:
11972-11976 (2000) observed that in addition to the chemokine
receptors CCR5 and CXCR4, primary HIV-1 isolates can also use APJ
as a co-receptor. CAT reporter assays showed that synthetic apelin
peptides inhibited HIV-1 entry into CD4-APJ-expressing cells.
[0180] As used herein, the singular forms "a", "and," and "the"
include plural referents unless the context clearly indicates
otherwise.
[0181] The following Examples are being submitted to illustrate
embodiments of the present disclosure. Nevertheless, one skilled in
the art, without departing from the spirit and scope of the
invention, can make various changes and modifications of the
invention to adapt it to various usages and conditions. The
following Examples are intended to be illustrative only and are not
intended to limit the scope of the present disclosure.
EXAMPLES
Reagents, Solvents and Purification
[0182] Commercially available chemical and biological reagents were
purchased from Sigma-Aldrich Canada, Chem-Impex International Inc.,
Fisher Scientific Ltd., Alfa Aesar Ltd., R&D Systems, Tocris
Bioscience, Harvard Apparatus, Caledon or VWR International, and
used without further purification unless otherwise stated. All
solvents were of American Chemical Society (ACS) grade and were
used without further purification. All anhydrous reactions were
conducted under positive pressure of argon using flame-dried
glassware. Solvents for anhydrous reactions were distilled prior to
use: dichloromethane and dichloroethane were distilled over calcium
hydride, tetrahydrofuran and diethyl ether were distilled over
sodium with benzophenone as an indicator, and methanol was
distilled over magnesium. HPLC grade acetonitrile,
dimethylformamide, 2-propanol, hexanes and methanol were used
without further purification. Commercially available ACS grade
solvents (>99.0% purity) were used for column chromatography
without further purification. Deionized water was obtained from a
Milli-Q reagent water filtration system (Millipore Co., Milford,
Mass.). The removal of solvents in vacuo was performed by
evaporation under reduced pressure using a Buchi rotary evaporator.
Automated Solid Phase Peptide Synthesis was performed on a PreludeX
(Gyros protein technologies). All reactions and fractions from
column chromatography were monitored by thin layer chromatography
(TLC) using glass plates with a UV fluorescent indicator (normal
SiO.sub.2, Merck 60 F.sub.254). Visualization was performed
following: UV absorption by fluorescence quenching, staining with
phosphomolybdic acid in ethanol (10 g/100 mL), ninhydrin
(ninhydrin:acetic acid:n-butanol, 0.6 g:6 mL:200 mL) or potassium
permanganate (KMnO.sub.4:K.sub.2CO3:NaOH:H.sub.2O, 1.5 g:10 g:0.12
g:200 mL). Flash chromatography was performed using Merck type 60,
230-400 mesh silica gel. Semi-preparative and analytical scale high
performance liquid chromatography (HPLC) were performed on a
Gilso393 chromatograph equipped with model 322 pump heads, a model
171 diode array detector, a FC203B fraction collector and a
Rheodyne 7725i injector fitted with a 1000 pL sample loop. Columns
used for purification were: Supelco As centis Si, C18 100 .ANG., 5
.mu.m, 250 mm.times.4.6 mm; Restek Viva, BiPhenyl 300 .ANG., 5
.mu.m, 250 mm.times.4.6 mm; and Vydac BiPhenyl, 300 .ANG., 5 .mu.m,
250 mm.times.4.6 mm. HPLC solvents were filtered through a
Millipore filtration system under vacuum prior to use. Peptides
were purified to >95% purity as assessed by analytical
reinjection.
Characterization
[0183] Optical rotations were measured on a Perkin Elmer 241
polarimeter with a microcell (10 cm, 1 mL) at ambient temperature
and are reported in units of 10.sup.-1 deg cm.sup.2 g.sup.-1. All
reported optical rotations were referenced against air and measured
at the sodium D line (.lamda.=589.3 nm).
[0184] Infrared spectra (IR) were recorded on a Nicolet Magna 750
or a 20SX FT-IR spectrometer. Cast refers to the evaporation of a
solution on a NaCl plate.
[0185] Nuclear magnetic resonance (NMR) spectra were recorded on an
Agilent/Varian Inova 600, Inova 400, Inova 300, DD2 MR 400, VNMRS
700 or Unity 500 spectrometer at 27.degree. C. For .sup.1H (300,
400, 500, 600. or 700 MHz) spectra, .delta. values were referenced
to CDCl.sub.3 (7.26 ppm), D.sub.2O (4.79 ppm) or CD.sub.3OD (3.30
ppm), and for .sup.13C (100, 125, 150 or 175 MHz) spectra, .delta.
values were referenced to CDCl.sub.3 (77.0 ppm) or CD.sub.3OD (49.0
ppm), as the solvents. Reported splitting patterns are abbreviated
as s=singlet, d=doublet, t=triplet, q=quartet, sept=septet,
m=multiplet.
[0186] Mass spectra (MS) were recorded on a Kratos AEIMS-50, Bruker
9.4T Apex-Qe FTICR (high resolution, HRMS) or on a Perspective
Biosystems Voyager.TM. Elite MALDI-TOF MS using
4-hydroxy-.alpha.-cyanocinnamic acid (HCCA) as a matrix. MS/MS was
performed on a Bruker Ultraflextreme MALDI/TOF/TOF. LCMS was
performed on an Agilent Technologies 6130 LCMS using a Core-Shell
C18 column (1.7 .mu.m, 100 .ANG., Phenomenex Kintex).
General Apelin Peptide SPPS Elongation Method
[0187] A suspension of resin in DMF (10 mL) was bubbled under Ar
gas for 15 minutes to swell. The N-terminal Fmoc group was removed
by bubbling a solution of 20% piperidine in DMF (3.times.10 mL) for
3 minutes, washing considerably with DMF (3.times.10 mL) after each
deprotection. Fmoc-deprotection was monitored by TLC, with the
dibenzofulvene-piperidine adduct appearing as aas a bright purple
spot under UV. To pre-activate the amino acid solution, one of the
following procedures was followed: (1) DIPEA (2.2 eq) was added to
a solution of Fmoc-protected amino acid (1.1 eq compared to resin
loading), HOBt (1.1 eq), and PyBOP (1.1 eq) in DMF (10 mL) and
stirred for 5 minutes, or (2) DIPEA (6.0 equivalents) was added to
a solution of Fmoc-protected amino acid (3.0 equivalents compared
to resin loading), HATU (3.0 equivalents), and HOAt
(1-hydroxy-7-azabenzotriazole) (3.0 equivalents) in DMF (10 mL) and
stirred for 5 minutes. The activated amino acid solution was added
to the resin and bubbled under Ar gas for 1-3 h. The resin was
washed with DMF (3.times.10 mL) and the extent of coupling was
assessed by either: i) cleaving a small sample of resin with a
solution of 95:2.5:2.5 TFA:TIPS:H.sub.2O for 1 h and MALDI-TOF
analysis or ii) performing a Kaiser test to detect the presence of
free amines. A solution of 20% acetic anhydride in DMF (10 mL) was
added to the resin and bubbled under Ar gas for 10 minutes to
end-cap any unreacted amines. The resin was rinsed thoroughly with
DMF (3.times.10 mL) and subjected to Fmoc-deprotection to further
elongate the peptide, or rinsed with CH.sub.2Cl.sub.2 (3.times.10
mL) and MeOH (3.times.10 mL), dried thoroughly, and stored under Ar
gas at -20.degree. C.
General Method for Apelin Peptide Resin Cleavage
[0188] Resin-bound apelin peptide was suspended in 95:2.5:2.5
TFA:TIPS:H2O with shaking under an Ar atmosphere for 2-3 hours. The
resin was removed via filtration through glass wool, rinsed with
TFA, and the solution concentrated in vacuo. Cold diethyl ether (1
mL, or 2.times.5 mL) was added to triturate the crude peptide. The
diethyl ether and peptide precipitate were decanted into a tube and
centrifuged for 1 minute to pellet the peptide. The diethyl ether
was then decanted, and the pellet was dissolved in 10% aqueous
acetonitrile, 0.1% TFA.
Apelin Peptide Purification Methods
[0189] Peptides were purified using C18 RP-HPLC using aqueous 0.1%
TFA (solvent A) and 0.1% TFA in acetonitrile (solvent B) as
eluents.
Example 1
Synthesis of D-Leu Peptides of pyr-1-apelin-13 A2 8 and Apelin-17
A2 9
[0190] D-Substituted apelin A2 peptides were easily accessible due
to the commercial availability of Fmoc-protected D-amino acids.
Following the Fmoc-SPPS strategy outlined in FIG. 3, D-Leu peptides
of pyr-1-apelin-13 A2 8 and apelin-17 A2 9 were synthesized.
Example 2
Synthesis of Dipeptide 22 for the Preparation of .alpha.-Methyl
Leucine Apelin A2 Peptides 10 and 11
[0191] .alpha.-methylated Leu dipeptide 20 was synthesized through
the HATU coupling of commercially available .alpha.-methyl-leucine
benzyl ester p-TsOH salt with Fmoc-Orn(Boc)-OH (Orn=ornithine)
(FIG. 4). The ornithine 8-amine was deprotected under acidic
conditions, and then guanidinylated with
1,3-di-Boc-2-(trifluoromethylsulfonyl)guanidine to produce di-Boc
protected arginine dipeptide 21. Benzyl ester removal under
Pd-catalyzed hydrogenolysis generated free acid 22, which was
incorporated into .alpha.-MeLeu apelin 13 and 17 A2 peptides 10
(SEQ ID NO:10) and 11 (SEQ ID NO:11) respectively.
Example 3
Synthesis of Dipeptide 29 for the Preparation of .alpha.-Methyl
Leucine Apelin A2 Peptides 12 and 13
[0192] The synthesis of dipeptide 29 is outlined in FIG. 5. Steric
occlusion of the susceptible amide bond through .alpha.-methylation
had previously been successful in conferring resistance to ACE2 by
the incorporation of Aib N-terminal to the monocarboxypeptidase
cleavage site. (Wang, W., et al. J. Am. Heart Assoc. 2, e000249
(2013)). Ni-Schiff base complex 23 was used to enantioselectively
prepare target .alpha.-methylated amino acids due to: ease of
synthesis; recyclability of the chiral ligand; and ability to
separate individual diastereomers by flash chromatography
Ala-Ni(II)-(5)-BPB complex 23 was synthesized according to
literature protocol (Belokon', Y. N., et al. Tetrahedron: Asymmetr:
9, 4249-4252 (1998)) and was used to divergently synthesize both
.alpha.-methyl arginine and .alpha.-methyl leucine amino acids.
[0193] For the synthesis of .alpha.-methyl arginine, 23 was
deprotonated with KOtBu and alkylated with azido-3-iodopropane (24)
to generate .alpha.,.alpha.-disubstituted Ni-complex 25. The
desired (S,S)-diastereomer was purified by silica flash
chromatography in 69% yield, and the absolute stereochemistry was
confirmed by X-ray crystallography (CCDC 1528624. Complex 25 was
hydrolyzed under acidic conditions and the resulting amino acid was
Fmoc-protected (26). A HATU-mediated peptide coupling with
H-Leu-OMe HCl salt afforded dipeptide 27, which was subsequently
converted to .alpha.Me-Arg containing dipeptide 28 through azide
hydrogenolysis and guanidinylation. Methyl ester deprotection gave
the
SPPS-compatible dipeptide 29 for the eventual preparation of
.alpha.MeArg peptides 12 and 13.
Example 4
Synthesis of Dipeptide 33 for the Preparation of .alpha.-Methyl
Leucine Apelin A2 Peptides 14 and 15
[0194] The synthesis of dipeptide 33 is outlined in FIG. 6. To
prepare .alpha.-methyl leucine, 23 was alkylated with
2-methyl-1-iodopropane to generate the desired (S,5)-diastereomer
30, with the absolute stereochemistry confirmed by X-ray
crystallography. Acid hydrolysis followed by Fmoc-protection
produced amino acid 31, which was subsequently coupled to
H-Ser(tBu)-OMe to give dipeptide 32. Methyl ester deprotection gave
the SPPS-compatible dipeptide 33, which was used for .alpha.MeLeu
apelin peptides 14 and 15.
Example 5
Synthesis of Azatripeptide 39 for the Preparation of Aza-Arginine
Apelin A2 Peptides 16 and 17
[0195] The synthesis of dipeptide 39 is outlined in FIG. 7.
Azadipeptide 34 was prepared by the sequential addition of
disuccinimidyl carbonate, then a solution of H-Leu-OtBu in DIPEA
(N,N-diisopropylethylamine) to benzophenone hydrazone analogous to
previously established literature protocol. (Traore, M., et al.,
Org. Lett. 16, 3588-3591 (2014), Garcia-Ramos, Y., et al., J. Pept.
Sci. 19, 725-729 (2013)). Regioselective semicarbazone alkylation
was achieved with tetraethylammonium hydroxide and
3-chloro-1-bromopropane to yield chloroalkylated product 35.
Displacement of the primary alkyl chloride with sodium azide
afforded 36, which was deprotected to semicarbazide 37 with
hydroxylamine hydrochloride. Semicarbazide 37 was aminoacylated
with the next N-terminal amino acid (Fmoc-Pro-OH) to generate
azatripeptide 38. The SPPS compatible tripeptide 39 was synthesized
following tert-butyl ester deprotection, hydrogenolysis of the
azide, and guanidinylation of the primary amine. Tripeptide 39 was
incorporated into azaArg apelin peptides 16 and 17.
Example 6
Synthesis of Azatripeptide 45 for the Preparation of Aza-Leucine
Apelin A2 Peptides 18 and 19
[0196] The synthesis of dipeptide 45 is outlined in FIG. 8. To
prepare a synthetic azaLeu tripeptide, 40 was prepared by the
sequential addition of disuccinimidyl carbonate, then a solution of
H-Ser(tBu)-OtBu in DIPEA to benzophenone hydrazone. Semicarbazone
alkylation was accomplished using tetraethylammonium hydroxide and
3-bromo-2-methylpropene to yield 41. Concomitant Pd-catalyzed
hydrogenation and hydrogenolysis afforded semicarbazide 42, which
was coupled to Fmoc-Orn(2-Cl-Cbz)-OH to generate azatripeptide 43.
Chemoselective tert-butyl ester deprotection to free acid 44 was
accomplished by addition of silica in refluxing toluene to
protected azatripeptide 43. Subsequent 2-chloro-Cbz deprotection
and guanidinylation of the resultant primary amine yielded
azatripeptide 45, which was further employed to generate
azaLeu-containing peptides 18 and 19.
Example 7
Synthesis and Characterization of Apelin Peptides
[0197] Compounds 23 and 24
[0198] Compounds 23 and 24 were prepared according to literature
protocols described in the literatures. See, Tetrahedron:
Asymmetry, 9, 4249-4252 (1998); WO 2011047215.
[0199] Fmoc-pBrPhe-2-Cl-Trt (6)
[0200] 2-Chlorotrityl chloride resin (1.05 mmol) was transferred to
a SPPS vessel, washed with CH.sub.2Cl.sub.2 (2.times.10 mL), DMF
(2.times.10 mL), and finally suspended in DMF and bubbled under Ar
gas for 10 minutes. Fmoc-p-bromo-L-phenylalanine (1.0 mmol) was
suspended in dry CH.sub.2Cl.sub.2 (10 mL) with DIPEA (5.0
equivalents) and added to the swollen resin. This solution was
bubbled under Ar gas for 2.5 h. The functionalized resin was washed
considerably with CH.sub.2Cl.sub.2 (3.times.10 mL) and DMF
(3.times.10 mL), and then unreacted sites were capped by bubbling
with dry MeOH (5 mL) under Ar gas for 45 minutes. The resin was
dried thoroughly under Ar, weighed and divided into 0.2 mmol
portions, and stored under an Ar atmosphere at -20.degree. C. "Trt"
refers to trityl.
[0201] Fmoc-His(Trt)-Lys(Boc)-Gly-Pro-Nle-Aib-pBrPhe-2-Q-Trt
(7)
[0202] Functionalized resin 6 was elongated by manual SPPS,
introducing amino acids in the following order: Fmoc-Aib-OH,
Fmoc-Nle-OH, Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Lys(Boc)-OH, and
Fmoc-His(Trt)-OH. A small sample of the resin was cleaved and
analysed by MALDI-TOF: Calculated for
C.sub.53H.sub.68BrN.sub.10O.sub.10 1083.4, found 1083.0 (M+H)+.
Synthesis of D-Leu Substituted A2 Peptides
[0203] D-Leu5-pyr-1-apelin-13 A2 (8)
[0204] Advanced intermediate 7 (0.1 mmol) was subjected to manual
SPPS, introducing amino acids in the following order:
Fmoc-Ser(tBu)-OH, Fmoc-D-Leu-OH, Fmoc-Arg(Pmc)-OH, Fmoc-Pro-OH,
Fmoc-Arg(Pmc)-OH, and pyr-Glu-OH. A portion (0.05 mmol) of
resin-bound peptide was cleaved and purified using a C.sub.18
RP-HPLC analytical column (Method A), eluting at 20.6 min. The
desired peptide was isolated as a white solid after lyophilization
(11.3 mg, 14%). Monoisotopic MW calculated for
C.sub.69H.sub.111BrN.sub.22O.sub.16 791.3860, found high resolution
(FTICR-ESI-MS) 791.3846 (M+2H).sup.2+.
[0205] D-Leu9-apelin-17 A2 (9)
[0206] Advanced intermediate 7 (0.1 mmol) was subjected to manual
SPPS, introducing amino acids in the following order:
Fmoc-Ser(tBu)-OH, Fmoc-D-Leu-OH, Fmoc-Arg(Pmc)-OH, Fmoc-Pro-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Arg(Pmc)-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Phe-OH, and Fmoc-Lys(Boc)-OH. A portion
(0.05 mmol) of resin-bound peptide was cleaved and purified using a
C.sub.18 RP-HPLC analytical column (Method A), eluting at 11.2 min.
The desired peptide was isolated as a white solid after
lyophilization (9.9 mg, 9.1%). Monoisotopic MW calculated for
C.sub.96H.sub.161BrN3.sub.4O.sub.20 547.2947, found high resolution
(FTICR-ESI-MS) 547.2942 (M+4H).sup.4+.
Synthesis of .alpha.-Methyl Leucine A2 Peptides
Benzyl
A-((5,)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-((tert-buto-
xycarbonyl) amino) pentanoyl)-A-methyl-L-leucinate (20)
[0207] Fmoc-Orn(Boc)-OH (1.23 g, 2.70 mmol), HATU (1.03 g, 2.70
mmol), HOAt (4.5 mL [0.6 M solution in DMF], 2.70 mmol), and DIPEA
(1.28 mL, 7.36 mmol) were dissolved in dry DMF (10 mL) and stirred
for 5 minutes to preactivate the amino acid. A solution of
N-Me-Leu-OBn p-TsOH (para-toluenesulfonic acid) salt (1.00 g, 2.45
mmol) and DIPEA (0.43 mL, 2.45 mmol) in dry CH.sub.2Cl.sub.2 (10
mL) was added and the reaction was stirred for 17 h at room
temperature. The reaction was washed with 10% aqueous NaHCO.sub.3
(20 mL), 10% aqueous citric acid (20 mL) and brine (20 mL). The
organic layer was dried over Na.sub.2SO.sub.4, filtered, and
concentrated in vacuo. The dipeptide was purified using flash
chromatography (silica gel, 25% EtOAc in hexanes), obtaining 20 as
a crunchy white solid (1.25 g, 76%). (R.sub.f 0.9 on SiO.sub.2, 1:3
hexanes:EtOAc); [.alpha.].sub.D.sup.26 500-17.4 (c 1.0
CH.sub.2Cl.sub.2); IR (CH.sub.2Cl.sub.2 cast) 3315, 3066, 3037,
2957, 2870, 1714, 1645, 1513, 1451, 1251, 1172 cm.sup.-1; .sup.1H
(CDCl.sub.3, 500 MHz): .delta. 7.76 (d, J=7.5 Hz, 2H, Ar--H), 7.59
(d, J=7.5 Hz, 2H, Ar--H), 503 7.43-7.27 (m, 9H, Ar--H), 5.65 (d,
J=8.5 Hz, 1H, Fmoc-NH), 5.35 (dd, J=10.8, 5.0 Hz, 1H,
Leu-CH.alpha.), 5.19-5.06 (m, 2H, Bn-OCH2504), 4.68 (ddd, J=7.7,
7.7, 4.8 Hz, 1H, Orn-CH.alpha.), 4.51 (s, 1H, Boc-NH), 4.37 (ddd,
J=10.6, 7.1, 7.1 Hz, 2H, Fmoc-CH.sub.2), 4.21 (t, J=7.1 Hz, 1H,
Fmoc-CH), 3.09-3.04 (m, 2H, Orn-CH.sub.2.delta.), 2.93 (s, 3H,
N--CH.sub.3), 1.81-1.65 (m, 3H, 2.times.Leu-CH.sub.2.beta.,
Orn-CH.sub.2.beta.), 1.56-1.46 (m, 4H, Orn-CH.sub.2.beta.,
2.times.Orn-CH.sub.2.gamma., 507 Leu-CH(CH.sub.3).sub.2), 1.44 (s,
9H, --C(CH.sub.3).sub.3), 1.01-0.84 (m, 6H, --CH(CH.sub.3).sub.2);
.sup.13C (CDCl3508, 125 MHz): .delta. 172.6, 171.3, 156.0, 155.9,
143.9, 143.8, 141.3, 141.3, 135.4, 128.7, 128.5, 128.4, 127.7,
127.1, 127.1, 125.2, 120.0, 79.1, 510 67.1, 67.0, 54.9, 50.7, 47.2,
40.1, 36.8, 31.1, 30.0, 28.5, 25.4, 24.9, 23.2, 21.4; HRMS (ES)
Calculated for C.sub.39H.sub.50N.sub.3O.sub.7 672.3643, found
672.3642 (M+H).sup.+ 511.
Benzyl(11S,14S,E)-11-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-6-((tert--
butoxycarbonyl)amino)-14-isobutyl-2,2,13-trimethyl-4,12-dioxo-3-oxa-5,7,13-
-triazapentadec-5-en-15-oate (21)
[0208] The guanidinylation reaction was adapted from a literature
procedure..sup.58 TFA (5 mL) was added to a solution of dipeptide
20 (0.701 g, 1.04 mmol) in dry CH.sub.2Cl.sub.2 (10 mL) and stirred
for 1 h. The reaction was concentrated in vacuo, using diethyl
ether co-evaporations to remove residual TFA. The yellow oil was
resuspended in dry CH.sub.2Cl.sub.2 (20 mL) and
1,3-di-Boc-2-(trifluoromethylsulfonyl)guanidine (0.449 g, 1.15
mmol) and triethylamine (0.32 mL, 2.30 mmol) were added and stirred
for 80 minutes. The reaction was washed with 2 N aqueous sodium
bisulfate (10 mL) and 10% NaHCO.sub.3 (10 mL), dried over
Na.sub.2SO.sub.4, filtered, and concentrated in vacuo. The
dipeptide was purified using flash chromatography (silica gel, 20%
EtOAc in hexanes), obtaining 21 as a crunchy white solid (0.820 g,
97%). (R 0.5 on SiO.sub.2, 3:1 hexanes:EtOAc);
[.alpha.].sub.D.sup.26 -12.5 (c 1.21 CHCl.sub.3); IR (CHCl.sub.3
cast) 3331, 2959, 2871, 1721, 1640, 1451, 1415, 1330, 1156, 1134
cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta. 8.29 (t, J=5.4
Hz, 1H, Arg-NH.epsilon.), 7.76 (d, J=7.6 Hz, 2H, Ar--H), 7.60 (d,
J=7.6 Hz, 2H, Ar--H), 7.43-7.27 (m, 9H, Ar--H), 5.68 (d, J=8.5 Hz,
1H, Fmoc-NH), 5.37-5.28 (m, 1H, Leu-CH.alpha.), 5.23-5.05 (m, 2H,
--OCH.sub.2Ph), 4.67 (td, J=8.1, 4.3 Hz, 1H, Arg-CH.alpha.),
4.44-4.31 (m, 2H, Fmoc-CH.sub.2), 4.21 (t, J=6.9 Hz, 1H, Fmoc-CH),
3.36 (ddd, J=7.4, 5.0, 3.2 Hz, 2H, Arg-CH.sub.2.delta.), 2.93 (s,
3H, N--CH.sub.3), 1.82-1.75 (m, 1H, Leu-CH.sub.2.beta.), 1.75-1.66
(m, 2H, Leu-CH.sub.2.beta., Arg-CH.sub.2.beta.), 1.63-1.55 (m, 3H,
Arg-CH.sub.2.beta., 2.times.Arg-CH.sub.2.gamma.) 1.49 (m, 10H,
Leu-CH(CH.sub.3).sub.2, --C(CH.sub.3).sub.3), 1.48 (s, 9H,
--C(CH.sub.3).sub.3), 0.93 (d, J=6.6 Hz, 3H,
Leu-CH(CH.sub.3).sub.2), 0.90 (d, J=6.5 Hz, 3H,
Leu-CH(CH.sub.3).sub.2); .sup.13C (CDCl.sub.3, 125 MHz): .delta.
172.5, 171.2, 163.6, 156.2, 156.0, 153.3, 143.9, 143.8, 141.3,
141.3, 135.4, 128.7, 128.6, 128.4, 127.7, 127.1, 127.1, 125.2,
125.2, 120.0, 83.1, 79.2, 67.1, 67.0, 54.9, 50.8, 47.2, 40.3, 36.8,
31.2, 29.9, 28.3, 28.1, 27.9, 27.9, 24.9, 23.2, 21.4; HRMS (ES)
Calculated for C.sub.45H.sub.60N.sub.5O.sub.9 814.4386, found
814.4378 (M+H).sup.+.
(11S,14S,E)-11-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-6-((tert-butoxy-
carbonyl)amino)-14-isobutyl-2,2,13-trimethyl-4,12-dioxo-3-oxa-5,7,13-triaz-
apentadec-5-en-15-oic Acid (22)
[0209] A solution of 21 (0.501 g, 0.62 mmol) was dissolved in
methanol (50 mL) and had 10% Pd/C (20 mg) added. The suspension was
stirred under hydrogen gas for 22 h, filtered through a pad of
Celite, and concentrated in vacuo. The crude residue was purified
using flash chromatography (silica gel, 5% MeOH in
CH.sub.2Cl.sub.2, 0.1% AcOH), yielding 22 as a white solid (0.378
g, 85%). (R.sub.f 0.2 on SiO.sub.2, 1% AcOH in EtOAc);
[.alpha.].sub.D.sup.26 -2.8 (c 1.0 CH.sub.2Cl.sub.2); IR
(CH.sub.2Cl.sub.2 cast) 3326, 3140, 3066, 2959, 2872, 1721, 1641,
1618, 1451, 1415, 1331, 1253, 1136 cm.sup.-1; .sup.1H (CDCl.sub.3,
500 MHz):
[0210] .delta. 8.48 (s, 1H, Arg-NH.epsilon.), 7.76 (d, J=7.5 Hz,
2H, Ar--H), 7.61 (d, J=7.5 Hz, 2H, Ar--H), 7.40 (t, J=7.5 Hz, 2H,
Ar--H), 7.32 (tdd, J=7.5, 3.4, 1.2 Hz, 2H, Ar--H), 6.05 (d, J=7.6
Hz, 1H, Fmoc-N--H), 5.37 (dd, J=10.7, 5.1 Hz, 1H, Leu-CH.alpha.),
4.80 (dd, J=5.4, 5.3 Hz, 1H, Arg-CH.alpha.), 4.38 (dd, J=10.6, 7.2
Hz, 2H, Fmoc-CH.sub.2), 4.21 (t, J=7.1 Hz, 1H, Fmoc-CH), 3.55-3.45
(m, 1H, Arg-CH.sub.2.delta.), 3.14-3.05 (m, 1H,
Arg-CH.sub.2.delta.), 2.98 (s, 3H, N--CH.sub.3), 1.92-1.56 (m, 6H,
2.times.Leu-CH.sub.2.beta., 2.times.Arg-CH.sub.2.beta.,
2.times.Arg-CH.sub.2.gamma.), 1.52 (s, 9H, --C(CH.sub.3).sub.3),
1.49 (m, 10H, Leu-CH(CH.sub.3).sub.2, --C(CH.sub.3).sub.3), 0.96
(d, J=6.6 Hz, 3H, Leu-CH(CH.sub.3).sub.2), 0.93 (d, J=6.5 Hz, 3H,
Leu-CH(CH.sub.3).sub.2); .sup.13C (CDCl.sub.3, 125 MHz): .delta.
172.3, 172.1, 162.8, 156.3, 155.7, 153.2, 144.9, 143.8, 141.4,
141.3, 127.7, 127.7, 127.1, 127.1, 125.2, 125.2, 120.0, 119.9,
83.1, 80.6, 66.9, 54.7, 51.1, 47.3, 40.6, 36.1, 30.7, 28.4, 28.1,
28.1, 24.8, 23.2, 21.4; HRMS (ES) Calculated for
C.sub.38H.sub.54N.sub.5O.sub.9 724.3916, found 724.3924
(M+H).sup.+.
N-MeLeu5-pyr-1-apelm-13 A2 (10)
[0211] Advanced intermediate 7 (0.1 mmol) was subjected to manual
SPPS, introducing amino acids in the following order:
Fmoc-Ser(tBu)-OH, 22, Fmoc-Pro-OH, Fmoc-Arg(Pmc)-OH. The resin was
split into half, and Fmoc-SPPS was continued on 0.1 mmol scale,
coupling pyr-Glu-OH. No endcapping was performed following addition
of 22. A portion (0.05 mmol) of resin-bound peptide was cleaved as
previously described and purified using a C.sub.18 RP-HPLC
analytical column (Method A), eluting at 11.2 min. The desired
peptide was isolated as a white solid after lyophilization (6.0 mg,
7%). Monoisotopic MW calculated for
C.sub.70H.sub.114BrN.sub.22O.sub.16 532.5983, found high resolution
(FTICR-ESI-MS) 532.5972 (M+3H).sup.3+.
N-MeLeu9-apelin-17 A2 (11)
[0212] The remaining 0.1 mmol carried over from the synthesis of 10
was coupled with: Fmoc-Gln(Trt)-OH, Fmoc-Arg(Pmc)-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Phe-OH, and Fmoc-Lys(Boc)-OH. No endcapping
was performed following addition of 22. A portion (0.05 mmol) of
resin-bound peptide was cleaved as previously described and
purified using a C.sub.18 RP-HPLC analytical column (Method A),
eluting at 11.3 min. The desired peptide was isolated as a white
solid after lyophilization (23.8 mg, 22%). Monoisotopic MW
calculated for C.sub.97H.sub.163BrN.sub.34O.sub.20 550.7986, found
high resolution (FTICR-ESI-MS) 550.7983 (M+4H).sup.4+.
Synthesis of .alpha.-Methyl Arginine A2 Peptides
1-azido-3-iodopropane (24)
[0213] Compound 24 was prepared according to literature
procedures..sup.43 A solution of 1-chloro-3-iodopropane (2.63 mL,
24.5 mmol) and sodium azide (1.91 g, 29.4 mmol) in dry DMF (60 mL)
was stirred at room temperature for 24 h. The reaction was diluted
by the addition of water (100 mL) and diethyl ether washes
(2.times.100 mL) were used to extract organic components. The
diethyl ether fractions were dried over Na.sub.2SO.sub.4, filtered
and concentrated in vacuo until a small volume (.about.10 mL) of
ether remained. The reaction was diluted in acetone (60 mL) and
following the addition of sodium iodide (5.50 g, 36.7 mmol), the
reaction was heated at 60.degree. C. for 24 h. The solution was
concentrated in vacuo until a small volume (.about.10 mL) remained,
then diluted with diethyl ether (100 mL) and washed with H.sub.2O
(2.times.100 mL). The organic layer was dried over
Na.sub.2SO.sub.4, vacuum filtered through a small plug of alumina,
and concentrated in vacuo, obtaining the desired product as a light
yellow oil (3.91 g, 76%). IR (CH.sub.2Cl.sub.2 cast) 2927, 2869,
2098, 1449, 1428, 1347, 1290, 1224, 1173 cm.sup.-1; .sup.1H
(CDCl.sub.3, 500 MHz): .delta.3.44 (t, J=6.4 Hz, 2H,
--CH.sub.2N.sub.3), 3.25 (t, J=6.6 Hz, 2H, --CH.sub.2I), 2.04 (app
pentet, J=6.5 Hz, 2H, --CH.sub.2--); .sup.13C (CDCl.sub.3, 125
MHz): .delta. 51.5, 32.4, 2.3.
(2S)-2-(3'-azidopropyl)-2-methyl-glycine-Ni(II)-(S)-BPB (25)
[0214] Complex 25 was prepared according to literature
procedure..sup.43 Nickel complex 23 (6.49 g, 12.7 mmol) and
potassium tert-butoxide (2.13 g, 19.0 mmol) were added to an RBF
and dissolved in dry DMF (50 mL) at 0.degree. C. under an Ar
atmosphere. This solution was stirred for 3 minutes, followed by
the addition of a solution of 24 (5.01 g, 19.0 mmol) in dry DMF (10
mL). The reaction was stirred at 0.degree. C. for 45 minutes, then
warmed to room temperature for 75 minutes. 5% aqueous acetic acid
(200 mL) was added to quench the reaction, followed by extraction
with CH.sub.2Cl.sub.12 (3.times.75 mL). Pooled organic layers were
washed with brine (2.times.75 mL), dried over Na.sub.2SO.sub.4,
filtered and concentrated in vacuo. The desired diastereomer was
purified by flash chromatography (silica gel; 2.5% MeOH in EtOAc),
yielding 25 as a red solid (5.18 g, 69%). Crystals of 25 were
obtained after dissolution in minimal CH.sub.2Cl.sub.2, dilution
with hexanes and slow evaporation. (R.sub.f0.6 on SiO.sub.2, 9:1
EtOAc:MeOH); [.alpha.].sub.D.sup.26 1853.4 (c 1.0
CH.sub.2Cl.sub.2); IR (CH.sub.2Cl.sub.2 cast) 3060, 2937, 2869,
2097, 1673, 1639, 1574, 1439, 1359, 1253, 1165 cm.sup.-1;
##STR00010##
[0215] .sup.1H (CDCl.sub.3, 500 MHz): .delta. 8.12-8.07 (m, 2H,
Ar--H.sub.1), 8.05 (dd, J=8.7, 0.9 Hz, 1H, Ar--H.sub.4), 7.55-7.48
(m, 2H, Ar--H.sub.8, Ar--H.sub.9), 7.47-7.41 (m, 3H, Ar--H.sub.2,
Ar--H.sub.11), 7.35-7.28 (m, 2H, ArH.sub.3, Ar--H.sub.10), 7.16
(ddd, J=8.5, 5.8, 2.7 Hz, 1H, Ar--H.sub.5), 7.08 (dt, J=7.6, 1.3
Hz, 1H Ar--H.sub.12),6.69-6.62 (m, 2H, Ar--H.sub.6,
Ar--H.sub.7),4.50 (d, J=12.7 Hz, 1H, Ph-CH.sub.2--N), 3.70 (dd,
J=18.7, 11.8 Hz, 2H, Ph-CH.sub.2--N, Pro-CH.sub.2.delta.),
3.51-3.42 (m, 2H, Pro-CH.alpha., --CH.sub.2N.sub.3), 3.32-3.20 (m,
2H, --CH.sub.2N.sub.3, Pro-CH.sub.2.gamma.), 2.71 (dddd, J=12.8,
7.1, 5.8, 2.6 Hz, 1H, Pro-CH.sub.2.beta., 2.58-2.43 (m, 2H,
Pro-CH.sub.2.beta., --CH.sub.2CH.sub.2N.sub.3), 2.26-2.04 (m, 3H,
--CH.sub.2CH.sub.2N.sub.3, Pro-CH.sub.2.gamma.,
Pro-CH.sub.2.delta., 1.86 (ddd, J=13.8, 12.4, 4.2 Hz, 1H,
--CH.sub.2CH.sub.2CH.sub.2N.sub.3), 1.76 (ddd, J=13.7, 12.4, 4.6
Hz, 1H, --CH.sub.2CH.sub.2CH.sub.2N.sub.3), 1.28 (s, 3H,
--CH.sub.3); .sup.13C (CDCl.sub.3, 125 MHz): .delta. 182.0, 180.6,
172.8, 141.6, 136.4, 133.4, 133.4, 131.8, 131.7, 130.2, 129.6,
129.1, 129.0, 128.5, 128.1, 127.3, 127.1, 124.0, 120.8, 77.4, 70.0,
63.5, 57.2, 51.3, 37.5, 30.7, 29.4, 25.5, 23.4; HRMS (ES)
Calculated for C.sub.31H.sub.32N.sub.6NaNiO.sub.3 617.1782, found
617.1785 (M+Na).sup.+.
(S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-azido-2-methylpentanoi-
c Acid (26)
[0216] A solution of 3N HCl:MeOH (1:1, 40 mL) was heated to
70.degree. C. and had 25 (2.60 g, 4.37 mmol) dissolved in MeOH (10
mL) added dropwise over 5 minutes. The reaction mixture was stirred
for 50 minutes at 70.degree. C., turning from dark red to green as
the reaction proceeded. The reaction was cooled to room
temperature, concentrated in vacuo and resuspended in 10% aqueous
sodium carbonate (20 mL). EDTA disodium salt (3.25 g, 8.73 mmol)
was added and stirred for 0.5 h at room temperature. The reaction
was cooled to 0.degree. C. and had a solution of Fmoc-OSu (1.62 g,
4.80 mmol) dissolved in acetone (20 mL) added to it. This reaction
was slowly warmed to room temperature and stirred for 16 h. The
following day, the reaction was diluted with EtOAc (50 mL) and
washed with 1 N HCl (3.times.20 mL). The organic layer was dried
over MgSO.sub.4, filtered, and concentrated in vacuo. The product
was purified by flash chromatography (silica gel, 1-5% MeOH in
CH.sub.2Cl.sub.2 gradient), yielding 26 as a white solid (1.64 g,
95%). (R.sub.f0.4 on SiO.sub.2, 9:1 EtOAc:MeOH); .sup.1H
(CDCl.sub.3, 500 MHz): .delta. 7.77 (d, J=7.5 Hz, 2H, Ar--H), 7.58
(d, J=7.5 Hz, 2H, Ar--H), 7.40 (td, J=7.4, 3.1 Hz, 2H, Ar--H), 7.32
(tdd, J=7.4, 2.6, 1.1 Hz, 2H, Ar--H), 5.57 (br s, 1H, Fmoc-NH),
4.48-4.36 (m, 2H, Fmoc-CH.sub.2), 4.21 (t, J=6.2 Hz, 1H, Fmoc-CH),
3.32-3.19 (m, 2H, --CH.sub.2N.sub.3), 2.28-2.17 (m, 1H,
Orn-CH.sub.2.gamma.), 2.02-1.90 (m, 1H, Orn-CH.sub.2.gamma.), 1.60
(br s, 3H, --CH.sub.3), 1.50-1.39 (m, 2H, Orn-CH.sub.2.beta.);
.sup.13C (CDCl.sub.3, 125 MHz): .delta. 170.1, 153.9, 143.8, 141.4,
127.7, 127.1, 125.0, 120.0, 66.6, 51.1, 47.2, 34.0, 33.4, 23.7,
23.5; HRMS (ES) Calculated for C.sub.21H.sub.21N.sub.4O.sub.4
393.1568, found 393.1566 (M-H).sup.-.
Methyl
((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-azido-2-methyl-
-pentanoyl)-L-leucinate (27)
[0217] Compound 26 (1.61 g, 4.09 mmol), HATU (1.55 g, 4.09 mmol),
HOAt (0.68 mL [0.6 M solution in DMF], 0.41 mmol), and DIPEA (2.85
mL, 16.4 mmol) were dissolved in dry DMF (25 mL) and stirred for 5
minutes to preactivate the amino acid. A solution of H-Leu-OMe*HCl
(0.780 g, 4.29 mmol) in dry CH.sub.2Cl.sub.2 (25 mL) was added and
the reaction was stirred for 16 h at room temperature. The reaction
was concentrated in vacuo, resuspended in EtOAc (50 mL), and washed
with 10% citric acid, water, and brine (50 mL). The organic layer
was dried over Na.sub.2SO.sub.4, filtered, and concentrated in
vacuo. Crude 27 was purified using flash chromatography (silica
gel, 33% EtOAc in hexanes), obtaining the desired dipeptide as a
yellow oil (1.22 g, 57%). (R.sub.f 0.5 on SiO.sub.2, 2:1
hexane:EtOAc); [.alpha.].sub.D.sup.26 -1.2 (c 1.0 CHCl.sub.3); IR
(CHCl.sub.3 cast) 3342, 2956, 2872, 2097, 1731, 1664, 1495, 1450,
1249, 1089 cm.sup.-1; .sup.1H(CDCl.sub.3, 500 MHz): .delta.7.76
(dd, J=7.4, 1.0 Hz, 2H, Ar--H), 7.59 (ddd, J=7.5, 4.0, 1.0 Hz, 2H,
Ar--H), 7.44-7.35 (m, 2H, Ar--H), 7.32 (dddd, J=7.5, 7.5, 2.2, 1.2
Hz, 2H, Ar--H), 6.38 (br s, 1H, Leu-NH), 5.83 (br s, 1H, Fmoc-NH),
4.60 (ddd, J=8.6, 8.0, 4.7 Hz, 1H, Leu-CH.alpha.), 4.49-4.35 (m,
2H, Fmoc-CH.sub.2), 4.20 (t, J=6.6 Hz, 1H, Fmoc-CH), 3.72 (s, 3H,
--OCH.sub.3), 3.34-3.18 (m, 2H, Arg-CH.sub.2.delta.), 2.47-2.23 (m,
1H, Arg-CH.sub.2.beta.), 1.84-1.76 (m, 1H, Arg-CH.sub.2.beta.),
1.70-1.40 (m, 8H, Arg-CH.sub.3, 2.times.Arg-CH.sub.2.gamma.,
2.times.Leu-CH.sub.2.beta., --CH(CH.sub.3).sub.2), 0.93 (m, 6H,
--CH(CH.sub.3).sub.2); .sup.13C (CDCl.sub.3, 125 MHz): .delta.
173.4, 173.1, 154.6, 143.9, 143.9, 141.4, 127.7, 127.1, 127.1,
125.0, 120.0, 66.5, 59.4, 52.4, 51.2, 51.1, 47.3, 41.3, 33.9, 25.0,
24.0, 23.5, 22.8, 21.9; HRMS (ES) Calculated for
C.sub.28H.sub.35N.sub.5NaO.sub.5 544.2530, found 544.2527
(M+Na)+.
Methyl
((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-((Z)-2,3-bis(t-
ert-butoxycarbonyl)guanidino)-2-methylpentanoyl)-L-leucinate
(28)
[0218] The guanidinylation reaction was adapted from a literature
procedure..sup.58 Dipeptide 27 (1.16 g, 2.23 mmol) was dissolved in
MeOH (50 mL) and had 10% Pd/C (20 mg) added. The suspension was
stirred under hydrogen gas for 2 h, filtered through a pad of
Celite, and concentrated in vacuo. The crude residue was suspended
in CH.sub.2Cl.sub.2 (30 mL) and
1,3-di-Boc-2-(trifluoromethylsulfonyl)guanidine (0.961 g, 2.45
mmol) and triethylamine (0.69 mL, 4.91 mmol) were added. This
reaction was stirred at room temperature under Ar for 18 h,
concentrated in vacuo, and purified using flash chromatography
(silica gel, 35% EtOAc in hexanes), yielding 28 as a white solid
(1.08 g, 66%). (R.sub.f0.4 on SiO.sub.2, 3:1 hexane:EtOAc);
[.alpha.].sub.D.sup.26 3.2 (c 1.0 CHCl.sub.3); IR (CHCl.sub.3 cast)
3332, 2959, 1723, 1644, 1619, 1495, 1451, 1369, 1332, 1234, 1155,
1135, 1057 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta. 8.28
(s, 1H, Arg-NH.sub..epsilon.), 7.76 (dt, J=7.5, 0.9 Hz, 2H, Ar--H),
7.60 (ddq, J=7.7, 5.0, 1.0 Hz, 2H, Ar--H), 7.46-7.36 (m, 2H,
Ar--H), 7.32 (dddd, J=7.4, 7.4, 3.8, 1.2 Hz, 2H, Ar--H), 6.39 (br
s, 1H, Leu-NH), 5.82 (br s, 1H, Fmoc-NH), 4.62-4.53 (m, 1H,
Leu-CH.alpha.), 4.46-4.36 (m, 2H, Fmoc-CH.sub.2), 4.21 (t, J=6.7
Hz, 1H, FmocCH.sub.2), 3.71 (s, 3H, --OCH.sub.3), 3.44-3.32 (m, 2H,
Arg-CH.sub.2.delta.), 2.35-2.19 (m, 1H, Arg-CH.sub.2.beta.),
1.82-1.71 (m, 1H, Arg-CH.sub.2.beta.), 1.70-1.51 (m, 8H,
Arg-CH.sub.3, 2.times.Arg-CH.sub.2.gamma.,
2.times.Leu-CH.sub.2.beta., --CH(CH.sub.3).sub.2), 1.49 (s, 9H,
--C(CH.sub.3).sub.3), 1.48 (s, 9H, --C(CH.sub.3).sub.3), 0.93 (d,
J=6.2 Hz, 6H, --CH(CH.sub.3).sub.2); .sup.13C (CDCl.sub.3, 125
MHz): .delta. 173.5, 173.2, 163.5, 156.2, 153.2, 143.9, 143.9,
141.3, 127.7, 127.1, 127.1, 125.0, 120.0, 83.1, 79.3, 66.5, 59.5,
52.4, 51.1, 47.3, 41.2, 40.6, 28.3, 28.1, 25.0, 24.0, 23.7, 22.8,
21.8; HRMS (ES) Calculated for C.sub.39H.sub.56N.sub.5O.sub.9
738.4073, found 738.4069 (M+H).sup.+.
((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-((Z)-2,3-bis(tert-but-
oxy-carbonyl)guanidino)-2-methylpentanoyl)-L-leucine (29)
[0219] Methyl ester deprotection conditions were adapted from a
literature protocol..sup.44 Dipeptide 28 (1.06 g, 1.44 mmol) was
dissolved in aqueous 2-propanol (70% 2-propanol in water, 50 mL)
and had CaCl.sub.2.2H.sub.2O (5.88 g) added to generate a 0.8 M
Ca.sup.2+ solution. Sodium hydroxide (0.115 g, 2.87 mmol) was added
and the reaction was stirred for 3.5 h. Acetic acid (0.164 mL, 2.87
mmol) was added to neutralize residual base, and the reaction was
concentrated in vacuo. The crude residue was dissolved in minimal
MeOH and the dipeptide was precipitated by the addition of H.sub.2O
and collected by vacuum filtration, yielding 29 as a white solid
(0.982 g, 94%). (R.sub.f0.05 on SiO.sub.2, 1:1 hexane:EtOAc);
[.alpha.].sub.D.sup.26 -6.0 (c 1.0 MeOH); IR (MeOH cast) 3347,
2957, 1722, 1641, 1450, 1416, 1368, 1331, 1135 cm.sup.-1; .sup.1H
(CD.sub.3OD, 500 MHz): .delta. 7.89 (s, 1H, Arg-NH.sub..epsilon.),
7.78 (dt, J=7.6, 0.9 Hz, 2H, Ar--H), 7.70-7.64 (m, 2H, Ar--H),
7.41-7.34 (m, 2H, Ar--H), 7.30 (td, J=7.4, 1.1 Hz, 3H, Ar--H), 4.38
(d, J=6.6 Hz, 2H, Fmoc-CH.sub.2), 4.25-4.19 (m, 2H, Fmoc-CH,
LeuCH.alpha.), 3.33-3.27 (m, 2H, Arg-CH.sub.2.delta.), 2.03-1.94
(m, 1H, Arg-CH.sub.2.beta.), 1.84-1.75 (m, 1H, Arg-CH.sub.2.beta.),
1.68-1.52 (m, 4H, --CH(CH.sub.3).sub.2, 2.times.Leu-CH.sub.2.beta.,
Arg-CH.sub.2.gamma.), 1.50 (d, J=3.7 Hz, 10H, --C(CH.sub.3).sub.3,
Arg-CH.sub.2.gamma.), 1.44 (s, 9H, --C(CH.sub.3).sub.3), 1.40 (s,
3H, Arg-CH.sub.3), 0.88 (d, J=6.4 Hz, 3H, --CH(CH.sub.3).sub.2,
0.87 (d, J=6.4 Hz, 3H, --CH(CH.sub.3).sub.2; .sup.13C (CDCl.sub.3,
125 MHz): .delta. 176.3, 172.4, 164.6, 157.5, 154.1, 145.3, 142.7,
128.9, 128.2, 126.2, 121.0, 84.5, 80.4, 79.5, 67.8, 60.6, 49.6,
49.3, 41.8, 28.6, 28.3, 26.1, 24.7, 23.7, 22.1; HRMS (ES)
Calculated for C.sub.38H.sub.54N.sub.5O.sub.9 724.3916, found
724.3913 (M+H)+.
.alpha.-MeArg4-pyr-1-apelin-13 A2 (12)
[0220] Advanced intermediate 7 (0.2 mmol) was subjected to manual
SPPS (solid phase peptide synthesis), introducing amino acids in
the following order: Fmoc-Ser(tBu)-OH, 29, Fmoc-Pro-OH,
Fmoc-Arg(Pmc)-OH. The resin was split into half, and Fmoc-SPPS was
continued on 0.1 mmol scale, coupling pyr-Glu-OH. No endcapping was
performed following addition of 29. A portion (0.05 mmol) of
resin-bound peptide was cleaved as previously described and
purified using a C.sub.18 RP-HPLC analytical column (Method A),
eluting at 13.4 min. The desired peptide was isolated as a white
solid after lyophilization (8.5 mg, 11%). Monoisotopic MW
calculated for C.sub.70H.sub.114BrN.sub.22O.sub.16 532.5983, found
high resolution (FTICR-ESI-MS) 532.5973 (M+3H).sup.3+.
.alpha.-MeArc8-apelin-17 A2 (13)
[0221] The remaining 0.1 mmol carried over from the synthesis of 12
was coupled with: FmocGln(Trt)-OH, Fmoc-Arg(Pmc)-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Phe-OH, and Fmoc-Lys(Boc)-OH. No endcapping
was performed following addition of 29. A portion (0.05 mmol) of
resin-bound peptide was cleaved as previously described and
purified using a C.sub.18 RP-HPLC analytical column (Method A),
eluting at 13.0 min. The desired peptide was isolated as a white
solid after lyophilization (12.5 mg, 11%). Monoisotopic MW
calculated for C.sub.97H.sub.163BrN.sub.34O.sub.20 550.7986, found
high resolution (FTICR-ESI-MS) 550.7974 (M+4H).sup.4+.
Synthesis of .alpha.-Methyl Leucine A2 Peptides
(2S)-2-(2'-methylpropyl)-2-methyl-glycine-Ni(II)-(S)-BPB (30)
[0222] Alkylation conditions were adapted from literature
protocol..sup.42 Nickel complex 23 (3.20 g, 6.25 mmol) and
potassium tert-butoxide (1.05 g, 9.37 mmol) were added to an RBF
and dissolved in dry DMF (25 mL) at 0.degree. C. under an Ar
atmosphere. This solution was stirred for 3 minutes, followed by
the addition of 1-iodo-2-methylpropane (2.16 mL, 18.7 mmol). The
reaction was stirred at 0.degree. C. for 30 minutes, then warmed to
room temperature for an additional 75 minutes. 5% aqueous acetic
acid (100 mL) was added to quench the reaction, followed by
extraction with CH.sub.2Cl.sub.2 (3.times.75 mL). The pooled
organic layers were washed with brine (2.times.75 mL), dried over
Na.sub.2SO.sub.4, filtered and concentrated in vacuo. The desired
diastereomer was purified by flash chromatography (silica gel; 2.5%
MeOH in EtOAc), yielding 30 as a red solid (2.43 g, 69%). Crystals
of 30 were obtained after dissolution in minimal CH.sub.2Cl.sub.2,
dilution with hexanes and slowevaporation. (R.sub.f 0.6 on
SiO.sub.2, 9:1 EtOAc:MeOH); [.alpha.].sub.D.sup.26 1683.7 (c 1.0
CHCl.sub.3); IR (CHCl.sub.3 cast) 2959, 2870, 1668, 1639, 1535,
1439, 1360, 1253, 1170 cm.sup.-1;
##STR00011##
[0223] .sup.1H (CDCl.sub.3, 500 MHz): .delta. 8.12-8.06 (m, 3H
Ar--H.sub.1, Ar--H.sub.4), 7.51-7.43 (m, 2H, Ar--H.sub.8,
Ar--H.sub.9), 7.42-7.36 (m, 3H, Ar--H.sub.2, Ar--H.sub.11),
7.34-7.22 (m, 2H, Ar--H.sub.3, Ar--H.sub.10), 7.12 (ddd, J=8.6,
6.7, 1.9 Hz, 1H, Ar--H.sub.5), 7.06-7.00 (m, 1H, Ar--H.sub.12),
6.64-6.53 (m, 2H, Ar--H.sub.6, Ar--H.sub.7), 4.48 (d, J=12.7 Hz,
1H, Ph-CH.sub.2--N), 3.74-3.64 (m, 2H, Ph-CH.sub.2--N,
Pro-CH.sub.2.delta.), 3.45 (dd, J=10.6, 6.1 Hz, 1H, Pro-CH.alpha.),
3.26-3.10 (m, 1H, Pro-CH.sub.2.gamma.), 2.74-2.65 (m, 1H,
Pro-CH.sub.2.beta.), 2.56-2.37 (m, 2H, Pro-CH.sub.2.beta.,
Leu-CHy), 2.13-2.00 (m, 2H, Pro-CH.sub.2.gamma.,
Pro-CH.sub.2.delta.), 1.73-1.60 (m, 2H, Leu-CH.sub.2.beta.), 1.27
(d, J=6.6 Hz, 3H, Leu-CH.sub.3.delta.), 1.22 (s, 3H,
Leu-CH.sub.3.beta.), 1.14 (d, J=6.7 Hz, 3H, Leu-CH.sub.3.delta.);
.sup.13C (CDCl.sub.3, 125 MHz): .delta. 182.9, 180.6, 172.3, 141.7,
136.8, 133.6, 133.5, 131.7, 131.6, 130.5, 129.4, 129.0, 128.9,
128.4, 127.8, 126.9, 123.8, 120.6, 77.5, 70.2, 63.6, 57.1, 48.5,
30.7, 30.7, 25.6, 24.5, 23.3, 23.3; HRMS (ES) Calculated for
C.sub.32H.sub.36N.sub.3NiO.sub.3 568.2105, found 568.2100
(M+H).sup.+.
(S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-2,4-dimethylpentanoic
Acid (31)
[0224] A solution of 3N HCl:MeOH (1:1, 10 mL) was heated to
70.degree. C. and had 30 (2.36 g, 4.16 mmol) dissolved in MeOH (5
mL) added dropwise over 5 minutes. The reaction mixture was stirred
for 40 minutes, turning from dark red to green as the reaction
proceeded. The reaction was cooled to room temperature,
concentrated in vacuo and resuspended in 10% aqueous sodium
carbonate (25 mL). EDTA disodium salt (3.09 g, 8.31 mmol) was added
and stirred for 0.5 h at room temperature. The reaction was cooled
to 0.degree. C. and had a solution of Fmoc-OSu (1.54 g, 4.57 mmol)
dissolved in acetone (25 mL) added to it. This reaction was slowly
warmed to room temperature and stirred for 22 h. The following day,
the reaction was diluted with EtOAc (50 mL) and washed with 1 N HCl
(3.times.50 mL). The organic layer was dried over MgSO.sub.4,
filtered, and concentrated in vacuo. The product was purified by
flash chromatography (silica gel, 1-5% MeOH in CH.sub.2Cl.sub.2
gradient), yielding 31 as a white solid (1.45 g, 95%). (R.sub.f0.35
on SiO.sub.2, 7.5% MeOH in CH.sub.2Cl.sub.12); .sup.1H (CDCl.sub.3,
500 MHz): .delta. 7.80-7.74 (m, 2H, Ar--H), 7.64-7.57 (m, 2H, ArH),
7.43-7.38 (m, 2H, Ar--H), 7.37-7.29 (m, 2H, Ar--H), 5.92 (br s, 1H,
N--H), 4.46-4.33 (m, 2H, Fmoc-CH.sub.2), 4.32 (t, 1H, J=6.0 Hz
Fmoc-CH), 2.26-2.19 (m, 1H, Leu-CH.sub.2.beta.), 1.83-1.73 (m, 1H,
Leu-CH.sub.2.beta.), 1.70-1.55 (m, 4H, Leu-CH.gamma.,
Leu-CH.sub.3.beta.), 0.96-0.82 (m, 6H, 2.times.LeuCH.sub.3.delta.);
.sup.13C (CDCl.sub.3, 125 MHz): .delta. 179.4, 155.2, 143.9, 141.6,
127.8, 127.1, 124.8, 120.0, 65.1, 47.3, 24.9, 24.7, 23.8, 23.0;
HRMS (ES) Calculated for C.sub.22H.sub.24NO.sub.4 366.1711, found
366.1706 (M-H).sup.-.
Methyl
N--((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-2,4-dimethyl--
pentanoyl)-O-(tert-butyl)-L-serinate (32)
[0225] Amino acid 31 (1.53 g, 4.16 mmol), HATU (1.58 g, 4.16 mmol),
HOAt (0.69 mL [0.6 M solution in DMF], 0.42 mmol), and DIPEA (2.90
mL, 16.6 mmol) were dissolved in dry DMF (25 mL) and stirred for 5
minutes to preactivate the amino acid. A solution of
H-Ser(tBu)-OMe.HCl (0.925 g, 4.37 mmol) in dry CH.sub.2Cl.sub.2 (25
mL) was added and the reaction was stirred for 20 h at room
temperature. The reaction was concentrated in vacuo, resuspended in
EtOAc (50 mL), and washed with 10% citric acid, water, and brine
(50 mL). The organic layer was dried over Na.sub.2SO.sub.4,
filtered, and concentrated in vacuo. Crude 32 was purified using
flash chromatography (silica gel, 25% EtOAc in hexanes), obtaining
the desired product as a whitesolid (0.872 g, 40%). (Rf 0.2 on
SiO.sub.2, 3:1 hexanes:EtOAc); [.alpha.].sub.D.sup.26 20.4 (c 1.0
CHCl3); IR (CHCl.sub.3 cast) 3440, 3384, 2973, 2956, 2872, 1730,
1669, 1493, 1364, 1241, 1099 cm.sup.-1; .sub.1H (CDCl.sub.3, 500
MHz): .delta. 7.76 (dd, J=7.6, 0.9 Hz, 2H, Ar--H), 7.64-7.58 (m,
2H, Ar--H), 7.39 (ddd, J=6.8, 6.8, 0.8 Hz, 2H, Ar--H), 7.31 (ddd,
J=7.4, 6.8, 1.1 Hz, 2H, Ar--H), 6.64 (br s, 1H, SerNH), 6.09 (s,
1H, Fmoc-NH), 4.74-4.68 (m, 1H, Ser-CH.alpha.), 4.43-4.30 (m, 2H,
Fmoc-CH.sub.2), 4.22 (t, J=6.8 Hz, 1H, Fmoc-CH), 3.81 (d, J=8.8 Hz,
1H, Ser-CH.sub.2.beta.), 3.75 (s, 3H, --OCH.sub.3), 3.57 (d, J=8.8
Hz, 1H, Ser-CH.sub.2.beta.), 2.44-2.31 (m, 1H, Leu-CH.sub.2.beta.),
1.73-1.52 (m, 5H, LeuCH.sub.2.beta., Leu-CH.gamma., Leu-CH3.beta.),
1.13 (s, 9H, --C(CH.sub.3).sub.3), 0.94-0.82 (m, 6H,
2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 173.9, 170.7, 154.4, 144.1, 144.0, 141.3, 127.6, 127.1,
125.1, 120.0, 73.4, 66.4, 61.9, 59.6, 53.1, 52.4, 47.3, 45.1, 27.3,
25.2, 24.7, 23.7, 23.6; HRMS (ES) Calculated for
C.sub.30H.sub.41N.sub.2O.sub.6 525.2959, found 525.2956 (M+H)+.
N--((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-2,4-dimethylpentanoy-
l)-O-(tert-butyl)-L-serine (33)
[0226] Methyl ester deprotection conditions were adapted from
literature procedure..sup.44 Dipeptide 32 (0.853 g, 1.63 mmol) was
dissolved in aqueous 2-propanol (70% 2-propanol in water, 50 mL)
and had CaCl.sub.2.2H.sub.2O (5.88 g) added to generate a 0.8 M
Ca.sup.2+ solution. Sodium hydroxide (0.130 g, 3.25 mmol) was added
and the reaction was stirred for 4 h. Acetic acid (0.186 mL, 3.25
mmol) was added to neutralize residual base, and the reaction was
concentrated in vacuo. The crude residue purified by flash
chromatography (silica gel, 50% EtOAc in hexanes 0.1% AcOH),
yielding dipeptide 33 as a white sticky solid (0.368 g, 44%).
(R.sub.f 0.3 on SiO.sub.2, 0.1% AcOH in EtOAc);
[.alpha.].sub.D.sup.26 27.0 (c 1.0 CHCl.sub.3); IR (CHCl.sub.3
cast) 3386, 3320, 3068, 3018, 2974, 2876, 1727, 1665, 1497, 1450,
1240, 1194, 1105 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta.
7.76 (dd, J=7.7, 0.9 Hz, 2H, Ar--H), 7.59 (ddd, J=7.5, 2.0, 1.0 Hz,
2H, Ar--H), 7.40 (ddd, J=7.5, 7.5, 0.9 Hz, 2H, Ar--H), 7.31 (ddd,
J=7.7, 7.5, 1.2, Hz, 2H, Ar--H), 6.78 (br s, 1H, Ser-NH), 5.73 (s,
1H, Fmoc-NH), 4.67-4.56 (m, 1H, Ser-CH.alpha.), 4.48-4.34 (m, 2H,
Fmoc-CH.sub.2), 4.20 (t, J=6.6 Hz, 1H, Fmoc-CH), 3.95-3.88 (m, 1H,
Ser-CH.sub.2.beta., 3.54-3.48 (m, 1H, Ser-CH.sub.2.beta., 2.19-2.07
(m, 1H, Leu-CH.sub.2.beta., 1.72-1.59 (m, 2H, Leu-CH.sub.2.beta.,
Leu-CH.gamma.), 1.54 (s, 3H, Leu-CH.sub.3.beta.), 1.19 (s, 9H,
--C(CH.sub.3).sub.3), 0.94-0.82 (m, 6H,
2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 174.3, 172.0, 154.9, 143.8, 141.4, 129.1, 128.2, 127.7,
127.1, 125.0, 120.0, 74.7, 66.6, 61.0, 59.9, 52.7, 47.2, 45.8,
27.7, 24.4, 24.0, 23.6; HRMS (ES) Calculated for
C.sub.29H.sub.37N.sub.2O.sub.6 509.2657, found 509.2657
(M-H).sup.-.
.alpha.-MeLeu5-pyr-1-apelin-13 A2 (14)
[0227] Advanced intermediate 7 (0.2 mmol) was subjected to manual
SPPS, introducing amino acids in the following order: 33,
Fmoc-Pro-OH, and Fmoc-Arg(Pmc)-OH. The resin was split into half,
and Fmoc-SPPS was continued on 0.1 mmol scale, coupling pyr-Glu-OH.
No endcapping was performed following addition of 33. A portion
(0.05 mmol) of resin-bound peptide was cleaved as previously
described and purified using a C.sub.18 RP-HPLC analytical column
(Method A), eluting at 13.7 min. The desired peptide was isolated
as a white solid after lyophilization (8.5 mg, 11%). Monoisotopic
MW calculated for C.sub.70H.sub.114BrN.sub.22O.sub.16 532.5983,
found high resolution (FTICR-ESI-MS) 532.5972 (M+3H).sup.3+. "Pmc"
refers to 2,2,5,7,8-pentamethylchroman-6-sulfonyl.
.alpha.-MeLeu9-apelin-17 A2 (15)
[0228] The remaining 0.1 mmol carried over from the synthesis of 14
was coupled with FmocGln(Trt)-OH, Fmoc-Arg(Pmc)-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Phe-OH, and Fmoc-Lys(Boc) OH. A portion
(0.05 mmol) of resin-bound peptide was cleaved as previously
described and purified using a C.sub.18 RP-HPLC analytical column
(Method A), eluting at 11.5 min. The desired peptide was isolated
as a white solid after lyophilization (14.3 mg, 13%). Monoisotopic
MW calculated for C.sub.97H.sub.163BrN.sub.34O.sub.20 550.7986,
found high resolution (FTICR-ESI-MS) 550.7974 (M+4H).sup.4+.
Synthesis of Aza-Arginine A2 Peptides
Tert-Butyl (2-(diphenylmethylene)hydrazine-1-carbonyl)-L-leucinate
(34)
[0229] Semicarbazone 34 was prepared by modifying a literature
procedure..sub.46 A solution of benzophenone hydrazone (4.39 g,
22.4 mmol) in dry CH.sub.2Cl.sub.2 (50 mL) was cooled to 0.degree.
C. and cannulated into a 0.degree. C. solution of disuccinimidyl
carbonate (7.41 g [85% purity], 24.6 mmol) in dry CH.sub.2Cl.sub.2
(50 mL) and dry DMF (10 mL). The reaction was warmed to room
temperature for 45 minutes, then cooled down to 0.degree. C. A
0.degree. C. solution of H-Leu-OtBu.HCl (5.00 g, 22.4 mmol) and
DIPEA (7.79 mL, 44.7 mmol) in dry CH.sub.2Cl.sub.2 (50 mL) was then
cannulated into the reaction vessel and allowed to slowly come up
to room temperature over 16 h. The reaction was concentrated in
vacuo and purified by flash chromatography (silica gel, 20% EtOAc
in hexanes), yielding a light yellow sticky solid (8.29 g, 91%).
(R.sub.f 0.8 on SiO.sub.2, 1:1 hexanes:EtOAc);
[.alpha.].sub.D.sup.26 36.7 (c 1.27 CHCl.sub.3); IR (CHCl.sub.3
cast) 3414, 3355, 3188, 3062, 2957, 2871, 1732, 1682, 1519, 1446,
1368, 1153, 1113 cm.sup.-1; .sup.1H (CDCl.sub.3, 400 MHz): .delta.
7.59 (s, 1H, .dbd.N--NH), 7.57-7.46 (m, 5H, Ar--H), 7.40-7.29 (m,
3H, Ar--H), 7.29-7.22 (m, 2H, Ar--H), 6.68 (d, J=9.0 Hz, 1H,
Leu-NH), 4.52 (ddd, J=8.8, 8.8, 5.6 Hz, 1H, Leu-CH.alpha.),
1.85-1.74 (m, 1H, Leu-CH.gamma.), 1.74-1.60 (m, 2H,
Leu-CH.sub.2.beta.), 1.50 (s, 9H, --C(CH.sub.3).sub.3), 1.00 (d,
J=6.5 Hz, 6H, 2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3,
125 MHz): .delta. 172.6, 154.9, 148.2, 137.0, 131.9, 129.8, 129.7,
129.4, 129.3, 128.8, 128.5, 128.3, 128.1, 127.2, 126.5, 81.7, 51.9,
42.4, 28.1, 25.0, 23.0, 22.1; HRMS (ES) Calculated for
C.sub.24H.sub.32N.sub.3O.sub.3 410.2438, found 410.2438
(M+H).sup.+.
Tert-Butyl
(1-(3-chloropropyl)-2-(diphenylmethylene)hydrazine-1-carbonyl)--
L-leucinate (35)
[0230] Alkylation conditions were initially adapted from a
literature procedure..sup.45 Semicarbazone 34 (2.47 g, 6.03 mmol)
was dissolved in THF (50 mL) and cooled to 0.degree. C. Aqueous
tetraethylammonium hydroxide (22.2 mL [20% solution], 30.1 mmol)
was added and stirred for 30 minutes, followed by the addition of
1-bromo-3-chloropropane (4.47 mL, 45.2 mmol) at 0.degree. C. The
reaction was slowly warmed to room temperature and was quenched
after 72 h by the addition of 10% citric acid (20 mL) followed by
brine (20 mL). Organic components were extracted with EtOAc
(3.times.100 mL), dried over Na.sub.2SO.sub.4, filtered and
concentrated in vacuo. Alkylated semicarbazone 204 was purified by
flash chromatography (silica gel, 15% EtOAc in hexanes) and was
isolated as a yellow oil (2.16 g, 74%). (Rf 0.85 on SiO.sub.2, 2:1
hexanes:EtOAc); [.alpha.].sub.D.sup.26 67.5 (c 1.42 CHCl.sub.3); IR
(CHCl.sub.3 cast) 3414, 3061, 2959, 2870, 1734, 1682, 1499, 1446,
1368, 1154 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta.
7.55-7.41 (m, 6H, Ar--H), 7.41-7.30 (m, 4H, Ar--H), 6.69 (d, J=8.7
Hz, 1H, Leu-NH), 4.47 (ddd, J=8.8, 8.7, 5.6 Hz, 1H, Leu-CH.alpha.),
3.46 (dt, J=14.7, 6.8 Hz, 1H, N--CH.sub.2), 3.38-3.27 (m, 3H,
N--CH.sub.2, 2.times.N--CH.sub.2CH.sub.2), 1.80-1.72 (m, 3H,
2.times.-CH.sub.2Cl, Leu-CH.gamma.), 1.66 (ddd, J=13.6, 8.0, 5.6
Hz, 1H, Leu-CH.sub.2.beta.), 1.61-1.51 (m, 1H, LeuCH.sub.2.beta.),
1.48 (s, 9H, --C(CH.sub.3).sub.3), 0.98 (d, J=6.6 Hz, 6H,
2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 172.8, 159.4, 158.3, 138.6, 135.7, 130.2, 129.8, 128.9,
128.8, 128.6, 128.2, 81.3, 52.7, 44.1, 42.4, 42.1, 30.0, 28.1,
25.1, 22.9, 22.2; HRMS (ES) Calculated for
C.sub.27H.sub.37ClN.sub.3O.sub.3 486.2518, found 486.2518
(M+H).sup.+.
tert-butyl
(1-(3-azidopropyl)-2-(diphenylmethylene)hydrazine-1-carbonyl)-L-
-leucinate (36)
[0231] This reaction was adapted from a literature
procedure..sup.45 Chloroalkylated semicarbazone 35 (2.08 g, 4.27
mmol) and sodium azide (0.833 g, 12.8 mmol) were dissolved in DMF
(50 mL) and heated at 60.degree. C. for 20 h. The reaction was
cooled and had H.sub.2O (150 mL) added to it, followed by EtOAc
(3.times.150 mL) washes to extract organic components. Pooled EtOAc
layers were dried over Na.sub.2SO.sub.4, filtered, and concentrated
in vacuo. The product was purified using flash chromatography
(silica gel, 10% EtOAc in hexanes), generating azide 36 as a yellow
oil (1.90 g, 90%). (Rf 0.2 on SiO.sub.2, 9:1 hexanes:EtOAc);
[.alpha.].sub.D.sup.26 53.8 (c 1.00 CHCl.sub.3); IR (CHCl.sub.3
cast) 3411, 3061, 2958, 2871, 2097, 1734, 1683, 1499, 1446, 1368,
1257, 1154 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta.
7.54-7.40 (m, 6H, Ar--H), 7.40-7.26 (m, 4H, Ar--H), 6.74 (d, J=8.7
Hz, 1H, Leu-NH), 4.47 (ddd, J=8.8, 8.7, 5.6 Hz, 1H, Leu-CH.alpha.),
3.42 (dt, J=14.7, 7.0 Hz, 1H, N--CH.sub.2), 3.27 (dt, J=14.7, 6.8
Hz, 1H, N--CH.sub.2), 3.05 (t, J=7.1 Hz, 2H, --CH.sub.2N.sub.3),
1.76 (ddsept, J=12.9, 7.8, 6.5 Hz, 1H, Leu-CH.gamma.), 1.70-1.62
(m, 1H, Leu-CH.sub.2.beta.), 1.61-1.55 (m, 1H, Leu-CH.sub.2.beta.),
1.56-1.49 (m, 2H, --CH.sub.2CH.sub.2N.sub.3), 1.48 (s, 9H,
--C(CH.sub.3).sub.3), 0.99 (d, J=6.6 Hz, 3H, Leu-CH.sub.3.delta.),
0.98 (d, J=6.6 Hz, 3H, Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3,
125 MHz): .delta. 172.8, 158.5, 158.4, 138.6, 135.8, 130.2, 129.8,
128.9, 128.8, 128.5, 128.3, 81.3, 52.7, 48.9, 43.4, 42.1, 28.1,
26.2, 25.1, 22.9, 22.2; HRMS (ES) Calculated for
C.sub.27H.sub.37N.sub.6O.sub.3 493.2922, found 493.2922
(M+H).sup.+.
Tert-Butyl (1-(3-azidopropyl)hydrazine-1-carbonyl)-L-leucinate
(37)
[0232] This procedure was adapted from literature
protocols..sup.46,59, Azide 36 (1.89 g, 3.84 mmol) was dissolved in
a solution of hydroxylamine hydrochloride (1.07 g, 15.4 mmol) in
pyridine (75 mL) and heated to 60.degree. C. for 22 h. The reaction
was cooled to room temperature, then concentrated in vacuo, using
CH.sub.2Cl.sub.2 and EtOAc co-evaporations to remove residual
pyridine. The product was purified using flash chromatography
(silica gel, 60% EtOAc in hexanes, 0.1% DIPEA) yielding
semicarbazide 37 as a yellow oil (1.19 g, 94%). (Rf 0.5 on
SiO.sub.2, 1:1 hexanes:EtOAc); [.alpha.].sub.D.sup.26 5.0 (c 0.92
CHCl.sub.3); IR (CHCl.sub.3 cast) 3406, 3335, 3216, 2958, 2934,
2871, 2098, 1732, 1654, 1510, 1368, 1257, 1155 cm.sup.-1; .sup.1H
(CDCl.sub.3, 500 MHz): .delta. 6.67 (d, J=8.8 Hz, 1H, Leu-NH), 4.33
(ddd, J=8.9, 8.8, 5.5 Hz, 1H, Leu-CH.alpha.), 3.64 (s, 2H,
H.sub.2N--N), 3.62-3.51 (m, 2H, N--CH.sub.2), 3.36 (t, J=6.7 Hz,
2H, --CH.sub.2N.sub.3), 1.84 (app p, J=6.8 Hz, 2H,
--CH.sub.2CH.sub.2N.sub.3), 1.71 (ddsept, J=8.2, 8.0, 6.5 Hz, 1H,
Leu-CH.gamma.), 1.59 (ddd, J=13.6, 8.1, 5.5 Hz, 1H,
Leu-CH.sub.2.beta.), 1.53-1.47 (m, 1H, LeuCH.sub.2.beta.), 1.45 (s,
9H, --C(CH.sub.3).sub.3), 0.95 (d, J=6.6 Hz, 6H,
2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 173.5, 158.7, 81.3, 52.3, 49.2, 48.0, 42.4, 28.1, 26.3,
25.0, 22.9, 22.1; HRMS (ES) Calculated for
C.sub.14H.sub.29N.sub.6O.sub.3 329.2296, found 329.2290
(M+H).sup.+.
(9H-fluoren-9-yl)methyl
(S)-2-(2-(3-azidopropyl)-2-(((S)-1-(tert-butoxy)-4-methyl-1-oxopentan-2-y-
l)carbamoyl)hydrazine-1-carbonyl)pyrrolidine-1-carboxylate (38)
[0233] A solution of Fmoc-Pro-OH (1.65 g, 4.88 mmol), HATU (1.86 g,
4.88 mmol), HOAt (0.81 mL [0.6 M solution], 0.49 mmol) and DIPEA
(2.13 mL, 12.2 mmol) were dissolved in dry DMF (20 mL) and
preactivated for 5 minutes before the addition of a solution of
semicarbazide 37 (1.34 g, 4.07 mmol) in dry CH.sub.2Cl.sub.2 (20
mL). The reaction mixture was stirred under Ar gas for 18 h then
concentrated in vacuo. The crude reaction mixture was resuspended
in EtOAc (75 mL) and washed with 10% citric acid (50 mL), water (50
mL) and brine (50 mL). Pooled aqueous layers were washed with EtOAc
(2.times.75 mL), and pooled organic fractions were dried over
Na.sub.2SO.sub.4, filtered and concentrated in vacuo. The product
was purified by flash chromatography (silica gel, 50% EtOAc in
hexanes) yielding azatripeptide 38 as a white solid (1.74 g, 66%).
(Rf 0.4 on SiO.sub.2, 1:1 hexanes:EtOAc); [.alpha.].sub.D.sup.26
-7.2 (c 0.83 CHCl.sub.3); IR (CHCl.sub.3 cast) 3357, 3229, 2957,
2872, 2097, 1690, 1529, 1452, 1424, 1367, 1257, 1155 cm.sup.-1;
.sup.1H (CDCl.sub.3, 500 MHz): .delta. 8.20 (s, 1H, C(O)NH--N),
7.80-7.74 (m, 2H, Ar--H), 7.61-7.54 (m, 2H, Ar--H), 7.47-7.37 (m,
2H, Ar--H), 7.31 (t, J=7.5 Hz, 2H, Ar--H), 6.04 (d, J=8.2 Hz, 1H,
Leu-NH), 4.47 (dd, J=10.5, 7.1 Hz, 1H, Fmoc-CH.sub.2), 4.42-4.29
(m, 2H, Fmoc-CH.sub.2, Leu-CH.alpha.), 4.25 (t, J=6.8 Hz, 1H,
Fmoc-CH), 4.19 (dd, J=7.4, 4.5 Hz, 1H, Pro-CH.alpha.), 3.67-3.54
(m, 3H, 2.times.N--CH.sub.2, Pro-CH.sub.2.delta.), 3.55-3.46 (m,
1H, Pro-CH.sub.2.delta.), 3.44-3.33 (m, 2H, --CH.sub.2N.sub.3),
2.27 (ddd, J=11.5, 5.3, 4.9 Hz, 1H, Pro-CH.sub.2.beta.), 2.17-2.06
(m, 2H, Pro-CH.sub.2.beta., Pro-CH.sub.2.gamma.), 2.01-1.93 (m, 1H,
Pro-CH.sub.2.gamma.), 1.82-1.72 (m, 2H, --CH.sub.2CH.sub.2N.sub.3),
1.63 (ddd, J=13.4, 6.7, 6.5 Hz, 1H, Leu-CH.gamma.), 1.54 (ddd,
J=7.1, 6.7, 6.7 Hz, 1H, Leu-CH.sub.2.beta.), 1.48-1.38 (m, 10H,
Leu-CH.sub.2.beta., --C(CH.sub.3).sub.3), 0.84 (d, J=6.5, 3H,
Leu-CH.sub.3.delta.), 0.83 (d, J=6.5, 3H, Leu-CH.sub.3.delta.);
.sup.13C (CDCl.sub.3, 125 MHz): .delta. 173.5, 170.9, 156.8, 156.0,
143.7, 141.4, 127.9, 127.1, 125.0, 120.1, 81.3, 68.0, 59.2, 52.6,
49.2, 47.2, 47.1, 46.2, 41.9, 28.8, 28.0, 27.2, 25.0, 24.7, 22.8,
22.1; HRMS (ES) Calculated for C.sub.34H.sub.46N.sub.7O.sub.6
648.3504, found 648.3503 (M+H).sup.+.
(2-((S)-1-(((9H-fluoren-9-yl)methoxy)carbonyl)pyrrolidine-2-carboxamido)-7-
-((tert-butoxycarbonyl)amino)-11,11-dimethyl-9-oxo-10-oxa-2,6,8-triazadode-
c-7-enoyl)-L-leucine (39)
[0234] A solution of azatripeptide 38 (0.803 g, 1.24 mmol) in dry
CH.sub.2Cl.sub.2 (20 mL) was cooled to 0.degree. C. and had TFA (10
mL) added and stirred for 15 minutes. The reaction was warmed to
room temperature for 90 minutes and concentrated in vacuo, using
toluene co-evaporations to remove residual TFA. The product was
resuspended in MeOH (20 mL), 10% Pd/C (25 mg) was added, and the
reaction was stirred under an atmosphere of hydrogen gas for 75
minutes. The reaction mixture was filtered through a pad of Celite,
concentrated in vacuo to dryness, and resuspended in dry
CH.sub.2Cl.sub.2 (20 mL) with triethylamine (0.76 mL, 5.45 mmol)
and 1,3-di-Boc-2 (trifluoromethylsulfonyl) guanidine (0.801 g, 2.05
mmol) for 40 h. Solvents were removed in vacuo and 39 was purified
using flash chromatography (silica gel, 90% EtOAc in hexanes, 0.1%
AcOH), yielding a white solid (0.413 g, 41%). (Rf 0.05 on
SiO.sub.2, 0.1% AcOH in EtOAc); [.alpha.].sub.D.sup.26 -42.4 (c
1.00 CH3OH); IR (CH3OH cast) 3328, 2959, 1721, 1688, 1642, 1530,
1419, 1335, 1156, 1136 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz):
.delta. 9.47 (br s, 1H, Arg-NH.sub..epsilon.), 8.53 (s, 1H,
C(O)NH--N), 7.75 (d, J=7.5 Hz, 2H, Ar--H), 7.56 (d, J=7.5 Hz, 1H,
Ar--H), 7.54 (d, J=7.5 Hz, 1H, Ar--H), 7.39 (app t, J=7.4 Hz, 2H,
Ar--H), 7.30 (app t, J=7.5 Hz, 2H, Ar--H), 6.47 (br s, 1H, Leu-NH),
4.39 (dd, J=10.4, 7.1 Hz, 1H, Fmoc-CH.sub.2), 4.30-4.23 (m, 2H,
Fmoc-CH.sub.2, Leu-CH.alpha.), 4.23-4.17 (m, 2H, Fmoc-CH,
Pro-CH.alpha.), 3.84-3.69 (m, 1H, Arg-N--CH.sub.2.beta.), 3.64-3.57
(m, 1H, Pro-CH.sub.2.delta.), 3.56-3.48 (m, 2H,
Pro-CH.sub.2.delta., Arg-CH.sub.2.delta.N), 3.46-3.38 (m, 1H,
Pro-CH.sub.2.delta.), 3.35-3.26 (m, 1H, Arg-CH.sub.2.delta.N),
2.21-2.09 (m, 2H, Pro-CH.sub.2.beta., Arg-CH.sub.2.gamma.),
2.09-2.01 (m, 1H, Arg-CH.sub.2.gamma.), 1.93-1.86 (m, 1H,
Pro-CH.sub.2.beta.), 1.84-1.72 (m, 2H, Pro-CH.sub.2.gamma.),
1.70-1.54 (m, 3H, Leu-CH.sub..gamma., 2.times.LeuCH.sub.2.beta.),
1.49 (m, 9H, --C(CH.sub.3).sub.3), 1.46 (s, 9H,
--C(CH.sub.3).sub.3), 0.95-0.77 (m, 6H,
2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 171.8, 163.1, 158.7, 156.5, 155.3, 153.1, 143.7, 141.3,
129.0, 128.2, 127.8, 127.1, 127.1, 125.3, 125.0, 120.0, 83.4, 79.8,
67.8, 58.7, 53.1, 47.1, 44.9, 39.9, 37.9, 29.7, 28.3, 28.1, 27.2,
24.9, 24.5, 22.8, 21.8; HRMS (ES) Calculated for
C.sub.41H.sub.56N.sub.7O.sub.10 806.4094, found 806.4088
(M-H).sup.-.
azaArg4-pyr-1-apelin-13 A2 (16)
[0235] Advanced intermediate 7 (0.2 mmol) was subjected to manual
SPPS, introducing amino acids in the following order:
Fmoc-Ser(tBu)-OH, 39, and Fmoc-Arg(Pmc)-OH. The resin was split
into half, and Fmoc-SPPS was continued on 0.1 mmol scale, coupling
pyr-Glu-OH. No endcapping was performed following addition of 39. A
portion (0.05 mmol) of resin-bound peptide was cleaved as
previously described and purified using a C.sub.18 RP-HPLC
analytical column (Method A), eluting at 13.5 min. The desired
peptide was isolated as a white solid after lyophilization (5.5 mg,
7%). Monoisotopic MW calculated for
C.sub.68H.sub.111BrN.sub.23O.sub.16 528.2582, found high resolution
(FTICR-ESI-MS) 528.2571 (M+3H).sup.3+.
azaArg8-apelin-17 A2 (17)
[0236] The remaining 0.1 mmol carried over from the synthesis of 16
was coupled with FmocGln(Trt)-OH, Fmoc-Arg(Pmc)-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Phe-OH, and Fmoc-Lys(Boc) OH. A portion
(0.05 mmol) of resin-bound peptide was cleaved as previously
described and purified using a C.sub.18 RP-HPLC analytical column
(Method A), eluting at 11.1 min. The desired peptide was isolated
as a white solid after lyophilization (15.6 mg, 14%). Monoisotopic
MW calculated for C.sub.95H.sub.160BrN.sub.35O.sub.20 547.5435,
found high resolution (FTICR-ESI-MS) 547.5430 (M+4H).sup.4+.
Synthesis of Aza-Leucine A2 Peptides
Tert-Butyl
O-(tert-butyl)-N-(2-(diphenylmethylene)hydrazine-1-carbonyl)-L--
serinate (40)
[0237] This molecule was prepared by adapting a literature
procedure..sup.46 A solution of benzophenone hydrazone (1.55 g,
7.88 mmol) in dry CH.sub.2Cl.sub.2 (30 mL) was cooled to 0.degree.
C. and cannulated into a 0.degree. C. solution of disuccinimidyl
carbonate (2.61 g [85% purity], 8.67 mmol) in dry CH.sub.2Cl.sub.2
(30 mL) and dry DMF (5 mL). The reaction was warmed to room
temperature for 45 min, then cooled down to 0.degree. C. A
0.degree. C. solution of H-Ser(tBu)-OtBu.HCl (2.00 g, 7.88 mmol)
and DIPEA (2.75 mL, 15.8 mmol) in dry CH.sub.2Cl.sub.2 (20 mL) was
then cannulated into the reaction vessel and allowed to slowly come
up to room temperature over 24 h. The reaction was concentrated in
vacuo and purified by flash chromatography (silica gel, 25% EtOAc
in hexanes), yielding a light yellow sticky solid (2.94 g, 83%).
(Rf 0.4 on SiO.sub.2, 1:1 hexanes:EtOAc); [.alpha.].sub.D.sup.26
28.0 (c 1.0 CH.sub.2Cl.sub.2); IR (CH.sub.2Cl.sub.2 cast) 3425,
3173, 3059, 2975, 2932, 1751, 1743, 1693, 1518, 1367, 1161
cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta. 7.61 (s, 1H,
.dbd.N--NH), 7.58-7.45 (m, 5H, Ar--H), 7.38-7.29 (m, 3H, Ar--H),
7.29-7.23 (m, 2H, Ar--H), 7.17 (d, J=8.9 Hz, 1H, Ser-NH), 4.55
(ddd, J=8.9, 3.3, 2.9 Hz, 1H, Ser-CH.alpha.), 3.88 (dd, J=8.6, 2.9
Hz, 1H, Ser-CH.sub.2.beta.), 3.64 (dd, J=8.6, 3.3 Hz, 1H,
Ser-CH.sub.2.beta.), 1.50 (s, 9H, C(O)OC(CH.sub.3).sub.3), 1.22 (s,
9H, --CH.sub.2OC(CH.sub.3).sub.3); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 169.9, 155.2, 147.9, 137.1, 131.9, 129.7, 129.2, 128.5,
128.2, 127.1, 81.6, 73.1, 62.7, 53.8, 28.1, 27.5; HRMS (ES)
Calculated for C.sub.25H.sub.34N.sub.3O.sub.4 440.2544, found
440.2549 (M+H).sup.+.
Tert-Butyl
O-(tert-butyl)-N-(2-(diphenylmethylene)-1-(2-methylallyl)hydraz-
ine-1-carbonyl)-L-serinate (41)
[0238] Alkylation conditions were adapted from a literature
procedure..sup.45 Semicarbazone 40 (0.945 g, 2.15 mmol) was
dissolved in THF (10 mL) and cooled to 0.degree. C. Aqueous
tetraethylammonium hydroxide (7.91 mL [20% solution], 10.8 mmol)
was added and stirred for 30 minutes, followed by the addition of
3-bromo-2-methylpropene (1.63 mL, 16.1 mmol) at 0.degree. C. The
reaction was slowly warmed to room temperature and was quenched
after 60 h by the addition of 10% citric acid (15 mL) followed by
brine (15 mL). Organic components were extracted with EtOAc
(3.times.75 mL), dried over Na.sub.2SO.sub.4, filtered and
concentrated in vacuo. Alkylated semicarbazone 41 was purified by
flash chromatography (silica gel, 20% EtOAc in hexanes) and was
isolated as a yellow oil (1.06 g, 99%). (Rf 0.6 on SiO.sub.2, 3:1
hexanes:EtOAc); [.alpha.].sub.D.sup.26 6.1 (c 0.75 CH2Cl2); IR
(CH.sub.2Cl.sub.2 cast) 3421, 3062, 2974, 2935, 2877, 1745, 1687,
1496, 1366, 1154, 1098 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz):
.delta. 7.50-7.39 (m, 6H, Ar--H, Ser-NH), 7.39-7.34 (m, 1H, Ar--H),
7.32-7.27 (m, 4H, Ar--H), 4.71 (dq, J=1.4, 1.1 Hz, 1H, =CHH), 4.58
(ddd, J=8.9, 3.2, 3.2 Hz, 1H, Ser-CH.alpha.), 4.48-4.43 (m, 1H,
.dbd.CHH), 3.98 (d, J=17.0 Hz, 1H, Leu-NCH.sub.2.beta.), 3.88-3.79
(m, 2H, Ser-CH.sub.2.beta., Leu-NCH.sub.2.beta.), 3.62 (dd, J=8.6,
3.3 Hz, 1H, Ser-CH.sub.2.beta.), 1.48 (s, 9H,
C(O)OC(CH.sub.3).sub.3), 1.41-1.32 (m, 3H, --CH.sub.3), 1.17 (s,
9H, --CH.sub.2OC(CH.sub.3).sub.3); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 170.2, 158.5, 154.1, 139.8, 139.2, 135.9, 129.5, 129.4,
128.3, 128.2, 128.0, 111.8, 81.3, 72.9, 62.8, 54.7, 50.6, 28.1,
27.4 19.5; HRMS (ES) Calculated for C.sub.29H.sub.40N.sub.3O.sub.4
494.3013, found 494.3010 (M+H).sup.+.
Tert-Butyl
O-(tert-butyl)-N-(1-isobutylhydrazine-1-carbonyl)-L-serinate
(42)
[0239] Alkylated semicarbazone 41 (2.19 g, 4.43 mmol) was dissolved
in MeOH (50 mL) and had 10% Pd/C (20 mg) added. The suspension was
stirred under hydrogen gas for 20 h, filtered through a pad of
Celite, and concentrated in vacuo. The crude residue purified using
flash chromatography (silica gel, 50% EtOAc in hexanes), yielding
semicarbazide 42 as a yellow oil (1.37 g, 93%). (R.sub.f 0.6 on
SiO.sub.2, 3:1 hexanes:EtOAc); [.alpha.].sub.D.sup.26 20.8 (c 0.45
CH.sub.2Cl.sub.2); IR (CH.sub.2Cl.sub.2 cast) 3420, 3331, 3217,
2974, 2934, 2873, 1741, 1656, 1509, 1366, 1232, 1157, 1100
cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta. 7.04 (d, J=9.0
Hz, 1H, Ser-NH), 4.45 (ddd, J=9.0, 3.1, 3.0 Hz, 1H, Ser-CH.alpha.),
3.78 (dd, J=8.6, 3.1 Hz, 1H, Ser-CH.sub.2.beta.), 3.56 (s, 2H,
H.sub.2N--N), 3.52 (dd, J=8.6, 3.2 Hz, 1H, Ser-CH.sub.2.beta.),
3.36 (dd, J=13.9, 7.7 Hz, 1H, Leu-NCH.sub.2.beta.), 3.26 (dd,
J=13.9, 7.4 Hz, 1H, Leu-NCH.sub.2.beta.), 2.01-1.89 (m, 1H,
Leu-CH.gamma.), 1.46 (s, 9H, C(O)OC(CH.sub.3).sub.3), 1.14 (s, 9H,
--CH.sub.2OC(CH.sub.3).sub.3), 0.92 (d, J=6.7 Hz, 3H,
Leu-CH.sub.3.delta.), 0.91 (d, J=6.7 Hz, 3H, Leu-CH.sub.3.delta.);
.sup.13C (CDCl.sub.3, 125 MHz): .delta. 170.8, 159.1, 81.1, 72.8,
63.1, 57.4, 54.4, 28.1, 27.4, 26.1, 19.9; HRMS (ES) Calculated for
C.sub.16H.sub.34N.sub.3O.sub.4 332.2544, found 332.2539
(M+H).sup.+.
Tert-Butyl
N-(2-((S,)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-((((-
2-chloro-benzyl)oxy)carbonyl)amino)pentanoyl)-1-isobutylhydrazine-1-carbon-
yl)-O-(tert-butyl)-L-serinate (43)
[0240] A solution of Fmoc-Orn(2-Cl-Cbz)-OH (2.59 g, 4.91 mmol),
HATU (1.87 g, 4.91 mmol), HOAt (0.82 mL [0.6 M solution], 0.49
mmol) and DIPEA (2.14 mL, 12.3 mmol) were dissolved in dry DMF (20
mL) and preactivated for 5 minutes before the addition of a
solution of semicarbazide 42 (1.36 g, 4.09 mmol) in dry
CH.sub.2Cl.sub.2 (20 mL). This reaction was stirred under Ar for 30
h then concentrated in vacuo. The crude reaction was resuspended in
EtOAc (100 mL) and washed with 10% citric acid (2.times.100 mL) and
brine (100 mL). Pooled aqueous layers were washed with EtOAc
(2.times.100 mL), and pooled organic fractions were dried over
Na.sub.2SO.sub.4, filtered and concentrated in vacuo. The reaction
was purified by flash chromatography (silica gel, 40% EtOAc in
hexanes) yielding azatripeptide 43 as a white solid (2.64 g, 77%),
with a 17% recovery of 42. (R.sub.f0.2 on SiO.sub.2, 1:1
hexanes:EtOAc); [.alpha.].sub.D.sup.26 11.8 (c 1.00 CHCl.sub.3); IR
(CHCl.sub.3 cast) 3321, 3007, 2974, 2934, 2873, 1700, 1657, 1523,
1450, 1367, 1247, 1157 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz):
.delta. 8.31 (s, 1H, C(O)NH--N), 7.79-7.74 (m, 2H, Fmoc-Ar--H),
7.59 (d, J=7.5 Hz, 2H, Fmoc-Ar--H), 7.39 (m, 4H,
2.times.Fmoc-Ar--H, 2.times.2-Cl--Ar--H), 7.34-7.28 (m, 2H,
Fmoc-Ar--H), 7.27-7.23 (m, 2H, 2.times.2-Cl--Ar--H), 5.82 (d, J=8.2
Hz, 1H, Ser-NH), 5.53 (d, J=7.8 Hz, 1H, Orn-NH.alpha.), 5.27-5.20
(m, 2H, --OCH.sub.2 (2-Cl)Ph, Orn-NH.sub..epsilon.), 5.16 (d,
J=13.0 Hz, 1H, --OCH.sub.2(2-Cl)Ph), 4.48-4.38 (m, 3H,
Ser-CH.alpha., Orn-CH.alpha., Fmoc-CH.sub.2), 4.38-4.32 (m, 1H,
Fmoc-CH.sub.2), 4.21 (t, J=7.0 Hz, 1H, Fmoc-CH), 3.71 (dd, J=8.8,
2.8 Hz, 1H, Ser-CH.sub.2.beta.), 3.54-3.45 (m, 2H,
Ser-CH.sub.2.beta., Orn-CH.sub.2.delta.), 3.44-3.36 (m, 1H,
Leu-NCH.sub.2.beta.), 3.33-3.24 (m, 1H, Leu-NCH.sub.2.beta.),
3.24-3.15 (m, 1H, Orn-CH.sub.2.delta.), 2.00-1.90 (m, 1H,
Orn-CH.sub.2.delta.), 1.86-1.77 (m, 1H, Leu-CH.gamma.), 1.75-1.56
(m, 3H, Om-CH.sub.2.beta., 2.times.Orn-CH.sub.2.gamma.), 1.41 (s,
9H, C(O)OC(CH.sub.3).sub.3), 1.08 (s, 9H,
--CH.sub.2OC(CH.sub.3).sub.3, 0.89 (d, J=6.6 Hz, 6H,
2.times.Leu-CH.sub.3O); .sup.13C (CDCl.sub.3, 125 MHz): .delta.
173.7, 170.2, 157.1, 156.7, 156.4, 143.6, 141.3, 134.1, 133.5,
129.7, 129.5, 129.4, 127.8, 127.1, 126.8, 125.1, 120.0, 81.6, 72.9,
67.3, 64.1, 62.6, 55.4, 54.5, 52.1, 47.1, 39.7, 29.8, 28.0, 27.3,
26.9, 26.2, 20.0, 20.0; HRMS (ES) Calculated for
C.sub.44H.sub.59ClN.sub.5O.sub.9 836.3996, found 836.4008
(M+H).sup.+.
N-(2-((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-((((2-chlorobenz-
yl)oxy)carbonyl)amino)pentanoyl)-1-isobutylhydrazine-1-carbonyl)-O-(tert-b-
utyl)-L-serine (44)
[0241] Azatripeptide 43 (1.21 g, 1.44 mmol) was dissolved in
toluene (100 mL) and had flash-grade silica (25.0 g) added. This
suspension was refluxed at 115.degree. C. for 95 minutes, checking
TLC and LC-MS every 30 minutes. The reaction was cooled to room
temperature and a 10% MeOH in CH.sub.2Cl.sub.2 solution (100 mL)
was added, then filtered through a pad of Celite. The reaction was
concentrated in vacuo, and purified by flash chromatography (silica
gel, 0-2% MeOH in EtOAc, 0.1% AcOH). The desired product was
obtained as a sticky white solid (0.770 g, 69%). (R.sub.f 0.3 on
SiO.sub.2, 1:4 hexanes:EtOAc, 0.1% AcOH); [.alpha.].sub.D.sup.26
14.5 (c 1.00 CHCl.sub.3); IR (CHC1.sub.3 cast) 3313, 3018, 2971,
2874, 1697, 1528, 1450, 1249, 1193, 1104 cm.sup.-1; .sup.1H
(CDCl.sub.3, 500 MHz): .delta. 8.10 (s, 1H, C(O)NH--N), 7.71 (d,
J=7.6 Hz, 2H, Fmoc-Ar--H), 7.54 (d, J=7.5 Hz, 2H, Fmoc-Ar--H),
7.40-7.29 (m, 4H, 2.times.Fmoc-Ar--H, 2.times.2-Cl--Ar--H),
7.29-7.16 (m, 4H, 2.times.Fmoc-Ar--H, 2.times.2-Cl--Ar--H), 6.05
(br s, 1H, Ser-NH), 5.53 (br s, 1H, Orn-NH.alpha.), 5.22-5.11 (m,
2H, --OCH.sub.2(2-Cl)Ph), 4.42-4.37 (m, 2H, Ser-CH.alpha.,
Fmoc-CH.sub.2), 4.35-4.27 (m, 1H, Orn-CH.alpha.), 4.21 (dd, J=10.1,
8.7 Hz, 1H, Fmoc-CH.sub.2), 4.14 (t, J=8.3 Hz, 1H, Fmoc-CH),
3.76-3.68 (m, 1H, Ser-CH.sub.2.beta.), 3.52-3.46 (m, 1H,
Ser-CH.sub.2.beta.), 3.33-3.13 (m, 4H, 2.times.Orn-CH.sub.2.delta.,
2.times.Leu-NCH.sub.2.beta.), 1.89-1.80 (m, 1H,
Orn-CH.sub.2.beta.), 1.79-1.65 (m, 2H, Om-CH.sub.2.beta.,
Leu-CH.gamma.), 1.62-1.54 (m, 2H, Orn-CH.sub.2.gamma.), 1.02 (s,
9H, --CH.sub.2OC(CH.sub.3).sub.3), 0.83 (d, J=6.5 Hz, 3H,
Leu-CH.sub.3.delta.), 0.81 (d, J=6.5 Hz, 3H, Leu-CH.sub.3.delta.);
.sup.13C (CDCl.sub.3, 125 MHz): .delta. 171.8, 170.4, 159.7, 158.3,
156.6, 143.6, 141.2, 134.2, 133.4, 129.6, 129.5, 129.3, 127.8,
127.1, 126.9, 125.1, 120.0, 73.6, 67.3, 63.9, 62.1, 55.7, 55.2,
52.5, 47.0, 39.9, 29.7, 27.3, 27.0, 25.9, 20.0; HRMS (ES)
Calculated for C.sub.40H.sub.49ClN.sub.5O.sub.9 778.3224, found
778.3208 (M-H).sup.-.
N--((S)-5-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-10-((tert-butoxycarb-
onyl)
amino)-2-isobutyl-14,14-dimethyl-4,12-dioxo-13-oxa-2,3,9,11-tetraaza-
pentadec-10-enoyl)-0-(tert-butyl)-L-serine (45)
[0242] A solution of 44 (0.730 g, 0.94 mmol) in MeOH (50 mL) had
10% Pd/C (25 mg) added, and the suspension was stirred under an
atmosphere of hydrogen gas for 135 minutes. The reaction mixture
was filtered through a pad of Celite, concentrated in vacuo to
dryness, and resuspended in dry CH.sub.2C.sub.012 (30 mL) with
triethylamine (0.59 mL, 4.21 mmol) and
1,3-di-Boc-2-(trifluoromethylsulfonyl)guanidine (0.549 g, 1.40
mmol) for 30 h. Solvents were removed in vacuo and the
azatripeptide product was purified using flash chromatography
(silica gel, 90% EtOAc in hexanes, 0.1% AcOH), yielding white solid
45 (0.161 g, 20%). (R.sub.f 0.1 on SiO.sub.2, 1:4 hexanes:EtOAc,
0.1% AcOH); [.alpha.].sub.D.sup.26 2.3 (c 0.85 CHCl.sub.3); IR
(CHCl.sub.3 cast) 3326, 2978, 2934, 1722, 1644, 1531, 1368, 1331,
1136, 1054 cm.sup.-1; .sup.1H (CDCl.sub.3, 500 MHz): .delta. 8.94
(br s, 1H, C(O)NH--N), 8.46 (br s, 1H, Arg-NH.sub..epsilon.), 7.75
(d, J=7.6 Hz, 2H, Ar--H), 7.58 (d, J=7.6 Hz, 2H, Ar--H), 7.39 (t,
J=7.5 Hz, 2H, Ar--H), 7.30 (t, J=7.5 Hz, 2H, Ar--H), 6.16 (br s,
1H, Arg-NH.alpha.), 6.08 (s, 1H, Ser-NH), 4.49-4.40 (m, 3H,
Arg-CH.alpha., Ser-CH.alpha., Fmoc-CH.sub.2), 4.34-4.28 (m, 1H,
Fmoc-CH.sub.2), 4.18 (t, J=7.0 Hz, 1H, Fmoc-CH), 3.81-3.75 (m, 1H,
Ser-CH.sub.2.beta.), 3.61-3.49 (m, 1H, Ser-CH.sub.2.beta.),
3.49-3.24 (m, 4H, 2.times.Arg-CH.sub.2.delta.,
2.times.Leu-NCH.sub.2.beta.), 1.92-1.83 (m, 1H,
Arg-CH.sub.2.beta.), 1.81-1.60 (m, 4H, Arg-CH.sub.2.beta.,
2.times.Arg-CH.sub.2.gamma., Leu-CH.gamma.), 1.50 (s, 9H,
Arg-C(CH.sub.3).sub.3), 1.47 (s, 9H, Arg-C(CH.sub.3).sub.3), 1.12
(s, 9H, --CH.sub.2OC(CH.sub.3).sub.3), 0.91-0.85 (m, 6H,
2.times.Leu-CH.sub.3.delta.); .sup.13C (CDCl.sub.3, 125 MHz):
.delta. 171.1, 170.2, 163.3, 162.4, 157.7, 156.5, 153.2, 143.7,
141.3, 127.8, 127.1, 125.0, 120.0, 83.6, 79.9, 74.7, 67.3, 61.5,
55.8, 54.0, 53.1, 47.1, 40.4, 29.4, 28.3, 28.0, 27.3, 27.0, 25.5,
20.2, 20.1; HRMS (ES) Calculated for
C.sub.43H.sub.64N.sub.7O.sub.11 854.4658, found 854.4654
(M+H).sup.+. azaLeu5-pyr-1-apelin-13 A2 (18)
[0243] Advanced intermediate 7 (0.2 mmol) was subjected to manual
SPPS, introducing amino acids in the following order: 45,
Fmoc-Pro-OH, and Fmoc-Arg(Pmc)-OH. The resin was split into half,
and Fmoc-SPPS was continued on 0.1 mmol scale, coupling pyr-Glu-OH.
No endcapping was performed following addition of 45. A portion
(0.05 mmol) of resin-bound peptide was cleaved as previously
described and purified using a C.sub.18 RP-HPLC analytical column
(Method A), eluting at 13.3 min. The desired peptide was isolated
as a white solid after lyophilization (4.8 mg, 6%). Monoisotopic MW
calculated for C.sub.68H.sub.111BrN.sub.23O.sub.16 528.2582, found
high resolution (FTICR-ESI-MS) 528.2576 (M+3H).sup.3+.
azaLeu9-pyr-1-apelin-13 A2 (19)
[0244] The remaining 0.1 mmol carried over from the synthesis of 18
was coupled with Fmoc-Gln(Trt)-OH, Fmoc-Arg(Pmc)-OH,
Fmoc-Arg(Pmc)-OH, Fmoc-Phe-OH, and Fmoc-Lys(Boc)-OH. A portion
(0.05 mmol) of resin-bound peptide was cleaved as previously
described and purified using a C.sub.18 RP-HPLC analytical column
(Method A), eluting at 11.3 min. The desired peptide was isolated
as a white solid after lyophilization (4.4 mg, 4%). Monoisotopic MW
calculated for C.sub.95H.sub.160BrN.sub.35O.sub.20 547.5435, found
high resolution (FTICR-ESI-MS) 547.5420 (M+4H).sup.4+.
Example 8
In Vitro NEP Stability
[0245] This experiment compared the in vitro NEP stability of the
Arg/Leu peptides of the embodiments to native apelin isoforms and
their A2 substituted counterparts. Peptides were incubated with
recombinant human NEP (rhNEP, Sino Biological) at 37.degree. C. for
up to 72 h, and the extent of degradation was analyzed via LC-MS
because of the overlapping elution patterns of peptide fragments.
FIG. 9 demostrates in vitro NEP degradation trends for a)
pyr-1-apelin-13 peptides and b) apelin-17 peptides, comparing
native apelin isoforms (1, 2), ACE2-resistant peptides (4, 5) and
novel Arg/Leu substituted peptides 8-19. Native apelin isoforms (1,
2) and their respective A2 substituted peptides (4, 5) were
degraded by NEP at rates comparable to those previously reported.
(McKinnie, S. M. K., et al. ChemBioChem: 17, 1495-1498 (2016)).
Peptide 5 interestingly showed increased susceptibility to NEP
despite all synthetic modifications being at minimum 6 amino acids
(P6') away from the site of endoprotease cleavage. Distal amino
acid substitutions have been shown to modulate NEP proteolysis in
the breakdown of Ap and synthetic substrates (Almenoff, J. et al.,
Biochemistry: 22, 590-599 (1983)) and previous in vitro plasma
degradation experiments observed that C-terminal modifications to
apelin peptides markedly affected the presence of key peptide
fragments (Murza, A. et al., Biopolymers: 101, 297-303 (2014)).
When examining the impact of Arg/Leu-substitution, all peptides
8-19 showed dramatically improved proteolytic stability to NEP
compared to either native peptide (1, 2) or the corresponding A2
substituted peptides (4, 5). Overall, Arg/Leu-substituted apelin-17
A2 peptides showed an enhanced stability compared to the
pyr-1-apelin-13 A2 peptides. However, the proteolysis of these
peptides was not due to degradation at either location associated
with NEP endoprotease activity. Instead, peptides were slowly
degraded between Nle-Aib within the A2-modified C-terminus. NEP
does have significant carboxydipeptidase activity as exemplified in
the degradation of neurological enkephalin pentapeptides
(Nalivaeva, N. N. et al., Handbook of Proteolytic Enzymes: 3rd Edn,
Elsevier Ltd., 612-619 (2013)) and key amino acids have been
implicated in binding and orienting the C-terminus of the peptide
substrate to facilitate proteolysis. (Dion, N., et al., Biochem.
J.: 311, 623-627 (1995); Bateman Jr., R. C., et al., J. Biol.
Chem.: 264, 6151-6157 (1989); McMurray, J. J. et al., J. Med.: 371,
993-1004 (2014)). C-terminal dipeptide excision was not observed
with native isoforms 1-3, likely due to the unfavorable geometry of
proline in the P1' position. Pro to Aib substitution in the A2
peptide series was observed to enable an additional NEP in vitro
proteolytic site.
[0246] This experiment investigates the ability of synthetic
peptides 8-19 to inhibit the inherent proteolytic activity of NEP.
Following preincubation of NEP with equimolar concentrations of
8-19, degradation of 1 was nearly identical in either the presence
or absence of peptides, suggesting that in vitro proteolytic
activity is not significantly impacted.
Example 9
[0247] In Vitro Peptide Stability--Plasma
[0248] This experiment explored the in vitro plasma stability of
synthetic apelin peptides 8-19. Triplicate assessments were
performed in human blood plasma and analyzed by RP-HPLC (Table 3).
(Wang, W., et al., Hypertension: 68, 365-37 (2016)).
TABLE-US-00032 TABLE 3 pyr-1-apelin-13 peptides apelin-17 peptides
Arg-Leu % apelin % apelin % apelin % apelin modification peptide 30
min 60 min peptide 30 min 60 min none (native) 1 45 .+-. 8 12 .+-.
2 2 51 .+-. 17 39 .+-. 7 none (A2) 4 77 .+-. 19 65 .+-. 14 5 43
.+-. 1 35 .+-. 5 D-Leu 8 32 .+-. 2 22 .+-. 1 9 80 .+-. 3 80 .+-. 4
NMeLeu 10 77 .+-. 3 59 .+-. 6 11 49 .+-. 10 47 .+-. 7 .alpha.MeArg
12 +i 62 .+-. 6 13 61 .+-. 10 55 .+-. 4 .alpha.MeLeu 14 45 .+-. 6
38 .+-. 3 15 77 .+-. 4 48 .+-. 7 azaArg 16 83 .+-. 3 57 .+-. 1 17
96 .+-. 6 94 .+-. 3 azaLeu 18 19 .+-. 5 2 .+-. 1 19 82 .+-. 1 68
.+-. 4
[0249] Arg/Leu substitution had a varying impact on the different
apelin isoforms. With the exception of 11, apelin-17 A2 peptides
showed enhanced stability compared to native 2 or A2-substitued
peptide 5. Most notably, azaArg8 peptide 17 showed very little
degradation during the time course examined. In contrast, there was
a much greater range of in vitro stabilities when examining the
Arg/Leu substituted pyr-1-apelin-13 A2 peptides. Peptides
substituted at the Arg4 position (12, 16) or directly on the
susceptible amide bond (10) showed comparable stability to that of
4, while Leu5-modified peptides (8, 14, 18) showed enhanced
proteolysis compared to native 1 or A2-modified peptide 4. Based on
the previous kinetic studies (McKinnie, S. M. K., et al.,
ChemBioChem: 17, 1495-1498 (2016)) and combined in vitro NEP and
plasma pharmacokinetics, NEP proteolysis appears to be more
significant in the degradation of apelin-17 isoforms. However, the
enhanced in vitro stabilities of Arg/Leu-modified peptides to both
NEP and nonspecific plasma proteolysis were encouraging prior to
interrogating their individual physiological activities.
Example 10
Binding Affinity of Apelin Peptides
[0250] This experiment evaluated the ability of peptides of the
present embodiments to bind to the wild-type rat apelin receptor,
in order to examine the impact of synthetic modification within the
critical RPRL motif of the apelin peptides. Membrane preparations
from CHO cells stably expressing the wild-type rat apelin receptor
tagged at its C-terminus with EGFP were generated as previously
described (Gerbier, R, et al., FASEB J., 29, 314-322 (2015)) and
the affinities of native isoforms 1 and 2, parent peptides 4 and 5,
and Arg/Leu-peptides 8-19 were determined by their abilities to
displace [.sup.125I]-pyr-1-apelin-13 (0.2 nM). Native isoforms 1
and 2 inhibited specific binding to the wild-type rat apelin
receptor with inhibitory constant (Ki) values of 0.3 and 0.05 nM
respectively (Table 3).
TABLE-US-00033 TABLE 3 pyr-1-apelin-13 peptides apelin-17 peptides
Ara-Leu Affinity* Ki Affinity Ki modification peptide (nM) peptide
(nM) none (native) 1 0.3 .+-. 0.07 (4) 2 0.053 .+-. 0.009 (4) none
(A2) 4 2 .+-. 0.3 (3) 5 0.19 .+-. 0.025 (3) D-Leu 8 0.12 .+-. 0.035
(3) 9 0.14 .+-. 0.056 (3) NMeLeu 10 0.10 .+-. 0.048 (3) 11 0.45
.+-. 0.110 (3) .alpha. MeArg 12 0.56 .+-. 0.033 (3) 13 0.13 .+-.
0.032 (3) .alpha. MeLeu 14 0.17 .+-. 0.050 (3) 15 0.18 .+-. 0.079
(3) azaArg 16 1 .+-. 0.10 (3) 17 0.14 .+-. 0.009 (3) azaLeu 18 0.13
.+-. 0.063 (3) 19 0.15 .+-. 0.015 (3) *Affinity values are means
.+-. SE (n), with n representing the number of independent
experiments performed in duplicate.
[0251] Pyr-1-apelin-13 peptides 8, 10, 14, and 18 showed a modest
improvement in receptor binding, while parent peptide
pyr-1-apelin-13 A2 (4), azaArg4-pyr-1-apelin-13 A2 (16), and
.alpha.MeArg4-pyr-1-apelin-13 A2 (12) exhibited a slightly weaker
affinity compared to 1 (by a factor 6, 3, and 2 respectively). In
contrast, Arg/Leu substitution slightly reduced the binding
affinity of all apelin-17 peptides compared to native 2, exhibiting
Ki values in the subnanomolar range, about three times less potent.
However, these data showed no drastic effect on in vitro apelin
receptor binding, thus supporting the hypothesis that the selected
synthetic modifications within the RPRL motif of apelin were not
deleterious for receptor binding.
Example 11
Binding Physiological Experiments
[0252] Synthetic peptides 8-19 were tested for blood pressure
lowering abilities in anesthetized mice. Apelin peptides were
injected through the carotid artery, monitoring blood pressure (BP)
and heart rate (HR) over 60 minutes. Surprisingly, the potent
physiological effects of 4 were not observed with any of the
Arg/Leu-substituted pyr-1-apelin-13 A2 peptides (FIG. 10A).
Conservative substitutions such as epimerization (8) or
N-methylation (10) at the Leu5 position showed no ability to
decrease blood pressure in this assay. However, peptides (10, 14,
16) did have a significant and pronounced effect of increasing the
murine HR following injection. Tachycardia is directly correlated
with native apelin isoforms binding to the receptor (Cheng, X., et
al., European Journal of Pharmacology: 470, 171-175, 2003) and
suggests that these peptides, while not fully functional, still
have some inherent physiological activities.
[0253] This differential physiological activity was further
observed when investigating the impact of the same substitutions on
the apelin-17 A2 isoform. All Arg/Leu modifications, even those
inactive in the 13 A2 isoform, showed an ability to induce
tachycardia. Most significantly, three peptides (11, 17, 19) showed
potent hypotensive activity that rivaled or bested that of native 2
or A2 variant 5 (FIG. 10B). Peptides that retained activity
involved N-methyl Leu9 peptide 11 and both conformationally
flexible aza-peptides 17 and 19, suggesting that these synthetic
modifications in the apelin-17 framework were flexible or
conservative enough to induce full biological activity upon binding
to the apelin receptor.
Example 12
Ischemic Heart Disease
[0254] Peptides that showed hypotensive activity were further
examined for their abilities to prevent myocardial ischemic
reperfusion injury using the Langendorff protocol. Stable isolated
rat hearts were exposed to a 30-minute period of ischemia, then
reperfused with: saline (vehicle); native 2; vasoactive peptides
11, 17, 19; or inactive 18; in a post-conditioning protocol. The ex
vivo heart was assessed for a variety of parameters (heart rate
(HR); left ventricle developed pressure (LVDP); maximum derivative
of change in systolic pressure over time (max dP/dt); minimum
derivative of change in diastolic pressure over time (min dP/dt);
and rate-pressure product (RPP)) indicative of general heart
function and performance (FIG. 11).
[0255] Following Langendorff experiments, the potent hypotensive
apelin-17 A2 peptides 11, 17, and 19 showed an equivalent ability
to rescue the heart from ischemic reperfusion injury compared to
native isoform 2. In all assessed parameters, these peptides showed
full potency, with 17 behaving very analogously to 2, while 11 and
19 showed a slight improvement over the native isoform in max/min
dP/dt, LVDP and RPP. It was observed that the inactive
pyr-1-apelin-13 A2 peptide 18 behaved comparably to that of the
negative saline control.
[0256] Synthetic substitution of the site of NEP proteolysis gave
rise to three potent peptides (11, 17, and 19) with full beneficial
cardiovascular activities, sub-nanomolar receptor affinities, and
improved in vitro NEP and plasma stabilities. As well, these
peptides showed no ability to inhibit the inherent activity of NEP.
Further optimization of the two apelin-17 A2 azapeptide derivatives
(17, 19) due to their improved pharmacokinetics is encouraging in
the pursuit of an apelin peptide with practical therapeutic
applicability. This study additionally provides insight into the
limited tolerance to modification within the `RPRL` motif, and
further supports its significant role in the apelinergic system.
Most notably, any Arg/Leu modification abolished full agonistic
activity within the pyr-1-apelin-13 A2 scaffold. Even conservative
substitutions employed such as epimerization, N- or a-methylations,
or a-carbon replacement with nitrogen failed to retain full
physiological activity despite having comparable in vitro apelin
receptor binding. The fact that some of the Arg/Leu modifications
show potency in the apelin-17 A2 series suggests that the longer
N-terminal extension is capable of facilitating the appropriate
receptor interactions and internalization necessary to induce full
physiological activity.
[0257] The inactivity of both D-Leu substituted peptides 8 and 9
was particularly surprising because of literature precedent that
D-Leu pyr-1-apelin-13 retained acceptable abilities to bind
(.about.10-fold decrease in affinity) and inhibit forskolin-induced
cAMP accumulation.29 Epimerization within or adjacent to an
inducible structural element such as a .beta.-turn would likely be
detrimental to activity. However, a recent apelin-17 peptide (P92)
with full agonistic activity has been reported with multiple
epimerizations, including two flanking both the N-(D-Gln) and
C-(D-Leu) termini of the "RPRL" region. Gerbier, et. al.,
"Development of original metabolically-stable apelin-17 analogs
with diuretic and cardiovascular effects," FASEB J., 2017, 31,
687-700. This peptide has additional substitutions that make direct
comparison with our peptides difficult, but it is encouraging to
know that physiological activity and stability can be enhanced
through epimerizations.
[0258] Select pyr-1-apelin-13 A2 (10, 14, 16) and apelin-17 A2 (9,
13, 15) peptides had an impact on the heart rate of mice following
perfusion without inducing any vasoactive effects. This may be
rationalized through the biased agonism of these peptides for
G-protein pathways instead of being internalized. It is known that
p-arrestin recruitment and internalization initiates vasodilation
and additional cardioprotective effects of apelin, and the
C-terminal phenylalanine of apelin plays a critical role in this
process.
Example 13
In Vitro Protease Experiments
Neprilysin Degradation Assays
[0259] Apelin peptides were dissolved in Milli-Q water (1 mM).
Recombinant human neprilysin (rhNEP, Sino Biological) was
reconstituted in Tris buffer (100 mM Tris, 100 mM NaCl, 10 .mu.M
ZnCl.sub.2, pH 7.5). To initiate the assay, rhNEP was diluted in
Tris buffer (3.1 nM final concentration), and preincubated at
37.degree. C. for 10 minutes prior to the addition of 5 .mu.L of
apelin peptide (1 mM) and 1.5 .mu.L internal standard
dansyl-Tyr-Val-Gly-OH (1 mM). Aliquots (10 .mu.L) were removed at
0, 1, 4, 24, and 72 h, quenched with 0.1 M EDTA (10 .mu.L), diluted
to 100 .mu.L with Milli-Q water and analyzed by LC-MS. Assays were
performed in triplicate (n=3) for each time point. Integrated peak
areas of the parent apelin peptide and internal standard derived
from LC-MS analyses, were extracted using Mass Hunter software
(version B.04.00) and compared in positive extracted ion count
modus (+EIC, extracted-ion chromatogram). The extent of proteolysis
was compared in positive extracted ion count modus (+EIC). The
extent of proteolysis was apelin peptide to the internal dansyl-YVG
standard (apelin:dansyl-YVG), to the same ratio at the different
assay time points. The decrease in apelin:dansyl-YVG ratio was
converted to a percentage of cleaved peptide over time.
Neprilysin Inhibition Assays
[0260] A solution of rhNEP (3.1 nM in 100 mM Tris, 100 mM 1118
NaCl, 10 .mu.M ZnCl.sub.2, pH 7.5) was preincubated with 5 .mu.L of
apelin peptide (1 mM) and 1.5 .mu.L internal standard
dansyl-Tyr-ValGly-OH (1 mM, dansyl-YVG-OH, Sigma-Aldrich) at
37.degree. C. for 10 min prior to the addition of 5 .mu.L
pyr-1-apelin-13 (1 mM). Aliquots (10 .mu.L) were removed at 0, 1,
4, 24, and 72 h, and quenched and analyzed as previously described.
Assays were performed in duplicate (n=2) for each time point.
[0261] Isolation and Quantification of Apelin Peptides from
Plasma
[0262] 20 .mu.L of plasma was portioned into microfuge tubes and
pre-warmed to 37.degree. C. 5 .mu.L of apelin peptide (400 .mu.M)
was added and incubated at 37.degree. C. for varying lengths of
time. Experiments were quenched by the addition of 20 .mu.L of 10%
aqueous TFA. 5 .mu.L of internal standard (1 mM
dansyl-Tyr-Val-Gly-OH) was added and experiments were diluted up to
100 .mu.L with 0.1% aqueous TFA. These assays were loaded onto a
pre-equilibrated C.sub.18 spin column (Harvard Apparatus), which
had previously been wet with 2.times.300 .mu.L 50% acetonitrile in
0.1% aqueous TFA and 2.times.300 .mu.L 0.1% aqueous TFA
respectively, centrifuging at 300.times.g for 2 minutes between
each 300 .mu.L aliquot. Quenched plasma assays were centrifuged at
300.times.g until the sample was loaded. The resultant filtrate was
reloaded onto the column along with 100 .mu.L 0.1% aqueous TFA and
centrifuged at 300.times.g two additional times. The desired plasma
peptides were washed by the addition of 2.times.300 .mu.L 0.1%
aqueous TFA and centrifuged at 300.times.g for 2 min, discarding
the filtrate after each wash. Desired peptides were eluted by the
addition of 300 .mu.L of 40% acetonitrile (human plasma) in 0.1%
aqueous TFA and centrifugation at 300.times.g for 2 minutes. Eluted
samples were diluted with 0.1% aqueous trifluoroacetic acid prior
to analysis by C18 RP-HPLC. To analyze the remaining percentage of
apelin peptides in plasma, incubations. of pyr-1-apelin-13 or
apelin-17 in plasma were immediately quenched, worked up and
analyzed by C18RP-HPLC as previously described, and the ratio of
apelin peptide to internal standard was calculated based on the
area under the peaks. This 0 minute incubation ratio was used to
compare the apelin peptide:internal standard ratios for the time
experiments.
Radioligand Binding Experiments
[0263] Membrane preparations from CHO cells stably expressing the
wild-type rat apelin receptor-EGFP were prepared as previously
described (Gerbier et al., New Structural Insights Into The Apelin
Receptor: Identification Of Key Residues For Apelin binding; FASEB
J. 2015, 29, 314-322; Iturrioz et. al., Development Of Original
Metabolically-Stable Apelin-17 Peptides With Diuretic And
Cardiovascular Effects; FASEB J. 2017, 31, 687-700.) Crude membrane
preparations (1 .mu.g total mass of membranes/assay) were incubated
for 3 h at 20.degree. C. with 0.2 nM [.sup.125I]-pyr-1-apelin-13
(monoiodinated on Lys.sup.8 with Bolton-Hunter reagent, Perkin
Elmer, Wellesley, Mass., USA) in binding buffer (50 mM HEPES, 5 mM
MgCl2 1149 pH 7.5, BSA 1%) alone or in presence of the different
compounds at various concentrations. The reaction was stopped by
adding 4 mL of cold binding buffer, filtered on Whatman GF/C
filters and washed with 5 mL of cold binding buffer. Radioactivity
was then counted using a Wizard 1470 Wallac gamma counter (Perkin
Elmer, Turku, Finland). Binding experiment data were analyzed with
GraphPad Prism.
Blood Pressure Assays
[0264] Mice were anaesthetized with 1.5% isoflurane/oxygen, and
body temperature was monitored and maintained at 36.degree. C. by a
heating pad. The aorta was cannulated via the right carotid artery
using a PV loop catheter (Model 1.2F from Scisense, Transonic) in
order to continuously record arterial blood pressure and heart rate
(LabScribe 2.0, Scisense). Peptides 1, 2, 4, 5, 8-19 (1.4 .mu.M/kg
body weight) or the same volume of saline were injected via the
right jugular vein. Results are reported as systolic blood pressure
(SBP), diastolic blood pressure (DBP), mean arterial blood pressure
(MABP) and heart rate (HR).
Langendorff Isolated Heart Technique
[0265] Langendorff heart perfusion and ischemia-reperfusion injury
were prepared and cardiac function was measured. Mice were
heparinized and anaesthetized with 1.5-2% isoflurane inhalation.
The heart was excised, mounted on a Langendorff system, and
perfused at a consistent pressure of 80 mmHg with modified
Krebs-Henseleit solution (116 mM NaCl, 3.2 mM KCl, 2.0 mM
CaCl.sub.2, 1.2 mM MgSO.sub.4, 25 mM NaHCO.sub.3, 1.2 mM
KH.sub.2PO.sub.4, 11 mM glucose, 0.5 mM EDTA and 2 mM pyruvate),
which was kept at 37.degree. C. and continuously oxygenated with
95% 02 and 5% CO.sub.2 which maintained the perfusion buffer at pH
7.4. After stabilization and 10 min baseline recording, global
ischemia was induced for 30 min followed by 40 min of reperfusion.
Apelin 17 (2) or apelin peptides (11, 17, 18, or 19) were given at
the start of reperfusion for 10 min at a concentration of 1 .mu.M.
Left ventricular functions were obtained continuously by PowerLab
system (ADInstruments, Australia). Data was reported as mean value
of every 5 min. Left ventricular functions were reported as: Left
Ventricular Developed Pressure (LVDP); Heart rate (HR); maximum
derivative of change in systolic pressure over time (max dP/dt);
minimum derivative of change in diastolic pressure over time (min
dP/dt); and Rate Pressure Product (RPP).
Example 14
Elucidation of KLKB1
[0266] Isolation and Quantification of Apelin-17A2 (5) from
Plasma.
[0267] 20 .mu.L of plasma was portioned into microfuge tubes and
prewarmed to 37.degree. C. 5 .mu.L of apelin peptide (400 .mu.M)
was added and incubated at 37.degree. C. for varying lengths of
time. Experiments were quenched by the addition of 20 .mu.L of 10%
aqueous TFA. 5 .mu.L of internal standard (1 mM
dansyl-Tyr-Val-Gly-OH) was added, and experiments were diluted up
to 100 .mu.L with 0.1% aqueous TFA. These assays were loaded onto a
preequilibrated Harvard C.sub.18-spin column (250 uL), which had
previously been wet with 2.times.300 .mu.L of 50% acetonitrile in
0.1% aqueous TFA and 2.times.300 .mu.L of 0.1% aqueous TFA
respectively, centrifuging at 300 g for 2 min between each 300
.mu.L aliquot. Quenched plasma assays were centrifuged at 300 g
until the sample was loaded. The resultant filtrate was reloaded
onto the column along with 100 .mu.L of 0.1% aqueous TFA and
centrifuged at 300 g two additional times. The desired plasma
peptide was washed by the addition of 2.times.300 .mu.L of 0.1%
aqueous TFA and centrifuged at 300 g for 2 min, discarding the
filtrate after each wash. The desired peptide were eluted by the
addition of 300 .mu.L of 40% acetonitrile (human plasma) in 0.1%
aqueous TFA and centrifugation at 300 g for 2 min. Eluted samples
were diluted with 0.1% aqueous trifluoroacetic acid prior to
analysis by C.sub.18-RP-HPLC. To analyze the remaining percentage
of 5 in plasma, incubations of 5 in plasma were immediately
quenched, worked up, and analyzed by C.sub.18 RP-HPLC, and the
ratio of apelin peptide to internal standard was calculated based
on the area under the peaks. This 0 min incubation ratio was used
to compare the apelin peptide/internal standard ratios for the time
experiments. FIG. 13 shows the breakdown-fragments (1-3 and 4-17)
after plasma incubation of apelin-17A2 (compound 5).
Example 15
[0268] The kinetic parameters for the KLKB1 cleavage was determined
by monitoring the decrease of parent peptide upon incubation of
recombinant human KLKB1 (rhKLKB1) with native apelin-17 (2) as well
as ACE2 and NEP-stabilized apelin A2 peptides 5 and 11, according
to the Neprilysin Qualitative Cleavage Assays and Plasma Kallikrein
KLKB1 Qualitative Cleavage Assays described herein.
[0269] Table 4 shows the kinetic parameters for NEP and KLKB1
cleavage of cardiovascular active peptides.
TABLE-US-00034 TABLE 4 Substrate Enzyme K.sub.m (.mu.M) k.sub.cat
(1/S) k.sub.cat/K.sub.m (1/MS) 2 NEP 190 .+-. 40 3.4 .+-. 0.3 (1.8
.+-. 0.4) .times. 10.sup.4 2 KLKB1 97 .+-. 21 13.7 .+-. 1.3 (1.4
.+-. 0.3) .times. 10.sup.5 5 KLKB1 30 .+-. 4 1.4 .+-. 0.2 (4.7 .+-.
0.8) .times. 10.sup.4 11 KLKB1 245 .+-. 75 16.5 .+-. 2.1 (6.7 .+-.
1.0) .times. 10.sup.4 Kininogen* KLKB1 0.75 0.031 4.1 .times.
10.sup.4 Factor XII* KLKB1 2.4 0.001 4.2 .times. 10.sup.2 *Data
obtained from Gozzo, A. J. et.al.; "Heparin modulation of human
plasma kallikrein on different substrates and inhibitors;" Biol.
Chem. 2006, 387, 1129-1138.
[0270] The KLKB1 cleavage kinetics are similar to those of
neprilysin (NEP), which cleaves within the critical `RPRL`-motif,
thereby inactivating apelin. KLKB1 processes apelin-17 (2) and
peptides 5 and 11 with moderate efficiency
(k.sub.cat/K.sub.m.about.10.sup.5), comparable to other
cardiovascular active peptide substrates. As the potent peptide 11,
which is resistant to ACE2 and neprilysin, is degraded quickly,
this stimulated an endeavor to explore a stabilization strategy
closer to the Arg3-Arg4 cleavage site.
Example 16
Synthesis of Apelin-14A2 (54)
[0271] Resin bound BrF was subjected to manual SPPS, introducing
amino acids in the following order: Fmoc-Aib-OH, Fmoc-Nle-OH,
Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Lys(Boc)-OH, Fmoc-His(Trt)-OH,
Fmoc-Ser(t-Bu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Pro-OH,
Fmoc-Arg(Pbf)-OH, Fmoc-Glu(Trt)-OH, Fmoc-Arg(Pbf)-OH). A portion
(0.05 mmol) of resin-bound peptide was cleaved as previously
described and purified using a C18 RP-HPLC analytical column
(method A), eluting at 14.4 min. The desired peptide was isolated
as a white solid after lyophilization (9.0 mg, 11%). Monoisotopic
MW (MALDI-TOF) calculated for C.sub.75H.sub.124BrN.sub.27O.sub.17
1753.9, found [M+H].sup.+ 1753.6.
Example 17
Synthesis of Apelin-NMe14A2 (55)
[0272] Resin bound BrF was subjected to manual SPPS, introducing
amino acids in the following order: Fmoc-Aib-OH, Fmoc-Nle-OH,
Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Lys(Boc)-OH, Fmoc-His(Trt)-OH,
Fmoc-Ser(t-Bu)-OH, Fmoc-Arg(Boc.sub.2)-NMeLeu-OH,.sup.12
Fmoc-Pro-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(Trt)-OH, Fmoc-Arg(Pbf)-OH).
A portion (0.05 mmol) of resin-bound peptide was cleaved as
previously described and purified using a C18 RP-HPLC analytical
column (method A), eluting at 14.7 min. The desired peptide was
isolated as a white solid after lyophilization (7.5 mg, 9%).
Monoisotopic MW (MALDI-TOF) calculated for
C.sub.76H.sub.127BrN.sub.27O.sub.17 1768.9, found [M+H].sup.+
1768.7.
Example 18
Synthesis of PALM-17A2 (56)
[0273] Compound 54 was extended by SPPS, introducing amino acids in
the following order: Fmoc-Arg(Pbf)-OH, Fmoc-Phe-OH,
Fmoc-Lys(Boc)-OH, palmitic acid. A portion (0.05 mmol) of
resin-bound peptide was cleaved as previously described and
purified using a BiPhe RP-HPLC analytical column (method A),
eluting at 25.8 min. The desired peptide was isolated as a white
solid after lyophilization (5.0 mg, 8%). Monoisotopic MW
(MALDI-TOF) calculated for C.sub.112H.sub.188BrN.sub.34O.sub.21
2424.4, found [M+H].sup.+ 2423.9.
Example 19
Synthesis of PEG-17A2 (57)
[0274] Compound 54 was extended by SPPS, introducing amino acids in
the following order: Fmoc-Arg(Pbf)-OH, Fmoc-Phe-OH,
Fmoc-Lys(Boc)-OH, Fmoc-(PEG).sub.6 propionic acid. A portion (0.05
mmol) of resin-bound peptide was cleaved as previously described
and purified using a BiPhe RP-HPLC analytical column (method A),
eluting at 25.6 min. The desired peptide was isolated as a white
solid after lyophilization (6.5 mg, 9%). Monoisotopic MW
(MALDI-TOF) calculated for C.sub.126H.sub.197BrN.sub.35O.sub.29
2743.4, found [M+H].sup.+ 2743.2.
Example 20
Synthesis of PALM-NMe17A2 (58)
[0275] Compound 55 was extended by SPPS, introducing amino acids in
the following order: Fmoc-Arg(Pbf)-OH, Fmoc-Phe-OH,
Fmoc-Lys(Boc)-OH, palmitic acid. A portion (0.05 mmol) of
resin-bound peptide was cleaved as previously described and
purified using a BiPhe RP-HPLC analytical column (method A),
eluting at 17.2 min. The desired peptide was isolated as a white
solid after lyophilization (5.5 mg, 7%). Monoisotopic MW
(MALDI-TOF) calculated for C.sub.113H.sub.190BrN.sub.34O.sub.21
2438.4, found 2438.0.
Example 21
Synthesis of PEG-NMe17A2 (59)
[0276] Compound 55 was extended by SPPS, introducing amino acids in
the following order: Fmoc-Arg(Pbf)-OH, Fmoc-Phe-OH,
Fmoc-Lys(Boc)-OH, Fmoc-(PEG).sub.6 propionic acid. A portion (0.05
mmol) of resin-bound peptide was cleaved as previously described
and puri-fied using a BiPhe RP-HPLC analytical column (method A),
eluting at 17.1 min. The desired peptide was isolated as a white
solid after lyophilization (6.5 mg, 8%). Monoisotopic MW
(MALDI-TOF) calculated for C.sub.127H.sub.199BrN.sub.35O.sub.29
2757.4, found 2757.4.
Example 22
In Vitro Stability Tests
[0277] The in vitro KLKB1 and NEP stability of the PALM/PEG
peptides 56-59 was compared to native apelin-17 (2), the A2
substituted peptide 5 and the NEP-resistant peptide 11. Peptides
56-59 were incubated with KLKB1 (rhKLKB1, Novoprotein) or
recombinant human NEP (rhNEP, Sino Biological) at 37.degree. C. for
up to 72 h.
[0278] Plasma Kallikrein KLKB1 Qualitative Cleavage Assays
[0279] Native apelin-17 (2) and apelin peptides 5, 56, 57, 58 and
59 were dissolved in Milli-Q water (1 mM). Human plasma kallikrein
KLKB1 were each reconstituted in Tris buffer (100 mM TrisHCl, 10 mM
CaCl2, 150 mM NaCl) and diluted with Tris buffer (50 mM TrisHCl,
250 mM NaCl) to give a KLKB1 concentration of 2 ng/.mu.L. The KLKB1
enzyme was then preincubated at 37.degree. C. for 10 minutes prior
to the addition of 5 .mu.L of apelin peptide (1 mM). Aliquots (1
.mu.L) were taken at 1, 2, 4, 6, 12, 24, 36, and 48 hours and
analyzed with MALDI-TOF mass spectrometry to qualitatively
determine the time point at which degradation products could be
observed (Table 4).
[0280] Neprilysin Qualitative Cleavage Assays
[0281] Native apelin-17 (2) and apelin peptides 5, 54, 56, 57, 58
and 59 were dissolved in Milli-Q water (1 mM). Recombinant Human
Neprilysin (rhNEP, Sino Biological) was reconstituted in Tris
buffer (100 mM Tris, 100 mM NaCl, 10 mM ZnCl.sub.2, pH 7.5). To
initiate the assays, rhNEP was diluted in Tris buffer to a 2
ng/.mu.L final concentration, and pre-incubated at 37.degree. C.
for 10 minutes prior to the addition of 5 .mu.L of apelin peptide
(1 mM). Aliquots (1 .mu.L) were taken at 1, 2, 4, 6, 12, 24, 36,
and 48 hours and analyzed with MALDI-TOF mass spectrometry to
qualitatively determine the time point at which degradation
products could be observed. Table 5 shows the timepoints at which
degradation products of apelin peptides could first be observed
through MALDI-TOF after incubation with KLKB1 and Neprilysin.
TABLE-US-00035 TABLE 5 Degradation Degradation Onset Onset
Timepoint Timepoint Peptide Modification with NEP with KLKB1 2
Apelin-17 <30 min <30 min 5 Apelin-17A2 <1 hr <30 min
54 Apelin-14A2 >36 hr -- 56 PALM-17A2 1 hr 1 hr 57 PEG-17A2 12
hr 1 hr 58 PALM-NMe17A2 >36 hr 2 hr 59 PEG-NMe17A2 >36 hr 2
hr
Quantitative Degradation Assays (Kinetics)
[0282] The extent of degradation was analyzed via LC-MS because of
the overlapping elution patterns of peptide fragments (NEP).
[0283] Native apelin-17 (2) and apelin peptides 5, 54, 56, 57, 58
and 59 were dissolved in Milli-Q water (1 mM). Recombinant human
neprilysin (rhNEP, Sino Biological) was reconstituted in Tris
buffer (100 mM Tris, 100 mM NaCl, 10 .mu.M ZnCl.sub.2, pH 7.5). To
initiate the assay, rhNEP was diluted in Tris buffer (3.1 nM final
concentration) and preincubated at 37.degree. C. for 10 min prior
to the addition of 5 .mu.L of apelin peptide (1 mM) and 1.5 .mu.L
of internal standard dansyl-Tyr-Val-Gly-OH (1 mM). Aliquots (10
.mu.L) were removed at 0, 1, 4, 24, and 72 h, quenched with 0.1 M
EDTA (10 .mu.L), diluted to 100 .mu.L with Milli-Q water, and
analyzed by LC-MS. Assays were performed in triplicate (n=3) for
each time point. Integrated peak areas of the parent apelin peptide
and internal standard derived from LC-MS analyses were extracted
using Mass Hunter software (version B.04.00) and compared in
positive extracted ion count modus (+EIC). The extent of
proteolysis was determined by comparing the initial (0 h) ratio of
the integrated extracted ions of the parent apelin peptide to the
internal dansyl-YVG standard (apelin/dansyl-YVG) to the same ratio
at the different assay time points. The decrease in
apelin/dansyl-YVG ratio was converted to a percentage of cleaved
peptide over time.
Ca2+ Mobilization Assay
[0284] To study the extent to which the newly derived peptides
trigger APJ-receptor activation, a fluorescence coupled calcium
release assay including a recombinant human APJ-Gal 6 receptor cell
line was used.
[0285] Chem-5-APJ cells (Millipore, USA) were seeded (30 000
cells/well) into Nunclon Delta Surface 96-well, clear-bottom
microtitre plates (Thermo Scientific, Denmark) 24 hours prior to
assay. Cells were loaded for 1 hour with FLIPR Calcium 6-QF
fluorescent indicator dye (Molecular Devices, USA) in assay buffer
[Hanks balanced salt solution (HBSS), 20 mM HEPES, 0.2% DMSO, 2.5
mM probenecid, pH 7.6], washed three times with assay buffer, then
returned to the incubator for 10 min before assay on a fluorimetric
imaging plate reader (FLIPR; Molecular Devices, Sunnyvale, Calif.,
USA). Maximum change in fluorescence over baseline was used to
determine agonist response. Dose-response curve data were fitted to
a four-parameter logistic equation using PRISM (GraphPad, USA) from
which pEC50 values were calculated. FIGS. 14A-G show the
concentration response curves of apelin peptides. Table 6 shows the
peptide half-life and receptor activation of studied Apelin
peptides.
TABLE-US-00036 TABLE 6 t.sub.1/2 t.sub.1/2 t.sub.1/2 (rhNEP,
(rhKLBB1, (hplasma, EC.sub.50 Apelin Modification h) h) h) (nM) 2
Apelin-17 0.4 0.4 0.02 N.D. 5 Apelin-17A2 1.0 0.7 0.3 4.0 .+-. 0.2
11 NMeLeu-17A2 >30 0.9 1.2 N.D. 54 Apelin-14A2 -- -- -- 568 .+-.
34 55 NMeLeu14A2 -- -- -- 176 .+-. 21 56 PALM-17A2 1.5 1.0 4.5 2.6
.+-. 0.2 57 PEG-17A2 >30 1.4 18 6.3 .+-. 0.4 58 NMeLeu- >30
2.1 20.5 11.3 .+-. 2.1 PALM17A2 59 NMeLeu- >30 2.9 27 2.5 .+-.
0.2 PEG17A2
[0286] Compounds 56-59 feature EC50 values in the low nanomolar
range comparable to the N-terminally free apelin-17A2 peptide
(i.e., compound 5). Unlike palmitoylation within the apelin peptide
sequence, which can be detrimental for receptor binding (Juhl, et
al., "Development of potent and metabolically stable APJ ligands
with high therapeutic potential;" ChemMedChem 2016, 11,
2378-2384.), N-terminal extension by a palmitoyl or PEG chain seems
not to affect receptor binding and internalization. Surprisingly,
the 14-mer left after the KLKB1 cut (i.e., compound 54 and 55),
seems to be rather inactive featuring a 200-times higher EC50 than
the 17-mers.
Example 23
Physiological Test-Blood Pressure Assays
[0287] Apelin peptides 11, 56-59 as well as the KLKB1-cleavage
fragments 54 and 55 were tested for blood pressure lowering
abilities in anesthetized mice.
[0288] Mice were anesthetized with 1.5% isoflurane/oxygen, and body
temperature was monitored and maintained at 36.degree. C. by a
heating pad. The aorta was cannulated via the right carotid artery
using a PV loop catheter (model 1.2F from Scisense, Transonic) in
order to continuously record arterial blood pressure and heart rate
(LabScribe 2.0, Scisense). Compounds 11, and 54-59 or 55-59 (1.4
.mu.M/kg body weight) or the same volume of saline was injected via
the right jugular vein. Results are reported as systolic blood
pressure (SBP), diastolic blood pressure (DBP), mean arterial blood
pressure (MABP), and heart rate (HR) shown in FIGS. 15A-D.
[0289] Apelin peptides were delivered systemically via the right
internal jugular vein while blood pressure (BP) and heart rate (HR)
were continuously monitored in the aorta cannulated via the right
carotid artery. All N-terminally extended apelin peptides, except
58, show pronounced and time-stable blood pressure lowering effects
(FIGS. 15a-d). Among the synthesized peptides 56-59, peptide 58
triggers also the lowest Ca.sup.2+ mobilization (Table 5).
Interestingly, the heart rate increasing effect is restored in this
peptide 58, suggesting alternative activation pathways. In this
regard, peptides 56, 57 and 59 are more potent than apelin-17 (2)
and apelin-17A2 (5). Importantly, both PEGylated peptides 57 and 59
show the most stable and potent effect. In contrast, both the
fragments left after KLKB1 cleavage (peptides 54 and 55) are
inactive or nearly so in their cardio-physiological effects (FIGS.
16A-B). This correlates with the results obtained from the
Ca.sup.2+ mobilization assay.
[0290] Human plasma kallikrein (KLKB1) has been identified as human
protease that cleaves apelin-17 relatively quickly between
Arg3-Arg4. The resulting C-terminal 14-mer appears to be poor with
regard to Ca.sup.2+ mobilization (APJ receptor activation capacity)
and is lacking beneficial cardio-physiological effects. Hence KLKB1
degradation inactivates apelin 17. N-terminally extension by a
palmitoyl or PEG6 chain yields apelin peptides that are more
cleavage resistant towards both KLKB1 and NEP proteases and have
prolonged plasma half-life. Combined with their potent and
prolonged blood pressure lowering effect, these new apelin peptides
present a promising new target for the development of
cardiovascular active peptide drugs. Further physiological studies
and other synthetic stabilization approaches are currently underway
to obtain a better understanding of the impact of this new cleavage
site for the design of novel drug targets.
Example 24
Cardiac Allograft Vasculopathy
[0291] B6 male hearts were transplanted heterotopically into male
or female B6 of the recipient mice, starting 2 weeks after
transplant. Synthesized apelin peptide (Apelin-NMe17A2) (11), was
given by daily intraperitoneal injection (3 mg/kg/d) for 4 weeks.
Female mice raise immune response against the male HY antigen,
injure the coronary arteries of the transplanted heart based on
Verhoeff-Van Gieson staining (FIG. 17) leading to progressive
expansion of the arterial intima occluding the arterial lumen (FIG.
18). Treatment with apelin peptide mitigates arteriopathy vs
saline-treated carrier controls (a-b). *p<0.05 compared with
carrier/placebo group. n=6; M=male; F=female. The results
demonstrate that treatment with apelin peptides of the present
invention may protect against transplant arteriopathy.
[0292] C57BL/6J mice were purchased from Jackson Laboratories. The
C57BL/6 mice subjected to surgery were 11-14 weeks old. All animal
experiments were carried out according to the Canadian Council on
Animal Care Guidelines. Animal protocols were approved by the
Animal Care and Use Committee at the University of Alberta. Hearts
from 12-14 weeks male wild-type (WT) donors were transplanted
heterotopically to the abdomen of the female WT recipients. The
inferior and superior vena cavae, and the pulmonary veins of the
donor heart were ligated. Then the donor aorta and pulmonary artery
were anastomosed to the recipient's abdominal aorta and inferior
vena cava, below the renal arteries. Cardiac allograft vasculopathy
(CAV) was induced due to the presence of HY-minor
histocompatibility antigen-directed, cell-mediated allo-immune
response against the male donor hearts. The heart grafts were
harvested six weeks after transplantation. Intima area, endothelial
loss in medium to large-sized arteries, inflammatory cellular
infiltration, microvasculature density and tip cell markers using
Immunohistochemistry and qPCR were characterized.
Example 25
Apelin Peptide Prevents Angiotensin II-Induced Aortic Abdominal
Aneurysm
[0293] Experimental Animals and Protocols. Male LDL receptor
deficient (Ldlr.sup.-/-) mice were generated and bred in C57BL/6
background. All animal experiments were carried out in accordance
with the Canadian Council on Animal Care Guidelines, and animal
protocols were reviewed and approved by the Animal Care and Use
Committee at the University of Alberta.
[0294] Angiotensin II (Ang II) and Phenylephrine (PE) Infusion In
Vivo.
[0295] Alzet micro-osmotic pump (model 1002 or 1004; Durect Co.)
was implanted subcutaneously at the dorsum of the neck to infuse
Ang II (1.5 mg/kg.sup.-1d.sup.-1) or vehicle (saline) for 28 days
in high fat fed Ldlr.sup.-/- mice.
[0296] Histological Analyses, Terminal Deoxynucleotidyl Transferase
dUTP Nick End Labeling (TUNEL) and Immunofluorescence Staining.
[0297] After 4 weeks of Ang II or saline infusion, mice underwent
whole body perfuse-fixation, via the left ventricle, with 10%
buffered formalin (80 mmHg, 20 min). Third order mesenteric
arteries were dissected out carefully without being forced or over
stretched, preserved in 10% buffered formalin for 48 hours and
embedded in paraffin. Aortas were dissected, imaged for gross
morphological assessment, then fixed in formalin and
paraffin-embedded. Five micrometer thick formalin fixed paraffin
embedded (FFPE) sections of aortas and mesenteric arteries were
stained for Movat's pentachrome and Gomori Trichrome to evaluate
morphological alternations. Collagen positive area was quantified
by the morphometric analysis using the Metamorph Basic (version
7.7.0.0) software. In situ DNA fragmentation was detected in
5-.mu.m thick FFPE sections of aorta using the commercially
available terminal deoxynucleotidyl transferase-mediated dUTP
nick-end labeling (TUNEL) assay kit according to manufacturer's
instructions (Invitrogen) as previously described. Five-micrometer
thick FFPE sections were also used for the immunofluorescence
staining for ACE2, calponin and apelin. Thickness of the medial
layer of the aorta was measured in calibrated images as the mean
distance between the external elastin lamella and the internal
elastin lamella from 8 randomly selected fields of the
cross-section of an aorta using the Metamorph Basic software
(version 7.7.0). Calponin positive cells in the aorta were
quantified to estimate the VSMC density.
[0298] Dihydroethidium (DHE) Staining and Nicotinamide Adenine
Dinucleotide Phosphate (NADPH) Oxidase Activity Assay.
[0299] For DHE and NADPH staining, fresh aortas were collected
(without perfuse-fixation) and preserved in OCT at -80.degree. C.
Nicotinamide adenine dinucleotide phosphate (NADPH) oxidase
activity in human or mice primary aortic VSMCs was quantified by
lucigenin enhanced chemiluminescence using a single-tube
luminometer (Berthold FB12, Berthold Technologies, Germany)
modified to maintain the sample temperature at 37.degree. C. as
previously described. Briefly, after three times of wash in
ice-cold phosphate buffered saline (PBS) with protease and, VSMCs
or OCT-embedded aorta sections were lysed with RIPA buffer
containing protease and phosphatase inhibitor cocktails. NADPH (1
mM) and Lucigenin (50 .mu.M) were added to 100 .mu.g of protein
extracts in the presence or absence of diphenylene iodonium (DPI;
10 .mu.M), a selective inhibitor of flavin-containing enzymes
including NADPH Oxidase. Light emission was measured every 1 second
during a 5-minute period using a single-tube luminometer (Berthold
FB12, Berthold Technologies, Germany) at 37.degree. C. The emission
over a 3-minute period was averaged for each sample.
[0300] Dihydroethidium (DHE) staining was performed on aortic SMCs
and OCT-embedded aorta sections and visualized under fluorescence
microscope (Olympus IX81). For SMCs, after 1 hour of incubation
with or without Ang II (1 .mu.M), cells were incubated with DHE (20
.mu.M DHE, final concentration in culture media; Sigma Aldrich) at
37.degree. C. for 30 minutes in dark. Fluorescence images were
subsequently captured with a fluorescence microscope (IX81,
Olympus) after washing with PBS. Quantitative measurements of DHE
fluorescence intensity were carried out using Metamorph Basic
(version 7.7.0.0), regions congruent to the cell nuclei boundaries
were drawn, the average pixel intensities were calculated and
corrected by subtracting the background, and reported here as DHE
fluorescence.
[0301] Ultrasonic Vasculography.
[0302] Ultrasonic images of the aortas were obtained in mice
anesthetized with 1.5% isoflurane using a Vevo 2100 high
resolution-imaging system equipped with a real time
microvisualization scan head (RMV 704, Visual Sonics, Toronto,
Canada). The aortic diameters were measured by M-mode at thoracic
aorta, aortic arch and abdominal aorta. The maximum aortic lumen
diameter (corresponding to cardiac systole) and the minimum aortic
lumen diameter (corresponding to cardiac diastole) recordings were
measured and used to calculate the aortic expansion index
[(systolic aortic diameter-diastolic aortic diameter)/systolic
diameterx 100].
[0303] Western Blot Analysis.
[0304] Protein was extracted from aorta using RIPA lysis buffer
containing protease and phosphatase inhibitor cocktails, and
quantified using the BCA Protein Array Kit (Pierce, Rockford,
Ill.). Equal amounts of protein extracts were loaded and separated
by SDS-PAGE gel and then transferred to polyvinylidene fluoride
(PVDF) membranes. The membranes were blocked for 1 hour at room
temperature with 5% skim milk in TBST, and then incubated with
primary antibodies overnight at 4.degree. C., followed by
HRP-linked secondary antibodies. The probed proteins were detected
with Amersham ECL Prime detection reagent and visualized with
ImageQuant LAS 4000 Mini Biomolecular Imager (GE Healthcare,
Baie-d'Urfe, QC, Canada). The expression levels of target proteins
were quantified by densitometry using the equipped software. Equal
loading of protein was confirmed by staining the membrane with
Pierce.TM. Reversible Protein Stain Kit for PVDF Membranes
(ThermoFisher Scientific, USA).
[0305] Apelin Peptide and Aortic Aneurysm.
[0306] Male Ldlr.sup.-/- mice (Jackson Lab) received high fat diet
(Envigo TD.88137) at 8 weeks of age and throughout the study. One
week after initiating high fat diet, osmotic pumps (Model 1004,
Alzet) were implanted subcutaneously to deliver Angiotensin II
(Sigma-Aldrich) at a rate of 1.5 mg/kg/d for 28 days. Synthesized
apelin peptide 11 was given by daily intraperitoneal injection (3
mg/kg/d) for 28 days.
[0307] The data is shown in FIGS. 19-25. As shown in these Figures,
NEP-resistant apelin peptide 11 (Apelin-NMe17A2) markedly prevented
the formation of abdominal aortic aneurysm suggesting that apelin
peptides represents a new class of drugs for this condition which
currently has no current medical therapy.
Sequence CWU 1 SEQUENCE LISTING <160> NUMBER OF SEQ ID
NOS: 54 <210> SEQ ID NO 1 <211> LENGTH: 12 <212>
TYPE: PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE:
1 Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro Phe 1 5 10
<210> SEQ ID NO 2 <211> LENGTH: 17 <212> TYPE:
PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE: 2 Lys
Phe Arg Arg Gln Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro 1 5 10
15 Phe <210> SEQ ID NO 3 <211> LENGTH: 36 <212>
TYPE: PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE:
3 Leu Val Gln Pro Arg Gly Ser Arg Asn Gly Pro Gly Pro Trp Gln Gly 1
5 10 15 Gly Arg Arg Lys Phe Arg Arg Gln Arg Pro Arg Leu Ser His Lys
Gly 20 25 30 Pro Met Pro Phe 35 <210> SEQ ID NO 4 <211>
LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Xaa is p-Glu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 4 Xaa Arg Pro Arg Leu Ser His Lys
Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ ID NO 5 <211>
LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (15)..(15) <223> OTHER
INFORMATION: Xaa is Norleucine <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(17)..(17) <223> OTHER INFORMATION: Xaa is paraBrPhe
<400> SEQUENCE: 5 Lys Phe Arg Arg Gln Arg Pro Arg Leu Ser His
Lys Gly Pro Xaa Xaa 1 5 10 15 Xaa <210> SEQ ID NO 6
<211> LENGTH: 77 <212> TYPE: PRT <213> ORGANISM:
Homo sapiens <400> SEQUENCE: 6 Met Asn Leu Arg Leu Cys Val
Gln Ala Leu Leu Leu Leu Trp Leu Ser 1 5 10 15 Leu Thr Ala Val Cys
Gly Gly Ser Leu Met Pro Leu Pro Asp Gly Asn 20 25 30 Gly Leu Glu
Asp Gly Asn Val Arg His Leu Val Gln Pro Arg Gly Ser 35 40 45 Arg
Asn Gly Pro Gly Pro Trp Gln Gly Gly Arg Arg Lys Phe Arg Arg 50 55
60 Gln Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro Phe 65 70 75
<210> SEQ ID NO 7 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE: 7 Gln
Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro Phe 1 5 10 <210>
SEQ ID NO 8 <400> SEQUENCE: 8 000 <210> SEQ ID NO 9
<400> SEQUENCE: 9 000 <210> SEQ ID NO 10 <211>
LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Xaa is pGlu <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (4)..(4) <223> OTHER
INFORMATION: Xaa is NMeArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 10 Xaa Arg Pro Xaa Leu Ser His Lys
Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ ID NO 11 <211>
LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is NMeLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (15)..(15) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 11 Lys Phe Arg Arg Gln Arg Pro Arg
Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10 15 Xaa <210> SEQ ID NO
12 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is D-Leu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 12 Arg
Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 13 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is NMeLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid <400>
SEQUENCE: 13 Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10
<210> SEQ ID NO 14 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(3)..(3) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 14 Arg
Pro Xaa Arg Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 15 <211> LENGTH: 12 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(4)..(4) <223> OTHER INFORMATION: Xaa is azaArg <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 15 Arg
Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 16 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (3)..(3)
<223> OTHER INFORMATION: Xaa is azaArg <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 16 Arg
Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 17 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is azaLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 17 Arg
Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 18 <211> LENGTH: 9 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is D-Leu <400> SEQUENCE:
18 Arg Pro Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 19
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is NMeLeu <400> SEQUENCE: 19 Arg Pro
Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 20
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (3)..(3) <223>
OTHER INFORMATION: Xaa is alphaMeArg <400> SEQUENCE: 20 Arg
Pro Xaa Leu Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 21
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is alphaMeLeu <400> SEQUENCE: 21 Arg
Pro Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 22
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (3)..(3) <223>
OTHER INFORMATION: Xaa is azaArg <400> SEQUENCE: 22 Arg Pro
Xaa Leu Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 23
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is azaLeu <400> SEQUENCE: 23 Arg Pro
Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 24
<211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1) <223>
OTHER INFORMATION: Xaa is pGlu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (5)..(5) <223>
OTHER INFORMATION: Xaa is D-Leu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 24 Xaa Arg Pro Arg Xaa Ser His Lys
Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ ID NO 25 <211>
LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is D-Leu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (15)..(15) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 25 Lys Phe Arg Arg Gln Arg Pro Arg
Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10 15 Xaa <210> SEQ ID NO
26 <211> LENGTH: 13 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is pGlu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (5)..(5)
<223> OTHER INFORMATION: Xaa is NMeLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(12)..(12) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 26 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 27 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is NMeLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(15)..(15) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 27 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 28 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (4)..(4) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 28 Xaa
Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 29 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(8)..(8) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 29 Lys
Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 30 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa is alphaMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 30 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 31 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is alphaMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 31 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 32 <211> LENGTH: 17 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (8)..(8) <223> OTHER INFORMATION: Xaa is azaArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 32 Lys
Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 33 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa is azaLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 33 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 34 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is azaLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(15)..(15) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 34 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 35 <211> LENGTH: 14 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (14)..(14) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 35 Arg
Gln Arg Pro Arg Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10
<210> SEQ ID NO 36 <211> LENGTH: 14 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(6)..(6) <223> OTHER INFORMATION: Xaa is NMeLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(12)..(12) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (14)..(14) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 36 Arg
Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10
<210> SEQ ID NO 37 <211> LENGTH: 18 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(1)..(1) <223> OTHER INFORMATION: Xaa is Palmitoylation
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 37 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Leu Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 38 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (16)..(16) <223> OTHER
INFORMATION: Xaa is Norleucine <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(18)..(18) <223> OTHER INFORMATION: Xaa is paraBrPhe
<400> SEQUENCE: 38 Xaa Lys Phe Arg Arg Gln Arg Pro Arg Leu
Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ ID NO 39
<211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1) <223>
OTHER INFORMATION: Xaa is Palmitoylation <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is NMeLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 39 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 40 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is NMeLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 40 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 41 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Palmitoylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is D-Leu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 41 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 42 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Palmitoylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is alphaMeArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 42 Xaa Lys Phe Arg Arg Gln Arg Pro
Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 43 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Palmitoylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is alphaMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 43 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 44 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Palmitoylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is azaArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 44 Xaa Lys Phe Arg Arg Gln Arg Pro
Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 45 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Palmitoylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is azaLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 45 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 46 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is D-Leu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 46 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 47 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Pegylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 47 Xaa
Lys Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 48 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is alphaMeLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 48 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 49 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Pegylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is azaArg <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 49 Xaa
Lys Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 50 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is azaLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 50 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 51 <211> LENGTH: 13 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is pGlu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is azaArg <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(12)..(12) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 51 Xaa
Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 52 <211> LENGTH: 13 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Peptidomimetic <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is pGlu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (2)..(2)
<223> OTHER INFORMATION: Xaa is Arg or a conservative variant
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (3)..(3) <223> OTHER INFORMATION: Xaa is Pro or a
conservative variant thereof <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is any amino acid or a conservative variant
thereof from the group consisting of Arg, Arg-D, alphaMeArg and
azaArg <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa
is any amino acid or a conservative variant thereof from the group
consisting of Leu, NMeLeu, alphaMeLeu and azaLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 52 Xaa
Xaa Xaa Xaa Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 53 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Peptidomimetic <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (6)..(6)
<223> OTHER INFORMATION: Xaa is Arg or a conservative variant
thereof <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (7)..(7) <223> OTHER INFORMATION: Xaa
is Pro or a conservative variant thereof <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (8)..(8)
<223> OTHER INFORMATION: Xaa is any amino acid or a
conservative variant thereof from the group consisting of Arg,
Arg-D, alphaMeArg and azaArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (9)..(9) <223>
OTHER INFORMATION: Xaa is any amino acid or a conservative variant
thereof from the group consisting of Leu, NMeLeu, alphaMeLeu and
azaLeu <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa
is Norleucine <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (16)..(16) <223> OTHER
INFORMATION: Xaa is alpha-aminoisobutryic acid <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is paraBrPhe <400>
SEQUENCE: 53 Lys Phe Arg Arg Gln Xaa Xaa Xaa Xaa Ser His Lys Gly
Pro Xaa Xaa 1 5 10 15 Xaa <210> SEQ ID NO 54 <211>
LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Peptidomimetic <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Xaa is H or a long chain moiety <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (7)..(7)
<223> OTHER INFORMATION: Xaa is Arg or a conservative variant
thereof <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (8)..(8) <223> OTHER INFORMATION: Xaa
Pro or a conservative variant thereof <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (9)..(9)
<223> OTHER INFORMATION: Xaa is any amino acid or a
conservative variant thereof from the group consisting of Arg,
Arg-D, alphaMeArg and azaArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10) <223>
OTHER INFORMATION: Xaa is any amino acid or a conservative variant
thereof from the group consisting of Leu, NMeLeu, alphaMeLeu and
azaLeu <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is Norleucine <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (17)..(17) <223> OTHER
INFORMATION: Xaa is alpha-aminoisobutryic acid <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18)
<223> OTHER INFORMATION: Xaa is paraBrPhe <400>
SEQUENCE: 54 Xaa Lys Phe Arg Arg Gln Xaa Xaa Xaa Xaa Ser His Lys
Gly Pro Xaa 1 5 10 15 Xaa Xaa
1 SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 54 <210>
SEQ ID NO 1 <211> LENGTH: 12 <212> TYPE: PRT
<213> ORGANISM: Homo sapiens <400> SEQUENCE: 1 Arg Pro
Arg Leu Ser His Lys Gly Pro Met Pro Phe 1 5 10 <210> SEQ ID
NO 2 <211> LENGTH: 17 <212> TYPE: PRT <213>
ORGANISM: Homo sapiens <400> SEQUENCE: 2 Lys Phe Arg Arg Gln
Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro 1 5 10 15 Phe
<210> SEQ ID NO 3 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE: 3 Leu
Val Gln Pro Arg Gly Ser Arg Asn Gly Pro Gly Pro Trp Gln Gly 1 5 10
15 Gly Arg Arg Lys Phe Arg Arg Gln Arg Pro Arg Leu Ser His Lys Gly
20 25 30 Pro Met Pro Phe 35 <210> SEQ ID NO 4 <211>
LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Xaa is p-Glu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 4 Xaa Arg Pro Arg Leu Ser His Lys
Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ ID NO 5 <211>
LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (15)..(15) <223> OTHER
INFORMATION: Xaa is Norleucine <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(17)..(17) <223> OTHER INFORMATION: Xaa is paraBrPhe
<400> SEQUENCE: 5 Lys Phe Arg Arg Gln Arg Pro Arg Leu Ser His
Lys Gly Pro Xaa Xaa 1 5 10 15 Xaa <210> SEQ ID NO 6
<211> LENGTH: 77 <212> TYPE: PRT <213> ORGANISM:
Homo sapiens <400> SEQUENCE: 6 Met Asn Leu Arg Leu Cys Val
Gln Ala Leu Leu Leu Leu Trp Leu Ser 1 5 10 15 Leu Thr Ala Val Cys
Gly Gly Ser Leu Met Pro Leu Pro Asp Gly Asn 20 25 30 Gly Leu Glu
Asp Gly Asn Val Arg His Leu Val Gln Pro Arg Gly Ser 35 40 45 Arg
Asn Gly Pro Gly Pro Trp Gln Gly Gly Arg Arg Lys Phe Arg Arg 50 55
60 Gln Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro Phe 65 70 75
<210> SEQ ID NO 7 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE: 7 Gln
Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro Phe 1 5 10 <210>
SEQ ID NO 8 <400> SEQUENCE: 8 000 <210> SEQ ID NO 9
<400> SEQUENCE: 9 000 <210> SEQ ID NO 10 <211>
LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Xaa is pGlu <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (4)..(4) <223> OTHER
INFORMATION: Xaa is NMeArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 10 Xaa Arg Pro Xaa Leu Ser His Lys
Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ ID NO 11 <211>
LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is NMeLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (15)..(15) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 11 Lys Phe Arg Arg Gln Arg Pro Arg
Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10 15 Xaa <210> SEQ ID NO
12 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is D-Leu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 12 Arg
Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 13 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (4)..(4) <223> OTHER INFORMATION: Xaa is NMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (10)..(10) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid <400>
SEQUENCE: 13 Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10
<210> SEQ ID NO 14 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(3)..(3) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 14 Arg
Pro Xaa Arg Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 15 <211> LENGTH: 12 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(4)..(4) <223> OTHER INFORMATION: Xaa is azaArg <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 15 Arg
Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 16 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (3)..(3)
<223> OTHER INFORMATION: Xaa is azaArg <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 16 Arg
Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 17 <211> LENGTH: 12 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is azaLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 17 Arg
Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 18 <211> LENGTH: 9 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4)
<223> OTHER INFORMATION: Xaa is D-Leu <400> SEQUENCE:
18 Arg Pro Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 19
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is NMeLeu <400> SEQUENCE: 19 Arg Pro
Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 20
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (3)..(3) <223>
OTHER INFORMATION: Xaa is alphaMeArg <400> SEQUENCE: 20 Arg
Pro Xaa Leu Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 21
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is alphaMeLeu <400> SEQUENCE: 21 Arg
Pro Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 22
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (3)..(3) <223>
OTHER INFORMATION: Xaa is azaArg <400> SEQUENCE: 22 Arg Pro
Xaa Leu Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 23
<211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (4)..(4) <223>
OTHER INFORMATION: Xaa is azaLeu <400> SEQUENCE: 23 Arg Pro
Arg Xaa Ser His Lys Gly Pro 1 5 <210> SEQ ID NO 24
<211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1) <223>
OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa is D-Leu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 24 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 25 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is D-Leu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(15)..(15) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 25 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 26 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa is NMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 26 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 27 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is NMeLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(15)..(15) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 27 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 28 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (4)..(4) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 28 Xaa
Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 29 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(8)..(8) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 29 Lys
Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 30 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa is alphaMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 30 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 31 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is alphaMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 31 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 32 <211> LENGTH: 17 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(8)..(8) <223> OTHER INFORMATION: Xaa is azaArg <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(15)..(15) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 32 Lys
Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 33 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is pGlu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (5)..(5) <223> OTHER INFORMATION: Xaa is azaLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 33 Xaa
Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10 <210>
SEQ ID NO 34 <211> LENGTH: 17 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is azaLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(15)..(15) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 34 Lys
Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa 1 5 10
15 Xaa <210> SEQ ID NO 35 <211> LENGTH: 14 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (12)..(12) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (14)..(14) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 35 Arg
Gln Arg Pro Arg Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10
<210> SEQ ID NO 36 <211> LENGTH: 14 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(6)..(6) <223> OTHER INFORMATION: Xaa is NMeLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(12)..(12) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (13)..(13) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (14)..(14) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 36 Arg
Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1 5 10
<210> SEQ ID NO 37 <211> LENGTH: 18 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Synthetic peptide <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(1)..(1) <223> OTHER INFORMATION: Xaa is Palmitoylation
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 37 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Leu Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 38 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (16)..(16) <223> OTHER
INFORMATION: Xaa is Norleucine <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17) <223>
OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(18)..(18) <223> OTHER INFORMATION: Xaa is paraBrPhe
<400> SEQUENCE: 38 Xaa Lys Phe Arg Arg Gln Arg Pro Arg Leu
Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ ID NO 39
<211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Synthetic peptide <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1) <223>
OTHER INFORMATION: Xaa is Palmitoylation <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Xaa is NMeLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 39 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 40 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (10)..(10) <223> OTHER INFORMATION: Xaa is NMeLeu
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 40 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 41 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Palmitoylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is D-Leu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 41 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 42 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Palmitoylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is alphaMeArg
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa is
Norleucine <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa
is alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 42 Xaa
Lys Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 43 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Palmitoylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is alphaMeLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 43 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 44 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Palmitoylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(9)..(9) <223> OTHER INFORMATION: Xaa is azaArg <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 44 Xaa
Lys Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 45 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Palmitoylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (10)..(10) <223> OTHER
INFORMATION: Xaa is azaLeu <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 45 Xaa Lys Phe Arg Arg Gln Arg Pro
Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 46 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Pegylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is D-Leu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 46 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 47 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is alphaMeArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE
<222> LOCATION: (16)..(16) <223> OTHER INFORMATION: Xaa
is Norleucine <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (17)..(17) <223> OTHER
INFORMATION: Xaa is alpha-aminoisobutryic acid <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18)
<223> OTHER INFORMATION: Xaa is paraBrPhe <400>
SEQUENCE: 47 Xaa Lys Phe Arg Arg Gln Arg Pro Xaa Leu Ser His Lys
Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ ID NO 48 <211>
LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Xaa is Pegylation <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (10)..(10) <223>
OTHER INFORMATION: Xaa is alphaMeLeu <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16)
<223> OTHER INFORMATION: Xaa is Norleucine <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 48 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 49 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is Pegylation <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (9)..(9) <223> OTHER
INFORMATION: Xaa is azaArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (16)..(16) <223>
OTHER INFORMATION: Xaa is Norleucine <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is alpha-aminoisobutryic acid
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Xaa is
paraBrPhe <400> SEQUENCE: 49 Xaa Lys Phe Arg Arg Gln Arg Pro
Xaa Leu Ser His Lys Gly Pro Xaa 1 5 10 15 Xaa Xaa <210> SEQ
ID NO 50 <211> LENGTH: 18 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Xaa is Pegylation <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(10)..(10) <223> OTHER INFORMATION: Xaa is azaLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 50 Xaa
Lys Phe Arg Arg Gln Arg Pro Arg Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa <210> SEQ ID NO 51 <211> LENGTH: 13
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa
is pGlu <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (4)..(4) <223> OTHER INFORMATION: Xaa
is azaArg <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa
is Norleucine <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (12)..(12) <223> OTHER
INFORMATION: Xaa is alpha-aminoisobutryic acid <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13)
<223> OTHER INFORMATION: Xaa is paraBrPhe <400>
SEQUENCE: 51 Xaa Arg Pro Xaa Leu Ser His Lys Gly Pro Xaa Xaa Xaa 1
5 10 <210> SEQ ID NO 52 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Peptidomimetic <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(1)..(1) <223> OTHER INFORMATION: Xaa is pGlu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(2)..(2) <223> OTHER INFORMATION: Xaa is Arg or a
conservative variant <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Xaa is Pro or a conservative variant thereof
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (4)..(4) <223> OTHER INFORMATION: Xaa is any amino
acid or a conservative variant thereof from the group consisting of
Arg, Arg-D, alphaMeArg and azaArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (5)..(5) <223>
OTHER INFORMATION: Xaa is any amino acid or a conservative variant
thereof from the group consisting of Leu, NMeLeu, alphaMeLeu and
azaLeu <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Xaa
is Norleucine <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (12)..(12) <223> OTHER
INFORMATION: Xaa is alpha-aminoisobutryic acid <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (13)..(13)
<223> OTHER INFORMATION: Xaa is paraBrPhe <400>
SEQUENCE: 52 Xaa Xaa Xaa Xaa Xaa Ser His Lys Gly Pro Xaa Xaa Xaa 1
5 10 <210> SEQ ID NO 53 <211> LENGTH: 17 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Peptidomimetic <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(6)..(6) <223> OTHER INFORMATION: Xaa is Arg or a
conservative variant thereof <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (7)..(7) <223>
OTHER INFORMATION: Xaa is Pro or a conservative variant thereof
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (8)..(8) <223> OTHER INFORMATION: Xaa is any amino
acid or a conservative variant thereof from the group consisting of
Arg, Arg-D, alphaMeArg and azaArg <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (9)..(9) <223>
OTHER INFORMATION: Xaa is any amino acid or a conservative variant
thereof from the group consisting of Leu, NMeLeu, alphaMeLeu and
azaLeu <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (15)..(15) <223> OTHER INFORMATION: Xaa
is Norleucine <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (16)..(16) <223> OTHER
INFORMATION: Xaa is alpha-aminoisobutryic acid <220> FEATURE:
<221> NAME/KEY: MISC_FEATURE <222> LOCATION: (17)..(17)
<223> OTHER INFORMATION: Xaa is paraBrPhe <400>
SEQUENCE: 53 Lys Phe Arg Arg Gln Xaa Xaa Xaa Xaa Ser His Lys Gly
Pro Xaa Xaa
1 5 10 15 Xaa <210> SEQ ID NO 54 <211> LENGTH: 18
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Peptidomimetic
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (1)..(1) <223> OTHER INFORMATION: Xaa is H or a
long chain moiety <220> FEATURE: <221> NAME/KEY:
MISC_FEATURE <222> LOCATION: (7)..(7) <223> OTHER
INFORMATION: Xaa is Arg or a conservative variant thereof
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (8)..(8) <223> OTHER INFORMATION: Xaa Pro or a
conservative variant thereof <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (9)..(9) <223>
OTHER INFORMATION: Xaa is any amino acid or a conservative variant
thereof from the group consisting of Arg, Arg-D, alphaMeArg and
azaArg <220> FEATURE: <221> NAME/KEY: MISC_FEATURE
<222> LOCATION: (10)..(10) <223> OTHER INFORMATION: Xaa
is any amino acid or a conservative variant thereof from the group
consisting of Leu, NMeLeu, alphaMeLeu and azaLeu <220>
FEATURE: <221> NAME/KEY: MISC_FEATURE <222> LOCATION:
(16)..(16) <223> OTHER INFORMATION: Xaa is Norleucine
<220> FEATURE: <221> NAME/KEY: MISC_FEATURE <222>
LOCATION: (17)..(17) <223> OTHER INFORMATION: Xaa is
alpha-aminoisobutryic acid <220> FEATURE: <221>
NAME/KEY: MISC_FEATURE <222> LOCATION: (18)..(18) <223>
OTHER INFORMATION: Xaa is paraBrPhe <400> SEQUENCE: 54 Xaa
Lys Phe Arg Arg Gln Xaa Xaa Xaa Xaa Ser His Lys Gly Pro Xaa 1 5 10
15 Xaa Xaa
* * * * *