U.S. patent application number 16/702996 was filed with the patent office on 2020-06-25 for bispecific antibodies against cd3 and cd20.
The applicant listed for this patent is GENMAB A/S. Invention is credited to Isil ALTINTAS, Esther BREIJ, Patrick ENGELBERTS, Paul PARREN, Rik RADEMAKER, David SATIJN, Janine SCHUURMAN, Edward VAN DEN BRINK, Riemke VAN DIJKHUIZEN RADERSMA, Sandra VERPLOEGEN.
Application Number | 20200199231 16/702996 |
Document ID | / |
Family ID | 56355550 |
Filed Date | 2020-06-25 |
![](/patent/app/20200199231/US20200199231A1-20200625-D00000.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00001.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00002.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00003.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00004.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00005.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00006.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00007.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00008.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00009.png)
![](/patent/app/20200199231/US20200199231A1-20200625-D00010.png)
View All Diagrams
United States Patent
Application |
20200199231 |
Kind Code |
A1 |
ENGELBERTS; Patrick ; et
al. |
June 25, 2020 |
BISPECIFIC ANTIBODIES AGAINST CD3 AND CD20
Abstract
Bispecific antibodies directed to CD3 and CD20 and uses of such
bispecific antibodies, in particular use thereof in the treatment
of diseases in which specific targeting and T cell-mediated killing
of cells that express CD20 is desired.
Inventors: |
ENGELBERTS; Patrick;
(Utrecht, NL) ; BREIJ; Esther; (Utrecht, NL)
; RADEMAKER; Rik; (Utrecht, NL) ; ALTINTAS;
Isil; (Utrecht, NL) ; SATIJN; David; (Utrecht,
NL) ; VERPLOEGEN; Sandra; (Utrecht, NL) ; VAN
DIJKHUIZEN RADERSMA; Riemke; (Utrecht, NL) ; VAN DEN
BRINK; Edward; (Utrecht, NL) ; SCHUURMAN; Janine;
(Utrecht, NL) ; PARREN; Paul; (Odijk, NL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
GENMAB A/S |
Copenhagen V |
|
DK |
|
|
Family ID: |
56355550 |
Appl. No.: |
16/702996 |
Filed: |
December 4, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15541594 |
Jul 5, 2017 |
10544220 |
|
|
PCT/EP2016/050296 |
Jan 8, 2016 |
|
|
|
16702996 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 16/2887 20130101;
C07K 2317/31 20130101; C07K 2317/21 20130101; C07K 2317/73
20130101; A61P 35/00 20180101; C07K 16/2809 20130101; C07K 2317/94
20130101; C07K 2317/92 20130101; A61K 39/39558 20130101; C07K
2317/567 20130101; C07K 2317/24 20130101; C07K 2317/75 20130101;
C07K 2317/90 20130101; A61K 2039/505 20130101; A61P 35/02 20180101;
C07K 16/30 20130101; C07K 2317/732 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 39/395 20060101 A61K039/395; C07K 16/30 20060101
C07K016/30 |
Foreign Application Data
Date |
Code |
Application Number |
Jan 8, 2015 |
EP |
PCT/EP2015/050276 |
Jul 15, 2015 |
DK |
PA201500412 |
Jul 15, 2015 |
DK |
PA201500413 |
Jul 16, 2015 |
DK |
PA201500415 |
Jul 16, 2015 |
DK |
PA201500416 |
Claims
1-71. (canceled)
72. A method of treating cancer comprising administering to a
subject in need thereof a therapeutically effective amount of a
bispecific antibody comprising: (a) a first binding arm comprising
a first antigen-binding region which binds to CD3e and comprises a
variable heavy chain (VH) region comprising the amino acid sequence
set forth in SEQ ID NO: 6 and a variable light chain (VL) region
comprising the amino acid sequence set forth in SEQ ID NO: 10, and
(b) a second binding arm comprising a second antigen-binding region
which binds to human CD20 and comprises VH CDR1, VH CDR2, and VH
CDR3 regions comprising the amino acid sequences set forth in SEQ
ID NOs: 32, 33, and 34, respectively, and VL CDR1, VL CDR2, and VL
CDR3 regions comprising the amino acid sequences set forth in SEQ
ID NO: 35, the sequence DAS, and SEQ ID NO: 36, respectively.
73. The method of claim 72, wherein the bispecific antibody
comprises a first heavy chain and a second heavy chain and a first
light chain and a second light chain, wherein said first heavy
chain and said second heavy chain comprise at least a hinge region,
a CH2 and CH3 region, wherein in said first heavy chain at least
one of the amino acids in the positions corresponding to a position
selected from the group consisting of T366, L368, K370, D399, F405,
Y407, and K409 in a human IgG1 heavy chain has been substituted,
and in said second heavy chain at least one of the amino acids in
the positions corresponding to a position selected from the group
consisting of T366, L368, K370, D399, F405, Y407, and K409 in a
human IgG1 heavy chain has been substituted, wherein said first
heavy chain and said second heavy chain are not substituted in the
same position, and wherein the positions are numbered according to
the EU Index.
74. The method of claim 73, wherein (i) the amino acid in the
position corresponding to F405 in a human IgG1 heavy chain is L in
said first heavy chain, and the amino acid in the position
corresponding to K409 in a human IgG1 heavy chain is R in said
second heavy chain, or (ii) the amino acid in the position
corresponding to K409 in a human IgG1 heavy chain is R in said
first heavy chain, and the amino acid in the position corresponding
to F405 in a human IgG1 heavy chain is L in said second heavy
chain.
75. The method of claim 72, wherein the bispecific antibody
comprises a first heavy chain and a second heavy chain and a first
light chain and a second light chain, wherein the positions
corresponding to positions L234, L235, and D265 in a human IgG1
heavy chain of both said first heavy chain and said second heavy
chain are F, E, and A, respectively, wherein the positions are
numbered according to the EU Index.
76. The method of claim 72, wherein the bispecific antibody
comprises a first heavy chain and a second heavy chain and a first
light chain and a second light chain, wherein the positions
corresponding to positions L234, L235, and D265 in a human IgG1
heavy chain of both said first heavy chain and said second heavy
chain are F, E, and A, respectively, wherein the position
corresponding to F405 in a human IgG1 heavy chain of said first
heavy chain is L, and the position corresponding to K409 in a human
IgG1 heavy chain of said second heavy chain is R, and wherein the
positions are numbered according to the EU Index.
77. The method of claim 72, wherein the bispecific antibody is a
full-length IgG1, kappa antibody.
78. The method of claim 72, wherein the cancer is a mature B cell
neoplasm.
79. The method of claim 78, wherein the mature B cell neoplasm is
selected from the group consisting of: B cell chronic lymphocytic
leukemia, small lymphocytic lymphoma, B cell prolymphocytic
leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma,
follicular lymphoma, cutaneous follicle center lymphoma, marginal
zone lymphoma, hairy cell leukemia, diffuse large B cell lymphoma,
Burkitt's lymphoma, plasmacytoma, plasma cell myeloma,
post-transplant lymphoproliferative disorder, Waldenstrom's
macroglobulinemia, malignant melanoma, and anaplastic large-cell
lymphoma.
80. The method of claim 72, wherein the cancer is diffuse large
B-cell lymphoma.
81. The method of claim 72, wherein the cancer is follicular
lymphoma.
82. The method of claim 72, wherein the method comprises further
administering one or more therapeutic agents.
83. A method of treating cancer comprising administering to a
subject in need thereof a therapeutically effective amount of a
bispecific antibody comprising: (a) a first binding arm comprising
a first antigen-binding region which binds to CD3e, wherein said
first antigen-binding region comprises a variable heavy chain (VH)
region comprising the sequence set forth in SEQ ID NO: 6 and a
variable light chain (VL) region comprising the sequence set forth
in SEQ ID NO: 10, and (b) a second binding arm comprising a second
antigen-binding region which binds to human CD20 and comprises a VH
region comprising the amino acid sequence set forth in SEQ ID NO:
27 and a VL region comprising the sequence set forth in SEQ ID NO:
28.
84. The method of claim 83, wherein the bispecific antibody
comprises a first heavy chain and a second heavy chain and a first
light chain and a second light chain, wherein said first heavy
chain and said second heavy chain comprise at least a hinge region,
a CH2 and CH3 region, wherein in said first heavy chain at least
one of the amino acids in the positions corresponding to a position
selected from the group consisting of T366, L368, K370, D399, F405,
Y407, and K409 in a human IgG1 heavy chain has been substituted,
and in said second heavy chain at least one of the amino acids in
the positions corresponding to a position selected from the group
consisting of T366, L368, K370, D399, F405, Y407, and K409 in a
human IgG1 heavy chain has been substituted, wherein said first
heavy chain and said second heavy chain are not substituted in the
same position, and wherein the positions are numbered according to
the EU Index.
85. The method of claim 84, wherein (i) the amino acid in the
position corresponding to F405 in a human IgG1 heavy chain is L in
said first heavy chain, and the amino acid in the position
corresponding to K409 in a human IgG1 heavy chain is R in said
second heavy chain, or (ii) the amino acid in the position
corresponding to K409 in a human IgG1 heavy chain is R in said
first heavy chain, and the amino acid in the position corresponding
to F405 in a human IgG1 heavy chain is L in said second heavy
chain.
86. The method of claim 83, wherein the bispecific antibody
comprises a first heavy chain and a second heavy chain and a first
light chain and a second light chain, wherein the positions
corresponding to positions L234, L235, and D265 in a human IgG1
heavy chain of both said first heavy chain and said second heavy
chain are F, E, and A, respectively, wherein the positions are
numbered according to the EU Index.
87. The method of claim 83, wherein the bispecific antibody
comprises a first heavy chain and a second heavy chain and a first
light chain and a second light chain, wherein the positions
corresponding to positions L234, L235, and D265 in a human IgG1
heavy chain of both said first heavy chain and said second heavy
chain are F, E, and A, respectively, wherein the position
corresponding to F405 in a human IgG1 heavy chain of said first
heavy chain is L, and the position corresponding to K409 in a human
IgG1 heavy chain of said second heavy chain is R, and wherein the
positions are numbered according to the EU Index.
88. The method of claim 83, wherein the bispecific antibody is a
full-length IgG1, kappa antibody.
89. The method of claim 83, wherein the cancer is a mature B cell
neoplasm.
90. The method of claim 89, wherein the mature B cell neoplasm is
selected from the group consisting of: B cell chronic lymphocytic
leukemia, small lymphocytic lymphoma, B cell prolymphocytic
leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma,
follicular lymphoma, cutaneous follicle center lymphoma, marginal
zone lymphoma, hairy cell leukemia, diffuse large B cell lymphoma,
Burkitt's lymphoma, plasmacytoma, plasma cell myeloma,
post-transplant lymphoproliferative disorder, Waldenstrom's
macroglobulinemia, malignant melanoma, and anaplastic large-cell
lymphoma.
91. The method of claim 83, wherein the cancer is diffuse large
B-cell lymphoma.
92. The method of claim 83, wherein the cancer is follicular
lymphoma.
93. The method of claim 83, wherein the method comprises further
administering one or more therapeutic agents.
94. A nucleic acid encoding the heavy chain and/or light chain of a
first and/or second binding arm of a bispecific antibody comprising
(a) a first binding arm comprising a first antigen-binding region
which binds to CD3e and comprises a variable heavy chain (VH)
region comprising the amino acid sequence set forth in SEQ ID NO: 6
and a variable light chain (VL) region comprising the amino acid
sequence set forth in SEQ ID NO: 10, and (b) a second binding arm
comprising a second antigen-binding region which binds to human
CD20, an expression vector which comprises the nucleic acid, or a
host cell comprising the nucleic acid or expression vector.
95. A method for detecting whether cross-linking between CD3- and
CD20-expressing cells occurs in a sample derived from a patient
upon administration of a bispecific antibody comprising (a) a first
binding arm comprising a first antigen-binding region which binds
to CD3e and comprises a variable heavy chain (VH) region comprising
the amino acid sequence set forth in SEQ ID NO: 6 and a variable
light chain (VL) region comprising the amino acid sequence set
forth in SEQ ID NO: 10, and (b) a second binding arm comprising a
second antigen-binding region which binds to human CD20, comprising
the steps of: (i) contacting the sample with the bispecific
antibody under conditions that allow for formation of a complex
between said bispecific antibody and the CD3- and CD20-expressing
cells; and (ii) analyzing whether a complex has been formed.
Description
REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. patent application
Ser. No. 15/541,594, filed Jul. 5, 2017 (now U.S. Pat. No.
10,544,220), which is a 35 U.S.C. 371 national stage filing of
International Application No. PCT/EP2016/050296, filed Jan. 8,
2016, which claims priority to International Application No.
PCT/EP2015/050276, filed Jan. 8, 2015 and Danish Patent Application
Nos. PA 2015 00412, filed Jul. 15, 2015; PA 2015 00413, filed Jul.
15, 2015; PA 2015 00415, filed Jul. 16, 2015; and PA 2015 00416,
filed Jul. 16, 2015. The contents of the aforementioned
applications are hereby incorporated by reference.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Dec. 4, 2019, is named GMI_147USEDV_Sequence_Listing.txt and is
83,702 bytes in size.
FIELD OF THE INVENTION
[0003] The present invention relates to bispecific antibodies
directed to CD3 and CD20 and to uses of such bispecific antibodies,
in particular use thereof in the treatment of diseases in which
specific targeting and T cell-mediated killing of cells that
express CD20 is desired.
BACKGROUND OF THE INVENTION
[0004] CD3 has been known for many years and therefore has been
subject of interest in many aspects. Specifically antibodies raised
against CD3 or the T-cell Receptor Complex, which CD3 is part of,
are known. An in vitro characterization of five humanized OKT3
effector function variant antibodies has been described (Xu et al.,
2000, Cell Immunol. 200(1):16-26).
[0005] Treatment with the anti-CD3 monoclonal antibody
hOKT3gamma1(Ala-Ala) results in improved C-peptide responses and
clinical parameters for at least 2 years after onset of type 1
diabetes in absence of continued immunosuppressive medications
(Herold et al., 2005, Diabetes, 54(6):1763-9).
[0006] CD3 antibodies cross-reactive to cynomolgus and/or rhesus
monkey CD3 have been described (WO2012162067, WO2008119567).
[0007] A promising approach to improve targeted antibody therapy is
by delivering cytotoxic cells specifically to the
antigen-expressing cancer cells. This concept of using T-cells for
efficient killing of tumor cells has been described in Staerz, et.
al., 1985, Nature 314:628-631). However, initial clinical studies
were rather disappointing mainly due to low efficacy, severe
adverse effects (cytokine storm) and immunogenicity of the
bispecific antibodies (Muller and Kontermann, 2010, BioDrugs 24:
89-98). Advances in the design and application of bispecific
antibodies have partially overcome the initial barrier of cytokine
storm and improved clinical effectiveness without dose-limiting
toxicities (Garber, 2014, Nat. Rev. Drug Discov. 13: 799-801; Lum
and Thakur, 2011, BioDrugs 25: 365-379). Critical to overcome the
initial barrier of cytokine storm as described for catumaxomab
(Berek et al. 2014, Int. J. Gynecol. Cancer 24(9): 1583-1589;
Mau-Sorensen et al. 2015, Cancer Chemother. Pharmacol. 75:
1065-1073), was the absence or silencing of the Fc domain.
[0008] The CD20 molecule (also called human B-lymphocyte-restricted
differentiation antigen or Bp35) is a hydrophobic transmembrane
protein with a molecular weight of approximately 35 kD located on
pre-B and mature B lymphocytes (Valentine et al. (1989) J. Biol.
Chem. 264(19):11282-11287; and Einfield et al., (1988) EMBO J.
7(3):711-717). CD20 is found on the surface of greater than 90% of
B cells from peripheral blood or lymphoid organs and is expressed
during early pre-B cell development and remains until plasma cell
differentiation. CD20 is present on both normal B cells as well as
malignant B cells. In particular, CD20 is expressed on greater than
90% of B cell non-Hodgkin's lymphomas (NHL) (Anderson et al. (1984)
Blood 63(6):1424-1433), but is not found on hematopoietic stem
cells, pro-B cells, normal plasma cells, or other normal tissues
(Tedder et al. (1985) J. Immunol. 135(2):973-979).
[0009] Methods for treating cancer as well as autoimmune and immune
diseases by targeting CD20 are known in the art. For example, the
chimeric CD20 antibody rituximab has been used for or suggested for
use in treating cancers such as non-Hodgkin's lymphoma (NHL),
chronic lymphocytic leukemia (CLL) and small lymphocytic lymphoma
(SLL). The human monoclonal CD20 antibody ofatumumab has been used
for or suggested for use in treating among others various CLL
indications, follicular lymphoma (FL), neuromyelitis optica (NMO),
diffuse and relapsing-remitting multiple sclerosis (RRMS). The
human monoclonal CD20 antibody obinutuzumab has been used for or
suggested for use in treating CLL. Furthermore, the humanized CD20
antibody ocrelizumab is being developed for RRMS.
[0010] Gall et al. (2005 Experimental Hematology 33: 452) disclose
the CD3xCD20 bispecific antibody CD20bi resulting from the chemical
heteroconjugation of the CD20-specific chimeric antibody Rituximab
(Rituxan) to anti-CD3 (Orthoclone OKT-3).
[0011] Stanglmaier et al. (2008 Int. J. Cancer: 123, 1181) describe
the trifunctional bispecific anti-CD3xanti-CD20 antibody
Bi20/FBTA05 combining a CD20-specific mouse IgG2a and a
CD3-specific rat IgG2b.
[0012] Wu et al. (2007 Nat Biotechnol. 25: 1290-1297) and
WO2011014659 describe a dual-specific (CD3 and CD20), tetravalent
immunoglobulin G (dual-variable-domain immunoglobulin, DVD-Ig).
[0013] WO2011090762 describes the generation of a CD3xCD20
polypeptide heterodimer.
[0014] WO2011028952 describes amongst others the generation of
CD3xCD20 bispecific molecules using Xencor's XmAb bispecific Fc
domain technology.
[0015] WO2014047231 describes REGN1979 and other CD3xCD20
bispecific antibodies generated using the Fc.DELTA.Adp technology
from Regeneron Pharmaceuticals.
[0016] Sun et al. (2015, Science Translational Medicine 7, 287ra70)
describe a B cell-targeting anti-CD20/CD3 T cell-dependent
bispecific antibody constructed using "knobs-into-holes"
technology.
[0017] Bispecific antibodies that bind to both CD3 and CD20 may be
useful in therapeutic settings in which specific targeting and T
cell-mediated killing of cells that express CD20 is desired, and
there is still a need for further efficient CD3xCD20 bispecific
antibodies.
SUMMARY OF THE INVENTION
[0018] It is an object of the present invention to provide novel
efficient bispecific antibodies comprising a first antigen-binding
region derived from a CD3 antibody and a second antigen-binding
region derived from a CD20 antibody.
[0019] The novel CD3xCD20 bispecific antibodies are useful in
therapeutic settings in which specific targeting and T
cell-mediated killing of cells that express CD20 is desired. The
novel CD3xCD20 bispecific antibodies are highly efficient in
killing CD20 expressing cells, including cells with low CD20 copy
numbers, and have been shown to be highly potent in eradicating
tumor cells in animal models. The novel CD3xCD20 bispecific
antibodies are advantageous by inducing rapid and strong killing of
cells at low dosing. The novel CD3xCD20 bispecific antibodies are
furthermore capable of inducing cytotoxicity by both CD4.sup.+ T
cells and CD8.sup.+ T cells which makes them suitable for engaging
T cells for killing CD20 positive tumors and other diseases
involving CD20 positive cells. In addition, the CD3xCD20 bispecific
antibodies are efficient in depleting B cells from lymphoid
structures. Accordingly, it is an object of the present invention
to provide a bispecific CD3xCD20 antibody which is capable of
inducing cytotoxicity by both CD4.sup.+ T cells and CD8.sup.+ T
cells. It is a further object of the present invention to provide a
bispecific CD3xCD20 antibody which is highly efficient in killing
CD20 expressing cells such as CD20 expressing tumor cells. It is a
further object of the present invention to provide a bispecific
CD3xCD20 antibody which is highly efficient in killing CD20
expressing cancers.
[0020] These and other aspects of the invention are described in
further detail below.
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] FIGS. 1A-1I: Binding of bispecific CD3xCD20 antibodies to
Daudi (FIGS. 1A-1F) and Jurkat (FIGS. 1G-1I) cells. (FIG. 1A)
Binding of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR and IgG1-7D8, (FIG.
1B) Binding of bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR and IgG1-2F2,
(FIG. 1C) Binding of bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR and
IgG1-RTX, (FIG. 1D) Binding of
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR and IgG1-11B8, (FIG. 1E)
Binding of bsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR and IgG1-GA101,
(FIG. 1F) Binding of bsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR (and
IgG1-7D8). Data shown are geometric means of fluorescence intensity
(geomean) (FIGS. 1A-1E) and median fluorescence intensity (FIG. 1F)
of binding to Daudi cells, as determined by flow cytometry, for two
representative experiments (FIGS. 1A-1E from one, FIG. 1F from the
other). (FIG. 1G) Binding of bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR
(huCLB-T3/4x7D8), bsIgG1-huCLB-T3/4-FEALxCD20-2F2-FEAR
(huCLB-T3/4x2F2), bsIgG1-huCLB-T3/4-FEALxCD20-GA101-FEAR
(huCLB-T3/4xGA101), bsIgG1-huCLB-T3/4-FEALxCD20-11B8-FEAR
(huCLB-T3/4x11B8) and monospecific bivalent IgG1-7D8-FEAR to Daudi
cells, (FIG. 1H) Binding of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR,
bsIgG1-huCD3-H1L1-FEALxb12-FEAR and monospecific, bivalent
IgG1-huCD3-H1L1-FEAL to Jurkat cells (FIG. 1I) Binding of
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR,
bsIgG1-huCLB-T3/4-FEALxCD20-2F2-FEAR.
bsIgG1-huCLB-T3/4-FEALxCD20-GA101-FEAR,
bsIgG1-huCLB-T3/4-FEALxCD20-RTX-FEAR,
bsIgG1-huCLB-T3/4-FEALxCD20-11B8-FEAR,
bsIgG1-huCLB-T3/4-FEALxCD20-2C6-FEAR,
bsIgG1-huCLB-T3/4-FEALxb12-FEAR and monospecific, bivalent
IgG1-huCLB-T3/4-FEAL to Jurkat cells. Data shown are median
fluorescence intensity, as determined by flow cytometry, of one
representative experiment.
[0022] FIGS. 2A and 2B: Concentration-dependent simultaneous
binding of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (CD3xCD20) to T
cells and B cells. Simultaneous binding of the bispecific antibody
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (CD3xCD20) to B and T cells in
blood was analyzed by flow cytometry. Data shown are from one
representative experiment. Data shown are the number of
double-positive (CD19 and CD4 [FIG. 2A] or CD19 and CD8 [FIG. 2B])
events, as determined by the number of events in the upper right
quadrant of the CD4/CD19 or the CD8/CD19 flow cytometry dot-plot.
Closed and open symbols indicate data from different healthy
donors. IgG1-2F2 (2F2, CD20-specific) and
bsIgG1-huCD3-H1L1-FEALxb12-FEAR (CD3xb12, CD3-specific) were
included as negative control antibodies.
[0023] FIGS. 3A-3N: Induction of cytotoxicity in vitro by CD3xCD20
bispecific antibodies in human B-cell lymphoma and B cell leukemia
cell lines. (FIG. 3A) Daudi cells were incubated with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (CD3x7D8),
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR (CD3x11B8), the monospecific
CD20 antibodies IgG1-7D8 (7D8), IgG1-7D8-FEAR (7D8-FEAR; with
inactive Fc region), IgG1-11B8-F405L or IgG1-11B8-FEAR (11B8-FEAR;
with inactive Fc region), and the bispecific control antibody
bsIgG1-huCD3-H1L1-FEALxb12-FEAR (CD3xb12) PBMCs were used as
effector cells. (FIG. 3B) Daudi cells were incubated with
BsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (CD3x7D8), the monospecific
CD20 antibody IgG1-7D8-FEAR (7D8-FEAR; with inactive Fc region) and
bsIgG1-huCD3-H1L1-FEALxb12-FEAR (CD3xb12), purified T cells were
used as effector cells. (FIGS. 3C-3F) Daudi cells were incubated
with CD3xCD20 bispecific antibodies based on two different CD3 arms
(huCD3-H1L1-FEAL and huCLB-T3/4-FEAL Fab arm, represented by open
and closed symbols, respectively) and four different CD20 arms: 7D8
(BsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR and
BsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR; [FIG. 3C]), 11B8
(BsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR and
BsIgG1-huCLB-T3/4-FEALxCD20-11B8-FEAR; [FIG. 3D]), GA101
(BsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR and
BsIgG1-huCLB-T3/4-FEALxCD20-GA101-FEAR; [FIG. 3E]) and 2F2
(BsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR and
BsIgG1-huCLB-T3/4-FEALxCD20-2F2-FEAR; [FIG. 3F]). (FIGS. 3G-3M)
Different B-cell lines were used as target cells and incubated with
antibodies as indicated. CD3xCD20 bispecific antibodies contained
the huCD3-H1L1-FEAL Fab arm and different CD20 Fab arms (7D8, 11B8,
2F2, GA101 or RTX) as indicated. CD3 antibody alone was
IgG1-huCD3-H1L1. Purified T cells were used as effector cells.
(FIG. 3N) Daudi cells were incubated with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (CD3x7D8),
bsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR (CD3x2C6) and
bsIgG1-huCD3-H1L1-FEALxb12-FEAR (CD3xb12), purified T cells were
used as effector cells. Data shown are mean percentages specific
lysis .+-.S.D of triplicate wells and data for each graph were
obtained from one representative experiment.
[0024] FIGS. 4A and 4B: Dose-dependent Induction of cytotoxicidty
in vitro by bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR using purified
total T cells (CD3.sup.+), CD4.sup.+ T cells (CD3.sup.+CD8.sup.-)
and CD8.sup.+ T cells (CD3.sup.+CD8.sup.+) as effector cells. Daudi
cells were incubated with the different T-cell subsets, as
indicated, and a dilution series of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR or the control antibodies
IgG1-huCD3-H1L1-FEALxb12-FEAR and IgG1-7D8-FEAR (data not shown).
Data shown are mean percentages of tumor cell lysis .+-.S.E.M. of
triplicate wells (FIG. 4A, FIG. 4B).
[0025] FIGS. 5A and 5B: Kinetics of
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR-dependent cytoxicity in Daudi
cells. Daudi cells were incubated with
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR in presence of purified T
cells isolated from two different donors (FIG. 5A and FIG. 5B).
Cytotoxicity was assessed after 4, 12, 24, 48 and 72 hours of
incubation (FIG. 5A) or after 3, 16 and 24 hours of incubation
(FIG. 5B). Data shown are percentages cell kill .+-.S.D. of
triplicate wells of cells incubated with
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR for different incubation
times. Data shown in FIG. 5A and FIG. 5B are from two independent
experiments, using purified T cells isolated from two different
donors.
[0026] FIGS. 6A-6E: Efficacy of Induction of cytotoxicidty in vitro
by CD3xCD20 bispecific antibodies at different effector to target
ratios. A cytotoxicity assay was performed using different CD3xCD20
bispecific antibodies and different E/T ratios. CD3xCD20 bispecific
antibodies included bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (FIG. 6A),
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR (FIG. 6B),
bsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR (FIG. 6C),
bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR (FIG. 6D) and
bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR (FIG. 6E). As a negative
control, bsIG1-huCLB-T3/4-FEALxb12-FEAR was included at an E/T
ratio of 10:1. Data shown are mean percentages lysis .+-.S.D. of
triplicate wells as determined in a cytotoxicity assay for one
representative experiment. Each line represents a different E/T
ratio (as indicated).
[0027] FIGS. 7A-7I: Cytotoxic activity of CD3xCD20 bispecific
antibodies in the Raji-luc co-engraftment model in NOD-SCID mice.
(FIG. 7A) Average tumor size in mice that were treated with vehicle
(PBS) or bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR at the indicated
doses. Error bars indicate S.E.M. (FIG. 7B) Tumor size in
individual mice after treatment with PBS or
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR on day 21 after tumor
inoculation. Statistical analysis of data at day 21 was performed
using Kruskal Wallis (Dunn's multiple comparison as post-test).
**p<0.01 (FIG. 7C) Kaplan-Meier plots with tumorsize cut-off set
at 600 mm.sup.3. Statistical significance of differences in
survival between the bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR-treated
groups and the PBS-treated control group were assessed by Mantel
Cox analysis. *p<0.05, **p<0.01, n.s. not significant (FIG.
7D) Average tumor size in mice that were treated with vehicle (PBS)
or bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR at the indicated doses.
Error bars indicate S.E.M. (FIG. 7E) Tumor size in individual mice
in the different treatment groups on day 25 after tumor
inoculation. Statistical analysis was performed using Kruskal
Wallis test (Dunn's multiple comparison as post-test) (FIG. 7F)
Kaplan-Meier plots with tumorsize cut-off set at 500 mm.sup.3.
Statistical significance of differences between treatment groups
and the vehicle control group was analysed by Mantel Cox analysis.
*p<0.05, ** p<0.01, n.s. not significant. (FIG. 7G) Average
tumor size in mice that were treated with vehicle (PBS),
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR or
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR at the indicated doses. Error
bars indicate S.E.M. (FIG. 7H) Tumor size in individual mice after
treatment with PBS, or bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR or
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR on day 20 after tumor
inoculation. Statistical analysis of data at day 20 was performed
using one-way ANOVA (Tukey's multiple comparison as post-test).
*p<0.05, **p<0.01 (FIG. 7I) Kaplan-Meier plots with tumorsize
cut-off set at 500 mm.sup.3. Statistical significance of
differences in survival between the
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR treated groups and the
PBS-treated control group were assessed by Mantel Cox analysis.
*p<0.05, **p<0.01, n.s. not significant.
[0028] FIGS. 8A-8C: Anti-tumor activity of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR In a Daudi-luc xenograft model
in HIS mice. (FIG. 8A) Average tumor size in the Daudi-luc
xenograft model in BRGS-HIS mice after treatment with PBS (vehicle
control), bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (mAb2) or the
control bispecific antibody bsIgG1-huCD3-H1L1-FEALxb12-FEAR (mAb1)
at the indicated dose levels. Tumor burden was assessed by
bioluminescence imaging. Error bars indicate S.E.M. (FIG. 8B)
Statistical analysis was performed at day 21 (Kruskal Wallis test
followed by Dunn's multiple comparison post-test) ** p<0.01
(FIG. 8C) Characterization of peripheral blood leukocyte
populations in Daudi-luc xenograft-bearing BRGS-HIS mice after
treatment with bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR or the control
bispecific antibody bsIgG1-huCD3-H1L1-FEALxb12-FEAR, as determined
by flow cytometry at day 9. % hCD45.sup.+ cells represents the
total percentage of human leukocytes in mouse peripheral blood. %
hCD19.sup.+, % hCD3.sup.+ and % hCD3.sup.+FSC.sup.hi represent the
percentage of B cells, T cells and activated T cells, respectively,
within the human leukocyte population.
[0029] FIGS. 9A-9F: Study of effects of a single dose of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR In cynomolgus monkeys. B-cell
counts (CD19.sup.+CD21.sup.+ cells) (FIG. 9A) and T-cell counts
(CD4.sup.+ plus CD8.sup.+ cells) (FIG. 9B) over time in peripheral
blood of cynomolgus monkeys treated with different doses of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (0.01, 0.1, 1 or 10 mg/kg).
Days -18 and -11 show pre-dose B- and T-cell counts. B cells (FIG.
9C) and T cells (FIG. 9D) as percentage of the total lymphocyte
population over time in lymph node samples from cynomolgus monkeys
treated with different doses of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (0.01, 0.1, 1 or 10 mg/kg).
Plasma levels of IL-2, IL-6, IL-8, IL-10, IFN-.gamma. and
TNF-.alpha. in cynomolgus monkeys treated with different doses of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (0.01, 0.1, 1 or 10 mg/kg)
(FIG. 9E). Pharmacokinetic profile of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR in blood samples at pre-dose
and at various time-points after dosing up to 70 days (FIG. 9F).
The dotted line shows the predicted pharmacokinetic profile of
IgG1, using a two-compartment model, with k.sub.10 (clearance
constant) at 0.006 h.sup.-1, Vc (plasma volume) 40 mLkg.sup.-1 and
3.5 kg bodyweight.
[0030] FIGS. 10A and 10B: Binding of bispecific CD3xCD20 antibodies
to wild type CD20 and CD20-AxP expressed in HEK293F cells. Binding
of CD3xCD20 bispecific antibodies
(bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR [huCD3x7D8],
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR [huCLB-T3/4x7D8],
bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR [huCD3x2F2],
bsIgG1-huCLB-T3/4-FEALxCD20-2F2-FEAR [huCLB-T3/4x2F2],
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR [huCD3x11B8],
bsIgG1-huCLB-T3/4-FEALxCD20-11B8-FEAR [huCLB-T3/4x11B8],
bsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR [huCD3xGA101],
bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR [huCD3xRTX],
bsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR [huCD3x2C6]) to wild type CD20
(FIG. 10A) and CD20 mutant (CD20-AxP) (FIG. 10B) expressed in
HEK293F cells was measured by flow cytometry. Data shown are mean
fluorescence intensities of one representative experiment.
[0031] FIG. 11: T cell activation upon Incubation of PBMC with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR.
[0032] Healthy donor PBMC were incubated with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR or positive and negative
control antibodies, and T cell activation was assessed by measuring
CD69 expression within the T cell population (CD28.sup.+ cells).
Experiments were performed with PBMC isolated from five healthy
donors. Results for two representative donors are shown.
TABLE-US-00001 TABLE 1 SEQ ID NO: Clone name Sequence SEQ ID NO: 1
huCD3 VH CDR1 GFTFNTYA SEQ ID NO: 2 huCD3 VH CDR2 IRSKYNNYAT SEQ ID
NO: 3 huCD3 VH CDR3 VRHGNFGNSYVSWFAY SEQ ID NO: 4 huCD3 VL CDR1
TGAVTTSNY huCD3 VL CDR2 GTN SEQ ID NO: 5 huCD3 VL CDR3 ALWYSNLWV
SEQ ID NO: 6 huCD3 VH1 EVKLVESGGGLVQPGGSLRLSCAASGFTFNTYAMNWVRQA
PGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKSSL
YLQMNNLKTEDTAMYYCVRHGNFGNSYVSWFAYWGQGTL VTVSS SEQ ID NO: 7 huCD3
VH2 EVKLVESGGGLVKPGRSLRLSCAASGFTFNTYAMNWVRQA
PGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKSIL
YLQMNNLKTEDTAMYYCVRHGNFGNSYVSWFAYWGQGTL VTVSS SEQ ID NO: 8 huCD3
VH3 EVKLVESGGGLVKPGRSLRLSCAASGFTFNTYAMNWVRQA
PGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKSIL
YLQMNSLKTEDTAMYYCVRHGNFGNSYVSWFAYWGQGTL VTVSS SEQ ID NO: 9 huCD3
VH4 EVKLVESGGGLVKPGRSLRLSCAASGFTFNTYAMNWVRQA
PGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKSIL
YLQMNSLKTEDTAMYYCVRHGNFGNSYVSWFAYWGQGTM VTVSS SEQ ID NO: 10 huCD3
VL1 QAVVTQEPSFSVSPGGTVTLTCRSSTGAVTTSNYANWVQQ
TPGQAFRGLIGGTNKRAPGVPARFSGSLIGDKAALTITGAQA
DDESIYFCALWYSNLWVFGGGTKLTVL SEQ ID NO: 11 huCD3 VL2
QAVVTQEPSFSVSPGGTVTLTCRSSTGAVTTSNYANWVQQ
TPGQAFRGLIGGTNKRAPGVPARFSGSILGNKAALTITGAQA
DDESIYFCALWYSNLWVFGGGTKLTVL SEQ ID NO: 12 huCD3 VL3
QAVVTQEPSFSVSPGGTVTLTCRSSTGAVTTSNYANWVQQ
TPGQAFRGLIGGTNKRAPGVPARFSGSILGNKAALTITGAQA
DDESDYYCALWYSNLWVFGGGTKLTVL SEQ ID NO: 13 Mature human
QDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHN CD3.epsilon. (epsilon)
DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGS
KPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLL
LLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPN PDYEPIRKGQRDLYSGLNQRRI SEQ
ID NO: 14 Human CD3.delta.
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRI (delta)
LDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
GIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQ VYQPLRDRDDAQYSHLGGNWARNK
SEQ ID NO: 15 IgG1m(f) heavy
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW chain constant
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC region (amino
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF acids positions
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV 118-447 according
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK to EU numbering)
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 16
IgG1m(f)-LFLEDA ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW heavy
chain NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC constant region
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE GGPSVF (amino acids
LFPPKPKDTLMISRTPEVTCVVV VSHEDPEVKFNWYVDGV positions 118-447
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK according to EU
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS numbering)
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 17 VH
huCLB-T3/4 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMFWVRQA
PGKGLEWVATISRYSRYIYYPDSVKGRFTISRDNAKNSLYLQ
MNSLRAEDTAVYYCARRPLYGSSPDYWGQGTLVTVSS SEQ ID NO: 18 VL huCLB-T3/4
EIVLTQSPATLSLSPGERATLSCSASSSVTYVHWYQQKPGQ
APRLLIYDTSKLASGIPARFSGSGSGTDFTLTISSLEPEDFAV YYCFQGSGYPLTFGSGTKLEMR
SEQ ID NO: 19 Mature cyno CD3.epsilon.
QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQH (epsilon)
NGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASH
HLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWS
KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIR KGQQDLYSGLNQRRI SEQ ID NO:
20 Mature rhesus QDGNEEMGSITQTPYHVSISGTTVILTCSQHLGSEVQWQH
CD3.epsilon. (epsilon) NGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASH
HLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWS
KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIR KGQQDLYSGLNQRRI SEQ ID NO:
21 IgG1m(f)-F405L ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW (amino
acids NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC positions 118-447
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF according to EU
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV numbering)
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK SEQ ID NO: 22
IgG1m(f)-K409R ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW (amino
acids NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC positions 118-447
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF according to EU
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV numbering)
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YS
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 23
IgG1m(f)-LFLEDA- ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW F405L
(FEAL) NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC (amino acids
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE GGPSVF positions 118-447
LFPPKPKDTLMISRTPEVTCVVV VSHEDPEVKFNWYVDGV according to EU
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK numbering)
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK SEQ ID NO: 24
IgG1m(f)-LFLEDA- ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW K409R
(FEAR) NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC (amino acids
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE FEGGPSVF positions 118-447
LFPPKPKDTLMISRTPEVTCVVV VSHEDPEVKFNWYVDGV according to EU
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK numbering)
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YS
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 25 Parent murine
VH EVKLLESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQA of SP34
PGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSQSIL
YLQMNNLKTEDTAMYYCVRHGNFGNSYVSWFAYWGQGTL VTVSA SEQ ID NO: 26 Parent
murine VL QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEK of SP34
PDHLFTGLIGGTNKRAPGVPARFSGSLIGDKAALTITGAQTE
DEAIYFCALWYSNLWVFGGGTKLTVL SEQ ID NO: 27 VH CD20-7D8
EVQLVESGGGLVQPDRSLRLSCAASGFTFHDYAMHWVRQA
PGKGLEWVSTISWNSGTIGYADSVKGRFTISRDNAKNSLYL
QMNSLRAEDTALYYCAKDIQYGNYYYGMD VWGQGTTVTVSS SEQ ID NO: 28 VL
CD20-7D8 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPG
QAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFA VYYCQQRSNWPITFGQGTRLEIK
SEQ ID NO: 29 Human GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
IgLC2/IgLC3 KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHR constant
domain SYSCQVTHEGSTVEKTVAPTECS SEQ ID NO: 30 VL huCD3-LKNH
QAVVTQEPS SVSPGGTVTLTCRSSTGAVTTSNYANWVQQ PGQAFRGLIGGTN
RAPGVPARFSGSLIGDKAALTITGAQ ADDESIYFCALWYSN WVFGGGTKLTVL SEQ ID NO:
31 VL huCD3-T41K QAVVTQEPSFSVSPGGTVTLTCRSSTGAVTTSNYANWVQQ
PGQAFRGLIGGTNKRAPGVPARFSGSLIGDKAALTITGAQ
ADDESIYFCALWYSNLWVFGGGTKLTVL SEQ ID NO: 32 VH CD20-7D8 GFTFHDYA
CDR1 SEQ ID NO: 33 VH CD20-7D8 ISWNSGTI CDR2 SEQ ID NO: 34 VH
CD20-7D8 AKDIQYGNYYYGMDV CDR3 SEQ ID NO: 35 VL CD20-7D8 QSVSSY CDR1
VL CD20-7D8 DAS CDR2 SEQ ID NO: 36 VL CD20-7D8 QQRSNWPIT CDR3 SEQ
ID NO: 37 VH CD20-2F2 EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQA
PGKGLEWVSTISWNSGSIGYADSVKGRFTISRDNAKKSLYL
QMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTVS S SEQ ID NO: 28 VL
CD20-2F2 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPG
QAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFA VYYCQQRSNWPITFGQGTRLEIK
SEQ ID NO: 38 VH CD20-2F2 GFTFNDYA CDR1 SEQ ID NO: 39 VH CD20-2F2
ISWNSGSI CDR2 SEQ ID NO: 34 VH CD20-2F2 AKDIQYGNYYYGMDV CDR3 SEQ ID
NO: 35 VL CD20-2F2 QSVSSY CDR1 VL CD20-2F2 DAS CDR2 SEQ ID NO: 36
VL CD20-2F2 QQRSNWPIT CDR3 SEQ ID NO: 40 VH CD20-11B8
EVQLVQSGGGLVHPGGSLRLSCTGSGFTFSYHAMHWVRQA
PGKGLEWVSIIGTGGVTYYADSVKGRFTISRDNVKNSLYLQ
MNSLRAEDMAVYYCARDYYGAGSFYDGLYGMDVWGQGTT VTVSS SEQ ID NO: 41 VL
CD20-11B8 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPG
QAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFA VYYCQQRSDWPLTFGGGTKVEIK
SEQ ID NO: 42 VH CD20-11B8 GFTFSYHA CDR1 SEQ ID NO: 43 VH CD20-11B8
IGTGGVT CDR2 SEQ ID NO: 44 VH CD20-11B8 ARDYYGAGSFYDGLYGMDV CDR3
SEQ ID NO: 45 VL CD20-11B8 QSVSSY CDR1 VL CD20-11B8 DAS CDR2 SEQ ID
NO: 46 VL CD20-11B8 QQRSDWPLT CDR3 SEQ ID NO: 47 VH CD20-2C6
AVQLVESGGGLVQPGRSLRLSCAASGFTFGDYTMHWVRQA
PGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLY
LQMNSLRAEDTALYYCTKDNQYGSGSTYGLGVWGQGTLVT VSS SEQ ID NO: 48 VL
CD20-2C6 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPG
QAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFA VYYCQQRSNWPLTFGGGTKVEIK
SEQ ID NO: 49 VH CD20-2C6 GFTFGDYT CDR1
SEQ ID NO: 50 VH CD20-2C6 ISWNSGSI CDR2 SEQ ID NO: 51 VH CD20-2C6
TKDNQYGSGSTYGLGV CDR3 SEQ ID NO: 52 VL CD20-2C6 QSVSSY CDR1 VL
CD20-2C6 DAS CDR2 SEQ ID NO: 53 VL CD20-2C6 QQRSNWPLT CDR3 SEQ ID
NO: 54 VL huCD3-CDR3 ALWYSN WV L97H SEQ ID NO: 55 huCLB-T3/4 VH
GFTFSSYG CDR1 SEQ ID NO: 56 huCLB-T3/4 VH ISRYSRYI CDR2 SEQ ID NO:
57 huCLB-T3/4 VH ARRPLYGSSPDY CDR3 SEQ ID NO: 58 huCLB-T3/4 VL
SSVTY CDR1 huCLB-T3/4 VL DTS CDR2 SEQ ID NO: 59 huCLB-T3/4 VL
FQGSGYPLT CDR3 SEQ ID NO: 60 IgG1m(a) CH3
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE region
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
SEQ ID NO: 61 IgG1m(f) CH3
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW region
ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
SEQ ID NO: 62 IgG1m(ax) CH3
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE region
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEGLHNHYTQKSLSLSPGK
SEQ ID NO: 63 IgG1 heavy chain
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-WT
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC (amino acids
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF positions 118-447
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV according to EU
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK numbering)
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 64 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC F405L
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF (amino acids
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV positions 118-447
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK according to EU
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS numbering)
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFLL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 65 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC K409R
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF (amino acids
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV positions 118-447
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK according to EU
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS numbering)
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSRLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 66 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC N297Q
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF (amino acids
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV positions 118-447
EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCK according to EU
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS numbering)
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 67 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC LFLEDANQPS
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVF (amino acids
LFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGV positions 118-447
EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCK according to EU
VSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS numbering)
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 68 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC F405L
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF N297Q
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV (amino acids
EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCK positions 118-447
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS according to EU
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFLL numbering)
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 69 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC K409R
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVF N297Q
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV (amino acids
EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCK positions 118-447
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS according to EU
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL numbering)
YSRLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 70 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC F405L
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVF LFLEDANQPS
LFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGV (amino acids
EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCK positions 118-447
VSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS according to EU
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFLL numbering)
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 71 IgG1 heavy
chain ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW constant region-
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC K409R
NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVF LFLEDANQPS
LFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGV (amino acids
EVHNAKTKPREEQYQSTYRVVSVLTVLHQDWLNGKEYKCK positions 118-447
VSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS according to EU
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL numbering)
YSRLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 72 huCD3 VH
CDR1 GFTFX.sub.1T YA, affinity variant wherein X.sub.1 is selected
from V, H, F, T, P, L, Q, D, K, W, S, G, A, C and R SEQ ID NO: 73
huCD3 VH CDR1 GFTFNX.sub.2YA, affinity variant wherein X.sub.2 is
selected from S, N, G, A, K, V, R, H, Q, P, I, F, M, Y, L, W, D, E
and C SEQ ID NO: 74 huCD3 VH CDR1 GFTFNTX.sub.3A, affinity variant
wherein X.sub.3 is selected from F, H, N, M, W, G, Q, V, T, S, L,
P, I, A, K, R and C SEQ ID NO: 75 huCD3 VH CDR2 IRSKYNX.sub.4YAT,
affinity variant wherein X.sub.4 is selected from S, Y, Q, W, L, A,
I, M, D, T, K, R, G, F, E, V, C and P SEQ ID NO: 76 huCD3 VH CDR2
IRSKYNNYX.sub.5T, affinity variant wherein X.sub.5 is selected from
N, L, Y, W, H, M, G, F, K, S, V, R, Q, D, C, E, P and T SEQ ID NO:
77 huCD3 VH CDR3 VRX.sub.6GNFGNSYVSWFAY, affinity variant wherein
X.sub.6 is selected from A, S, V, N, K, L, T, I, P, Q, C, G, Y, W,
F, and R SEQ ID NO: 78 huCD3 VH CDR3 VRHGNFX.sub.7NSYVSWFAY,
affinity variant wherein X.sub.7 is selected from P, Q, A, Y, H, I,
N, V, E, L, F, W, M, R, C, S and T SEQ ID NO: 79 huCD3 VH CDR3
VRHGNFGNSYVX.sub.8WFAY, affinity variant wherein X.sub.8 is
selected from A, T, G, L, N, C, P, F, Q, H, R, K, E, W, and Y SEQ
ID NO: 80 huCD3 VH CDR3 VRHGNFGNSYVSWFAX.sub.9, affinity variant
wherein X.sub.9 is selected from H, S, F, N, W, T, C, A, I, L, Q,
V, E, M, K, R, G and P SEQ ID NO: 81 huCD3 VL CDR1
TGAVTX.sub.10SNY, affinity variant wherein X.sub.10 is selected
from S, A, G, R, V, F, I, E, M, H, N, Y, P, Q, D, K and L SEQ ID
NO: 82 huCD3 VL CDR3 AX.sub.11WYSNLWV, affinity variant wherein
X.sub.11 is selected from C, F, Y, I, T, V, M, A, S, N, G, W, E, K,
P, R and D SEQ ID NO: 83 huCD3 VL CDR3 ALWYSNX.sub.12WV, affinity
variant wherein X.sub.12 is selected from D, K, Q, R, G, V, E, T,
N, Y, S, P, W, F and M
The CDR regions have been annotated according to the IMGT
definitions.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0033] The term "human CD3" or "CD3" as used herein, refers to the
human Cluster of Differentiation 3 protein which is part of the
T-cell co-receptor protein complex and is composed of four distinct
chains. CD3 is also found in other species, and thus, the term
"CD3" may be used herein and is not limited to human CD3 unless
contradicted by context. In mammals, the complex contains a
CD3.gamma. (gamma) chain (human CD3.gamma. chain
UniProtKB/Swiss-Prot No P09693, or cynomolgus monkey CD3.gamma.
UniProtKB/Swiss-Prot No Q95LI7), a CD3.delta. (delta) chain (human
CD3.delta. UniProtKB/Swiss-Prot No P04234, or cynomolgus monkey
CD3.delta. UniProtKB/Swiss-Prot No Q95LI8), two CD3.epsilon.
(epsilon) chains (human CD3.epsilon. UniProtKB/Swiss-Prot No
P07766; cynomolgus CD3.epsilon. UniProtKB/Swiss-Prot No Q95LI5; or
rhesus CD3.epsilon. UniProtKB/Swiss-Prot No G7NCB9), and a
CD3.zeta.-chain (zeta) chain (human CD3.zeta. UniProtKB/Swiss-Prot
No P20963, cynomolgus monkey CD3.zeta. UniProtKB/Swiss-Prot No
Q09TKO). These chains associate with a molecule known as the T-cell
receptor (TCR) and generate an activation signal in T lymphocytes.
The TCR and CD3 molecules together comprise the TCR complex.
[0034] The term "human CD20" or "CD20" refers to human CD20
(UniProtKB/Swiss-Prot No P11836) and includes any variants,
isoforms and species homologs of CD20 which are naturally expressed
by cells, including tumor cells, or are expressed on cells
transfected with the CD20 gene or cDNA. Species homologs include
rhesus monkey CD20 (Macaca mulatta; UniProtKB/Swiss-Prot No
H9YXP1).
[0035] The term "chimeric antibody" as used herein, refers to an
antibody wherein the variable region is derived from a non-human
species (e.g. derived from rodents) and the constant region is
derived from a different species, such as human. Chimeric
antibodies may be generated by antibody engineering. "Antibody
engineering" is a term used generic for different kinds of
modifications of antibodies, and which is a well-known process for
the skilled person. In particular, a chimeric antibody may be
generated by using standard DNA techniques as described in Sambrook
et al., 1989, Molecular Cloning: A laboratory Manual, New York:
Cold Spring Harbor Laboratory Press, Ch. 15. Thus, the chimeric
antibody may be a genetically or an enzymatically engineered
recombinant antibody. It is within the knowledge of the skilled
person to generate a chimeric antibody, and thus, generation of the
chimeric antibody according to the present invention may be
performed by other methods than described herein. Chimeric
monoclonal antibodies for therapeutic applications are developed to
reduce antibody immunogenicity. They may typically contain
non-human (e.g. murine) variable regions, which are specific for
the antigen of interest, and human constant antibody heavy and
light chain domains. The terms "variable region" or "variable
domains" as used in the context of chimeric antibodies, refers to a
region which comprises the CDRs and framework regions of both the
heavy and light chains of the immunoglobulin.
[0036] The term "humanized antibody" as used herein, refers to a
genetically engineered non-human antibody, which contains human
antibody constant domains and non-human variable domains modified
to contain a high level of sequence homology to human variable
domains. This can be achieved by grafting of the six non-human
antibody complementarity-determining regions (CDRs), which together
form the antigen binding site, onto a homologous human acceptor
framework region (FR) (see WO92/22653 and EP0629240). In order to
fully reconstitute the binding affinity and specificity of the
parental antibody, the substitution of framework residues from the
parental antibody (i.e. the non-human antibody) into the human
framework regions (back-mutations) may be required. Structural
homology modeling may help to identify the amino acid residues in
the framework regions that are important for the binding properties
of the antibody. Thus, a humanized antibody may comprise non-human
CDR sequences, primarily human framework regions optionally
comprising one or more amino acid back-mutations to the non-human
amino acid sequence, and fully human constant regions. Optionally,
additional amino acid modifications, which are not necessarily
back-mutations, may be applied to obtain a humanized antibody with
preferred characteristics, such as affinity and biochemical
properties.
[0037] The term "human antibody" as used herein, refers to
antibodies having variable and constant regions derived from human
germline immunoglobulin sequences. Human antibodies may include
amino acid residues not encoded by human germline immunoglobulin
sequences (e.g., mutations introduced by random or site-specific
mutagenesis in vitro or by somatic mutation in vivo). However, the
term "human antibody", as used herein, is not intended to include
antibodies in which CDR sequences derived from the germline of
another mammalian species, such as a mouse, have been grafted onto
human framework sequences. Human monoclonal antibodies of the
invention can be produced by a variety of techniques, including
conventional monoclonal antibody methodology, e.g., the standard
somatic cell hybridization technique of Kohler and Milstein, Nature
256: 495 (1975). Although somatic cell hybridization procedures are
preferred, in principle, other techniques for producing monoclonal
antibody can be employed, e.g., viral or oncogenic transformation
of B-lymphocytes or phage display techniques using libraries of
human antibody genes.
[0038] A suitable animal system for preparing hybridomas that
secrete human monoclonal antibodies is the murine system. Hybridoma
production in the mouse is a very well established procedure.
Immunization protocols and techniques for isolation of immunized
splenocytes for fusion are known in the art. Fusion partners (e.g.,
murine myeloma cells) and fusion procedures are also known.
[0039] Human monoclonal antibodies can be generated using
transgenic or transchromosomal mice carrying parts of the human
immune system rather than the mouse system.
[0040] The term "immunoglobulin" refers to a class of structurally
related glycoproteins consisting of two pairs of polypeptide
chains, one pair of light (L) low molecular weight chains and one
pair of heavy (H) chains, all four inter-connected by disulfide
bonds. The structure of immunoglobulins has been well
characterized. See for instance Fundamental Immunology Ch. 7 (Paul,
W., ed., 2nd ed. Raven Press, N.Y. (1989)). Briefly, each heavy
chain typically is comprised of a heavy chain variable region
(abbreviated herein as V.sub.H or VH) and a heavy chain constant
region (abbreviated herein as CH or CH). The heavy chain constant
region typically is comprised of three domains, C.sub.H1, C.sub.H2,
and C.sub.H3. Each light chain typically is comprised of a light
chain variable region (abbreviated herein as V.sub.L or VL) and a
light chain constant region (abbreviated herein as C.sub.L or CL).
The light chain constant region typically is comprised of one
domain, C.sub.L. The V.sub.H and V.sub.L regions may be further
subdivided into regions of hypervariability (or hypervariable
regions which may be hypervariable in sequence and/or form of
structurally defined loops), also termed complementarity
determining regions (CDRs), interspersed with regions that are more
conserved, termed framework regions (FRs). Each V.sub.H and V.sub.L
is typically composed of three CDRs and four FRs, arranged from
amino-terminus to carboxy-terminus in the following order: FR1,
CDR1, FR2, CDR2, FR3, CDR3, FR4 (see also Chothia and Lesk J. Mol.
Biol. 196 901-917 (1987)). Unless otherwise stated or contradicted
by context, CDR sequences herein are identified according to IMGT
rules (Brochet X., Nucl Acids Res. 2008; 36:W503-508 and Lefranc M
P., Nucleic Acids Research 1999; 27:209-212; see also internet http
address http://www.imgt.org/).
Unless otherwise stated or contradicted by context, reference to
amino acid positions in the constant regions in the present
invention is according to the EU-numbering (Edelman et al., Proc
Natl Acad Sci USA. 1969 May; 63(1):78-85; Kabat et al., Sequences
of Proteins of Immunological Interest, Fifth Edition. 1991 NIH
Publication No. 91-3242).
[0041] The term "antibody" (Ab) in the context of the present
invention refers to an immunoglobulin molecule, a fragment of an
immunoglobulin molecule, or a derivative of either thereof, which
has the ability to specifically bind to an antigen under typical
physiological conditions with a half life of significant periods of
time, such as at least about 30 minutes, at least about 45 minutes,
at least about one hour, at least about two hours, at least about
four hours, at least about 8 hours, at least about 12 hours, about
24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or
more days, etc., or any other relevant functionally-defined period
(such as a time sufficient to induce, promote, enhance, and/or
modulate a physiological response associated with antibody binding
to the antigen and/or time sufficient for the antibody to recruit
an effector activity). The variable regions of the heavy and light
chains of the immunoglobulin molecule contain a binding domain that
interacts with an antigen. The constant regions of the antibodies
(Abs) may mediate the binding of the immunoglobulin to host tissues
or factors, including various cells of the immune system (such as
effector cells) and components of the complement system such as
C1q, the first component in the classical pathway of complement
activation. As indicated above, the term antibody herein, unless
otherwise stated or clearly contradicted by context, includes
fragments of an antibody that are antigen-binding fragments, i.e.,
retain the ability to specifically bind to the antigen. It has been
shown that the antigen-binding function of an antibody may be
performed by fragments of a full-length antibody. Examples of
antigen-binding fragments encompassed within the term "antibody"
include (i) a Fab' or Fab fragment, a monovalent fragment
consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains,
or a monovalent antibody as described in WO2007059782 (Genmab);
(ii) F(ab').sub.2 fragments, bivalent fragments comprising two Fab
fragments linked by a disulfide bridge at the hinge region; (iii) a
Fd fragment consisting essentially of the V.sub.H and C.sub.H1
domains; (iv) a Fv fragment consisting essentially of the V.sub.L
and V.sub.H domains of a single arm of an antibody, (v) a dAb
fragment (Ward et al., Nature 341L 544-546 (1989)), which consists
essentially of a V.sub.H domain and also called domain antibodies
(Holt et al; Trends Biotechnol. 2003 November; 21(11):484-90); (vi)
camelid or nanobodies (Revets et al; Expert Opin Biol Ther. 2005
January; 5(1):111-24) and (vii) an isolated complementarity
determining region (CDR). Furthermore, although the two domains of
the Fv fragment, V.sub.L and V.sub.H, are coded for by separate
genes, they may be joined, using recombinant methods, by a
synthetic linker that enables them to be made as a single protein
chain in which the V.sub.L and V.sub.H regions pair to form
monovalent molecules (known as single chain antibodies or single
chain Fv (scFv), see for instance Bird et al., Science 242, 423-426
(1988) and Huston et al., PNAS USA 85. 5879-5883 (1988)). Such
single chain antibodies are encompassed within the term antibody
unless otherwise noted or clearly indicated by context. Although
such fragments are generally included within the meaning of
antibody, they collectively and each independently are unique
features of the present invention, exhibiting different biological
properties and utility. These and other useful antibody fragments
in the context of the present invention, as well as bispecific
formats of such fragments, are discussed further herein. It also
should be understood that the term antibody, unless specified
otherwise, also includes polyclonal antibodies, monoclonal
antibodies (mAbs), antibody-like polypeptides, such as chimeric
antibodies and humanized antibodies, and antibody fragments
retaining the ability to specifically bind to the antigen
(antigen-binding fragments) provided by any known technique, such
as enzymatic cleavage, peptide synthesis, and recombinant
techniques. An antibody as generated can possess any isotype.
[0042] The term "bispecific antibody" in the context of the present
invention refers to an antibody having two different
antigen-binding regions defined by different antibody
sequences.
[0043] When used herein, unless contradicted by context, the term
"Fab-arm" or "arm" refers to one heavy chain-light chain pair and
is used interchangeably with "half molecules" herein.
[0044] When used herein, unless contradicted by context, the term
"Fc region" refers to an antibody region comprising at least a
hinge region, a CH2 domain, and a CH3 domain.
[0045] As used herein, the term "isotype" refers to the
immunoglobulin class (for instance IgG1, IgG2, IgG3, IgG4, IgD,
IgA, IgE, or IgM) that is encoded by heavy chain constant region
genes.
[0046] The term "monovalent antibody" means in the context of the
present invention that an antibody molecule is capable of binding a
single molecule of the antigen, and thus is not capable of antigen
crosslinking.
[0047] A "CD20 antibody" or "anti-CD20 antibody" is an antibody as
described above, which binds specifically to the antigen CD20.
[0048] A "CD3 antibody" or "anti-CD3 antibody" is an antibody as
described above, which binds specifically to the antigen CD3, in
particular human CD3.epsilon. (epsilon).
[0049] A "CD3xCD20 antibody" or "anti-CD3xCD20 antibody" is a
bispecific antibody, which comprises two different antigen-binding
regions, one of which binds specifically to the antigen CD20 and
one of which binds specifically to CD3.
[0050] In a preferred embodiment, the bispecific antibody of the
invention is isolated. An "isolated bispecific antibody," as used
herein, is intended to refer to a bispecific antibody which is
substantially free of other antibodies having different antigenic
specificities (for instance an isolated bispecific antibody that
specifically binds to CD20 and CD3 is substantially free of
monospecific antibodies that specifically bind to CD20 or CD3).
[0051] The term "epitope" means a protein determinant capable of
specific binding to an antibody. Epitopes usually consist of
surface groupings of molecules such as amino acids or sugar side
chains and usually have specific three-dimensional structural
characteristics, as well as specific charge characteristics.
Conformational and nonconformational epitopes are distinguished in
that the binding to the former but not the latter is lost in the
presence of denaturing solvents. The epitope may comprise amino
acid residues directly involved in the binding and other amino acid
residues, which are not directly involved in the binding, such as
amino acid residues which are effectively blocked or covered by the
specifically antigen binding peptide (in other words, the amino
acid residue is within the footprint of the specifically antigen
binding peptide).
[0052] The term "monoclonal antibody" as used herein refers to a
preparation of antibody molecules of single molecular composition.
A monoclonal antibody composition displays a single binding
specificity and affinity for a particular epitope. Accordingly, the
term "human monoclonal antibody" refers to antibodies displaying a
single binding specificity which have variable and constant regions
derived from human germline immunoglobulin sequences.
[0053] The human monoclonal antibodies may be generated by a
hybridoma which includes a B cell obtained from a transgenic or
transchromosomal non-human animal, such as a transgenic mouse,
having a genome comprising a human heavy chain transgene and a
light chain transgene, fused to an immortalized cell.
[0054] As used herein, the term "binding" in the context of the
binding of an antibody to a predetermined antigen or epitope
typically is a binding with an affinity corresponding to a K.sub.D
of about 10.sup.-7 M or less, such as about 10.sup.-8 M or less,
such as about 10.sup.-9 M or less, about 10.sup.-10 M or less, or
about 10.sup.-11 M or even less when determined by for instance
surface plasmon resonance (SPR) technology in a BIAcore 3000
instrument using the antigen as the ligand and the antibody as the
analyte, and binds to the predetermined antigen with an affinity
corresponding to a K.sub.D that is at least ten-fold lower, such as
at least 100 fold lower, for instance at least 1,000 fold lower,
such as at least 10,000 fold lower, for instance at least 100,000
fold lower than its affinity for binding to a non-specific antigen
(e.g., BSA, casein) other than the predetermined antigen or a
closely-related antigen. The amount with which the affinity is
lower is dependent on the K.sub.D of the antibody, so that when the
K.sub.D of the antibody is very low (that is, the antibody is
highly specific), then the amount with which the affinity for the
antigen is lower than the affinity for a non-specific antigen may
be at least 10,000 fold.
[0055] The term "k.sub.d" (sec.sup.-1), as used herein, refers to
the dissociation rate constant of a particular antibody-antigen
interaction. Said value is also referred to as the k.sub.off
value.
[0056] The term "K.sub.D" (M), as used herein, refers to the
dissociation equilibrium constant of a particular antibody-antigen
interaction.
[0057] When used herein the term "heterodimeric interaction between
the first and second CH3 regions" refers to the interaction between
the first CH3 region and the second CH3 region in a
first-CH3/second-CH3 heterodimeric protein.
[0058] When used herein the term "homodimeric interactions of the
first and second CH3 regions" refers to the interaction between a
first CH3 region and another first CH3 region in a
first-CH3/first-CH3 homodimeric protein and the interaction between
a second CH3 region and another second CH3 region in a
second-CH3/second-CH3 homodimeric protein.
[0059] The term "reducing conditions" or "reducing environment"
refers to a condition or an environment in which a substrate, here
a cysteine residue in the hinge region of an antibody, is more
likely to become reduced than oxidized.
[0060] The present invention also provides bispecific antibodies
comprising functional variants of the V.sub.L regions, V.sub.H
regions, or one or more CDRs of the bispecific antibodies of the
examples. A functional variant of a V.sub.L, V.sub.H, or CDR used
in the context of a bispecific antibody still allows each arm of
the bispecific antibody to retain at least a substantial proportion
(at least about 50%, 60%, 70%, 80%, 90%, 95% or more) of the
affinity and/or the specificity/selectivity of the parent
bispecific antibody and in some cases such a bispecific antibody
may be associated with greater affinity, selectivity and/or
specificity than the parent bispecific antibody.
[0061] Such functional variants typically retain significant
sequence identity to the parent bispecific antibody. The percent
identity between two sequences is a function of the number of
identical positions shared by the sequences (i.e., % homology=# of
identical positions/total # of positions.times.100), taking into
account the number of gaps, and the length of each gap, which need
to be introduced for optimal alignment of the two sequences. The
percent identity between two nucleotide or amino acid sequences may
e.g. be determined using the algorithm of E. Meyers and W. Miller,
Comput. Appl. Biosci 4, 11-17 (1988) which has been incorporated
into the ALIGN program (version 2.0), using a PAM120 weight residue
table, a gap length penalty of 12 and a gap penalty of 4. In
addition, the percent identity between two amino acid sequences may
be determined using the Needleman and Wunsch, J. Mol. Biol. 48,
444-453 (1970) algorithm.
[0062] Exemplary variants include those which differ from VH and/or
VL and/or CDR regions of the parent bispecific antibody sequences
mainly by conservative substitutions; for instance 10, such as 9,
8, 7, 6, 5, 4, 3, 2 or 1 of the substitutions in the variant are
conservative amino acid residue replacements.
[0063] In the context of the present invention, conservative
substitutions may be defined by substitutions within the classes of
amino acids reflected in the following table:
TABLE-US-00002 Amino acid residue classes for conservative
substitutions Acidic Residues Asp (D) and Glu (E) Basic Residues
Lys (K), Arg (R), and His (H) Hydrophilic Uncharged Residues Ser
(S), Thr (T), Asn (N), and Gln (Q) Aliphatic Uncharged Residues Gly
(G), Ala (A), Val (V), Leu (L), and Ile (I) Non-polar Uncharged
Residues Cys (C), Met (M), and Pro (P) Aromatic Residues Phe (F),
Tyr (Y), and Trp (W)
[0064] In the context of the present invention the following
notations are, unless otherwise indicated, used to describe a
mutation; i) substitution of an amino acid in a given position is
written as e.g. K409R which means a substitution of a Lysine in
position 409 with an Arginine; and ii) for specific variants the
specific three or one letter codes are used, including the codes
Xaa and X to indicate any amino acid residue. Thus, the
substitution of Lysine with Arginine in position 409 is designated
as: K409R, and the substitution of Lysine with any amino acid
residue in position 409 is designated as K409X. In case of deletion
of Lysine in position 409 it is indicated by K409*.
[0065] The term "recombinant host cell" (or simply "host cell"), as
used herein, is intended to refer to a cell into which an
expression vector has been introduced, e.g. an expression vector
encoding an antibody of the invention. Recombinant host cells
include, for example, transfectomas, such as CHO, CHO-S, HEK,
HEK293, HEK-293F, Expi293F, PER.C6 or NSO cells, and lymphocytic
cells.
[0066] The term "treatment" refers to the administration of an
effective amount of a therapeutically active bispecific antibody of
the present invention with the purpose of easing, ameliorating,
arresting or eradicating (curing) symptoms or disease states.
[0067] The term "effective amount" or "therapeutically effective
amount" refers to an amount effective, at dosages and for periods
of time necessary, to achieve a desired therapeutic result. A
therapeutically effective amount of a bispecific antibody may vary
according to factors such as the disease state, age, sex, and
weight of the individual, and the ability of the bispecifc antibody
to elicit a desired response in the individual. A therapeutically
effective amount is also one in which any toxic or detrimental
effects of the antibody or antibody portion are outweighed by the
therapeutically beneficial effects.
[0068] The term "anti-idiotypic antibody" refers to an antibody
which recognizes unique determinants generally associated with the
antigen-binding site of an antibody.
FURTHER ASPECTS AND EMBODIMENTS OF THE INVENTION
[0069] As described above, the invention relates to a bispecific
antibody comprising two different antigen-binding regions, one
which has a binding specificity for CD3 and one which has a binding
specificity for CD20.
[0070] Thus, the invention relates to a bispecific antibody
comprising (i) a first binding arm comprising a first
antigen-binding region binding to human CD3.epsilon. (epsilon),
wherein said first antigen-binding region comprises [0071] a) heavy
chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:1, 2, and 3, respectively, and
light chain variable (VL) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NO:4, the sequence GTN, and the
sequence as set forth in SEQ ID NO:5, respectively; [0072] b) heavy
chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:1, 2, and 3, respectively, and
light chain variable (VL) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NO:4, the sequence GTN, and the
sequence as set forth in SEQ ID NO:54, respectively; [0073] c)
heavy chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:73, 2, and 3, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:4, the sequence GTN, and
the sequence as set forth in SEQ ID NO:5, wherein X2 of SEQ ID
NO:73 is selected from M and P, respectively; [0074] d) heavy chain
variable (VH) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NOs:74, 2, and 3, respectively, and light chain
variable (VL) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5, wherein X.sub.3 of SEQ ID NO:74 is A,
respectively; [0075] e) heavy chain variable (VH) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs:1,
75, and 3, respectively, and light chain variable (VL) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NO:4,
the sequence GTN, and the sequence as set forth in SEQ ID NO:5,
wherein X4 of SEQ ID NO:75 is E, respectively; [0076] f) heavy
chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:1, 2, and 77, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:4, the sequence GTN, and
the sequence as set forth in SEQ ID NO:5, wherein X.sub.6 of SEQ ID
NO:77 is selected from F, G, I, K, L and N, respectively; [0077] g)
heavy chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:1, 2, and 78, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:4, the sequence GTN, and
the sequence as set forth in SEQ ID NO:5, wherein X.sub.7 of SEQ ID
NO:78 is P, respectively; [0078] h) heavy chain variable (VH)
region CDR1, CDR2, and CDR3 having the sequences as set forth in
SEQ ID NOs:1, 2, and 79, respectively, and light chain variable
(VL) region CDR1, CDR2, and CDR3 having the sequences as set forth
in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in
SEQ ID NO:5, wherein X.sub.8 of SEQ ID NO:79 is selected from A and
G, respectively; [0079] i) heavy chain variable (VH) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs:1,
2, and 80, respectively, and light chain variable (VL) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NO:4,
the sequence GTN, and the sequence as set forth in SEQ ID NO:5,
wherein X.sub.8 of SEQ ID NO:80 is selected from M, R and V,
respectively; or [0080] j) heavy chain variable (VH) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs:55,
56 and 57, respectively, and light chain variable (VL) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NO:58,
the sequence DTS, and the sequence as set forth in SEQ ID NO:59,
respectively, and [0081] (ii) a second binding arm comprising a
second antigen-binding region binding to human CD20.
[0082] Hereby bispecific antibodies with varying binding affinities
for CD3 epsilon are provided. In one embodiment it is preferred
that the binding affinity for CD3 is lower than it is for the
parent anti-CD3 binding arm. Experimental data have shown that
bispecific CD3xCD20 antibodies as described above in c) to i)
having an anti-CD3 binding arm with a substitution which lower the
binding affinity for CD3 epsilon maintains the tumor killing
potency of the parent bispecific anti-CD3xCD20 antibody.
[0083] In one embodiment, the invention relates to a bispecific
antibody comprising (i) a first binding arm comprising a first
antigen-binding region binding to human CD3.epsilon. (epsilon),
wherein said first antigen-binding region comprises (a) heavy chain
variable (VH) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NOs:1, 2, and 3, respectively, and light chain
variable (VL) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5 or SEQ ID NO:54, respectively, or (b) heavy
chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:55, 56 and 57, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:58, the sequence DTS, and
the sequence as set forth in SEQ ID NO:59, respectively, and (ii) a
second binding arm comprising a second antigen-binding region
binding to human CD20.
[0084] In one embodiment, the invention relates to a bispecific
antibody comprising a first binding arm comprising a first
antigen-binding region binding to human CD3.epsilon. (epsilon),
wherein said first antigen-binding region comprises heavy chain
variable (VH) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NOs: 1, 2, and 3, respectively, and light chain
variable (VL) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5, respectively.
[0085] The term "binding arm comprising an antigen-binding region"
means an antibody molecule or fragment that comprises an
antigen-binding region. Thus, binding arm can be e.g. the six VH
and VL CDR regions, the VH and VL sequences, the Fab fragment or a
half-molecule antibody (i.e. comprising one heavy and one light
chain).
[0086] In one embodiment, the first antigen-binding region
comprises a first heavy chain variable sequence (VH), and a first
light chain variable sequence (VL), and the second antigen-binding
region comprises a second heavy chain variable sequence (VH), and a
second light chain variable sequence (VL).
[0087] In one embodiment, the first binding arm comprises a first
heavy chain comprising a first heavy chain variable sequence (VH)
and a first heavy chain constant sequence (CH), and a first light
chain comprising a first light chain variable sequence (VL) and a
first light chain constant sequence (CL), and (ii) the second
binding arm comprises a second heavy chain comprising a second
heavy chain variable sequence (VH) and a second heavy chain
constant sequence (CH), and a second light chain comprising a
second light chain variable sequence (VL) and a second light chain
constant sequence (CL).
[0088] In one embodiment, the bispecific antibody is a full length
antibody, such as a full length IgG1 antibody, e.g. a full length
IgG1,.lamda. (lambda),.kappa. (kappa) antibody or IgG1,.kappa.
(kappa), .kappa. (kappa) antibody.
First Binding Arm
[0089] The first binding arm comprises a first antigen-binding
region binding to human CD3.epsilon. (epsilon), wherein said first
antigen-binding region comprises [0090] a) heavy chain variable
(VH) region CDR1, CDR2, and CDR3 having the sequences as set forth
in SEQ ID NOs:1, 2, and 3, respectively, and light chain variable
(VL) region CDR1, CDR2, and CDR3 having the sequences as set forth
in SEQ ID NO:4, the sequence GTN, and the sequence as set forth in
SEQ ID NO:5, respectively; [0091] b) heavy chain variable (VH)
region CDR1, CDR2, and CDR3 having the sequences as set forth in
SEQ ID NOs:1, 2, and 3, respectively, and light chain variable (VL)
region CDR1, CDR2, and CDR3 having the sequences as set forth in
SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ
ID NO:54, respectively; [0092] c) heavy chain variable (VH) region
CDR1, CDR2, and CDR3 having the sequences as set forth in SEQ ID
NOs:73, 2, and 3, respectively, and light chain variable (VL)
region CDR1, CDR2, and CDR3 having the sequences as set forth in
SEQ ID NO:4, the sequence GTN, and the sequence as set forth in SEQ
ID NO:5, wherein X.sub.2 of SEQ ID NO:73 is selected from M and P,
respectively; [0093] d) heavy chain variable (VH) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs:74,
2, and 3, respectively, and light chain variable (VL) region CDR1,
CDR2, and CDR3 having the sequences as set forth in SEQ ID NO:4,
the sequence GTN, and the sequence as set forth in SEQ ID NO:5,
wherein X.sub.3 of SEQ ID NO:74 is A; [0094] e) heavy chain
variable (VH) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NOs:1, 75, and 3, respectively, and light chain
variable (VL) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5, wherein X.sub.4 of SEQ ID NO:75 is E; [0095]
f) heavy chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:1, 2, and 77, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:4, the sequence GTN, and
the sequence as set forth in SEQ ID NO:5, wherein X.sub.6 of SEQ ID
NO:77 is selected from F, G, I, K, L and N, respectively; [0096] g)
heavy chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:1, 2, and 78, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:4, the sequence GTN, and
the sequence as set forth in SEQ ID NO:5, wherein X.sub.7 of SEQ ID
NO:78 is P; [0097] h) heavy chain variable (VH) region CDR1, CDR2,
and CDR3 having the sequences as set forth in SEQ ID NOs:1, 2, and
79, respectively, and light chain variable (VL) region CDR1, CDR2,
and CDR3 having the sequences as set forth in SEQ ID NO:4, the
sequence GTN, and the sequence as set forth in SEQ ID NO:5, wherein
X.sub.8 of SEQ ID NO:79 is selected from A and G, respectively;
[0098] i) heavy chain variable (VH) region CDR1, CDR2, and CDR3
having the sequences as set forth in SEQ ID NOs:1, 2, and 80,
respectively, and light chain variable (VL) region CDR1, CDR2, and
CDR3 having the sequences as set forth in SEQ ID NO:4, the sequence
GTN, and the sequence as set forth in SEQ ID NO:5, wherein X.sub.8
of SEQ ID NO:80 is selected from M, R and V, respectively; or
[0099] j) heavy chain variable (VH) region CDR1, CDR2, and CDR3
having the sequences as set forth in SEQ ID NOs:55, 56 and 57,
respectively, and light chain variable (VL) region CDR1, CDR2, and
CDR3 having the sequences as set forth in SEQ ID NO:58, the
sequence DTS, and the sequence as set forth in SEQ ID NO:59,
respectively.
[0100] In one embodiment, the first binding arm comprises a first
antigen-binding region binding to human CD3.epsilon. (epsilon),
wherein said first antigen-binding region comprises (a) heavy chain
variable (VH) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NOs:1, 2, and 3, respectively, and light chain
variable (VL) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5 or SEQ ID NO:54, respectively, or (b) heavy
chain variable (VH) region CDR1, CDR2, and CDR3 having the
sequences as set forth in SEQ ID NOs:55, 56 and 57, respectively,
and light chain variable (VL) region CDR1, CDR2, and CDR3 having
the sequences as set forth in SEQ ID NO:58, the sequence DTS, and
the sequence as set forth in SEQ ID NO:59, respectively.
[0101] In one embodiment, the first binding arm comprises a first
antigen-binding region binding to human CD3.epsilon. (epsilon),
wherein said first antigen-binding region comprises heavy chain
variable (VH) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NOs:1, 2, and 3, respectively, and light chain
variable (VL) region CDR1, CDR2, and CDR3 having the sequences as
set forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5, respectively.
[0102] The six CDR sequences as defined in (a) above are derived
from a mouse antibody denoted SP34. Humanized versions of this
antibody have been generated, and the humanized antibodies are
denoted huCD3 herein and are further disclosed in WO2015001085
(Genmab).
[0103] The six CDR sequences as defined in (b) above are derived
from huCLB-T3/4. huCLB-T3/4 is a humanized version of the murine
CD3 antibody CLB-T3/4 (Parren et al., Res Immunol. 1991,
142(9):749-63, hereby incorporated by reference in its entirety,
including sequence disclosures). Briefly, the CLB-T3/4 murine VH
and VL sequences as published in Parren et al. (1991) were aligned
to the human VH and VL repertoires using the IMGTs V-QUEST. The
closest human germlines that were found were IGHV3-21*01 for the VH
gene and IGKV3-11*01(+IGKJ4*02) for the VL gene. All amino acid
residues in the murine VH and VL sequences that differed were
replaced by the human equivalent, except for those within the CDR
regions of CLB-T3/4. As no related J-region was found for the VH
sequence, the common WGQGTLVTVSS sequence was used for the FR4
region of the heavy chain. Both sequences were cloned into the
relevant expression vectors and expressed by cotransfection in
HEK293F cells. huCLB-T3/4 has a VH region comprising the sequence
set forth in SEQ ID NO: 17 (VH huCLB-T3/4) and a VL region
comprising the sequence set forth in SEQ ID NO:18 (VL huCLB-T3/4).
huCLB-T3/4 has the VH CDR1, CDR2 and CDR3 sequences set forth in
SEQ ID NOs:55, 56 and 57, respectively, and the VL CDR1, CDR2 and
CDR3 sequences set forth in SEQ ID NO:58, the sequence DTS, and the
sequence set forth in SEQ ID NO:59, respectively.
[0104] The various humanized huCD3 antibodies and huCLB-T3/4 bind
to human CD3.epsilon. (epsilon).
[0105] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first heavy chain
variable sequence (VH), wherein said VH sequence has at least 90%,
at least 95%, at least 97%, or at least 99% amino acid sequence
identity to the amino acid sequence as set forth in the VH
sequences selected from the group consisting of: [0106] a) a VH
sequence as set forth in SEQ ID NO:6; [0107] b) a VH sequence as
set forth in SEQ ID NO:7; [0108] c) a VH sequence as set forth in
SEQ ID NO:8; [0109] d) a VH sequence as set forth in SEQ ID NO:9;
and [0110] e) a VH sequence as set forth in SEQ ID NO: 17.
[0111] In one embodiment, the VH sequence of the first
antigen-binding region is selected from the group consisting of:
[0112] a) a VH sequence as set forth in SEQ ID NO:6; [0113] b) a VH
sequence as set forth in SEQ ID NO:7; [0114] c) a VH sequence as
set forth in SEQ ID NO:8; [0115] d) a VH sequence as set forth in
SEQ ID NO:9; [0116] e) a VH sequence as set forth in SEQ ID NO:
17.
[0117] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first VL sequence
of the first antigen-binding region, wherein said VL sequence has
at least 90%, at least 95%0, at least 97%0, or at least 99%0 amino
acid sequence identity to the amino acid sequence as set forth in
the VL sequences selected from the group consisting of: [0118] a) a
VL sequence as set forth in SEQ ID NO: 10; [0119] b) a VL sequence
as set forth in SEQ ID NO:11; [0120] c) a VL sequence as set forth
in SEQ ID NO: 12; and [0121] d) a VL sequence as set forth in SEQ
ID NO: 18.
[0122] In one embodiment, the VL sequence of the first
antigen-binding region is selected from the group consisting of:
[0123] a VL sequence as set forth in SEQ ID NO: 10; [0124] a) a VL
sequence as set forth in SEQ ID NO:11; [0125] b) a VL sequence as
set forth in SEQ ID NO: 12; and [0126] c) a VL sequence as set
forth in SEQ ID NO: 18.
[0127] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises first VH and VL
sequences, wherein said VH and VL sequences of the first
antigen-binding region are selected from the group consisting of:
[0128] a) a VH sequence as set forth in SEQ ID NO:6, and a VL
sequence as set forth in SEQ ID NO:10; [0129] b) a VH sequence as
set forth in SEQ ID NO:8, and a VL sequence as set forth in SEQ ID
NO:10; [0130] c) a VH sequence as set forth in SEQ ID NO:9, and a
VL sequence as set forth in SEQ ID NO:10; [0131] d) a VH sequence
as set forth in SEQ ID NO:6, and a VL sequence as set forth in SEQ
ID NO:11; [0132] e) a VH sequence as set forth in SEQ ID NO:6, and
a VL sequence as set forth in SEQ ID NO:12; [0133] f) a VH sequence
as set forth in SEQ ID NO:7, and a VL sequence as set forth in SEQ
ID NO:10; [0134] g) a VH sequence as set forth in SEQ ID NO:7, and
a VL sequence as set forth in SEQ ID NO:11; [0135] h) a VH sequence
as set forth in SEQ ID NO:7, and a VL sequence as set forth in SEQ
ID NO:12; [0136] i) a VH sequence as set forth in SEQ ID NO:8, and
a VL sequence as set forth in SEQ ID NO:11; [0137] j) a VH sequence
as set forth in SEQ ID NO:8, and a VL sequence as set forth in SEQ
ID NO:12; [0138] k) a VH sequence as set forth in SEQ ID NO:9, and
a VL sequence as set forth in SEQ ID NO:11; [0139] l) a VH sequence
as set forth in SEQ ID NO:9, and a VL sequence as set forth in SEQ
ID NO:12; and [0140] m) a VH sequence as set forth in SEQ ID NO:17,
and a VL sequence as set forth in SEQ ID NO:18.
[0141] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises first VH and VL
sequences, wherein said VH and VL sequences of the first
antigen-binding region are selected from the group consisting of:
[0142] a) a VH sequence as set forth in SEQ ID NO:6, and a VL
sequence as set forth in SEQ ID NO:10; [0143] b) a VH sequence as
set forth in SEQ ID NO:17, and a VL sequence as set forth in SEQ ID
NO:18 In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises first VH and VL
sequences as set forth in SEQ ID Nos: 17 and 18.
[0144] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed comprises a first antigen-binding
region having at least 90% sequence identity to the VH sequence is
as set forth in SEQ ID NO:6, and at least 90% sequence identity to
the VL sequence is as set forth in SEQ ID NO:10. In one embodiment
the sequence deviations are in the framework sequences and not in
the CDR sequences. Accordingly, in one embodiment, the invention
relates to a bispecific antibody comprising a first antigen-binding
region having at least 90% sequence identity to the VH sequence is
as set forth in SEQ ID NO:6, and at least 90% sequence identity to
the VL sequence is as set forth in SEQ ID NO:10 wherein the CDR
sequences are as set forth in SEQ ID NOs:1, 2, and 3, for the heavy
chain and as set forth in SEQ ID NO:4, the sequence GTN, and the
sequence as set forth in SEQ ID NO:5 for the light chain so that
the CDR sequences are unmutated.
[0145] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed comprises a first antigen-binding
region having at least 95% sequence identity to the VH sequence is
as set forth in SEQ ID NO:6, and at least 95%0 sequence identity to
the VL sequence is as set forth in SEQ ID NO: 10. In one
embodiment, the invention relates to a bispecific antibody
comprising a first antigen-binding region having at least 95%0
sequence identity to the VH sequence is as set forth in SEQ ID
NO:6, and at least 95%0 sequence identity to the VL sequence is as
set forth in SEQ ID NO: 10 wherein the CDR sequences are as set
forth in SEQ ID NOs: 1, 2, and 3, for the heavy chain and as set
forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5 for the light chain so that the CDR sequences
are unmutated.
[0146] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed comprises a first antigen-binding
region having at least 97%0 sequence identity to the VH sequence is
as set forth in SEQ ID NO:6, and at least 97%0 sequence identity to
the VL sequence is as set forth in SEQ ID NO: 10. In one
embodiment, the invention relates to a bispecific antibody
comprising a first antigen-binding region having at least 97%0
sequence identity to the VH sequence is as set forth in SEQ ID
NO:6, and at least 97%0 sequence identity to the VL sequence is as
set forth in SEQ ID NO: 10 wherein the CDR sequences are as set
forth in SEQ ID NOs: 1, 2, and 3, for the heavy chain and as set
forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5 for the light chain so that the CDR sequences
are unmutated.
[0147] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed comprises a first antigen-binding
region having at least 98%0 sequence identity to the VH sequence is
as set forth in SEQ ID NO:6, and at least 98%0 sequence identity to
the VL sequence is as set forth in SEQ ID NO: 10. In one
embodiment, the invention relates to a bispecific antibody
comprising a first antigen-binding region having at least 98%0
sequence identity to the VH sequence is as set forth in SEQ ID
NO:6, and at least 98%0 sequence identity to the VL sequence is as
set forth in SEQ ID NO: 10 wherein the CDR sequences are as set
forth in SEQ ID NOs: 1, 2, and 3, for the heavy chain and as set
forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5 for the light chain so that the CDR sequences
are unmutated.
[0148] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed comprises a first antigen-binding
region having at least 99%0 sequence identity to the VH sequence is
as set forth in SEQ ID NO:6, and at least 99%0 sequence identity to
the VL sequence is as set forth in SEQ ID NO: 10. In one
embodiment, the invention relates to a bispecific antibody
comprising a first antigen-binding region having at least 99%
sequence identity to the VH sequence is as set forth in SEQ ID
NO:6, and at least 99% sequence identity to the VL sequence is as
set forth in SEQ ID NO: 10 wherein the CDR sequences are as set
forth in SEQ ID NOs: 1, 2, and 3, for the heavy chain and as set
forth in SEQ ID NO:4, the sequence GTN, and the sequence as set
forth in SEQ ID NO:5 for the light chain so that the CDR sequences
are unmutated.
[0149] Hereby bispecific antibodies of the invention are provided
wherein the VH and VL sequences may vary within at least 90%
sequence identity to the parent sequences. It is preferred that the
variants have the same properties as the parent antibodies. In
certain embodiments the sequences only vary in the framework
sequences so that the CDR sequences are identical to the parent CDR
sequences.
[0150] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first antigen-binding
region comprises the VH sequence is as set forth in SEQ ID NO:6,
and the VL sequence is as set forth in SEQ ID NO:10.
[0151] In one embodiment, the first binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a mouse antibody.
[0152] In one embodiment, the first binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a humanized antibody.
[0153] In one embodiment, the first binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a full-length antibody.
[0154] In one embodiment, the first binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a full-length IgG1,A (lambda) or IgG1, K (kappa)
antibody.
Second Binding Arm
[0155] Suitable CD20 antibodies for use as the second binding arm
in the bispecific antibodies according to the invention are CD20
antibodies, which bind to an epitope on human CD20, which does not
comprise or require the amino acid residues alanine at position 170
or proline at position 172, but which comprises or requires the
amino acid residues asparagine at position 163 and asparagine at
position 166. Examples of such antibodies are the antibodies
denoted 2F2 and 7D8 as disclosed in WO2004035607 (Genmab) and the
antibody denoted 2C6 as disclosed in WO2005103081 (Genmab). The CDR
sequences of 2F2, 7D8 and 2C6 are disclosed in Table 1.
[0156] Further suitable CD20 antibodies for use as the second
binding arm in the bispecific antibodies according to the invention
are CD20 antibodies, which bind to an epitope on human CD20, which
does not comprise or require the amino acid residues alanine at
position 170 or proline at position 172. An example of such an
antibody is 11B8 as disclosed in WO2004035607 (Genmab). The CDR
sequences of 11B8 are disclosed in Table 1.
[0157] Further suitable CD20 antibodies for use as the second
antigen-binding region in the bispecific antibodies according to
the invention are CD20 antibodies with a low functional off-rate
meaning that the antibodies are slowly dissociated from CD20 upon
binding.
[0158] The k.sub.d dissociation constant or k.sub.off rate may be
determined by the method described under the heading "Dissociation
rates of anti-CD20 F(ab).sub.2 fragments" in Example 5 of
WO2004035607. Thus, in one embodiment, the CD20 antibodies have a
k.sub.d dissociation constant of 1.0 x.sup.-4 sec or below, such as
of 8.0.times.10.sup.-5 sec.sup.-1 or below, such as in the range of
8.0.times.10.sup.-5 sec.sup.-1 to 4.0.times.10.sup.-5 sec.sup.-1 as
determined by the above method.
[0159] Further suitable CD20 antibodies for use as the second
binding arm in the bispecific antibodies according to the invention
are CD20 antibodies having the six CDR sequences of the antibody
denoted 11B8 as disclosed in WO2004035607. The CDR sequences of
11B8 are disclosed in Table 1.
[0160] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a second
antigen-binding region which binds to human CD20, which second
antigen-binding region comprises heavy chain variable (VH) region
CDR1, CDR2, and CDR3 having the sequences selected from: [0161] (i)
the VH CDR1 region of SEQ ID NO:32, the VH CDR2 region of SEQ ID
NO:33, the VH CDR3 region of SEQ ID NO:34, [0162] (ii) the VH CDR1
region of SEQ ID NO:38, the VH CDR2 region of SEQ ID NO:39, the VH
CDR3 region of SEQ ID NO:34, [0163] (iii) the VH CDR1 region of SEQ
ID NO:42, the VH CDR2 region of SEQ ID NO:43, the VH CDR3 region of
SEQ ID NO:44, or [0164] (iv) the VH CDR1 region of SEQ ID NO:49,
the VH CDR2 region of SEQ ID NO:50, the VH CDR3 region of SEQ ID
NO:51.
[0165] In a preferred embodiment, the bispecific antibody as
defined in any of the embodiments disclosed herein comprises a
second antigen-binding region comprising the VH CDR1 region of SEQ
ID NO:32, the VH CDR2 region of SEQ ID NO:33, and the VH CDR3
region of SEQ ID NO:34.
[0166] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a second
antigen-binding region which binds to human CD20, which second
antigen-binding region comprises heavy chain variable (VH) region
CDR1, CDR2, and CDR3 and chain variable (LH) region CDR1, CDR2, and
CDR3 sequences selected from: [0167] (i) the VH CDR1 region of SEQ
ID NO:32, the VH CDR2 region of SEQ ID NO:33, the VH CDR3 region of
SEQ ID NO:34, the VL CDR1 region of SEQ ID NO:35, the VL CDR2
region of DAS, and the VL CDR3 region of SEQ ID NO:36, [0168] (ii)
the VH CDR1 region of SEQ ID NO:38, the VH CDR2 region of SEQ ID
NO:39, the VH CDR3 region of SEQ ID NO:34, the VL CDR1 region of
SEQ ID NO:35, the VL CDR2 region of DAS, and the VL CDR3 region of
SEQ ID NO:36, [0169] (iii) the VH CDR1 region of SEQ ID NO:42, the
VH CDR2 region of SEQ ID NO:43, the VH CDR3 region of SEQ ID NO:44,
the VL CDR1 region of SEQ ID NO:45, the VL CDR2 region of DAS, and
the VL CDR3 region of SEQ ID NO:46, [0170] (iv) the VH CDR1 region
of SEQ ID NO:49, the VH CDR2 region of SEQ ID NO:50, the VH CDR3
region of SEQ ID NO:51, the VL CDR1 region of SEQ ID NO:52, the VL
CDR2 region of DAS, and the VL CDR3 region of SEQ ID NO:53, [0171]
(v) the VH CDR1 region of SEQ ID NO:32, the VH CDR2 region of SEQ
ID NO:33, the VH CDR3 region of SEQ ID NO:34, the VL CDR1 region of
SEQ ID NO:45, the VL CDR2 region of DAS, and the VL CDR3 region of
SEQ ID NO:46, [0172] (vi) the VH CDR1 region of SEQ ID NO:32, the
VH CDR2 region of SEQ ID NO:33, the VH CDR3 region of SEQ ID NO:34,
the VL CDR1 region of SEQ ID NO:52, the VL CDR2 region of DAS, and
the VL CDR3 region of SEQ ID NO:53, [0173] (vii) the VH CDR1 region
of SEQ ID NO:38, the VH CDR2 region of SEQ ID NO:39, the VH CDR3
region of SEQ ID NO:34, the VL CDR1 region of SEQ ID NO:45, the VL
CDR2 region of DAS, and the VL CDR3 region of SEQ ID NO:46, [0174]
(viii) the VH CDR1 region of SEQ ID NO:38, the VH CDR2 region of
SEQ ID NO:39, the VH CDR3 region of SEQ ID NO:34, the VL CDR1
region of SEQ ID NO:52, the VL CDR2 region of DAS, and the VL CDR3
region of SEQ ID NO:53, [0175] (ix) the VH CDR1 region of SEQ ID
NO:42, the VH CDR2 region of SEQ ID NO:43, the VH CDR3 region of
SEQ ID NO:44, the VL CDR1 region of SEQ ID NO:35, the VL CDR2
region of DAS, and the VL CDR3 region of SEQ ID NO:36, [0176] (x)
the VH CDR1 region of SEQ ID NO:42, the VH CDR2 region of SEQ ID
NO:43, the VH CDR3 region of SEQ ID NO:44, the VL CDR1 region of
SEQ ID NO:52, the VL CDR2 region of DAS, and the VL CDR3 region of
SEQ ID NO:53, [0177] (xi) the VH CDR1 region of SEQ ID NO:49, the
VH CDR2 region of SEQ ID NO:50, the VH CDR3 region of SEQ ID NO:51,
the VL CDR1 region of SEQ ID NO:35, the VL CDR2 region of DAS, and
the VL CDR3 region of SEQ ID NO:36, or [0178] (xii) the VH CDR1
region of SEQ ID NO:49, the VH CDR2 region of SEQ ID NO:50, the VH
CDR3 region of SEQ ID NO:51, the VL CDR1 region of SEQ ID NO:45,
the VL CDR2 region of DAS, and the VL CDR3 region of SEQ ID
NO:46.
[0179] In a preferred embodiment, the bispecific antibody as
defined in any of the embodiments as disclosed herein comprises a
second antigen-binding region comprising the VH CDR1 region of SEQ
ID NO:32, the VH CDR2 region of SEQ ID NO:33, the VH CDR3 region of
SEQ ID NO:34, the VL CDR1 region of SEQ ID NO:35, the VL CDR2
region of DAS, and the VL CDR3 region of SEQ ID NO:36.
[0180] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a VH sequence which
has at least 90%, at least 95%, at least 97%, or at least 99% amino
acid sequence identity to the amino acid sequence as set forth in
SEQ ID NO:27, and a VL sequence which has at least 90%, at least
95%, at least 97%, or at least 99% amino acid sequence identity to
the amino acid sequence as set forth in SEQ ID NO:28.
In one embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:37, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:28. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:40, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:41. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:47, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:48. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:27, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:41. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:27, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:48. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:37, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:41. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:37, and a a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:48. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:40, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:28. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:40, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:48. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:47, and a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:28. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises a VH sequence which has at
least 90%, at least 95%, at least 97%, or at least 99% amino acid
sequence identity to the amino acid sequence as set forth in SEQ ID
NO:47, and a a VL sequence which has at least 90%, at least 95%, at
least 97%, or at least 99% amino acid sequence identity to the
amino acid sequence as set forth in SEQ ID NO:41. In one
embodiment, the bispecific antibody as defined in any of the
embodiments disclosed herein comprises second VH and VL sequences,
wherein said VH and VL sequences of the second antigen-binding
region are selected from the group consisting of: [0181] (i) the VH
sequence of SEQ ID NO:27, and the VL sequence of SEQ ID NO:28,
[0182] (ii) the VH sequence of SEQ ID NO:37, and the VL sequence of
SEQ ID NO:28, [0183] (iii) the VH sequence of SEQ ID NO:40, and the
VL sequence of SEQ ID NO:41, [0184] (iv) the VH sequence of SEQ ID
NO:47, and the VL sequence of SEQ ID NO:48, [0185] (v) the VH
sequence of SEQ ID NO:27, and the VL sequence of SEQ ID NO:41,
[0186] (vi) the VH sequence of SEQ ID NO:27, and the VL sequence of
SEQ ID NO:48, [0187] (vii) the VH sequence of SEQ ID NO:37, and the
VL sequence of SEQ ID NO:41, [0188] (viii) the VH sequence of SEQ
ID NO:37, and the VL sequence of SEQ ID NO:48, [0189] (ix) the VH
sequence of SEQ ID NO:40, and the VL sequence of SEQ ID NO:28,
[0190] (x) the VH sequence of SEQ ID NO:40, and the VL sequence of
SEQ ID NO:48, [0191] (xi) the VH sequence of SEQ ID NO:47, and the
VL sequence of SEQ ID NO:28, or [0192] (xii) the VH sequence of SEQ
ID NO:47, and the VL sequence of SEQ ID NO:41.
[0193] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the second antigen-binding
region comprises the VH sequence of SEQ ID NO:27, and the VL
sequence of SEQ ID NO:28.
[0194] In one embodiment, the second binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a human antibody.
[0195] In one embodiment, the second binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a full-length antibody.
[0196] In one embodiment, the second binding arm of the bispecific
antibody as defined in any of the embodiments disclosed herein is
derived from a IgG1, K (kappa) antibody.
Bispecific Antibody Formats
[0197] The present invention provides bispecific CD3xCD20
antibodies which efficiently promote T cell-mediated killing of
CD20-expressing tumor cells. Depending on the desired functional
properties for a particular use, particular antigen-binding regions
can be selected from the set of antibodies or antigen-binding
regions provided by the present invention. Many different formats
and uses of bispecific antibodies are known in the art, and were
reviewed by Kontermann; Drug Discov Today, 2015 July; 20(7):838-47
and; MAbs, 2012 March-April; 4(2):182-97.
[0198] A bispecific antibody according to the present invention is
not limited to any particular bispecific format or method of
producing it.
[0199] Examples of bispecific antibody molecules which may be used
in the present invention comprise (i) a single antibody that has
two arms comprising different antigen-binding regions; (ii) a
single chain antibody that has specificity to two different
epitopes, e.g., via two scFvs linked in tandem by an extra peptide
linker; (iii) a dual-variable-domain antibody (DVD-Ig), where each
light chain and heavy chain contains two variable domains in tandem
through a short peptide linkage (Wu et al., Generation and
Characterization of a Dual Variable Domain Immunoglobulin
(DVD-Ig.TM.) Molecule, In: Antibody Engineering, Springer Berlin
Heidelberg (2010)); (iv) a chemically-linked bispecific (Fab')2
fragment; (v) a Tandab, which is a fusion of two single chain
diabodies resulting in a tetravalent bispecific antibody that has
two binding sites for each of the target antigens; (vi) a
flexibody, which is a combination of scFvs with a diabody resulting
in a multivalent molecule; (vii) a so-called "dock and lock"
molecule, based on the "dimerization and docking domain" in Protein
Kinase A, which, when applied to Fabs, can yield a trivalent
bispecific binding protein consisting of two identical Fab
fragments linked to a different Fab fragment; (viii) a so-called
Scorpion molecule, comprising, e.g., two scFvs fused to both
termini of a human Fab-arm; and (ix) a diabody.
[0200] In one embodiment, the bispecific antibody of the present
invention is a diabody, a cross-body, or a bispecific antibody
obtained via a controlled Fab-arm exchange (such as described in
WO2011131746 (Genmab)).
[0201] Examples of different classes of bispecific antibodies
include but are not limited to (i) IgG-like molecules with
complementary CH3 domains to force heterodimerization; (ii)
recombinant IgG-like dual targeting molecules, wherein the two
sides of the molecule each contain the Fab fragment or part of the
Fab fragment of at least two different antibodies; (iii) IgG fusion
molecules, wherein full length IgG antibodies are fused to extra
Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules,
wherein single chain Fv molecules or stabilized diabodies are fused
to heavy-chain constant-domains, Fc-regions or parts thereof; (v)
Fab fusion molecules, wherein different Fab-fragments are fused
together, fused to heavy-chain constant-domains, Fc-regions or
parts thereof; and (vi) ScFv- and diabody-based and heavy chain
antibodies (e.g., domain antibodies, nanobodies) wherein different
single chain Fv molecules or different diabodies or different
heavy-chain antibodies (e.g. domain antibodies, nanobodies) are
fused to each other or to another protein or carrier molecule fused
to heavy-chain constant-domains, Fc-regions or parts thereof.
[0202] Examples of IgG-like molecules with complementary CH3 domain
molecules include but are not limited to the Triomab/Quadroma
molecules (Trion Pharma/Fresenius Biotech; Roche, WO2011069104),
the so-called Knobs-into-Holes molecules (Genentech, WO9850431),
CrossMAbs (Roche, WO2011117329) and the electrostatically-matched
molecules (Amgen, EP1870459 and WO2009089004; Chugai,
US201000155133; Oncomed, WO2010129304), the LUZ-Y molecules
(Genentech, Wranik et al. J. Biol. Chem. 2012, 287(52): 43331-9,
doi: 10.1074/jbc.M112.397869. Epub 2012 Nov. 1), DIG-body and
PIG-body molecules (Pharmabcine, WO2010134666, WO2014081202), the
Strand Exchange Engineered Domain body (SEEDbody) molecules (EMD
Serono, WO2007110205), the Biclonics molecules (Merus,
WO2013157953), Fc.DELTA.Adp molecules (Regeneron, WO201015792),
bispecific IgG1 and IgG2 molecules (Pfizer/Rinat, WO11143545),
Azymetric scaffold molecules (Zymeworks/Merck, WO2012058768),
mAb-Fv molecules (Xencor, WO2011028952), bivalent bispecific
antibodies (WO2009080254) and the DuoBody.RTM. molecules (Genmab
A/S, WO2011131746).
[0203] Examples of recombinant IgG-like dual targeting molecules
include but are not limited to Dual Targeting (DT)-Ig molecules
(WO2009058383), Two-in-one Antibody (Genentech; Bostrom, et al
2009. Science 323, 1610-1614), Cross-linked Mabs (Karmanos Cancer
Center), mAb2 (F-Star, WO2008003116), Zybody molecules (Zyngenia;
LaFleur et al. MAbs. 2013 March-April; 5(2):208-18), approaches
with common light chain (Crucell/Merus, U.S. Pat. No. 7,262,028),
KiBodies (NovImmune, WO2012023053) and CovX-body (CovX/Pfizer;
Doppalapudi, V. R., et al 2007. Bioorg. Med. Chem. Lett. 17,
501-506).
[0204] Examples of IgG fusion molecules include but are not limited
to Dual Variable Domain (DVD)-Ig molecules (Abbott, U.S. Pat. No.
7,612,181), Dual domain double head antibodies (Unilever; Sanofi
Aventis, WO20100226923), IgG-like Bispecific molecules (ImClone/Eli
Lilly, Lewis et al. Nat Biotechnol. 2014 February; 32(2):191-8),
Ts2Ab (MedImmune/AZ; Dimasi et al. J Mol Biol. 2009 Oct. 30;
393(3):672-92) and BsAb molecules (Zymogenetics, WO2010111625),
HERCULES molecules (Biogen Idec, US007951918), scFv fusion
molecules (Novartis), scFv fusion molecules (Changzhou Adam Biotech
Inc, CN 102250246) and TvAb molecules (Roche, WO2012025525,
WO2012025530).
[0205] Examples of Fc fusion molecules include but are not limited
to ScFv/Fc Fusions (Pearce et al., Biochem Mol Biol Int. 1997
September; 42(6):1179-88), SCORPION molecules (Emergent
BioSolutions/Trubion, Blankenship J W, et al. AACR 100 th Annual
meeting 2009 (Abstract #5465); Zymogenetics/BMS, WO2010111625),
Dual Affinity Retargeting Technology (Fc-DART) molecules
(MacroGenics, WO2008157379, WO2010080538) and Dual(ScFv)2-Fab
molecules (National Research Center for Antibody
Medicine--China).
[0206] Examples of Fab fusion bispecific antibodies include but are
not limited to F(ab)2 molecules (Medarex/AMGEN; Deo et al J
Immunol. 1998 Feb. 15; 160(4):1677-86), Dual-Action or Bis-Fab
molecules (Genentech, Bostrom, et al 2009. Science 323, 1610-1614),
Dock-and-Lock (DNL) molecules (ImmunoMedics, WO2003074569,
WO2005004809), Bivalent Bispecific molecules (Biotecnol,
Schoonjans, J Immunol. 2000 Dec. 15; 165(12):7050-7) and Fab-Fv
molecules (UCB-Celltech, WO 2009040562 A1).
[0207] Examples of ScFv-, diabody-based and domain antibodies
include but are not limited to Bispecific T Cell Engager (BiTE)
molecules (Micromet, WO2005061547), Tandem Diabody molecules
(TandAb) (Affimed) Le Gall et al., Protein Eng Des Sel. 2004 April;
17(4):357-66), Dual Affinity Retargeting Technology (DART)
molecules (MacroGenics, WO2008157379, WO2010080538), Single-chain
Diabody molecules (Lawrence, FEBS Lett. 1998 Apr. 3;
425(3):479-84), TCR-like Antibodies (AIT, ReceptorLogics), Human
Serum Albumin ScFv Fusion (Merrimack, WO2010059315) and COMBODY
molecules (Epigen Biotech, Zhu et al. Immunol Cell Biol. 2010
August; 88(6):667-75), dual targeting nanobodies (Ablynx, Hmila et
al., FASEB J. 2010) and dual targeting heavy chain only domain
antibodies.
[0208] In one aspect, the bispecific antibody of the invention
comprises a first Fc-region comprising a first CH3 region, and a
second Fc-region comprising a second CH3 region, wherein the
sequences of the first and second CH3 regions are different and are
such that the heterodimeric interaction between said first and
second CH3 regions is stronger than each of the homodimeric
interactions of said first and second CH3 regions. More details on
these interactions and how they can be achieved are provided in
WO2011131746 and WO2013060867 (Genmab), which are hereby
incorporated by reference.
[0209] As described further herein, a stable bispecific CD3xCD20
antibody can be obtained at high yield using a particular method on
the basis of one homodimeric starting CD20 antibody and one
homodimeric starting CD3 antibody containing only a few, fairly
conservative, asymmetrical mutations in the CH3 regions.
Asymmetrical mutations mean that the sequences of said first and
second CH3 regions contain amino acid substitutions at
non-identical positions.
[0210] In one aspect, the bispecific antibody as defined in any of
the embodiments disclosed herein comprises first and second heavy
chains, wherein each of said first and second heavy chain comprises
at least a hinge region, a CH2 and CH3 region, wherein in said
first heavy chain at least one of the amino acids in the positions
corresponding to a positions selected from the group consisting of
T366, L368, K370, D399, F405, Y407, and K409 in a human IgG1 heavy
chain has been substituted, and in said second heavy chain at least
one of the amino acids in the positions corresponding to a position
selected from the group consisting of T366, L368, K370, D399, F405,
Y407, and K409 in a human IgG1 heavy chain has been substituted,
and wherein said first and said second heavy chains are not
substituted in the same positions.
[0211] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises first and second
heavy chains, wherein (i) the amino acid in the position
corresponding to F405 in a human IgG1 heavy chain is L in said
first heavy chain, and the amino acid in the position corresponding
to K409 in a human IgG1 heavy chain is R in said second heavy
chain, or (ii) the amino acid in the position corresponding to K409
in a human IgG1 heavy chain is R in said first heavy chain, and the
amino acid in the position corresponding to F405 in a human IgG1
heavy chain is L in said second heavy chain.
[0212] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at a position selected from the group
consisting of: 366, 368, 370, 399, 405, 407 and 409, and the second
Fc-region has an amino acid substitution at a position selected
from the group consisting of: 366, 368, 370, 399, 405, 407 and 409,
and wherein the first and second Fc-regions are not substituted in
the same positions.
[0213] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 366, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 368, 370, 399, 405, 407 and 409. In one
embodiment the amino acid at position 366 is selected from Ala,
Asp, Glu, His, Asn, Val, or Gln.
[0214] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 368, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 366, 370, 399, 405, 407 and 409.
[0215] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 370, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 366, 368, 399, 405, 407 and 409.
[0216] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 399, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 366, 368, 370, 405, 407 and 409.
[0217] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 405, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 366, 368, 370, 399, 407 and 409.
[0218] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 407, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 366, 368, 370, 399, 405, and 409.
[0219] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid substitution at position 409, and said second Fc-region
has an amino acid substitution at a position selected from the
group consisting of: 366, 368, 370, 399, 405, and 407.
[0220] Accordingly, in one embodiment of the bispecific antibody as
defined in any of the embodiments disclosed herein, the sequences
of said first and second CH3 regions contain asymmetrical
mutations, i.e. mutations at different positions in the two CH3
regions, e.g. a mutation at position 405 in one of the CH3 regions
and a mutation at position 409 in the other CH3 region.
[0221] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the first Fc-region has an
amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, Ile,
Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or Cys,
at position 409 and said second Fc-region has an amino-acid
substitution at a position selected from the group consisting of:
366, 368, 370, 399, 405 and 407. In one such embodiment, said first
Fc-region has an amino acid other than Lys, Leu or Met, e.g. Gly,
Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln, Pro,
Trp, Tyr, or Cys, at position 409 and said second Fc-region has an
amino acid other than Phe, e.g. Gly, Ala, Val, Ile, Ser, Thr, Lys,
Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, Cys, Lys, or Leu, at
position 405. In a further embodiment hereof, said first Fc-region
has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val,
Ile, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or
Cys, at position 409 and said second Fc-region has an amino acid
other than Phe, Arg or Gly, e.g. Leu, Ala, Val, Ile, Ser, Thr, Met,
Lys, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or Cys, at position
405.
[0222] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
comprises a Phe at position 405 and an amino acid other than Lys,
Leu or Met, e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp,
Asn, Glu, Gln, Pro, Trp, Tyr, or Cys, at position 409 and said
second Fc-region comprises an amino acid other than Phe, e.g. Gly,
Ala, Val, Ile, Ser, Thr, Lys, Arg, His, Asp, Asn, Glu, Gln, Pro,
Trp, Tyr, Leu, Met, or Cys, at position 405 and a Lys at position
409. In a further embodiment hereof, said first Fc-region comprises
a Phe at position 405 and an amino acid other than Lys, Leu or Met,
e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu,
Gln, Pro, Trp, Tyr, or Cys, at position 409 and said second
Fc-region comprises an amino acid other than Phe, Arg or Gly, e.g.
Leu, Ala, Val, Ile, Ser, Thr, Met, Lys, His, Asp, Asn, Glu, Gln,
Pro, Trp, Tyr, or Cys, at position 405 and a Lys at position
409.
[0223] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
comprises a Phe at position 405 and an amino acid other than Lys,
Leu or Met, e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp,
Asn, Glu, Gln, Pro, Trp, Tyr, or Cys, at position 409 and said
second Fc-region comprises a Leu at position 405 and a Lys at
position 409. In a further embodiment hereof, said first Fc-region
comprises a Phe at position 405 and an Arg at position 409 and said
second Fc-region comprises an amino acid other than Phe, Arg or
Gly, e.g. Leu, Ala, Val, Ile, Ser, Thr, Lys, Met, His, Asp, Asn,
Glu, Gln, Pro, Trp, Tyr, or Cys, at position 405 and a Lys at
position 409. In another embodiment, said first Fc-region comprises
Phe at position 405 and an Arg at position 409 and said second
Fc-region comprises a Leu at position 405 and a Lys at position
409.
[0224] In a further embodiment of the bispecific antibody as
defined in any of the embodiments disclosed herein, said first
Fc-region comprises an amino acid other than Lys, Leu or Met, e.g.
Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln,
Pro, Trp, Tyr, or Cys, at position 409 and said second Fc-region
comprises a Lys at position 409, a Thr at position 370 and a Leu at
position 405. In a further embodiment, said first Fc-region
comprises an Arg at position 409 and said second Fc-region
comprises a Lys at position 409, a Thr at position 370 and a Leu at
position 405.
[0225] In an even further embodiment of the bispecific antibody as
defined in any of the embodiments disclosed herein, said first
Fc-region comprises a Lys at position 370, a Phe at position 405
and an Arg at position 409 and said second Fc-region comprises a
Lys at position 409, a Thr at position 370 and a Leu at position
405.
[0226] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
comprises an amino acid other than Lys, Leu or Met, e.g. Gly, Ala,
Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp,
Tyr, or Cys, at position 409 and said second Fc-region comprises a
Lys at position 409 and: a) an Ile at position 350 and a Leu at
position 405, or b) a Thr at position 370 and a Leu at position
405.
[0227] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
comprises an Arg at position 409 and said second Fc region
comprises a Lys at position 409 and: a) an Ile at position 350 and
a Leu at position 405, or b) a Thr at position 370 and a Leu at
position 405.
[0228] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
comprises a Thr at position 350, a Lys at position 370, a Phe at
position 405 and an Arg at position 409 and said second Fc region
comprises a Lys at position 409 and: a) an Ile at position 350 and
a Leu at position 405, or b) a Thr at position 370 and a Leu at
position 405.
[0229] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
comprises a Thr at position 350, a Lys at position 370, a Phe at
position 405 and an Arg at position 409 and said second Fc-region
comprises an Ile at position 350, a Thr at position 370, a Leu at
position 405 and a Lys at position 409.
[0230] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, said first Fc-region has
an amino acid other than Lys, Leu or Met at position 409 and said
second Fc-region has an amino acid other than Phe at position 405,
such as other than Phe, Arg or Gly at position 405; or said first
CH3 region has an amino acid other than Lys, Leu or Met at position
409 and said second CH3 region has an amino acid other than Tyr,
Asp, Glu, Phe, Lys, Gln, Arg, Ser or Thr at position 407.
[0231] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region
having an amino acid other than Lys, Leu or Met at position 409 and
a second Fc-region having an amino acid other than Tyr, Asp, Glu,
Phe, Lys, Gln, Arg, Ser or Thr at position 407.
[0232] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region
having a Tyr at position 407 and an amino acid other than Lys, Leu
or Met at position 409 and a second Fc-region having an amino acid
other than Tyr, Asp, Glu, Phe, Lys, Gln, Arg, Ser or Thr at
position 407 and a Lys at position 409.
[0233] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region
having a Tyr at position 407 and an Arg at position 409 and a
second Fc-region having an amino acid other than Tyr, Asp, Glu,
Phe, Lys, Gln, Arg, Ser or Thr at position 407 and a Lys at
position 409.
[0234] In another embodiment, said first Fc-region has an amino
acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, Ile, Ser, Thr,
Phe, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or Cys, at
position 409 and said second Fc-region has an amino acid other than
Tyr, Asp, Glu, Phe, Lys, Gln, Arg, Ser or Thr, e.g. Leu, Met, Gly,
Ala, Val, Ile, His, Asn, Pro, Trp, or Cys, at position 407. In
another embodiment, said first Fc-region has an amino acid other
than Lys, Leu or Met, e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg,
His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or Cys, at position 409 and
said second Fc-region has an Ala, Gly, His, Ile, Leu, Met, Asn, Val
or Trp at position 407.
[0235] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val,
Ile, Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or
Cys, at position 409 and said second Fc-region has a Gly, Leu, Met,
Asn or Trp at position 407.
[0236] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has a Tyr at position 407 and an amino acid other than Lys, Leu or
Met, e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn,
Glu, Gln, Pro, Trp, Tyr, or Cys, at position 409 and said second
Fc-region has an amino acid other than Tyr, Asp, Glu, Phe, Lys,
Gln, Arg, Ser or Thr, e.g. Leu, Met, Gly, Ala, Val, Ile, His, Asn,
Pro, Trp, or Cys, at position 407 and a Lys at position 409.
[0237] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has a Tyr at position 407 and an amino acid other than Lys, Leu or
Met, e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn,
Glu, Gln, Pro, Trp, Tyr, or Cys, at position 409 and said second
Fc-region has an Ala, Gly, His, Ile, Leu, Met, Asn, Val or Trp at
position 407 and a Lys at position 409.
[0238] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has a Tyr at position 407 and an amino acid other than Lys, Leu or
Met, e.g. Gly, Ala, Val, Ile, Ser, Thr, Phe, Arg, His, Asp, Asn,
Glu, Gln, Pro, Trp, Tyr, or Cys, at position 409 and said second
Fc-region has a Gly, Leu, Met, Asn or Trp at position 407 and a Lys
at position 409.
[0239] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has a Tyr at position 407 and an Arg at position 409 and said
second Fc-region has an amino acid other than Tyr, Asp, Glu, Phe,
Lys, Gln, Arg, Ser or Thr, e.g. Leu, Met, Gly, Ala, Val, Ile, His,
Asn, Pro, Trp, or Cys, at position 407 and a Lys at position
409.
[0240] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has a Tyr at position 407 and an Arg at position 409 and said
second Fc-region has an Ala, Gly, His, Ile, Leu, Met, Asn, Val or
Trp at position 407 and a Lys at position 409.
[0241] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, said first Fc-region
has a Tyr at position 407 and an Arg at position 409 and said
second Fc-region has a Gly, Leu, Met, Asn or Trp at position 407
and a Lys at position 409.
[0242] In another embodiment of the bispecific antibody as defined
in any of the embodiments disclosed herein, the first Fc-region has
an amino acid other than Lys, Leu or Met, e.g. Gly, Ala, Val, Ile,
Ser, Thr, Phe, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or Cys,
at position 409, and the second Fc-region has
(i) an amino acid other than Phe, Leu and Met, e.g. Gly, Ala, Val,
Ile, Ser, Thr, Lys, Arg, His, Asp, Asn, Glu, Gln, Pro, Trp, Tyr, or
Cys, at position 368, or (ii) a Trp at position 370, or (iii) an
amino acid other than Asp, Cys, Pro, Glu or Gln, e.g. Phe, Leu,
Met, Gly, Ala, Val, Ile, Ser, Thr, Lys, Arg, His, Asn, Trp, Tyr, or
Cys, at position 399 or (iv) an amino acid other than Lys, Arg,
Ser, Thr, or Trp, e.g. Phe, Leu, Met, Ala, Val, Gly, Ile, Asn, His,
Asp, Glu, Gln, Pro, Tyr, or Cys, at position 366.
[0243] In one embodiment, the first Fc-region has an Arg, Ala, His
or Gly at position 409, and the second Fc region has
(i) a Lys, Gln, Ala, Asp, Glu, Gly, His, Ile, Asn, Arg, Ser, Thr,
Val, or Trp at position 368, or (ii) a Trp at position 370, or
(iii) an Ala, Gly, Ile, Leu, Met, Asn, Ser, Thr, Trp, Phe, His,
Lys, Arg or Tyr at position 399, or (iv) an Ala, Asp, Glu, His,
Asn, Val, Gln, Phe, Gly, Ile, Leu, Met, or Tyr at position 366.
[0244] In one embodiment, the first Fc-region has an Arg at
position 409, and the second Fc region has
(i) an Asp, Glu, Gly, Asn, Arg, Ser, Thr, Val, or Trp at position
368, or (ii) a Trp at position 370, or (iii) a Phe, His, Lys, Arg
or Tyr at position 399, or (iv) an Ala, Asp, Glu, His, Asn, Val,
Gln at position 366.
[0245] In addition to the above-specified amino-acid substitutions,
said first and second Fc regions may contain further amino-acid
substitutions, deletion or insertions relative to wild-type Fc
sequences.
[0246] In a further embodiment, said first and second Fab-arms (or
heavy chain constant domains) comprising the first and second Fc
regions comprise, except for the specified mutations, a CH3
sequence independently selected from the following: (IgG1m(a)) (SEQ
ID NO:60), (IgG1m(f)) (SEQ ID NO:61), and (IgG1m(ax) (SEQ ID
NO:62).
[0247] In one embodiment, neither said first nor said second
Fc-region comprises a Cys-Pro-Ser-Cys sequence in the (core) hinge
region.
[0248] In a further embodiment, both said first and said second
Fc-region comprise a Cys-Pro-Pro-Cys sequence in the (core) hinge
region.
[0249] In separate and specific embodiments, one or both Fab arms
comprise a heavy-chain constant region sequence independently
selected from SEQ ID NO:63, 64, 65, 66, 67, 68, 69, 70, and 71 (see
Table 1).
[0250] In one embodiment of the bispecific antibody according to
any of the embodiments as disclosed herein, (a) the first
antigen-binding region comprises heavy chain variable (VH) region
CDR1, CDR2, and CDR3 having the sequences as set forth in SEQ ID
NOs:1, 2, and 3, respectively, and light chain variable (VL) region
CDR1, CDR2, and CDR3 having the sequences as set forth in SEQ ID
NO:4, the sequence GTN, and the sequence as set forth in SEQ ID
NO:5, respectively, and (b) the second antigen-binding region which
binds to human CD20 comprises the VH CDR1 region of SEQ ID NO:32,
the VH CDR2 region of SEQ ID NO:33, the VH CDR3 region of SEQ ID
NO:34, the VL CDR1 region of SEQ ID NO:35, the VL CDR2 region of
DAS, and the VL CDR3 region of SEQ ID NO:36, respectively.
[0251] In one embodiment of the bispecific antibody according to
any of the embodiments as disclosed herein, (a) the first
antigen-binding region comprises the VH sequence as set forth in
SEQ ID NO:6, and a VL sequence as set forth in SEQ ID NO:10, and
(b) the second antigen-binding region comprises the VH sequence as
set forth in SEQ ID NO:27, and the VL sequence as set forth in SEQ
ID NO:28.
[0252] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first antigen-binding
region is a Fab arm derived from IgG1-huCD3-H1L1-FEAL, and the
second antigen-binding region is a Fab arm derived from
IgG1-7D8-FEAR.
[0253] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first binding arm is a
half-molecule antibody (i.e. comprising one heavy and one light
chain) derived from IgG1-huCD3-H1L1-FEAL, and the second binding
arm is a half-molecule antibody derived from IgG1-7D8-FEAR.
[0254] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first binding arm is a
half-molecule antibody derived from IgG1-huCD3-H1L1-FEAR, and the
second binding arm is a half-molecule antibody derived from
IgG1-7D8-FEAL.
Methods of Preparing Bispecific Antibodies
[0255] Traditional methods such as the hybrid hybridoma and
chemical conjugation methods (Marvin and Zhu (2005) Acta Pharmacol
Sin 26:649) can be used in the preparation of the bispecific
antibodies of the invention. Co-expression in a host cell of two
antibodies, consisting of different heavy and light chains, leads
to a mixture of possible antibody products in addition to the
desired bispecific antibody, which can then be isolated by, e.g.,
affinity chromatography or similar methods.
[0256] Strategies favoring the formation of a functional
bispecific, product, upon co-expression of different antibody
constructs can also be used, e.g., the method described by
Lindhofer et al. (1995 J Immunol 155:219). Fusion of rat and mouse
hydridomas producing different antibodies leads to a limited number
of heterodimeric proteins because of preferential
species-restricted heavy/light chain pairing. Another strategy to
promote formation of heterodimers over homodimers is a
"knob-into-hole" strategy in which a protuberance is introduced on
a first heavy-chain polypeptide and a corresponding cavity in a
second heavy-chain polypeptide, such that the protuberance can be
positioned in the cavity at the interface of these two heavy chains
so as to promote heterodimer formation and hinder homodimer
formation. "Protuberances" are constructed by replacing small
amino-acid side-chains from the interface of the first polypeptide
with larger side chains. Compensatory "cavities" of identical or
similar size to the protuberances are created in the interface of
the second polypeptide by replacing large amino-acid side-chains
with smaller ones (U.S. Pat. No. 5,731,168). EP1870459 (Chugai) and
WO2009089004 (Amgen) describe other strategies for favoring
heterodimer formation upon co-expression of different antibody
domains in a host cell. In these methods, one or more residues that
make up the CH3-CH3 interface in both CH3 domains are replaced with
a charged amino acid such that homodimer formation is
electrostatically unfavorable and heterodimerization is
electrostatically favorable. WO2007110205 (Merck) describe yet
another strategy, wherein differences between IgA and IgG CH3
domains are exploited to promote heterodimerization.
[0257] Another in vitro method for producing bispecific antibodies
has been described in WO2008119353 (Genmab), wherein a bispecific
antibody is formed by "Fab-arm" or "half-molecule" exchange
(swapping of a heavy chain and attached light chain) between two
monospecific IgG4- or IgG4-like antibodies upon incubation under
reducing conditions. The resulting product is a bispecific antibody
having two Fab arms which may comprise different sequences.
[0258] A preferred method for preparing the bispecific CD3xCD20
antibodies of the present invention includes the methods described
in WO2011131746 and WO13060867 (Genmab) comprising the following
steps: [0259] a) providing a first antibody comprising an Fc
region, said Fc region comprising a first CH3 region; [0260] b)
providing a second antibody comprising a second Fc region, said Fc
region comprising a second CH3 region, wherein the first antibody
is a CD3 antibody and the second antibody is a CD20 antibody, or
vice versa; [0261] wherein the sequences of said first and second
CH3 regions are different and are such that the heterodimeric
interaction between said first and second CH3 regions is stronger
than each of the homodimeric interactions of said first and second
CH3 regions; [0262] c) incubating said first antibody together with
said second antibody under reducing conditions; and [0263] d)
obtaining said bispecific CD3xCD20 antibody.
[0264] In one embodiment, the said first antibody together with
said second antibody are incubated under reducing conditions
sufficient to allow the cysteines in the hinge region to undergo
disulfide-bond isomerization, wherein the heterodimeric interaction
between said first and second antibodies in the resulting
heterodimeric antibody is such that no Fab-arm exchange occurs at
0.5 mM GSH after 24 hours at 37.degree. C.
[0265] Without being limited to theory, in step c), the heavy-chain
disulfide bonds in the hinge regions of the parent antibodies are
reduced and the resulting cysteines are then able to form inter
heavy-chain disulfide bond with cysteine residues of another parent
antibody molecule (originally with a different specificity). In one
embodiment of this method, the reducing conditions in step c)
comprise the addition of a reducing agent, e.g. a reducing agent
selected from the group consisting of: 2-mercaptoethylamine
(2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione,
tris(2-carboxyethyl)phosphine (TCEP), L-cysteine and
beta-mercapto-ethanol, preferably a reducing agent selected from
the group consisting of: 2-mercaptoethylamine, dithiothreitol and
tris(2-carboxyethyl)phosphine. In a further embodiment, step c)
comprises restoring the conditions to become non-reducing or less
reducing, for example by removal of a reducing agent, e.g. by
desalting.
[0266] For this method any of the CD3 and CD20 antibodies described
above may be used including first and second CD3 and CD20
antibodies, respectively, comprising a first and/or second Fc
region. Examples of such first and second Fc regions, including
combination of such first and second Fc regions may include any of
those described above. In a particular embodiment the first and
second CD3 and CD20 antibodies, respectively, may be chosen so as
to obtain a bispecific antibody as described herein.
[0267] In one embodiment of this method, said first and/or second
antibodies are full-length antibodies.
[0268] The Fc regions of the first and second antibodies may be of
any isotype, including, but not limited to, IgG1, IgG2, IgG3 or
IgG4. In one embodiment of this method, the Fc regions of both said
first and said second antibodies are of the IgG1 isotype. In
another embodiment, one of the Fc regions of said antibodies is of
the IgG1 isotype and the other of the IgG4 isotype. In the latter
embodiment, the resulting bispecific antibody comprises an Fc
region of an IgG1 and an Fc region of IgG4 and may thus have
interesting intermediate properties with respect to activation of
effector functions.
[0269] In a further embodiment, one of the antibody starting
proteins has been engineered to not bind Protein A, thus allowing
to separate the heterodimeric protein from said homodimeric
starting protein by passing the product over a protein A
column.
[0270] As described above, the sequences of the first and second
CH3 regions of the homodimeric starting antibodies are different
and are such that the heterodimeric interaction between said first
and second CH3 regions is stronger than each of the homodimeric
interactions of said first and second CH3 regions. More details on
these interactions and how they can be achieved are provided in
WO2011131746 and WO2013060867 (Genmab), which are hereby
incorporated by reference in their entirety.
[0271] In particular, a stable bispecific CD3xCD20 antibody can be
obtained at high yield using the above method of the invention on
the basis of two homodimeric starting antibodies which bind CD3 and
CD20, respectively, and contain only a few, fairly conservative,
asymmetrical mutations in the CH3 regions. Asymmetrical mutations
mean that the sequences of said first and second CH3 regions
contain amino acid substitutions at non-identical positions.
[0272] The bispecific antibodies of the invention may also be
obtained by co-expression of constructs encoding the first and
second polypeptides in a single cell. Thus, in a further aspect,
the invention relates to a method for producing a bispecific
antibody, said method comprising the following steps:
[0273] a) providing a first nucleic-acid construct encoding a first
polypeptide comprising a first Fc region and a first
antigen-binding region of a first antibody heavy chain, said first
Fc region comprising a first CH3 region,
[0274] b) providing a second nucleic-acid construct encoding a
second polypeptide comprising a second Fc region and a second
antigen-binding region of a second antibody heavy chain, said
second Fc region comprising a second CH3 region,
[0275] wherein the sequences of said first and second CH3 regions
are different and are such that the heterodimeric interaction
between said first and second CH3 regions is stronger than each of
the homodimeric interactions of said first and second CH3 regions,
and wherein said first homodimeric protein has an amino acid other
than Lys, Leu or Met at position 409 and said second homodimeric
protein has an amino-acid substitution at a position selected from
the group consisting of: 366, 368, 370, 399, 405 and 407,
[0276] optionally wherein said first and second nucleic acid
constructs encode light chain sequences of said first and second
antibodies
[0277] c) co-expressing said first and second nucleic-acid
constructs in a host cell, and
[0278] d) obtaining said heterodimeric protein from the cell
culture.
[0279] Thus, the present invention also relates to a recombinant
eukaryotic or prokaryotic host cell which produces a bispecific
antibody of the present invention.
[0280] In one embodiment of the present invention, the bispecific
antibody is obtained by any of the methods according to the present
invention.
[0281] Suitable expression vectors, including promoters, enhancers,
etc., and suitable host cells for the production of antibodies are
well-known in the art. Examples of host cells include yeast,
bacterial and mammalian cells, such as CHO or HEK cells.
[0282] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises first and second CH3
regions, except for the specified mutations, comprising the
sequence of SEQ ID NO:60 (IgG1m(a)).
[0283] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein neither said first nor said second
Fc-region comprises a Cys-Pro-Ser-Cys sequence in the hinge
region.
[0284] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein both of said first and said second
Fc-region comprise a Cys-Pro-Pro-Cys sequence in the hinge
region.
[0285] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein the first and second Fc-regions are
human antibody Fc-regions.
[0286] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein said first and second Fc region, except
for the specified mutations, comprise a sequence independently
selected from the group consisting of SEQ ID NOS:63, 64, 65, 66,
67, 68, 69, 70, and 71.
[0287] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein the first and second antigen-binding
regions comprise human antibody VH sequences and, optionally, human
antibody VL sequences.
[0288] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein the first and second antigen-binding
regions are from heavy-chain antibodies.
[0289] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first Fc-region and
a second Fc-region, wherein the first and second antigen-binding
regions comprise a first and second light chain.
[0290] In further embodiments, the co-expression method according
to the invention comprises any of the further features described
under the in vitro method above.
[0291] In a further aspect, the invention relates to an expression
vector comprising the first and second nucleic-acid constructs
specified herein above. In a further embodiment, the expression
vector further comprises a nucleotide sequence encoding the
constant region of a light chain, a heavy chain or both light and
heavy chains of an antibody, e.g. a human antibody.
[0292] An expression vector in the context of the present invention
may be any suitable vector, including chromosomal, non-chromosomal,
and synthetic nucleic acid vectors (a nucleic acid sequence
comprising a suitable set of expression control elements). Examples
of such vectors include derivatives of SV40, bacterial plasmids,
phage DNA, baculovirus, yeast plasmids, vectors derived from
combinations of plasmids and phage DNA, and viral nucleic acid (RNA
or DNA) vectors. In one embodiment, a CD20 or a CD3
antibody-encoding nucleic acid is comprised in a naked DNA or RNA
vector, including, for example, a linear expression element (as
described in for instance Sykes and Johnston, Nat Biotech 17,
355-59 (1997)), a compacted nucleic acid vector (as described in
for instance U.S. Pat. No. 6,077,835 and/or WO 00/70087), a plasmid
vector such as pBR322, pUC 19/18, or pUC 118/119, a "midge"
minimally-sized nucleic acid vector (as described in for instance
Schakowski et al., Mol Ther 3, 793-800 (2001)), or as a
precipitated nucleic acid vector construct, such as a
CaP04-precipitated construct (as described in for instance
WO200046147, Benvenisty and Reshef, PNAS USA 83, 9551-55 (1986),
Wigler et al., Cell 14, 725 (1978), and Coraro and Pearson, Somatic
Cell Genetics 7, 603 (1981)). Such nucleic acid vectors and the
usage thereof are well known in the art (see for instance U.S. Pat.
Nos. 5,589,466 and 5,973,972).
[0293] In one embodiment, the vector is suitable for expression of
the CD20 antibody and/or the CD3 antibody in a bacterial cell.
Examples of such vectors include expression vectors such as
BlueScript (Stratagene), pIN vectors (Van Heeke & Schuster, J
Biol Chem 264, 5503-5509 (1989), pET vectors (Novagen, Madison
Wis.) and the like).
[0294] An expression vector may also or alternatively be a vector
suitable for expression in a yeast system. Any vector suitable for
expression in a yeast system may be employed. Suitable vectors
include, for example, vectors comprising constitutive or inducible
promoters such as alpha factor, alcohol oxidase and PGH (reviewed
in: F. Ausubel et al., ed. Current Protocols in Molecular Biology,
Greene Publishing and Wiley InterScience New York (1987), and Grant
et al., Methods in Enzymol 153. 516-544 (1987)).
[0295] An expression vector may also or alternatively be a vector
suitable for expression in mammalian cells, e.g. a vector
comprising glutamine synthetase as a selectable marker, such as the
vectors described in Bebbington (1992) Biotechnology (NY)
10:169-175.
[0296] A nucleic acid and/or vector may also comprises a nucleic
acid sequence encoding a secretion/localization sequence, which can
target a polypeptide, such as a nascent polypeptide chain, to the
periplasmic space or into cell culture media. Such sequences are
known in the art, and include secretion leader or signal
peptides.
[0297] The expression vector may comprise or be associated with any
suitable promoter, enhancer, and other expression-facilitating
elements. Examples of such elements include strong expression
promoters (e. g., human CMV IE promoter/enhancer as well as RSV,
SV40, SL3-3, MMTV, and HIV LTR promoters), effective poly (A)
termination sequences, an origin of replication for plasmid product
in E. coli, an antibiotic resistance gene as selectable marker,
and/or a convenient cloning site (e.g., a polylinker). Nucleic
acids may also comprise an inducible promoter as opposed to a
constitutive promoter such as CMV IE.
[0298] In one embodiment, the CD20 and/or CD3 antibody-encoding
expression vector may be positioned in and/or delivered to the host
cell or host animal via a viral vector.
[0299] In an even further aspect, the invention relates to a host
cell comprising the first and second nucleic-acid constructs
specified herein above.
[0300] Thus the present invention also relates to a recombinant
eukaryotic or prokaryotic host cell which produces a bispecific
antibody of the present invention, such as a transfectoma.
[0301] The first CD20-specific antibody may be expressed in a
recombinant eukaryotic or prokaryotic host cell, such as a
transfectoma, which produces an antibody of the invention as
defined herein or a bispecific antibody of the invention as defined
herein. The CD3-specific antibody may likewise be expressed in a
recombinant eukaryotic or prokaryotic host cell, such as a
transfectoma, which produces an antibody of the invention as
defined herein or a bispecific antibody of the invention as defined
herein.
[0302] Examples of host cells include yeast, bacterial, plant and
mammalian cells, such as CHO, CHO-S, HEK, HEK293, HEK-293F,
Expi293F, PER.C6 or NSO cells or lymphocytic cells. For example, in
one embodiment, the host cell may comprise a first and second
nucleic acid construct stably integrated into the cellular genome.
In another embodiment, the present invention provides a cell
comprising a non-integrated nucleic acid, such as a plasmid,
cosmid, phagemid, or linear expression element, which comprises a
first and second nucleic acid construct as specified above.
[0303] In an even further aspect, the invention relates to a
transgenic non-human animal or plant comprising nucleic acids
encoding one or two sets of a human heavy chain and a human light
chain, wherein the animal or plant produces a bispecific antibody
of the invention.
[0304] In a further aspect, the invention relates to a hybridoma
which produces an antibody for use in a bispecific antibody of the
invention as defined herein. In an even further aspect, the
invention relates to a transgenic non-human animal or plant
comprising nucleic acids encoding one or two sets of a human heavy
chain and a human light chain, wherein the animal or plant produces
an antibody for use in a bispecific antibody or a bispecific
antibody of the invention.
[0305] In one aspect, the invention relates to a nucleic acid
construct encoding one or more amino acid sequences set out in
Table 1.
[0306] In one aspect, the invention relates to an expression vector
comprising [0307] (i) a nucleic acid sequence encoding a heavy
chain sequence of a first binding arm according to any one of the
embodiments disclosed herein; [0308] (ii) a nucleic acid sequence
encoding a light chain sequence of a first binding arm according to
any one of the embodiments disclosed herein; [0309] (iii) a nucleic
acid sequence encoding a heavy chain sequence of a second binding
arm according to any one of the embodiments disclosed herein;
[0310] (iv) a nucleic acid sequence encoding a light chain sequence
of a second binding arm according to any one of the of the
embodiments disclosed herein; [0311] (v) the nucleic acid set forth
in (i) and the nucleic acid set forth in (ii); [0312] (vi) the
nucleic acid set forth in (iii) and the nucleic acid set forth in
(iv). [0313] (vii) the nucleic acid set forth in (i), (ii), (iii)
and (iv).
[0314] In one aspect, the invention relates to a method for
producing a bispecific antibody according to any one of the
embodiments as disclosed herein, comprising the steps of [0315] a)
culturing a host cell as disclosed herein comprising an expression
vector as disclosed herein expressing the first antibody as
disclosed herein and purifying said antibody from the culture
media; [0316] b) culturing a host cell as disclosed herein
comprising an expression vector as disclosed herein expressing the
second antibody as disclosed herein and purifying said antibody
from the culture media; [0317] c) incubating said first antibody
together with said second antibody under reducing conditions
sufficient to allow the cysteines in the hinge region to undergo
disulfide-bond isomerization, and [0318] d) obtaining said
bispecific antibody.
[0319] In one aspect, the invention relates to a host cell
comprising an expression vector as defined above. In one
embodiment, the host cell is a recombinant eukaryotic, recombinant
prokaryotic, or recombinant microbial host cell.
Fc Regions
[0320] In one aspect of the present invention, the bispecific
CD3xCD20 antibody according to the present invention further
comprises a first Fc region and a second Fc region which may be
comprised in a first and a second Fab-arm which respectively
further comprise the first and second antigen-binding regions
described above (or vice versa).
[0321] In another aspect of the present invention, the bispecific
CD3xCD20 antibody comprises a first and a second Fab-arm comprising
a first and a second antigen-binding region, respectively. The
bispecific CD3xCD20 antibody further comprises a first and a second
Fc region. In one aspect of the present invention, the bispecific
CD3xCD20 antibody comprises the first Fab-arm comprising the first
antigen-binding region and the first Fc region, and the second
Fab-arm comprising the second antigen-binding region and the second
Fc region.
[0322] In another aspect of the present invention, the bispecific
CD3xCD20 antibody comprises the second Fab-arm comprising the
second antigen-binding region and the first Fc region, and the
first Fab-arm comprising the first antigen-binding region and the
second Fc region.
[0323] The first and second Fc-regions may each be of any isotype,
including, but not limited to, IgG1, IgG2, IgG3 and IgG4, and may
comprise one or more mutations or modifications. In one embodiment,
each of the first and second Fc regions is of the IgG4 isotype or
derived therefrom, optionally with one or more mutations or
modifications. In one embodiment, each of the first and second Fc
regions is of the IgG1 isotype or derived therefrom, optionally
with one or more mutations or modifications. In another embodiment,
one of the Fc regions is of the IgG1 isotype and the other of the
IgG4 isotype, or is derived from such respective isotypes,
optionally with one or more mutations or modifications.
[0324] In one embodiment, one or both of the Fc regions comprise a
mutation removing the acceptor site for Asn-linked glycosylation or
is otherwise manipulated to change the glycosylation properties.
For example, in an IgG1 Fc-region, an N297Q mutation can be used to
remove an Asn-linked glycosylation site. Accordingly, in a specific
embodiment, one or both Fc-regions comprise an IgG1 wildtype
sequence with an N297Q mutation (SEQ ID NO:66, see Table 1).
[0325] In one embodiment, one or both Fc-regions are
effector-function-deficient. For example, the Fc-region(s) may be
of an IgG4 isotype, or a non-IgG4 type, e.g. IgG1, IgG2 or IgG3,
which has been mutated such that the ability to mediate effector
functions, such as ADCC, has been reduced or even eliminated. Such
mutations have e.g. been described in Dall'Acqua W F et al., J
Immunol. 1ZZ(2):1129-1138 (2006) and Hezareh M, J Virol.;
Z5(24):12161-12168 (2001). In one embodiment, one or both
Fc-regions comprise an IgG1 wildtype sequence (SEQ ID NO:63, see
Table 1).
[0326] The bispecific antibody according to the present invention
may comprise modifications in the Fc region. When a bispecific
antibody comprises such modifications it may become an inert, or
non-activating, bispecific antibody. The term "inertness", "inert"
or "non-activating" as used herein, refers to an Fc region which is
at least not able to bind any Fc.gamma. receptors, induce
Fc-mediated cross-linking of FcRs, or induce FcR-mediated
cross-linking of target antigens via two Fc regions of individual
antibodies, or is not able to bind C1q. The inertness of an Fc
region of a humanized or chimeric CD3 antibody is advantageously
tested using the antibody in a monospecific format.
[0327] Several variants can be constructed to make the Fc region of
an antibody inactive for interactions with Fc.gamma. (gamma)
receptors and C1q for therapeutic antibody development. Examples of
such variants are described herein.
[0328] Thus, in one embodiment, the antibody comprises an Fc region
which has been modified so that said antibody mediates reduced
Fc-mediated T-cell proliferation compared to a wild-type antibody
by at least 50%, at least 60%, at least 70%, at least 80%, at least
90%, at least 99% or 100%, wherein said T-cell proliferation is
measured in a peripheral blood mononuclear cell (PBMC)-based
functional assay.
[0329] Thus, amino acids in the Fc region that play a dominant role
in the interactions with C1q and the Fc.gamma. receptors may be
modified. Examples of amino acid positions that may be modified
include positions 1234, 1235 and P331. Combinations thereof, such
as L234F/L235E/P331S, can cause a profound decrease in binding to
human CD64, CD32A, CD16 and C1q.
[0330] Hence, in one embodiment, the amino acid in at least one
position corresponding to L234, L235 and P331, may be A, A and S,
respectively (Xu et al., 2000, Cell Immunol. 200(1):16-26;
Oganesyan et al., 2008, Acta Cryst. (D64):700-4). Also, L234F and
L235E amino acid substitutions can result in Fc regions with
abrogated interactions with Fc.gamma. receptors and C1q (Canfield
et al., 1991, J. Exp. Med. (173):1483-91; Duncan et al., 1988,
Nature (332):738-40). Hence, in one embodiment, the amino acids in
the positions corresponding to 1234 and 1235, may be F and E,
respectively. A D265A amino acid substitution can decrease binding
to all Fc gamma Receptors and prevent ADCC (Shields et al., 2001,
J. Biol. Chem. (276):6591-604). Hence, in one embodiment, the amino
acid in the position corresponding to D265 may be A. Binding to C1q
can be abrogated by mutating positions D270, K322, P329, and P331.
Mutating these positions to either D270A or K322A or P329A or P331A
can make the antibody deficient in CDC activity Idusogie E E, et
al., 2000, J Immunol. 164: 4178-84). Hence, in one embodiment, the
amino acids in at least one position corresponding to D270, K322,
P329 and P331, may be A, A, A, and A, respectively.
[0331] An alternative approach to minimize the interaction of the
Fc region with Fc.gamma. receptors and C1q is by removal of the
glycosylation site of an antibody. Mutating position N297 to e.g.
Q, A, or E removes a glycosylation site which is critical for
IgG-Fc gamma Receptor interactions. Hence, in one embodiment, the
amino acid in a position corresponding to N297, may be G, Q, A or E
Leabman et al., 2013, MAbs; 5(6):896-903). Another alternative
approach to minimize interaction of the Fc region with Fc.gamma.
receptors may be obtained by the following mutations; P238A, A327Q,
P329A or E233P/L234V/L235A/G236del (Shields et al., 2001, J. Biol.
Chem. (276):6591-604).
[0332] Alternatively, human IgG2 and IgG4 subclasses are considered
naturally compromised in their interactions with C1q and Fc gamma
Receptors although interactions with Fc.gamma. receptors were
reported (Parren et al., 1992, J. Clin Invest. 90: 1537-1546;
Bruhns et al., 2009, Blood 113: 3716-3725). Mutations abrogating
these residual interactions can be made in both isotypes, resulting
in reduction of unwanted side-effects associated with FcR binding.
For IgG2, these include L234A and G237A, and for IgG4, L235E.
Hence, in one embodiment, the amino acid in a position
corresponding to 1234 and G237 in a human IgG2 heavy chain, may be
A and A, respectively. In one embodiment, the amino acid in a
position corresponding to L235 in a human IgG4 heavy chain, may be
E.
[0333] Other approaches to further minimize the interaction with Fc
gamma Receptors and C1q in IgG2 antibodies include those described
in WO2011066501 and Lightle, S., et al., 2010, Protein Science
(19):753-62.
[0334] The hinge region of the antibody can also be of importance
with respect to interactions with Fc.gamma. receptors and
complement (Brekke et al., 2006, J Immunol 177:1129-1138;
Dall'Acqua W F, et al., 2006, J Immunol 177:1129-1138).
Accordingly, mutations in or deletion of the hinge region can
influence effector functions of an antibody.
[0335] The term "cross-linking" as used herein, refers to the
indirect bridging of antibody Fab arm(s) (monovalently or
bivalently) bound to the target antigen by an FcR-bearing cell
through binding to the antibody Fc region. Thus, an antibody which
binds its target antigen on target antigen-bearing cells may
cross-link that cell with another cell expressing FcRs.
[0336] The term "unspecific killing" as used herein, refers to the
killing of cells by the cytotoxic function of T cells or other
effector cells, through tumor target antigen-independent activation
of said cells. Thus, by unspecific killing is meant that effector
cells, e.g. cytotoxic T cells, are activated and induce
cytotoxicity independent of tumor target binding, for example by
binding of the antibody to CD3 and an Fc.gamma.R.
[0337] Thus, in one embodiment, the bispecific antibody comprises a
first and a second immunoglobulin heavy chain, wherein in at least
one of said first and second immunoglobulin heavy chains one or
more amino acids in the positions corresponding to positions L234,
L235, D265, N297, and P331 in a human IgG1 heavy chain, are not L,
L, D, N, and P, respectively.
[0338] In one embodiment, in both the first and second heavy chains
one or more amino acids in the position corresponding to positions
L234, L235, D265, N297, and P331 in a human IgG1 heavy chain, are
not L, L, D, N, and P, respectively.
[0339] In another embodiment, in at least one of the first and
second heavy chains one or more amino acids in the positions
corresponding to positions L234, L235 and D265 in a human IgG1
heavy chain, are not L, L and D, respectively, and the amino acids
in the positions corresponding to N297 and P331 in a human IgG1
heavy chain, are N and P, respectively.
[0340] The term "amino acid corresponding to positions" as used
herein refers to an amino acid position number in a human IgG1
heavy chain. Corresponding amino acid positions in other
immunoglobulins may be found by alignment with human IgG1. Unless
otherwise stated or contradicted by context, the amino acids of the
constant region sequences are herein numbered according to the
EU-index of numbering (described in Kabat, E. A. et al., 1991,
Sequences of proteins of immunological interest. 5th Edition--US
Department of Health and Human Services, NIH publication No.
91-3242, pp 662, 680, 689). Thus, an amino acid or segment in one
sequence that "corresponds to" an amino acid or segment in another
sequence is one that aligns with the other amino acid or segment
using a standard sequence alignment program such as ALIGN, ClustalW
or similar, typically at default settings and has at least 50%, at
least 80%0, at least 90%0, or at least 95%0 identity to a human
IgG1 heavy chain. It is considered well-known in the art how to
align a sequence or segment in a sequence and thereby determine the
corresponding position in a sequence to an amino acid position
according to the present invention.
[0341] In the context of the present invention, the amino acid may
be defined as described above.
[0342] The term "the amino acid is not" or similar wording when
referring to amino acids in a heavy chain is to be understood to
mean that the amino acid is any other amino acid than the specific
amino acid mentioned. For example, the amino acid in the position
corresponding to L234 in a human IgG1 heavy chain is not L, means
that the amino acid may be any of the other naturally or
non-naturally occurring amino acids than L.
[0343] In one embodiment, in at least one of said first and second
heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain, is not D.
[0344] In one embodiment, in at least one of the first and second
heavy chains the amino acid in the position corresponding to D265
in a human IgG1 heavy chain, is not D, and the amino acids in the
positions corresponding to positions N297 and P331 in a human IgG1
heavy chain, are N and P, respectively.
[0345] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
position D265 in a human IgG1 heavy chain is hydrophobic or polar
amino acids.
[0346] The term "hydrophobic" as used herein in relation to an
amino acid residue, refers to an amino acid residue selected from
the group consisting of; A, C, F, G, H, I, L, M, R, T, V, W, and Y.
Thus, in one embodiment, in at least one of said first and second
heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is selected from the
group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T,
V, W and Y.
[0347] The term "polar" as used herein in relation to amino acid
residues, refers to any amino acid residue selected from the group
consisting of; C, D, E, H, K, N, Q, R, S, and T.
[0348] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acid in the position corresponding to
position D265 in a human heavy chain is selected from the group
consisting of; C, E, H, K, N, Q, R, S, and T.
[0349] In another embodiment, in at least one of said first and
second heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is an aliphatic
uncharged, aromatic or acidic amino acid.
[0350] The term "aliphatic uncharged" as used herein in relation to
amino acid residues, refers to any amino acid residue selected from
the group consisting of: A, G, I, L, and V.
[0351] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is selected from the
group consisting of; A, G, I, L, and V.
[0352] The term "aromatic" as used herein in relation to amino acid
residues, refers to any amino acid residue selected from the group
consisting of: F, T, and W. Thus, in one embodiment, in at least
one of said first and second heavy chains the amino acid in the
position corresponding to position D265 in a human IgG1 heavy chain
is selected from the group consisting of; F, T, and W.
[0353] The term "acidic" as used herein in relation to amino acid
residues, refers to any amino acid residue chosen from the group
consisting of: D and E. Thus, in one embodiment, in at least one of
said first and second heavy chains the amino acid in the position
corresponding to position D265 in a human IgG1 heavy chain is
selected from the group consisting of; D and E.
[0354] In a particular embodiment, in at least one of said first
and second heavy chains the amino acid in the position
corresponding to position D265 in a human IgG1 heavy chain is
selected from the group consisting of; A, E, F, G, I, L, T, V, and
W.
[0355] In one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain, is not D.
[0356] In one embodiment, in both the first and second heavy chains
the amino acid in the position corresponding to D265 in a human
IgG1 heavy chain, is not D, and the amino acids in the positions
corresponding to positions N297 and P331 in a human IgG1 heavy
chain, are N and P, respectively.
[0357] In one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is hydrophobic or polar amino
acid.
[0358] Thus, in one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is selected from the group of
amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and
Y.
[0359] Thus, in one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human heavy chain is selected from the group consisting
of; C, E, H, K, N, Q, R, S, and T. In one embodiment, in both said
first and second heavy chains the amino acid in the position
corresponding to position D265 in a human IgG1 heavy chain is
selected from the group of amino acids consisting of; A, C, F, G,
H, I, L, M, R, T, V, W and Y.
[0360] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to position
D265 in a human heavy chain is selected from the group consisting
of; C, E, H, K, N, Q, R, S, and T.
[0361] In another embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is aliphatic uncharged, aromatic
or acidic amino acids.
[0362] Thus, in one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is selected from the group
consisting of; A, G, I, L, and V.
[0363] Thus, in one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is selected from the group
consisting of; F, T, and W.
[0364] Thus, in one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain are selected from the group
consisting of; D and E.
[0365] In a particular embodiment, in both said first and second
heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is selected from the
group consisting of; A, E, F, G, I, L, T, V, and W.
[0366] In further embodiment, in at least one of said first and
second heavy chains the amino acid in the position corresponding to
position N297 in a human IgG1 heavy chain, is not N.
[0367] In one embodiment, in at least one of the first and second
heavy chains the amino acid in the position corresponding to N297
in a human IgG1 heavy chain, is not N, and the amino acid in the
position corresponding to position P331 in a human IgG1 heavy
chain, is P.
[0368] In one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to positions
N297 in a human IgG1 heavy chain, is not N.
[0369] In one embodiment, in both the first and second heavy chains
the amino acid in the position corresponding to N297 in a human
IgG1 heavy chain, is not N, and the amino acid in the position
corresponding to position P331 in a human IgG1 heavy chain, is
P.
[0370] In further embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain, are not L
and L, respectively.
[0371] In one embodiment, in at least one of the first and second
heavy chains the amino acids in the positions corresponding to 1234
and 1235 in a human IgG1 heavy chain, are not L and L,
respectively, and the amino acids in the positions corresponding to
positions N297 and P331 in a human IgG1 heavy chain, are N and P,
respectively.
[0372] In one embodiment, in at least one of said first and second
heavy chains the amino acids corresponding to positions L234 and
1235 in a human IgG1 heavy chain are selected from the group
consisting of; A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, Y,
V.
[0373] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
positions L234 and 1235 in a human IgG1 heavy chain are hydrophobic
or polar amino acids.
[0374] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group consisting of; A, C, F, G, H, I, M, R, T,
V, W, and Y.
[0375] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group of amino acids consisting of; C, D, E, H,
K, N, Q, R, S, and T.
[0376] In a particular embodiment, in at least one of said first
and second heavy chains the amino acids in the positions
corresponding to positions L234 and L235 in a human IgG1 heavy
chain are each selected from the group consisting of; A, C, D, E,
F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y.
[0377] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234 and 1235 in a human IgG1 heavy chain, are not L and L,
respectively.
[0378] In one embodiment, in both the first and second heavy chains
the amino acids in the positions corresponding to L234 and L235 in
a human IgG1 heavy chain, are not L and L, respectively, and the
amino acids in the positions corresponding to positions N297 and
P331 in a human IgG1 heavy chain, are N and P, respectively.
[0379] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to 1234 and
1235 in a human IgG1 heavy chain are hydrophobic or polar amino
acids.
[0380] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234 and 1235 in a human IgG1 heavy chain are each selected from
the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and
Y.
[0381] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234 and 1235 in a human IgG1 heavy chain are each selected from
the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S,
and T.
[0382] In a particular embodiment, in both said first and second
heavy chains the amino acids in the positions corresponding to
positions L234 and 1235 in a human IgG1 heavy chain are each
selected from the group consisting of; A, C, D, E, F, G, H, I, K,
M, N, Q, R, S, T, V, W, and Y.
[0383] In another embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are
aliphatic uncharged, aromatic or acidic amino acids.
[0384] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group consisting of; A, G, I, and V.
[0385] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group consisting of; F, T, and W.
[0386] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group consisting of; D and E.
[0387] In a particular embodiment, in at least one of said first
and second heavy chains the amino acids in the positions
corresponding to 1234 and 1235 are each selected from the group
consisting of; A, D, E, F, G, I, T, V, and W.
[0388] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
positions L234 and 1235 in a human IgG1 heavy chain, are F and E;
or A and A, respectively.
[0389] In one embodiment, in at least one of the first and second
heavy chains the amino acids in the positions corresponding to L234
and L235 in a human IgG1 heavy chain, are F and E; or A and A,
respectively, and the amino acids in the positions corresponding to
positions N297 and P331 in a human IgG1 heavy chain, are N and P,
respectively.
[0390] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
L234 and L235 in a human IgG1 heavy chain, are F and E; or A and A,
respectively.
[0391] In one embodiment, in both the first and second heavy chains
the amino acids in the positions corresponding to L234 and L235 in
a human IgG1 heavy chain, are F and E; or A and A, respectively,
and the amino acids in the positions corresponding to positions
N297 and P331 in a human IgG1 heavy chain, are N and P,
respectively.
[0392] In a particular embodiment, in at least one of said first
and second heavy chains the amino acids in the positions
corresponding to positions L234 and L235 in a human IgG1 heavy
chain, are F and E, respectively.
[0393] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
L234 and L235 in a human IgG1 heavy chain, are F and E,
respectively.
[0394] In one embodiment, in at least one of said first and second
heavy chains at least the amino acids in the positions
corresponding to positions L234 and L235 in a human IgG1 heavy
chain, are A and A, respectively.
[0395] In one embodiment, in both said first and second heavy
chains at least the amino acids in the positions corresponding to
positions L234 and 1235 in a human IgG1 heavy chain, are A and A,
respectively.
[0396] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are not
L, L, and D, respectively.
[0397] In one embodiment, in at least one of the first and second
heavy chains the amino acids in the positions corresponding to
L234, L235, and D265 in a human IgG1 heavy chain, are not L, L and
D, respectively, and the amino acids in the positions corresponding
to positions N297 and P331 in a human IgG1 heavy chain, are N and
P, respectively.
[0398] In one embodiment, in at least one of said first and second
heavy chains the amino acids corresponding to positions L234 and
1235 in a human IgG1 heavy chain are selected from the group
consisting of; A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, Y,
V, and W, and the amino acid corresponding to position D265 is
selected from the group consisting of; A, C, E, F, G, H, I, K, L,
M, N, P, Q, R, S, T, Y, V, and W.
[0399] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
positions L234, L235 and D265 in a human IgG1 heavy chain are
hydrophobic or polar amino acids.
[0400] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is selected from the
group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T,
V, W and Y, and the amino acids in the positions corresponding to
positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group consisting of; A, C, F, G, H, I, M, R, T,
V, W, and Y.
[0401] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234 and L235 in a human IgG1 heavy chain are each
selected from the group of amino acids consisting of; C, D, E, H,
K, N, Q, R, S, and T, the amino acid in the position corresponding
to position D265 in a human heavy chain is selected from the group
consisting of; C, E, H, K, N, Q, R, S, and T.
[0402] In a particular embodiment, in at least one of said first
and second heavy chains the amino acids in the positions
corresponding to positions L234 and L235 in a human IgG1 heavy
chain are each selected from the group consisting of; A, C, D, E,
F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y, and the amino acid in
the position corresponding to position D265 in a human IgG1 heavy
chain is selected from the group consisting of; A, C, E, F, G, H,
I, K, L, M, N, Q, R, S, T, V, W, and Y.
[0403] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to L234,
L235, and D265 in a human IgG1 heavy chain are hydrophobic or polar
amino acids.
[0404] In one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is selected from the group of
amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and
Y, and the amino acids in the positions corresponding to positions
L234 and L235 in a human IgG1 heavy chain are each selected from
the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and
Y.
[0405] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
L234 and L235 in a human IgG1 heavy chain are each selected from
the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S,
and T, the amino acid in the position corresponding to position
D265 in a human heavy chain is selected from the group consisting
of; C, E, H, K, N, Q, R, S, and T.
[0406] In a particular embodiment, in both said first and second
heavy chains the amino acids in the positions corresponding to
positions L234 and 1235 in a human IgG1 heavy chain are each
selected from the group consisting of; A, C, D, E, F, G, H, I, K,
M, N, Q, R, S, T, V, W, and Y, and the amino acid in the position
corresponding to position D265 in a human IgG1 heavy chain is
selected from the group consisting of; A, C, E, F, G, H, I, K, L,
M, N, Q, R, S, T, V, W, and Y.
[0407] In another embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234, 1235 and D265 in a human IgG1 heavy chain are
aliphatic uncharged, aromatic or acidic amino acids.
[0408] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is selected from the
group consisting of; A, G, I, L, and V, and the amino acids in the
positions corresponding to positions L234 and 1235 in a human IgG1
heavy chain are each selected from the group consisting of; A, G,
I, and V.
[0409] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234, 1235 and D265 in a human IgG1 heavy chain are
each selected from the group consisting of; F, T, and W.
[0410] Thus, in one embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234, 1235, and D265 in a human IgG1 heavy chain are
each selected from the group consisting of; D and E.
[0411] In a particular embodiment, in at least one of said first
and second heavy chains the amino acid in the position
corresponding to position D265 in a human IgG1 heavy chain is
selected from the group consisting of; A, E, F, G, I, L, T, V, and
W, and the amino acids in the positions corresponding to 1234 and
1235 are each selected from the group consisting of; A, D, E, F, G,
I, T, V, and W.
[0412] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234, 1235 and D265 in a human IgG1 heavy chain, are not L, L, and
D, respectively.
[0413] In one embodiment, in both the first and second heavy chains
the amino acids in the positions corresponding to L234, L235, and
D265 in a human IgG1 heavy chain, are not L, L, and D,
respectively, and the amino acids in the positions corresponding to
positions N297 and P331 in a human IgG1 heavy chain, are N and P,
respectively.
[0414] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to 1234,
1235, and D265 in a human IgG1 heavy chain are aliphatic uncharged,
aromatic or acidic amino acids.
[0415] In one embodiment, in both said first and second heavy
chains the amino acid in the position corresponding to position
D265 in a human IgG1 heavy chain is selected from the group
consisting of; A, G, I, L, and V, and the amino acids in the
positions corresponding to positions 1234 and 1235 in a human IgG1
heavy chain are each selected from the group consisting of; A, G,
I, and V.
[0416] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234, 1235, and D265 in a human IgG1 heavy chain are each selected
from the group consisting of; D and E.
[0417] In a particular embodiment, in both said first and second
heavy chains the amino acid in the position corresponding to
position D265 in a human IgG1 heavy chain is selected from the
group consisting of; A, E, F, G, I, L, T, V, and W, and the amino
acids in the positions corresponding to L234 and L235 are each
selected from the group consisting of; A, D, E, F, G, I, T, V, and
W.
[0418] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A; or A, A, and A, respectively.
[0419] In one embodiment, in at least one of the first and second
heavy chains the amino acids in the positions corresponding to
L234, L235, and D265 in a human IgG1 heavy chain, are F, E, and A;
or A, A, and A, respectively, and the amino acids in the positions
corresponding to positions N297 and P331 in a human IgG1 heavy
chain, are N and P, respectively.
[0420] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234, 1235, and D265 in a human IgG1 heavy chain, are F, E, and A;
or A, A, and A, respectively.
[0421] In one embodiment, in both the first and second heavy chains
the amino acids in the positions corresponding to L234, L235, and
D265 in a human IgG1 heavy chain, are F, E, and A; or A, A, and A,
respectively, and the amino acids in the positions corresponding to
positions N297 and P331 in a human IgG1 heavy chain, are N and P,
respectively.
[0422] In a particular embodiment, in at least one of said first
and second heavy chains the amino acids in the positions
corresponding to positions L234, 1235, and D265 in a human IgG1
heavy chain, are F, E, and A, respectively.
[0423] In a particular preferred embodiment, in both said first and
second heavy chains the amino acids in the positions corresponding
to positions L234, 1235, and D265 in a human IgG1 heavy chain, are
F, E, and A, respectively.
[0424] In one embodiment, in at least one of said first and second
heavy chains the amino acids in the positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are A,
A, and A, respectively.
[0425] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234, 1235, and D265 in a human IgG1 heavy chain, are A, A, and A,
respectively.
[0426] In another embodiment, in at least one of said first and
second heavy chains the amino acids in the positions corresponding
to positions L234, L235, D265, N297, and P331 in a human IgG1 heavy
chain, are F, E, A, Q, and S, respectively.
[0427] In one embodiment, in both said first and second heavy
chains the amino acids in the positions corresponding to positions
1234, 1235, D265, N297, and P331 in a human IgG1 heavy chain, are
F, E, A, Q, and S, respectively.
[0428] In a particular embodiment, the antibody according to the
invention, comprises a VH sequence as set out in SEQ ID NO:8, a VL
sequence as set out in SEQ ID NO:10, and in at least one of the
heavy chains the amino acids in positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A, respectively.
[0429] In another embodiment, the antibody according to the
invention, comprises a VH sequence as set out in SEQ ID NO:8, a VL
sequence as set out in SEQ ID NO:12, and in at least one of the
heavy chains the amino acids in positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A, respectively.
[0430] In another embodiment, the antibody according to the
invention, comprises a VH sequence as set out in SEQ ID NO:6, a VL
sequence as set out in SEQ ID NO:10, and in at least one of the
heavy chains the amino acids in positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A, respectively.
[0431] In another embodiment, the antibody according to the
invention, comprises a VH sequence as set out in SEQ ID NO:6, a VL
sequence as set out in SEQ ID NO:12, and in at least one of the
heavy chains the amino acids in positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A, respectively.
[0432] In another embodiment, the antibody according to the
invention, comprises a VH sequence as set out in SEQ ID NO:9, a VL
sequence as set out in SEQ ID NO:10, and in at least one of the
heavy chains the amino acids in positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A, respectively.
[0433] In another embodiment, the antibody according to the
invention, comprises a VH sequence as set out in SEQ ID NO:9, a VL
sequence as set out in SEQ ID NO:12, and in at least one of the
heavy chains the amino acids in positions corresponding to
positions L234, L235, and D265 in a human IgG1 heavy chain, are F,
E, and A, respectively.
[0434] In one aspect, the bispecific antibody according to the
invention comprises the human IgLC2/IgLC3 constant domain lambda
light chain of SEQ ID NO:29.
[0435] Several antibody variants were generated with one or more
amino acid substitutions in the Fc region. A non-activating Fc
region prevents the antibody from interacting with Fc-receptors
present on blood cells, such as monocytes, or with C1q to activate
the classical complement pathway. Reduction of the Fc activity was
tested in antibody variants that contain different combinations of
amino acid substitutions in the Fc region. Maximally five amino
acid substitutions were introduced, which include the mutations
N297Q, L234A, L235A, L234F, L235E, D265A, and P331S. Substitutions
in one or more of these five amino acid positions were introduced
in the K409R and/or F405L IgG1 backbone. The following Fc region
variants of the huCLB-T3/4 antibody were generated: N297Q (refers
to the N297Q substitution, termed IgG1-huCLB-T3/4-N297Q), LFLE
(refers to the L234F/L235E substitutions, termed
IgG1-huCLB-T3/4-LFLE), LALA (refers to the L234A/L235A
substitutions, termed IgG1-huCLB-T3/4-LALA), LFLENQ (refers to the
L234F/L235E/N297Q substitutions, termed IgG1-huCLB-T3/4-LFLENQ),
LFLEDA (refers to the L234F/L235E/D265A substitutions, termed
IgG1-huCLB-T3/4-LFLEDA), DA (refers to the D265A substitution,
termed IgG1-huCLB-T3/4-DA), DAPS (refers to the D265A/P331S
substitutions, termed IgG1-huCLB-T3/4-DAPS), DANQ (refers to the
D265A/N297Q substitutions, termed IgG1-huCLB-T3/4-DANQ), LFLEPS
(refers to the L234F/L235E/P331S substitutions, termed
IgG1-huCLB-T3/4-LFLEPS), and LFLEDANQPS (refers to the
L234F/L235E/D265A/N297Q/P331S substitutions, termed
IgG1-huCLB-T3/4-LFLEDANQPS).
[0436] In particular, in the IgG1-huCD3 antibody variants a
combination of three amino acid substitutions, which include the
mutations L234F, L235E and D265A and is referred to as LFLEDA or
FEA, were introduced in the K409R and F405L IgG1 backbones to
generate antibodies with a non-activating Fc region. The resulting
non-activating antibody variant is termed with the suffix "FEAR" or
"FEAL", respectively.
[0437] In one aspect, the bispecific antibodies according to the
invention may be modified in the light chain and/or heavy chain to
increase the expression level and/or production yield. In one
embodiment, the antibodies according to the invention may be
modified in the light chain. Such modifications are known in the
art and may be performed according to the methods described in e.g.
Zheng, L., Goddard, J.-P., Baumann, U., & Reymond, J.-L.
(2004). Expression improvement and mechanistic study of the
retro-Diels-Alderase catalytic antibody 10F11 by site-directed
mutagenesis. Journal of Molecular Biology, 341(3), 807-14.
[0438] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first heavy chain
and first light chain, wherein the amino acid in the position
corresponding to position T41 in the lambda light chain of SEQ ID
NO:10 of the first light chain is not T.
[0439] In one embodiment the bispecific antibody as defined in any
of the embodiments disclosed herein, the amino acid in the position
corresponding to position T41 in the lambda light chain of SEQ ID
NO: 10 is selected from H, I, K, L, Q, R and V.
[0440] In one embodiment the bispecific antibody as defined in any
of the embodiments disclosed herein, the amino acid in the position
corresponding to position T41 in the lambda light chain of SEQ ID
NO: 10 is H, K or R.
[0441] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acid in the
position corresponding to position T41 in the lambda light chain of
SEQ ID NO: 10 of the first light chain is K.
[0442] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acid in the
position corresponding to position F10 in the lambda light chain of
SEQ ID NO:10 of the first light chain is not F, and one or more of
the amino acid positions corresponding to the positions T41, K55,
and L97 in the lambda light chain of SEQ ID NO: 10 of the first
light chain are not T, K and L, respectively.
[0443] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acids in the
positions corresponding to positions F10, T41, K55, and L97 in the
lambda light chain of SEQ ID NO:10 of the first light chain are not
F, T, K and L, respectively.
[0444] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acids in the
positions corresponding to positions F10, T41, K55, and L97 in the
lambda light chain of SEQ ID NO: 10 of the first light chain are L,
K, N, and H, respectively.
[0445] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acids in the
positions corresponding to positions R23 and A35 in the lambda
light chain of SEQ ID NO: 10 of the first light chain are not R and
A, respectively.
[0446] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acids in the
positions corresponding to positions R23 and A35 in the lambda
light chain of SEQ ID NO: 10 of the first light chain are A and P,
respectively.
[0447] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acids in the
positions corresponding to positions F10, R23, A35, R47, D71, A82,
D83, S86, I87, and F89 in the lambda light chain of SEQ ID NO:10 of
the first light chain are not F, R, A, R, D, A, D, S, I, and F,
respectively.
[0448] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein, the amino acids in the
positions corresponding to positions F10, R23, A35, R47, D71, A82,
D83, S86, I87, and F89 in the lambda light chain of SEQ ID NO:10 of
the first light chain are L, A, P, T, G, P, E, A, E, and Y,
respectively.
[0449] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein,
[0450] (i) the amino acid in the position corresponding to position
F10 in the lambda light chain of SEQ ID NO: 10 of the first light
chain is not F, or
[0451] (ii) the amino acid in the position corresponding to
position K55 in the lambda light chain of SEQ ID NO: 10 of the
first light chain is not K, or
[0452] (iii) the amino acid in the position corresponding to
position F10 in the lambda light chain of SEQ ID NO:10 of the first
light chain is not F, and the amino acid in the position
corresponding to position K55 in the lambda light chain of SEQ ID
NO:10 of the first light chain is not K.
[0453] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein,
[0454] (i) the amino acid in the position corresponding to position
F10 in the lambda light chain of SEQ ID NO: 10 of the first light
chain is L, or
[0455] (ii) the amino acid in the position corresponding to
position K55 in the lambda light chain of SEQ ID NO: 10 of the
first light chain is N, or
[0456] (iii) the amino acid in the position corresponding to
position F10 in the lambda light chain of SEQ ID NO:10 of the first
light chain is L, and the amino acid in the position corresponding
to position K55 in the lambda light chain of SEQ ID NO:10 of the
first light chain is N.
[0457] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein the amino acid in
the position corresponding to position T41 is selected from H, I,
K, L, Q, R or V, such as selected from H, K and R, such as K. In
one embodiment, the bispecific antibody according to the invention
comprises a first light chain having the amino acids L, K, N, and
H, respectively, in the positions corresponding to positions F10,
T41, K55, and L97 in the lambda light chain of SEQ ID NO:10. In one
embodiment, the bispecific antibody according to the invention
comprises a first light chain, wherein the amino acid in the
position corresponding to position R23 is selected from A, G, H, K,
Q, S, and T, such as from A and G, and wherein the amino acid in
the position corresponding to A35 is selected from I, L, M, P, V,
G, F and W, such as from I, L, M, P, and V.
[0458] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein the amino acid in
the position corresponding to position R23 is A or G, such as A,
and the amino acid in the position corresponding to position A35 is
P.
[0459] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein the amino acids in
the positions corresponding to positions F10, R23, A35, R47, D71,
A82, D83, S86, I87, and F89 in the lambda light chain of SEQ ID
NO:10 are not F, R, A, R, D, A, D, S, I, and F, respectively.
[0460] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein the amino acid in
the position corresponding to position R23 is selected from A, G,
H, K, Q, S, and T, such as from A and G, wherein the amino acid in
the position corresponding to A35 is selected from I, L, M, P, V,
G, F and W, such as from I, L, M, P, and wherein the amino acids in
the positions corresponding to positions F10, R47, D71, A82, D83,
S86, I87, and F89 in the lambda light chain of SEQ ID NO: 10 are L,
T, G, P, E, A, E, and Y, respectively.
[0461] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein the amino acid in
the position corresponding to position R23 is A or G, and wherein
the amino acids in the positions corresponding to positions F10,
A35, R47, D71, A82, D83, S86, I87, and F89 in the lambda light
chain of SEQ ID NO: 10 are L, P, T, G, P, E, A, E, and Y,
respectively.
[0462] In one aspect, the bispecific antibodies according to the
invention may be modified in the first and/or second light chains
to increase the affinity of the antibodies.
[0463] In one aspect, the bispecific antibodies according to the
invention may be modified in the light chain of the first and/or
second binding arm to reduce the affinity of the antibodies. This
may be advantageous in some settings and lead to increased
efficacy. In particular low affinity of the first binding arm
(binding to human CD3.epsilon. (epsilon)) may have an impact on the
motility of T cells in circulation and at tumor site thus leading
to better engagement of T cells with tumor cells, cf. Molhoj et
al., Molecular Immunology 44 (2007). In particular this may be
useful in bispecific formats, in which the CD3 antibodies are used
as one of the binding arms. Modifications that lead to reduced
antibody affinity are known in the art, see for example Webster et
al. Int J Cancer Suppl. 1988; 3:13-6.
[0464] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein
[0465] (i) the amino acid in the position corresponding to position
F10 in the lambda light chain of SEQ ID NO: 10 is not F, or
[0466] (ii) the amino acid in the position corresponding to
position K55 in the lambda light chain of SEQ ID NO: 10 is not K,
or
[0467] (iii) the amino acid in the position corresponding to
position F10 in the lambda light chain of SEQ ID NO: 10 is not F,
and the amino acid in the position corresponding to position K55 in
the lambda light chain of SEQ ID NO: 10 is not K.
[0468] In one embodiment, the antibody according to the invention
comprises a constant light chain (LC), wherein
[0469] (i) the amino acid in the position corresponding to position
F10 in the lambda light chain of SEQ ID NO: 10 is L, or
[0470] (ii) the amino acid in the position corresponding to
position K55 in the lambda light chain of SEQ ID NO: 10 is N,
or
[0471] (iii) the amino acid in the position corresponding to
position F10 in the lambda light chain of SEQ ID NO:10 is L, and
the amino acid in the position corresponding to position K55 in the
lambda light chain of SEQ ID NO: 10 is N.
[0472] In one embodiment, the bispecific antibody according to the
invention comprises a light chain, wherein the amino acids in the
positions corresponding to positions F10, T41, K55, and L97 in the
lambda light chain of SEQ ID NO:10 are not F, T, K and L,
respectively. Such modifications serve both to increase the
expression level and to reduce the affinity.
[0473] In one embodiment, the bispecific antibody according to the
invention comprises a first light chain, wherein the amino acids in
the positions corresponding to positions F10, T41, K55, and L97 in
the lambda light chain of SEQ ID NO:10 are L, K, N, and H,
respectively. Such modifications serve both to increase the
expression level and to reduce the affinity.
[0474] In a further aspect of the invention, mutations in the CDR
regions of huCD3 have been made to optimize the binding affinity of
the CD3 binding arm, such as to reduce the binding affinity of the
CD3 arm.
[0475] Thus, in one embodiment, the CD3 binding arm of the
bispecific antibody according to the invention comprises the six
CDR sequences selected from the CDR sequences set forth in the the
below Table 2.
TABLE-US-00003 TABLE 2 VH VH VH VL VL CDR1 CDR2 CDR3 CDR1 CDR3 (SEQ
(SEQ (SEQ (SEQ VL (SEQ ID NO) ID NO) ID NO) ID NO) CDR2 ID NO) 72 2
3 4 GTN 5 72 2 3 81 GTN 5 72 2 3 4 GTN 82 72 2 3 4 GTN 83 73 2 3 4
GTN 5 73 2 3 81 GTN 5 73 2 3 4 GTN 82 73 2 3 4 GTN 83 74 2 3 4 GTN
5 74 2 3 81 GTN 5 74 2 3 4 GTN 82 74 2 3 4 GTN 83 1 75 3 4 GTN 5 1
75 3 81 GTN 5 1 75 3 4 GTN 82 1 75 3 4 GTN 83 1 76 3 4 GTN 5 1 76 3
81 GTN 5 1 76 3 4 GTN 82 1 76 3 4 GTN 83 1 2 77 4 GTN 5 1 2 77 81
GTN 5 1 2 77 4 GTN 82 1 2 77 4 GTN 83 1 2 78 4 GTN 5 1 2 78 81 GTN
5 1 2 78 4 GTN 82 1 2 78 4 GTN 83 1 2 79 4 GTN 5 1 2 79 81 GTN 5 1
2 79 4 GTN 82 1 2 79 4 GTN 83 1 2 80 4 GTN 5 1 2 80 81 GTN 5 1 2 80
4 GTN 82 1 2 80 4 GTN 83 1 2 3 81 GTN 5 1 2 3 4 GTN 82 1 2 3 4 GTN
83
[0476] In one embodiment, the six CDR sequences may be inserted in
any one of the huCD3 VH and VL framework sequences VH1, VH2, VH3
and VH4, and VL1, VL2, and VL3, respectively, replacing the CDR
sequences of huCD3. In one embodiment, the six CDR sequences are
inserted in the huCD3 framework sequences VH1 and VL1.
[0477] In a further embodiment, the CD3 binding arm comprises the
six CDR sequences selected from the Table 2, wherein
[0478] X.sub.1 of SEQ ID NO:72 is selected from V, H, F, T, P, L,
Q, D, K, W, G, A, C and R;
[0479] X2 of SEQ ID NO:73 is selected from N, A, H, Q, P, F, M, Y,
L, W, D, E and C;
[0480] X.sub.4 of SEQ ID NO:75 is selected from Y, Q, W, L, A, I,
M, D, T, K, R, G, F, E, V, C and P;
[0481] X.sub.5 of SEQ ID NO:76 is selected from N, L, Y, W, H, M,
G, F, K, S, V, R, Q, D, C, E and P;
[0482] X.sub.10 of SEQ ID NO:81 is selected from A, G, R, V, F, E,
M, H, N, Y, P, Q, D, K and L;
[0483] X.sub.12 of SEQ ID NO:83 is selected from D, K, Q, G, V, E,
T, N, Y, S, P, W, F and M.
[0484] Such huCD3 CDR variant sequences have reduced binding
affinity compared to huCD3 wildtype CDR sequences. The six CDR
sequences may be inserted in any of the huCD3 VH and VL framework
sequences VH1, VH2, VH3 and VH4, and VL1, VL2 and VL3,
respectively, replacing the CDR sequences of huCD3. In one
embodiment, the six CDR sequences are inserted in the huCD3
framework sequences VH1 and VL1. In a further embodiment, the six
CDR sequences have been inserted in the huCD3 framework sequences
VH1 and VL1, wherein the amino acid T in position 41 of VL1 (SEQ ID
NO:10) has been mutated to K.
[0485] In a further embodiment, the CD3 binding arm comprises the
six CDR sequences selected from the Table 2, wherein
[0486] X.sub.1 of SEQ ID NO:72 is selected from L, P, Q, D, K, W,
S, G, A, C and R;
[0487] X.sub.2 of SEQ ID NO:73 is selected from S, N, G, A, K, V,
R, H, Q, P, I, F, M, Y, L, W, D, E and C;
[0488] X.sub.3 of SEQ ID NO:74 is selected from M, W, G, Q, V, T,
S, L, P, I, A, K, R and C;
[0489] X.sub.4 of SEQ ID NO:75 is selected from W, L, A, I, M, D,
T, K, R, G, F, E, V, C and P;
[0490] X.sub.5 of SEQ ID NO:76 is selected from C, E, P and T:
[0491] X.sub.6 of SEQ ID NO:77 is selected from A, S, V, N, K, L,
T, I, P, Q, C, G, Y, W, F, and R;
[0492] X.sub.7 of SEQ ID NO:78 is selected from P, C, S, and T;
[0493] X.sub.8 of SEQ ID NO:79 is selected from A, T, G, L, N, C,
P, F, Q, H, R, K, E, W, and Y;
[0494] X.sub.9 of SEQ ID NO:80 is selected from P, L, T, C, A, I,
L, Q, V, E, M, K, R, G and P;
[0495] X.sub.10 of SEQ ID NO:81 is selected from E, H, I, M, N, Y,
P, Q, D, K and L;
[0496] X11 of SEQ ID NO:82 is selected from F, Y, I, T, V, M, A, S,
N, G, W, E, K, P, R and D; and
[0497] X.sub.12 of SEQ ID NO:83 is selected from G, Y, V, N, T, S,
H, E, P, W, F and M.
[0498] Such HuCD3 CDR variant sequences have reduced binding
affinity compared to huCD3 wildtype CDR sequences. The six CDR
sequences may be inserted in any of the huCD3 VH and VL framework
sequences VH1, VH2, VH3 and VH4, and VL1, VL2 and VL3,
respectively, replacing the CDR sequences of huCD3. In one
embodiment, the six CDR sequences are inserted in the huCD3
framework sequences VH1 and VL1. In a further embodiment, the six
CDR sequences have been inserted in the huCD3 framework sequences
VH1 and VL1, wherein the amino acid T in position 41 of VL1 (SEQ ID
NO:10) has been mutated to K.
[0499] In yet a further embodiment, the CD3 binding arm comprises
the six CDR sequences selected from the CDR sequences set forth in
the below Table 3, wherein
[0500] X.sub.2 of SEQ ID NO:73 is selected from M and P;
[0501] X.sub.3 of SEQ ID NO:74 is A;
[0502] X.sub.4 of SEQ ID NO:75 is E;
[0503] X.sub.6 of SEQ ID NO:77 is selected from F, G, I, K, L, and
N;
[0504] X.sub.7 of SEQ ID NO:78 is P;
[0505] X.sub.8 of SEQ ID NO:79 is selected from A and G; and
[0506] X.sub.9 of SEQ ID NO:80 is selected from M, R and V.
TABLE-US-00004 TABLE 3 VH VH VH VL VL CDR1 CDR2 CDR3 CDR1 CDR3 (SEQ
(SEQ (SEQ (SEQ VL (SEQ ID NO) ID NO) ID NO) ID NO) CDR2 ID NO) 73 2
3 4 GTN 5 74 2 3 4 GTN 5 1 75 3 4 GTN 5 1 2 77 4 GTN 5 1 2 78 4 GTN
5 1 2 79 4 GTN 5 1 2 80 4 GTN 5
[0507] Such HuCD3 CDR variant sequences have reduced binding
affinity compared to huCD3 wildtype CDR sequences. The six CDR
sequences may be inserted in any of the huCD3 VH and VL framework
sequences VH1, VH2, VH3 and VH4, and VL1, VL2 and VL3,
respectively, replacing the CDR sequences of huCD3. In one
embodiment, the six CDR sequences are inserted in the huCD3
framework sequences VH1 and VL1. In a further embodiment, the six
CDR sequences have been inserted in the huCD3 framework sequences
VH1 and VL1, wherein the amino acid T in position 41 of VL1 (SEQ ID
NO:10) has been mutated to K.
[0508] In a further embodiment of the bispecific antibody as
defined in any of the embodiments disclosed herein, the first
binding arm is derived from a CD3 antibody having a binding
affinity value (K.sub.D) to human CD3 epsilon higher than
3.4.times.10.sup.-8 M as determined by Bio-Layer Interferometry,
such as from 3.5.times.10.sup.-8 M to 9.9x10.sup.-8 M, or from
1.0.times.10.sup.-7 M to 9.9.times.10.sup.-7 M as determined by
Bio-Layer Interferometry.
[0509] In a further embodiment of the invention, one or both of the
antibodies forming part of the bispecific antibody have been
engineered to reduce or increase the binding to the neonatal Fc
receptor (FcRn) in order to manipulate the serum half-life of the
bispecific antibody. Techniques for increasing or reducing the
serum half-life are well-known in the art. See for example
Dall'Acqua et al. 2006, J. Biol. Chem., 281:23514-24; Hinton et al.
2006,J. Immunol., 176:346-56; and Zalevsky et al. 2010 Nat.
Biotechnol., 28:157-9.
[0510] In one aspect, the bispecific antibody as defined in any of
the embodiments disclosed herein comprises a first constant heavy
chain (HC) and a first constant light chain (LC), wherein the
positions corresponding to positions L234, L235, and D265 in the
human IgG1 heavy chain of SEQ ID NO:15 of both the first heavy
chain and the second heavy chain are F, E, and A, respectively.
[0511] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first and second
constant heavy chain (HC) and a first and second constant light
chain (LC), wherein the positions corresponding to positions L234
and L235 in the human IgG1 heavy chain of SEQ ID NO:15 of both the
first heavy chain and the second heavy chain are F and E,
respectively.
[0512] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first binding arm is a
Fab arm derived from IgG1-huCD3-H1L1-FEAR, and the second binding
arm is a Fab arm derived from IgG1-7D8-FEAL.
[0513] Herein, huCD3-H1L1 refers to the humanized SP34 anti-CD3
antibody having VH1 and VL1 which are set forth in table 1 as SEQ
ID Nos: 6 and 10. FEAL refers to L234F, L235E and D265A and F405L
mutations in the constant region of the antibody whereas FEAR
refers to L234F, L235E and D265A and K409R mutations in the
constant region of the antibody wherein the amino acid positions
corresponds to the amino acid positions of human IgG1. "IgG1"
refers to that the antibody constant regions are derived from the
human IgG1 outside the specified mutations. 7D8 refers to the
anti-CD20 antibody having the VH and VL sequence set forth in Table
1 as SEQ ID Nos: 27 and 28.
[0514] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first binding arm is a
half-molecule antibody derived from IgG1-huCD3-H1L1-FEAR, and the
second binding arm is a half-molecule antibody derived from
IgG1-7D8-FEAL.
[0515] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first binding arm is a
Fab arm derived from IgG1-huCD3-H1L1-FEAL, and the second binding
arm is a Fab arm derived from IgG1-7D8-FEAR.
[0516] In one embodiment of the bispecific antibody as defined in
any of the embodiments disclosed herein the first binding arm is a
half-molecule antibody (i.e. comprising one heavy and one light
chain) derived from IgG1-huCD3-H1L1-FEAL, and the second binding
arm is a half-molecule antibody (Fab arm and Fc arm) derived from
IgG1-7D8-FEAR.
[0517] In one embodiment, the bispecific antibody as defined in any
of the embodiments disclosed herein comprises a first and second
constant heavy chain (HC) and a first and second constant light
chain (LC), wherein the positions corresponding to positions L234,
L235, and D265 in the human IgG1 heavy chain of SEQ ID NO:15 of
both the first constant heavy chain and the second constant heavy
chain are F, E, and A, respectively, and wherein the position
corresponding to F405 in the human IgG1 heavy chain of SEQ ID NO:
15 of the first constant heavy chain is L, and the position
corresponding to K409 in the human IgG1 heavy chain of SEQ ID NO:15
of the second constant heavy chain is R, and wherein (i) the
positions corresponding to positions F10, T41, K55, and L97 in the
lambda light chain of SEQ ID NO:10 of the first constant light
chain are L, K, N, and H, respectively, or (ii) the position
corresponding to position T41 in the lambda light chain of SEQ ID
NO: 10 of the first light constant chain is K.
Further Embodiments of the Bispecific Antibodies
[0518] The bispecific antibody of the invention can be of any
isotype. The choice of isotype typically will be guided by the
desired effector functions, such as ADCC induction. Exemplary
isotypes are IgG1, IgG2, IgG3, and IgG4. Either of the human light
chain constant regions, kappa or lambda, may be used. The effector
function of the antibodies of the present invention may be changed
by isotype switching to, e.g., an IgG1, IgG2, IgG3, IgG4, IgD, IgA,
IgE, or IgM antibody for various therapeutic uses. In one
embodiment, both Fc-regions of an antibody of the present invention
are of the IgG1 isotype, for instance an IgG1,.kappa.. In one
embodiment, the two Fc-regions of a bispecific antibody are of the
IgG1 and IgG4 isotypes, respectively. Optionally, the Fc-region may
be modified in the hinge and/or CH3 region as described elsewhere
herein.
[0519] In one embodiment, the bispecific antibody of the invention
is a full-length antibody, preferably an IgG1 antibody, in
particular an IgG1,.kappa. antibody or a variant thereof. In
another embodiment, the bispecific antibody of the invention
comprises an antibody fragment or a single-chain antibody. Antibody
fragments may e.g. be obtained by fragmentation using conventional
techniques, and the fragments screened for utility in the same
manner as described herein for whole antibodies. For example,
F(ab').sub.2 fragments may be generated by treating an antibody
with pepsin. The resulting F(ab').sub.2 fragment may be treated to
reduce disulfide bridges with a reducing agent, such as
dithiothreitol, to produce Fab' fragments. Fab fragments may be
obtained by treating an antibody with papain. A F(ab').sub.2
fragment may also be produced by binding Fab' fragments via a
thioether bond or a disulfide bond. Antibody fragments may also be
generated by expression of nucleic acids encoding such fragments in
recombinant cells (see for instance Evans et al., J. Immunol. Meth.
184., 123-38 (1995)). For example, a chimeric gene encoding a
portion of an F(ab').sub.2 fragment could include DNA sequences
encoding the C.sub.H1 domain and hinge region of the H chain,
followed by a translational stop codon to yield such a truncated
antibody fragment molecule.
[0520] The bispecific CD3xCD20 antibodies of the invention may also
be prepared from single chain antibodies. Single chain antibodies
are peptides in which the heavy and light chain Fv regions are
connected. In one embodiment, the bispecific antibody of the
present invention comprises a single-chain Fv (scFv) wherein the
heavy and light chains in the Fv of a CD20 antibody of the present
invention are joined with a flexible peptide linker (typically of
about 10, 12, 15 or more amino acid residues) in a single peptide
chain. Methods of producing such antibodies are described in for
instance U.S. Pat. No. 4,946,778, Pluckthun in `The Pharmacology of
Monoclonal Antibodies`, vol. 113, Rosenburg and Moore eds.
Springer-Verlag, New York, pp. 269-315 (1994), Bird et al., Science
242, 423-426 (1988), Huston et al., PNAS USA 85, 5879-5883 (1988)
and McCafferty et al., Nature 34&, 552-554 (1990). A bispecific
antibody can then be formed from two V.sub.H and V.sub.L from a
single-chain CD20 antibody and a single-chain CD3 antibody, or a
polyvalent antibody formed from more than two V.sub.H and V.sub.L
chains.
[0521] In one embodiment, one or both Fc-regions of the CD3 and
CD20 monoclonal antibodies for producing a bispecific antibody of
the invention are effector-function-deficient.
Conjugates
[0522] In a further aspect, the present invention provides a
bispecific CD3xCD20 antibody linked or conjugated to one or more
therapeutic moieties, such as a cytokine, an immune-suppressant, an
immune-stimulatory molecule and/or a radioisotope. Such conjugates
are referred to herein as "immunoconjugates" or "drug conjugates".
Immunoconjugates which include one or more cytotoxins are referred
to as "immunotoxins".
[0523] In one embodiment, the first and/or second Fc-region is
conjugated to a drug or a prodrug or contains an acceptor group for
the same. Such acceptor group may e.g. be an unnatural amino
acid.
Compositions
[0524] In a further aspect, the invention relates to a composition
comprising a bispecific antibody according to any one of the
embodiments disclosed herein.
[0525] In a further aspect, the invention relates to a
pharmaceutical composition comprising:
a bispecific CD3xCD20 antibody as defined in any of the embodimets
disclosed herein, and a pharmaceutically acceptable carrier.
[0526] The pharmaceutical composition of the present invention may
contain one bispecific antibody of the present invention or a
combination of different bispecific antibodies of the present
invention.
[0527] The pharmaceutical compositions may be formulated in
accordance with conventional techniques such as those disclosed in
Remington: The Science and Practice of Pharmacy, 19th Edition,
Gennaro, Ed., Mack Publishing Co., Easton, Pa., 1995. A
pharmaceutical composition of the present invention may e.g.
include diluents, fillers, salts, buffers, detergents (e. g., a
nonionic detergent, such as Tween-20 or Tween-80), stabilizers (e.
g., sugars or protein-free amino acids), preservatives, tissue
fixatives, solubilizers, and/or other materials suitable for
inclusion in a pharmaceutical composition.
[0528] Pharmaceutically acceptable carriers include any and all
suitable solvents, dispersion media, coatings, antibacterial and
antifungal agents, isotonicity agents, antioxidants and absorption
delaying agents, and the like that are physiologically compatible
with a bispecific antibody of the present invention. Examples of
suitable aqueous and nonaqueous carriers which may be employed in
the pharmaceutical compositions of the present invention include
water, saline, phosphate buffered saline, ethanol, dextrose,
polyols (such as glycerol, propylene glycol, polyethylene glycol,
and the like), and suitable mixtures thereof, vegetable oils,
carboxymethyl cellulose colloidal solutions, tragacanth gum and
injectable organic esters, such as ethyl oleate, and/or various
buffers. Pharmaceutically acceptable carriers include sterile
aqueous solutions or dispersions and sterile powders for the
extemporaneous preparation of sterile injectable solutions or
dispersion. Proper fluidity may be maintained, for example, by the
use of coating materials, such as lecithin, by the maintenance of
the required particle size in the case of dispersions, and by the
use of surfactants.
[0529] Pharmaceutical bispecific antibodies of the present
invention may also comprise pharmaceutically acceptable
antioxidants for instance (1) water soluble antioxidants, such as
ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium
metabisulfite, sodium sulfite and the like; (2) oil-soluble
antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole,
butylated hydroxytoluene, lecithin, propyl gallate,
alpha-tocopherol, and the like; and (3) metal chelating agents,
such as citric acid, ethylenediamine tetraacetic acid (EDTA),
sorbitol, tartaric acid, phosphoric acid, and the like.
[0530] Pharmaceutical bispecific antibodies of the present
invention may also comprise isotonicity agents, such as sugars,
polyalcohols, such as mannitol, sorbitol, glycerol or sodium
chloride in the compositions.
[0531] The pharmaceutical bispecific antibodies of the present
invention may also contain one or more adjuvants appropriate for
the chosen route of administration such as preservatives, wetting
agents, emulsifying agents, dispersing agents, preservatives or
buffers, which may enhance the shelf life or effectiveness of the
pharmaceutical composition. The bispecific antibodies of the
present invention may be prepared with carriers that will protect
the bispecific antibody against rapid release, such as a controlled
release formulation, including implants, transdermal patches, and
microencapsulated delivery systems. Such carriers may include
gelatin, glyceryl monostearate, glyceryl distearate, biodegradable,
biocompatible polymers such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid alone or with a wax, or other materials well known
in the art. Methods for the preparation of such formulations are
generally known to those skilled in the art.
[0532] Sterile injectable solutions may be prepared by
incorporating the active compound in the required amount in an
appropriate solvent with one or a combination of ingredients e.g.
as enumerated above, as required, followed by sterilization
microfiltration. Generally, dispersions are prepared by
incorporating the active compound into a sterile vehicle that
contains a basic dispersion medium and the required other
ingredients e.g. from those enumerated above. In the case of
sterile powders for the preparation of sterile injectable
solutions, examples of methods of preparation are vacuum drying and
freeze-drying (lyophilization) that yield a powder of the active
ingredient plus any additional desired ingredient from a previously
sterile-filtered solution thereof.
[0533] The actual dosage levels of the active ingredients in the
pharmaceutical compositions may be varied so as to obtain an amount
of the active ingredient which is effective to achieve the desired
therapeutic response for a particular patient, composition, and
mode of administration, without being toxic to the patient. The
selected dosage level will depend upon a variety of pharmacokinetic
factors including the activity of the particular compositions of
the present invention employed, or the amide thereof, the route of
administration, the time of administration, the rate of excretion
of the particular compound being employed, the duration of the
treatment, other drugs, compounds and/or materials used in
combination with the particular compositions employed, the age,
sex, weight, condition, general health and prior medical history of
the patient being treated, and like factors well known in the
medical arts.
[0534] The pharmaceutical composition may be administered by any
suitable route and mode. In one embodiment, a pharmaceutical
composition of the present invention is administered parenterally.
"Administered parenterally" as used herein means modes of
administration other than enteral and topical administration,
usually by injection, and include epidermal, intravenous,
intramuscular, intraarterial, intrathecal, intracapsular,
intraorbital, intracardiac, intradermal, intraperitoneal,
intratendinous, transtracheal, subcutaneous, subcuticular,
intraarticular, subcapsular, subarachnoid, intraspinal,
intracranial, intrathoracic, epidural and intrasternal injection
and infusion.
[0535] In one embodiment that pharmaceutical composition is
administered by intravenous or subcutaneous injection or
infusion.
Uses
[0536] In one aspect, the invention relates to the bispecific
antibody according to any one of the embodiments disclosed herein,
the composition as disclosed herein, or the pharmaceutical
composition as disclosed herein for use as a medicament.
[0537] In one aspect, the invention relates to the bispecific
antibody according to any one of the embodiments disclosed herein,
the composition as disclosed herein, or the pharmaceutical
composition as disclosed herein for use in the treatment of a
disease.
[0538] In one aspect, the invention relates to a method of
treatment of a disease comprising administering the bispecific
antibody according to any one of the embodiments disclosed herein,
the composition as disclosed herein, or the pharmaceutical
composition as disclosed herein to a subject in need thereof.
[0539] In one embodiment, the disease is mature B-cell
malignancy.
[0540] In one embodiment, the disease is cancer, such as NHL or B
cell leukemia.
[0541] The bispecific antibodies of the invention may be used for a
number of purposes. In particular, the bispecific antibodies of the
invention may be used for the treatment of various forms of cancer,
including metastatic cancer and refractory cancer.
[0542] In particular, the bispecific antibodies according to the
invention may be useful in therapeutic settings in which specific
targeting and T cell-mediated killing of cells that express CD20 is
desired, and they may be more efficient compared to a regular CD20
antibody in certain such indications and settings.
[0543] The bispecific antibodies of the invention also have
additional utility in therapy and diagnosis of a variety of
CD20-related diseases. For example, the bispecific antibodies can
be used to elicit in vivo or in vitro one or more of the following
biological activities: to inhibit the growth of and/or
differentiation of a cell expressing CD20; to kill a cell
expressing CD20; to mediate phagocytosis or ADCC of a cell
expressing CD20 in the presence of human effector cells; to mediate
CDC of a cell expressing CD20 in the presence of complement; to
mediate apoptosis of a cell expressing CD20; and/or to induce
translocation into lipid rafts upon binding CD20.
[0544] In another embodiment, the bispecific antibodies of the
invention can be used to effect T cell-mediated immune responses,
inflammation and microenvironment re-modelling.
[0545] In a particular embodiment, the bispecific antibodies are
used in vivo to treat, prevent or diagnose a variety of
CD20-related diseases. Examples of CD20-related diseases include,
among others, B cell lymphoma, e.g., non-Hodgkin's lymphoma (NHL),
B cell leukemia and immune diseases, e.g., autoimmune diseases,
such as those listed below.
[0546] In one embodiment the bispecific antibodies according to the
invention are used for the treatment of NHL or B cell leukemia.
[0547] In one embodiment, the bispecific antibodies according to
the invention are used for the treatment of CD20 antibody-resistant
NHL or B cell leukemia, such as rituximab- or ofatumumab-resistant
NHL or B cell leukemia, e.g. rituximab-resistant non-aggressive
B-cell lymphoma.
[0548] In one embodiment, the bispecific antibodies according to
the invention are used for the treatment of Acute Lymphoblastic
Leukemia (ALL), such as relapsed or refractory ALL.
[0549] In one embodiment, the bispecific antibodies according to
the invention are used for the treatment of CLL, such as relapsed
or refractory CLL.
[0550] In one embodiment, the bispecific antibodies according to
the invention are used for the treatment of FL, such as or relapsed
or refractory FL.
[0551] In one embodiment, the bispecific antibodies according to
the invention are used for the treatment of Adult Grade III
Lymphomatoid Granulomatosis; Adult Nasal Type Extranodal NK/T-cell
Lymphoma; Anaplastic Large Cell Lymphoma; Angioimmunoblastic T-cell
Lymphoma; Contiguous Stage II Adult Burkitt Lymphoma; Contiguous
Stage II Adult Diffuse Large Cell Lymphoma; Contiguous Stage II
Adult Diffuse Mixed Cell Lymphoma; Contiguous Stage II Adult
Diffuse Small Cleaved Cell Lymphoma; Contiguous Stage II Adult
Immunoblastic Large Cell Lymphoma; Contiguous Stage II Adult
Lymphoblastic Lymphoma; Contiguous Stage II Grade 1 Follicular
Lymphoma; Contiguous Stage II Grade 2 Follicular Lymphoma;
Contiguous Stage II Grade 3 Follicular Lymphoma; Contiguous Stage
II Mantle Cell Lymphoma; Contiguous Stage II Marginal Zone
Lymphoma; Contiguous Stage II Small Lymphocytic Lymphoma; Cutaneous
B-cell Non-Hodgkin Lymphoma; Epstein-Barr Virus Infection;
Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated
Lymphoid Tissue; Hepatosplenic T-cell Lymphoma; Intraocular
Lymphoma; Nodal Marginal Zone B-cell Lymphoma; Noncontiguous Stage
II Adult Burkitt Lymphoma; Noncontiguous Stage II Adult Diffuse
Large Cell Lymphoma; Noncontiguous Stage II Adult Diffuse Mixed
Cell Lymphoma; Noncontiguous Stage II Adult Diffuse Small Cleaved
Cell Lymphoma; Noncontiguous Stage II Adult Immunoblastic Large
Cell Lymphoma; Noncontiguous Stage II Adult Lymphoblastic Lymphoma;
Noncontiguous Stage II Grade 1 Follicular Lymphoma; Noncontiguous
Stage II Grade 2 Follicular Lymphoma; Noncontiguous Stage II Grade
3 Follicular Lymphoma; Noncontiguous Stage II Mantle Cell Lymphoma;
Noncontiguous Stage II Marginal Zone Lymphoma; Noncontiguous Stage
II Small Lymphocytic Lymphoma; Noncutaneous Extranodal Lymphoma;
Peripheral T-cell Lymphoma; Post-transplant Lymphoproliferative
Disorder; Progressive Hairy Cell Leukemia, Initial Treatment;
Recurrent Adult Burkitt Lymphoma; Recurrent Adult Diffuse Mixed
Cell Lymphoma; Recurrent Adult Diffuse Small Cleaved Cell Lymphoma;
Recurrent Adult Grade III Lymphomatoid Granulomatosis; Recurrent
Adult Hodgkin Lymphoma; Recurrent Adult Immunoblastic Large Cell
Lymphoma; Recurrent Adult Lymphoblastic Lymphoma; Recurrent Adult
T-cell Leukemia/Lymphoma; Recurrent Cutaneous T-cell Non-Hodgkin
Lymphoma; Recurrent Grade 1 Follicular Lymphoma; Recurrent Grade 2
Follicular Lymphoma; Recurrent Grade 3 Follicular Lymphoma;
Recurrent Mantle Cell Lymphoma; Recurrent Marginal Zone Lymphoma;
Recurrent Mycosis Fungoides/Sezary Syndrome; Recurrent Small
Lymphocytic Lymphoma; Refractory Hairy Cell Leukemia; Small
Intestine Lymphoma; Splenic Marginal Zone Lymphoma; Stage I Adult
Burkitt Lymphoma; Stage I Adult Diffuse Large Cell Lymphoma; Stage
I Adult Diffuse Mixed Cell Lymphoma; Stage I Adult Diffuse Small
Cleaved Cell Lymphoma; Stage I Adult Hodgkin Lymphoma; Stage I
Adult Immunoblastic Large Cell Lymphoma; Stage I Adult
Lymphoblastic Lymphoma; Stage I Adult T-cell Leukemia/Lymphoma;
Stage I Cutaneous T-cell Non-Hodgkin Lymphoma; Stage I Grade 1
Follicular Lymphoma; Stage I Grade 2 Follicular Lymphoma; Stage I
Grade 3 Follicular Lymphoma; Stage I Mantle Cell Lymphoma; Stage I
Marginal Zone Lymphoma; Stage I Small Lymphocytic Lymphoma; Stage
IA Mycosis Fungoides/Sezary Syndrome; Stage IB Mycosis
Fungoides/Sezary Syndrome; Stage II Adult Hodgkin's Lymphoma; Stage
II Adult T-cell Leukemia/Lymphoma; Stage II Cutaneous T-cell
Non-Hodgkin Lymphoma; Stage IIA Mycosis Fungoides/Sezary Syndrome;
Stage IIB Mycosis Fungoides/Sezary Syndrome; Stage III Adult
Burkitt Lymphoma; Stage III Adult Diffuse Large Cell Lymphoma;
Stage III Adult Diffuse Mixed Cell Lymphoma; Stage III Adult
Diffuse Small Cleaved Cell Lymphoma; Stage III Adult Hodgkin
Lymphoma; Stage III Adult Immunoblastic Large Cell Lymphoma; Stage
III Adult Lymphoblastic Lymphoma; Stage III Adult T-cell
Leukemia/Lymphoma; Stage III Cutaneous T-cell Non-Hodgkin Lymphoma;
Stage III Grade 1 Follicular Lymphoma; Stage III Grade 2 Follicular
Lymphoma; Stage III Grade 3 Follicular Lymphoma; Stage III Mantle
Cell Lymphoma; Stage III Marginal Zone Lymphoma; Stage III Small
Lymphocytic Lymphoma; Stage IIIA Mycosis Fungoides/Sezary Syndrome;
Stage IIIB Mycosis Fungoides/Sezary Syndrome; Stage IV Adult
Burkitt Lymphoma; Stage IV Adult Diffuse Large Cell Lymphoma; Stage
IV Adult Diffuse Mixed Cell Lymphoma; Stage IV Adult Diffuse Small
Cleaved Cell Lymphoma; Stage IV Adult Hodgkin Lymphoma; Stage IV
Adult Immunoblastic Large Cell Lymphoma; Stage IV Adult
Lymphoblastic Lymphoma; Stage IV Adult T-cell Leukemia/Lymphoma;
Stage IV Cutaneous T-cell Non-Hodgkin Lymphoma; Stage IV Grade 1
Follicular Lymphoma; Stage IV Grade 2 Follicular Lymphoma; Stage IV
Grade 3 Follicular Lymphoma; Stage IV Mantle Cell Lymphoma; Stage
IV Marginal Zone Lymphoma; Stage IV Small Lymphocytic Lymphoma;
Stage IVA Mycosis Fungoides/Sezary Syndrome; Stage IVB Mycosis
Fungoides/Sezary Syndrome; T-cell Large Granular Lymphocyte
Leukemia; Testicular Lymphoma; Untreated Hairy Cell Leukemia; or
Waldenstrom Macroglobulinemia.
[0552] In a particular embodiment, the antibodies of the invention
are used to treat or to prevent NHL, as the antibodies deplete the
CD20 bearing tumor cells.
[0553] NHL is a type of B cell lymphoma. Lymphomas, e.g., B cell
lymphomas, are a group of related cancers that arise when a
lymphocyte (a blood cell) becomes malignant. The normal function of
lymphocytes is to defend the body against invaders: germs, viruses,
fungi, even cancer. There are many subtypes and maturation stages
of lymphocytes and, therefore, there are many kinds of lymphomas.
Like normal cells, malignant lymphocytes can move to many parts of
the body. Typically, lymphoma cells form tumors in the lymphatic
system: bone marrow, lymph nodes, spleen, and blood. However, these
cells can migrate to other organs. Certain types of lymphoma will
tend to grow in locations in which the normal version of the cell
resides. For example, it is common for follicular NHL tumors to
develop in the lymph nodes.
[0554] CD20 is usually expressed at elevated levels on neoplastic
(i.e., tumorigenic) B cells associated with NHL. Accordingly, CD20
binding antibodies of the invention can be used to deplete CD20
bearing tumor cells which lead to NHL and, thus, can be used to
prevent or treat this disease.
[0555] The bispecific antibodies of the present invention also can
be used to block or inhibit other effects of CD20. For example, it
is known that CD20 is expressed on B lymphocytes and is involved in
the proliferation and/or differentiation of these cells. Since B
lymphocytes function as immunomodulators, CD20 is an important
target for antibody mediated therapy to target B lymphocytes, e.g.,
to inactivate or kill B lymphocytes, involved in autoimmune
disorders. Such autoimmune disorders include, for example, the
above listed diseases
[0556] Similarly, the invention relates to a method for killing a
tumor cell expressing CD20, comprising administration, to an
individual in need thereof, of an effective amount of a bispecific
antibody of the invention.
[0557] The present invention also relates to a method for
inhibiting growth and/or proliferation of one or more tumor cells
expressing CD20, comprising administration, to an individual in
need thereof, of a bispecific antibody of the present
invention.
[0558] The present invention alto relates to a method for treating
cancer, comprising [0559] a) selecting a subject suffering from a
cancer comprising tumor cells expressing CD20, and [0560] b)
administering to the subject the bispecific antibody of the present
invention or a pharmaceutical composition of the present
invention.
[0561] Also, the invention relates to the use of a bispecific
antibody that binds to human CD3 and human CD20 for the preparation
of a medicament for the treatment of cancer, such as one of the
specific cancer indications mentioned herein.
[0562] The invention further relates to a bispecific antibody for
use in the treatment of cancer, such as one of the cancer
indications mentioned above.
In one embodiment the bispecific antibody is for use in the
treatment of mature B-cell malignancies. In one embodiment the
bispecific antibody is for use in the treatment of tumors
expressing CD20. In one embodiment the bispecific antibody is for
use in the treatment of B cell lymphoma. In one embodiment the
bispecific antibody is for use in the treatment of B cell lymphoma
such as NHL. In one embodiment the bispecific antibody is for use
in the treatment of precursor B cell lymphoblastic leukemia. In one
embodiment the bispecific antibody is for use in the treatment of B
cell chronic lymhocytic leukemia (CLL). In one embodiment the
bispecific antibody is for use in the treatment of small
lymphocytic lymphoma (SLL). In one embodiment the bispecific
antibody is for use in the treatment of B cell prolymphocytic
leukemia. In one embodiment the bispecific antibody is for use in
the treatment of lymphoplasmacytic lymphoma. In one embodiment the
bispecific antibody is for use in the treatment of mantle cell
lymphoma (MCL). In one embodiment the bispecific antibody is for
use in the treatment of follicular lymphoma (FL), including
low-grade, intermediate-grade and high-grade FL. In one embodiment
the bispecific antibody is for use in the treatment of B cell
Hodgkin's lymphoma. In one embodiment the bispecific antibody is
for use in the treatment of immune disorders in which CD20
expressing B cells are involved. In one embodiment the bispecific
antibody is for use in the treatment of psoriasis. In one
embodiment the bispecific antibody is for use in the treatment of
sclerosis. In one embodiment the bispecific antibody is for use in
the treatment of inflammatory bowel disease. For the above
mentioned uses it is preferred that the antibody is
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR, however it may be any of the
bispecific CD3xCD20 antibodies disclosed herein.
[0563] The bispecific antibodies of the present invention have
numerous in vitro and in vivo diagnostic and therapeutic utilities
involving the diagnosis and treatment of disorders involving cells
expressing CD20. For example, the antibodies can be administered to
cells in culture, e.g., in vitro or ex vivo, or to human subjects,
e.g., in vivo, to treat, prevent and to diagnose a variety of
disorders. As used herein, the term "subject" is intended to
include human and non-human animals which respond to the bispecific
antibodies against CD3 and CD20. Preferred subjects include human
patients having disorders that can be corrected or ameliorated by
inhibiting or controlling B cells (normal or malignant).
[0564] In one aspect, the invention relates to a diagnostic
composition comprising a bispecific antibody according to any one
of the embodiments as disclosed herein.
[0565] In one embodiment, the diagnostic composition is a companion
diagnostic which is used to screen and select those patients who
will benefit from treatment with the bispecific antibody.
[0566] In one embodiment, the bispecific antibodies of the present
invention can be used to treat a subject with a tumorigenic
disorder, e.g., a disorder characterized by the presence of tumor
cells expressing CD20 including, for example, B cell lymphoma,
e.g., NHL. Examples of tumorigenic diseases which can be treated
and/or prevented include B cell lymphoma, e.g., NHL, including
precursor B cell lymphoblastic leukemia/lymphoma and mature B cell
neoplasms, such as B cell chronic lymhocytic leukemia (CLL)/small
lymphocytic lymphoma (SLL), B cell prolymphocytic leukemia,
lymphoplasmacytic lymphoma, mantle cell lymphoma (MCL), follicular
lymphoma (FL), including low-grade, intermediate-grade and
high-grade FL, cutaneous follicle center lymphoma, marginal zone B
cell lymphoma (MALT type, nodal and splenic type), hairy cell
leukemia, diffuse large B cell lymphoma (DLBCL), Burkitt's
lymphoma, plasmacytoma, plasma cell myeloma, post-transplant
lymphoproliferative disorder, Waldenstrom's macroglobulinemia,
malignant melanoma and anaplastic large-cell lymphoma (ALCL).
[0567] Further examples of B cell non-Hodgkin's lymphomas are
lymphomatoid granulomatosis, primary effusion lymphoma,
intravascular large B cell lymphoma, mediastinal large B cell
lymphoma, heavy chain diseases (including .gamma., .alpha., and
.alpha. disease), lymphomas induced by therapy with
immunosuppressive agents, such as cyclosporine-induced lymphoma,
and methotrexate-induced lymphoma.
[0568] In a further embodiment, the bispecific antibodies of the
present invention can be used to treat B cell Hodgkin's
lymphoma.
[0569] Examples of immune disorders in which CD20 expressing B
cells are involved which can be treated and/or prevented include
autoimmune disorders, such as psoriasis, psoriatic arthritis,
dermatitis, systemic scleroderma and sclerosis, inflammatory bowel
disease (IBD), Crohn's disease, ulcerative colitis, respiratory
distress syndrome, meningitis, encephalitis (including chronic
fatigue syndrome/myalgic encephalitis (CFS/ME) and chronic fatigue
syndrome/myalgic encephalitis (CFS/ME), uveitis,
glomerulonephritis, eczema, asthma, atherosclerosis, leukocyte
adhesion deficiency, multiple sclerosis, Raynaud's syndrome,
Sjogren's syndrome, juvenile onset diabetes, Reiter's disease,
Behcet's disease, immune complex nephritis, IgA nephropathy, IgM
polyneuropathies, immune-mediated thrombocytopenias, such as acute
idiopathic thrombocytopenic purpura and chronic idiopathic
thrombocytopenic purpura, hemolytic anemia, myasthenia gravis,
lupus nephritis, systemic lupus erythematosus, rheumatoid arthritis
(RA), atopic dermatitis, pemphigus, Graves' disease, Hashimoto's
thyroiditis, Wegener's granulomatosis, Omenn's syndrome, chronic
renal failure, acute infectious mononucleosis, HIV, and herpes
virus associated diseases. Further examples are severe acute
respiratory distress syndrome and choreoretinitis. Furthermore,
other diseases and disorders include those caused by or mediated by
infection of B-cells with virus, such as Epstein-Barr virus
(EBV).
[0570] Further examples of inflammatory, immune and/or autoimmune
disorders in which autoantibodies and/or excessive B lymphocyte
activity are prominent and which can be treated and/or prevented,
include the following:
[0571] vasculitides and other vessel disorders, such as microscopic
polyangiitis, Churg-Strauss syndrome, and other ANCA-associated
vasculitides, polyarteritis nodosa, essential cryoglobulinaemic
vasculitis, cutaneous leukocytoclastic angiitis, Kawasaki disease,
Takayasu arteritis, giant cell arthritis, Henoch-Schonlein purpura,
primary or isolated cerebral angiitis, erythema nodosum,
thrombangiitis obliterans, thrombotic thrombocytopenic purpura
(including hemolytic uremic syndrome), and secondary vasculitides,
including cutaneous leukocytoclastic vasculitis (e.g., secondary to
hepatitis B, hepatitis C, Waldenstrom's macroglobulinemia, B-cell
neoplasias, rheumatoid arthritis, SjOgren's syndrome, or systemic
lupus erythematosus); further examples are erythema nodosum,
allergic vasculitis, panniculitis, Weber-Christian disease, purpura
hyperglobulin-aemica, and Buerger's disease;
[0572] skin disorders, such as contact dermatitis, linear IgA
dermatosis, vitiligo, pyoderma gangrenosum, epidermolysis bullosa
acquisita, pemphigus vulgaris (including cicatricial pemphigoid and
bullous pemphigoid), alopecia areata (including alopecia
universalis and alopecia totalis), dermatitis herpetiformis,
erythema multiforme, and chronic autoimmune urticaria (including
angioneurotic edema and urticarial vasculitis);
[0573] immune-mediated cytopenias, such as autoimmune neutropenia,
and pure red cell aplasia; [0574] connective tissue disorders, such
as CNS lupus, discoid lupus erythematosus, CREST syndrome, mixed
connective tissue disease, polymyositis/dermatomyositis, inclusion
body myositis, secondary amyloidosis, cryoglobulinemia type I and
type II, fibromyalgia, phospholipid antibody syndrome, secondary
hemophilia, relapsing polychondritis, sarcoidosis, stiff man
syndrome, and rheumatic fever; further examples are eosinophil
fasciitis, myositis, and juvenile dermatomyositis;
[0575] arthritides, such as ankylosing spondylitis, juvenile
chronic arthritis, adult Still's disease, and SAPHO syndrome;
further examples are sacroileitis, reactive arthritis, Still's
disease, and gout;
[0576] hematologic disorders, such as aplastic anemia, primary
hemolytic anemia (including cold agglutinin syndrome), hemolytic
anemia secondary to CLL or systemic lupus erythematosus; POEMS
syndrome, pernicious anemia, and Waldenstrom's purpura
hyperglobulinaemica; further examples are agranulocytosis,
autoimmune neutropenia, Franklin's disease, Seligmann's disease,
.mu.-chain disease, paraneoplastic syndrome secondary to thymoma
and lymphomas, and factor VIII inhibitor formation;
[0577] endocrinopathies, such as polyendocrinopathy, and Addison's
disease; further examples are autoimmune hypoglycemia, autoimmune
hypothyroidism, autoimmune insulin syndrome, de Quervain's
thyroiditis, and insulin receptor antibody-mediated insulin
resistance;
[0578] hepato-gastrointestinal disorders, such as celiac disease,
Whipple's disease, primary biliary cirrhosis, chronic active
hepatitis, and primary sclerosing cholangiitis; a further example
is autoimmune gastritis;
[0579] nephropathies, such as rapid progressive glomerulonephritis,
post-streptococcal nephritis, Goodpasture's syndrome, membranous
glomerulonephritis, and cryoglobulinemic nephritis; a further
example is minimal change disease;
[0580] neurological disorders, such as autoimmune neuropathies,
mononeuritis multiplex, Lambert-Eaton's myasthenic syndrome,
Sydenham's chorea, tabes dorsalis, and Guillain-Barre's syndrome;
further examples are myelopathy/tropical spastic paraparesis,
myasthenia gravis, acute inflammatory demyelinating polyneuropathy,
and chronic inflammatory demyelinating polyneuropathy;
[0581] cardiac and pulmonary disorders, such as fibrosing
alveolitis, bronchiolitis obliterans, allergic aspergillosis,
cystic fibrosis, L6ffler's syndrome, myocarditis, and pericarditis;
further examples are hypersensitivity pneumonitis, and
paraneoplastic syndrome secondary to lung cancer;
[0582] allergic disorders, such as bronchial asthma and hyper-IgE
syndrome; a further example is amaurosis fugax;
[0583] ophthalmologic disorders, such as idiopathic
chorioretinitis;
[0584] infectious diseases, such as parvovirus B infection
(including hands-and-socks syndrome); and
[0585] gynecological-obstretical disorders, such as recurrent
abortion, recurrent fetal loss, and intrauterine growth
retardation; a further example is paraneoplastic syndrome secondary
to gynaecological neoplasms;
[0586] male reproductive disorders, such as paraneoplastic syndrome
secondary to testicular neoplasms; and
[0587] transplantation-derived disorders, such as allograft and
xenograft rejection, and graft-versus-host disease (including
chronic graft-versus-host disease).
[0588] In one embodiment, the disease is an inflammatory, immune
and/or autoimmune disorder selected from ulcerative colitis,
Crohn's disease, juvenile onset diabetes, multiple sclerosis,
immune-mediated thrombocytopenias, such as acute idiopathic
thrombocytopenic purpura and chronic idiopathic thrombocytopenic
purpura, hemolytic anemia (including autoimmune hemolytic anemia),
myasthenia gravis, systemic sclerosis, and pemphigus vulgaris.
[0589] In a further embodiment of the methods of treatment of the
present invention, the efficacy of the treatment is being monitored
during the therapy, e.g. at predefined points in time, by
determining tumor burden or CD20 expression levels on the relevant
tumor cells.
[0590] Dosage regimens in the above methods of treatment and uses
are adjusted to provide the optimum desired response (e.g., a
therapeutic response). For example, a single bolus may be
administered, several divided doses may be administered over time
or the dose may be proportionally reduced or increased as indicated
by the exigencies of the therapeutic situation. Parenteral
compositions may be formulated in dosage unit form for ease of
administration and uniformity of dosage.
[0591] The efficient dosages and the dosage regimens for the
bispecific antibodies depend on the disease or condition to be
treated and may be determined by the persons skilled in the art. An
exemplary, non-limiting range for a therapeutically effective
amount of a compound of the present invention is about 0.001-10
mg/kg, such as about 0.001-5 mg/kg, for example about 0.001-2
mg/kg, such as about 0.001-1 mg/kg, for instance about 0.001, about
0.01, about 0.1, about 1 or about 10 mg/kg. Another exemplary,
non-limiting range for a therapeutically effective amount of a
bispecific antibody of the present invention is about 0.1-100
mg/kg, such as about 0.1-50 mg/kg, for example about 0.1-20 mg/kg,
such as about 0.1-10 mg/kg, for instance about 0.5, about such as
0.3, about 1, about 3, about 5, or about 8 mg/kg.
[0592] A physician or veterinarian having ordinary skill in the art
may readily determine and prescribe the effective amount of the
pharmaceutical composition required. For example, the physician or
veterinarian could start doses of the bispecific antibody employed
in the pharmaceutical composition at levels lower than that
required in order to achieve the desired therapeutic effect and
gradually increase the dosage until the desired effect is achieved.
In general, a suitable daily dose of a bispecific antibody of the
present invention will be that amount of the compound which is the
lowest dose effective to produce a therapeutic effect.
Administration may e.g. be parenteral, such as intravenous,
intramuscular or subcutaneous. In one embodiment, the bispecific
antibodies may be administered by infusion in a weekly dosage of
calculated by mg/m.sup.2. Such dosages can, for example, be based
on the mg/kg dosages provided above according to the following:
dose (mg/kg).times.70: 1.8. Such administration may be repeated,
e.g., 1 to 8 times, such as 3 to 5 times. The administration may be
performed by continuous infusion over a period of from 2 to 24
hours, such as of from 2 to 12 hours. In one embodiment, the
bispecific antibodies may be administered by slow continuous
infusion over a long period, such as more than 24 hours, in order
to reduce toxic side effects.
[0593] In one embodiment the bispecific antibodies may be
administered in a weekly dosage of calculated as a fixed dose for
up to 8 times, such as from 4 to 6 times when given once a week.
Such regimen may be repeated one or more times as necessary, for
example, after 6 months or 12 months. Such fixed dosages can, for
example, be based on the mg/kg dosages provided above, with a body
weight estimate of 70 kg. The dosage may be determined or adjusted
by measuring the amount of bispecific antibody of the present
invention in the blood upon administration by for instance taking
out a biological sample and using anti-idiotypic antibodies which
target the CD20 antigen antigen-binding region of the bispecific
antibodies of the present invention.
[0594] In one embodiment, the bispecific antibodies may be
administered as maintenance therapy, such as, e.g., once a week for
a period of 6 months or more.
[0595] A bispecific antibody may also be administered
prophylactically in order to reduce the risk of developing cancer,
delay the onset of the occurrence of an event in cancer
progression, and/or reduce the risk of recurrence when a cancer is
in remission.
[0596] The bispecific antibodies of the invention may also be
administered in combination therapy, i.e., combined with other
therapeutic agents relevant for the disease or condition to be
treated. Accordingly, in one embodiment, the bispecific
antibody-containing medicament is for combination with one or more
further therapeutic agents, such as a cytotoxic, chemotherapeutic
or anti-angiogenic agent.
[0597] Such combined administration may be simultaneous, separate
or sequential. For simultaneous administration the agents may be
administered as one composition or as separate compositions, as
appropriate. The present invention thus also provides methods for
treating a disorder involving cells expressing CD20 as described
above, which methods comprise administration of a bispecific
antibody of the present invention combined with one or more
additional therapeutic agents as described below.
[0598] In one embodiment, the present invention provides a method
for treating a disorder involving cells expressing CD20 in a
subject, which method comprises administration of a therapeutically
effective amount of a bispecific antibody of the present invention,
and optionally at least one additional therapeutic agent, or an
antibody binding to a different CD20 epitope than said antibody, to
a subject in need thereof.
[0599] In one embodiment, the present invention provides a method
for treating or preventing cancer, which method comprises
administration of a therapeutically effective amount of a
bispecific antibody of the present invention and at least one
additional therapeutic agent to a subject in need thereof.
[0600] In one embodiment, such an additional therapeutic agent may
be selected from a tyrosine kinase inhibitor (TKI), such as
imatinib (Glivec, Gleevec STI571), ibrutinib (PCI-32765, Imbruvica)
or lapatinib (PTK787/ZK222584).
[0601] In one embodiment, such an additional therapeutic agent may
be selected from a Bruton tyrosine kinase (BTK) inhibitor, such as
ibrutinib.
[0602] In one embodiment, such an additional therapeutic agent may
be selected from a proteasome inhibitor (PI), such as
carfilzomib.
[0603] In one embodiment, such an additional therapeutic agent may
be selected from a immunomodulatory agent (IMID), such as
pomalidomide, thalidomide, or lenalidomide.
[0604] In one embodiment, such an additional therapeutic agent may
be selected from a phosphoinositide 3-kinase inhibitor, such as
idelalisib or duvelisib.
[0605] In one embodiment, such an additional therapeutic agent may
be selected from an aurora A kinase inhibitor, such as
alisertib.
[0606] In one embodiment, such an additional therapeutic may be
selected from a B-cell lymphoma-2 (Bcl-2) inhibitor, such as
venetoclax.
[0607] In one embodiment, such an additional therapeutic may be
selected from histone deacytelase (HDAC) inhibitors, such as
panobinostat.
[0608] Pharmaceutical compositions of the invention also can be
administered in combination therapy, i.e., combined with other
agents. In one embodiment, such therapeutic agents include one or
more chemotherapeutics, from the class of alkylating agents,
antimetabolites, mitotic inhibitors, anti-tumor antibiotics,
topoisomerase inhibitors or platinum analogs. Examples of such
chemotherapeutic agents are doxorubicin (Adriamycin), cisplatin
(Platinol), bleomycin (Blenoxane), carmustine (Gliadel),
cyclophosphamide (Cytoxan, Procytox, Neosar), bendamustine, and
chlorambucil (Leukeran).
[0609] In another embodiment, bispecific antibodies of the present
invention may be administered in combination with chlorambucil;
CHOP (cyclophosphamide, hydroxydaunorubicin, oncovin, prednisone or
prednisolone); cyclophosphamide and prednisolone; cyclophosphamide,
vincristine, and prednisone; cyclophosphamide, vincristine,
doxorubicin, and prednisone; fludarabine and an alkylating agent;
dose-adjusted EPOCH (etoposide, prednisolone, vincristine,
cyclophosphamide and doxorubicin); GemOx (gemcitabine and
oxaliplatin); GDP (gemcitabine, dexamethasone and cisplatin) or in
combination with other common multi-drugs regimens for NHL, such as
disclosed, e.g., in Non-Hodgkin's Lymphomas: Making sense of
Diagnosis, Treatment, and Options, Lorraine Johnston, 1999,
O'Reilly and Associates, Inc.
[0610] In one embodiment, such an additional therapeutic agent may
be selected from an antimetabolite, such as methotrexate,
6-mercaptopurine, 6-thioguanine, cytarabine, fludarabine,
5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine
or cladribine.
[0611] In another embodiment, such an additional therapeutic agent
may be selected from an alkylating agent, such as mechlorethamine,
thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine
(CCNU), cyclophosphamide, busulfan, dibromomannitol,
streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C,
cisplatin and other platinum derivatives, such as carboplatin.
[0612] In another embodiment, such an additional therapeutic agent
may be selected from an anti-mitotic agent, such as taxanes, for
instance docetaxel, and paclitaxel, and vinca alkaloids, for
instance vindesine, vincristine, vinblastine, and vinorelbine.
[0613] In another embodiment, such an additional therapeutic agent
may be selected from a topoisomerase inhibitor, such as topotecan
or irinotecan, or a cytostatic drug, such as etoposide and
teniposide.
[0614] In another embodiment, the present invention provides a
method for treating a disorder involving cells expressing CD20 in a
subject, which method comprises administration of a therapeutically
effective amount of a bispecific antibody of the present invention
and at least one inhibitor of angiogenesis, neovascularization,
and/or other vascularization to a subject in need thereof
[0615] Examples of such angiogenesis inhibitors are urokinase
inhibitors, matrix metalloprotease inhibitors (such as marimastat,
neovastat, BAY 12-9566, AG 3340, BMS-275291 and similar agents),
inhibitors of endothelial cell migration and proliferation (such as
TNP-470, squalamine, 2-methoxyestradiol, combretastatins,
endostatin, angiostatin, penicillamine, SCH66336 (Schering-Plough
Corp, Madison, N.J.), R115777 (Janssen Pharmaceutica, Inc,
Titusville, N.J.) and similar agents), antagonists of angiogenic
growth factors (such as such as ZD6474, SU6668, antibodies against
angiogenic agents and/or their receptors (such as VEGF (e.g.
bevacizumab), bFGF, and angiopoietin-1), thalidomide, thalidomide
analogs (such as CC-5013), Sugen 5416, SU5402, antiangiogenic
ribozyme (such as angiozyme), interferon .alpha. (such as
interferon .alpha.2a), suramin and similar agents), VEGF-R kinase
inhibitors and other anti-angiogenic tyrosine kinase inhibitors
(such as SU011248), inhibitors of endothelial-specific
integrin/survival signaling (such as vitaxin and similar agents),
copper antagonists/chelators (such as tetrathiomolybdate, captopril
and similar agents), carboxyamido-triazole (CAI), ABT-627, CM101,
interleukin-12 (IL-12), IM862, PNU145156E as well as nucleotide
molecules inhibiting angiogenesis (such as antisense-VEGF-cDNA,
cDNA coding for angiostatin, cDNA coding for p53 and cDNA coding
for deficient VEGF receptor-2).
[0616] Other examples of such inhibitors of angiogenesis,
neovascularization, and/or other vascularization are
anti-angiogenic heparin derivatives (e.g., heperinase III),
temozolomide, NK4, macrophage migration inhibitory factor,
cyclooxygenase-2 inhibitors, inhibitors of hypoxia-inducible factor
1, anti-angiogenic soy isoflavones, oltipraz, fumagillin and
analogs thereof, somatostatin analogues, pentosan polysulfate,
tecogalan sodium, dalteparin, tumstatin, thrombospondin, NM-3,
combrestatin, canstatin, avastatin, antibodies against other
targets, such as anti-alpha-v/beta-3 integrin and anti-kininostatin
antibodies.
[0617] In one embodiment, a therapeutic agent for use in
combination with a bispecific antibody for treating the disorders
as described above may be an anti-cancer immunogen, such as a
cancer antigen/tumor-associated antigen (e.g., epithelial cell
adhesion molecule (EpCAM/TACSTD1), mucin 1 (MUC1), carcinoembryonic
antigen (CEA), tumor-associated glycoprotein 72 (TAG-72), gp100,
Melan-A, MART-1, KDR, RCAS1, MDA7, cancer-associated viral vaccines
(e.g., human papillomavirus vaccines) or tumor-derived heat shock
proteins,
[0618] In one embodiment, a therapeutic agent for use in
combination with a bispecific antibody for treating the disorders
as described above may be an anti-cancer cytokine, chemokine, or
combination thereof. Examples of suitable cytokines and growth
factors include IFN.gamma., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12,
IL-13, IL-15, IL-18, IL-23, IL-24, IL-27, IL-28a, IL-28b, IL-29,
KGF, IFN.alpha. (e.g., INF.alpha.2b), IFN.beta., GM-CSF, CD40L,
Flt3 ligand, stem cell factor, ancestim, and TNF.alpha.. Suitable
chemokines may include Glu-Leu-Arg (ELR)-negative chemokines such
as IP-10, MCP-3, MIG, and SDF-1.alpha. from the human CXC and C-C
chemokine families. Suitable cytokines include cytokine
derivatives, cytokine variants, cytokine fragments, and cytokine
fusion proteins.
[0619] In one embodiment, a therapeutic agent for use in
combination with a bispecific antibody for treating the disorders
as described above may be a cell cycle control/apoptosis regulator
(or "regulating agent"). A cell cycle control/apoptosis regulator
may include molecules that target and modulate cell cycle
control/apoptosis regulators such as (i) cdc-25 (such as NSC
663284), (ii) cyclin-dependent kinases that overstimulate the cell
cycle (such as flavopiridol (L868275, HMR1275),
7-hydroxystaurosporine (UCN-01, KW-2401), and roscovitine
(R-roscovitine, CYC202)), and (iii) telomerase modulators (such as
BIBR1532, SOT-095, GRN163 and compositions described in for
instance U.S. Pat. Nos. 6,440,735 and 6,713,055). Non-limiting
examples of molecules that interfere with apoptotic pathways
include TNF-related apoptosis-inducing ligand (TRAIL)/apoptosis-2
ligand (Apo-2L), antibodies that activate TRAIL receptors,
interferon-.gamma. (IFN-.gamma.) and anti-sense Bcl-2.
[0620] In one embodiment, a therapeutic agent for use in
combination with a bispecific antibody for treating the disorders
as described above may be a hormonal regulating agent, such as
agents useful for anti-androgen and anti-estrogen therapy. Examples
of such hormonal regulating agents are tamoxifen, idoxifene,
fulvestrant, droloxifene, toremifene, raloxifene,
diethylstilbestrol, ethinyl estradiol/estinyl, an antiandrogene
(such as flutaminde/eulexin), a progestin (such as such as
hydroxyprogesterone caproate, medroxy-progesterone/provera,
megestrol acepate/megace), an adrenocorticosteroid (such as
hydrocortisone, prednisone), luteinizing hormone-releasing hormone
(and analogs thereof and other LHRH agonists such as buserelin and
goserelin), an aromatase inhibitor (such as anastrazole/arimidex,
aminoglutethimide/cytraden, exemestane) or a hormone inhibitor
(such as octreotide/sandostatin).
[0621] In one embodiment, a therapeutic agent for use in
combination with a bispecific antibody for treating the disorders
as described above may be an immune check-point inhibitor, such as
molecules that block the activity of CTLA-4, e.g. ipilimumab, PD-1,
e.g. pembrolizumab, PD-L1, TIM3, TIGIT, BTLA, VISTA or LAG-3.
[0622] In one embodiment, a therapeutic agent for use in
combination with a bispecific antibody for treating the disorders
as described above may be an anti-cancer nucleic acid or an
anti-cancer inhibitory RNA molecule.
[0623] Examples of other anti-cancer agents, which may be relevant
as therapeutic agents for use in combination with a bispecific
antibody according to the invention for treating the disorders as
described above are differentiation inducing agents, retinoic acid
analogues (such as all trans retinoic acid, 13-cis retinoic acid
and similar agents), vitamin D analogues (such as seocalcitol and
similar agents), inhibitors of ErbB3, ErbB4, IGF-IR, insulin
receptor, PDGFRa, PDGFRbeta, Flk2, Flt4, FGFR1, FGFR2, FGFR3,
FGFR4, TRKA, TRKC, RON (such as an anti-RON antibody), Sea, Tie,
Tie2, Eph, Ret, Ros, Alk, LTK, PTK7 and similar agents.
[0624] Examples of other anti-cancer agents, which may be relevant
as therapeutic agents for use in combination with a bispecific
antibody according to the invention for treating the disorders as
described above are estramustine and epirubicin.
[0625] Examples of other anti-cancer agents, which may be relevant
as therapeutic agents for use in combination with a bispecific
antibody according to the invention for treating the disorders as
described above are a HSP90 inhibitor like 17-allyl amino
geld-anamycin, antibodies directed against a tumor antigen such as
PSA, CA125, KSA, integrins, e.g. integrin .beta.1, or inhibitors of
VCAM.
[0626] Examples of other anti-cancer agents, which may be relevant
as therapeutic agents for use in combination with a bispecific
antibody for treating the disorders as described above are
calcineurin-inhibitors (such as valspodar, PSC 833 and other MDR-1
or p-glycoprotein inhibitors), TOR-inhibitors (such as sirolimus,
everolimus and rapamcyin), and inhibitors of "lymphocyte homing"
mechanisms (such as FTY720), and agents with effects on cell
signaling such as adhesion molecule inhibitors (for instance
anti-LFA).
[0627] In yet another embodiment, the bispecific antibodies may be
administered in conjunction with radiotherapy and/or autologous or
allogeneic peripheral stem cell or bone marrow transplantation.
[0628] In still another embodiment, the bispecific antibodies may
be administered in combination with one or more antibodies selected
from anti-CD25 antibodies, anti-CD19 antibodies, anti-CD20
antibodies (e.g. ofatumumab or rituximab), anti-CD21 antibodies,
anti-CD22 antibodies, anti-CD37 antibodies, anti-CD38 antibodies,
anti-IL6R antibodies, anti-IL8 antibodies, anti-IL15 antibodies,
anti-IL15R antibodies, anti-CD4 antibodies, anti-CD11a antibodies
(e.g., efalizumab), anti-alpha-4/beta-1 integrin (VLA4) antibodies
(e.g., natalizumab), and CTLA4-Ig.
[0629] In a further embodiment, the bispecific antibodies may be
administered in combination with one or more antibodies that block
immune checkpoints, such as anti-CTLA-4 (CD152) antibodies,
anti-PD-1 (CD279) antibodies, anti-PD-L1 (CD274) antibodies,
anti-LAG-3 (CD223) antibodies, anti-TIM3 antibodies, anti-CEACAM1
(CD66a) antibodies, anti-VISTA antibodies, anti-TIGIT antibodies,
anti-BTLA (CD272) antibodies.
[0630] In a further embodiment, the bispecific antibodies may be
administered in combination with one or more agonistic antibodies
which are specific for costimulatory receptors on immune cells,
such as anti-4-1BB (CD137) antibodies (e.g. urelumab), anti-OX40
(CD134) antibodies, anti-CD40 antibodies, anti-CD27 antibodies.
[0631] In a further embodiment, the bispecific antibodies may be
administered in combination with one or more type II macrophage
depleting or polarizing antibodies, such as anti-CSF-1R (CD115)
antibodies.
[0632] In a further embodiment, the bispecific antibodies may be
administered in combination with one or more antibodies that bind
to molecules involved in regulation of the innate immune system,
such as anti-CD47 antibodies, anti-CD200 antibodies, anti-CD200R
antibodies, antibodies against killer cell inhibitory receptors
(KIRs), antibodies against CD94/NKG2 receptors, anti-CD305
(LAIR1).
[0633] In another particular embodiment, the bispecific antibodies
are administered in combination with one or more antibodies
selected from anti-CD19 antibodies, anti-CD21 antibodies, anti-CD22
antibodies, anti-CD37 antibodies, and anti-CD38 antibodies for the
treatment of malignant diseases.
[0634] In another particular embodiment, the bispecific antibodies
are administered in combination with an anti-CD20 antibody, such as
ofatumumab.
[0635] In still another particular embodiment, the bispecific
antibodies are administered in combination with one or more
antibodies selected from anti-IL6R antibodies, anti-IL8 antibodies,
anti-IL15 antibodies, anti-IL15R antibodies, anti-CD4 antibodies,
anti-CD11a antibodies (e.g., efalizumab), anti-alpha-4/beta-1
integrin (VLA4) antibodies (e.g natali-zumab), and CTLA4-Ig for the
treatment of inflammatory diseases.
[0636] In one embodiment, the bispecific antibody of the invention
is for use in combination with one or more other therapeutic
antibodies, such as zanolimumab, daratumumab (Darzalex),
ranibizumab, nimotuzumab, panitumumab, hu806, daclizumab (Zenapax),
basiliximab (Simulect), infliximab (Remicade), adalimumab (Humira),
natalizumab (Tysabri), omalizumab (Xolair), and/or efalizumab
(Raptiva).
[0637] In another embodiment the bispecific antibody of the
invention is for use in combination with one or more antibody-drug
conjugates (ADCs), for example brentuximab-vedotin (Adcetris),
inotuzumab ozogamicin (CMC-544), polatuzumab vedotin (RG7593),
coltuximab ravtansine (SAR3419), indatuximab ravtansine (BT-062),
inotuzumab ozogamicin (CMC-544), denintuzumab mafodotin (SGN-CD19),
polatuzumab vedotin (RG7596) or a CD37-specific antibody drug
conjugated (for example IMGN529 or AGS67E).
In another embodiment, the bispecific antibody of the invention can
be used in combination with an anti-inflammatory or an
immunosuppressive agent. For example, the combination therapy can
include a composition of the present invention with at least one
anti-inflammatory agent or at least one immunosuppressive agent. In
one embodiment such therapeutic agents include one or more
anti-inflammatory agents, such as a steroidal drug or a NSAID
(nonsteroidal anti-inflammatory drug). Preferred agents include,
for example, aspirin and other salicylates, Cox-2 inhibitors, such
as celecoxib (Celebrex), NSAIDs such as ibuprofen (Motrin, Advil),
fenoprofen (Nalfon), naproxen (Naprosyn), sulindac (Clinoril),
diclofenac (Voltaren), piroxicam (Feldene), ketoprofen (Orudis),
diflunisal (Dolobid), nabumetone (Relafen), etodolac (Lodine),
oxaprozin (Daypro), and indomethacin (Indocin).
[0638] In another embodiment, such therapeutic agents include one
or more DMARDs, such as methotrexate (Rheumatrex),
hydroxychloroquine (Plaquenil), sulfasalazine (Asulfidine),
pyrimidine synthesis inhibitors, e.g., leflunomide (Arava), IL-1
receptor blocking agents, e.g., anakinra (Kineret), and TNF-.alpha.
blocking agents, e.g., etanercept (Enbrel), infliximab (Remicade)
and adalimumab.
[0639] In another embodiment, such therapeutic agents include one
or more immunosuppressive agents, such as cyclosporine (Sandimmune,
Neoral) and azathioprine (Imural).
[0640] In a particular embodiment, the bispecific antibodies are
administered in combination with an anti-CD25 antibody for the
treatment of bullous pemphigoid, e.g., in patients with
graft-versus-host disease.
Radiotherapy--Surgery
[0641] In one embodiment, the present invention provides a method
for treating a disorder involving cells expressing CD20 in a
subject, which method comprises administration of a therapeutically
effective amount of a CD3xCD20 bispecific antibody of the present
invention, and radiotherapy to a subject in need thereof.
[0642] In one embodiment, the present invention provides a method
for treating or preventing cancer, which method comprises
administration of a therapeutically effective amount of a CD3xCD20
bispecific antibody of the present invention, and radiotherapy to a
subject in need thereof.
[0643] In one embodiment, the present invention provides the use of
a bispecific antibody of the present invention, for the preparation
of a pharmaceutical composition for treating cancer to be
administered in combination with radiotherapy.
[0644] Radiotherapy may comprise radiation or associated
administration of radiopharmaceuticals to a patient. The source of
radiation may be either external or internal to the patient being
treated (radiation treatment may, for example, be in the form of
external beam radiation therapy (EBRT) or brachytherapy (BT)).
Radioactive elements that may be used in practicing such methods
include, e.g., radium, cesium-137, iridium-192, americium-241,
gold-198, cobalt-57, copper-67, technetium-99, iodide-123,
iodide-131, and indium-111.
[0645] In a further embodiment, the present invention provides a
method for treating or preventing cancer, which method comprises
administration to a subject in need thereof of a therapeutically
effective amount of a bispecific antibody of the present invention,
in combination with surgery.
Diagnostic Uses
[0646] Thus, in one aspect, the invention relates to a diagnostic
composition comprising a bispecific CD3xCD20 antibody as defined
herein, and to its use.
[0647] In another aspect, the invention relates to a kit for
detecting cross-linking between CD3- and CD20-expressing cells, in
a sample derived from a patient such as a blood sample, lymph node
sample or bone marrow sample, comprising [0648] i) a bispecific
antibody according to any one of the embodiments as disclosed
herein; and [0649] ii) instructions for use of said kit.
[0650] In one embodiment, the present invention provides a kit for
diagnosis of cancer comprising a container comprising a bispecific
CD3xCD20 antibody, and one or more reagents for detecting
cross-linking of CD20 expressing cells and CD3 expressing
cells.
[0651] Reagents may include, for example, fluorescent tags,
enzymatic tags, or other detectable tags. The reagents may also
include secondary or tertiary antibodies or reagents for enzymatic
reactions, wherein the enzymatic reactions produce a product that
may be visualized.
[0652] In a further aspect, the invention relates to a method for
detecting whether cross-linking between CD3- and CD20-expressing
cells occurs in a sample derived from a patient, such as a blood
sample, lymph node sample or bone marrow sample, upon
administration of a bispecific antibody according to any one of the
embodiments as disclosed herein, comprising the steps of: [0653]
(i) contacting the sample with a bispecific antibody according to
any one of the embodiments as disclosed herein under conditions
that allow for formation of a complex between said bispecific
antibody and the CD3- and CD20-expressing cells; and [0654] (ii)
analyzing whether a complex has been formed.
[0655] Detection of the complex can be done by methods known in the
art, such as by the method disclosed in Example 5.
[0656] In a further aspect, the invention relates to an
anti-idiotypic antibody which binds to the first antigen-binding
region as defined in any one of the embodiments disclosed herein,
or which binds to the second antigen-binding region as defined in
any one of the embodiments disclosed herein.
[0657] The present invention is further illustrated by the
following examples, which should not be construed as limiting the
scope of the invention.
EXAMPLES
Example 1--Generation of Humanized CD3 Antibodies and
Non-Activating Antibody Variants
Humanization of CD3 Antibodies
[0658] Humanization of a murine CD3 antibody SP34 (U.S. Pat. No.
8,236,308, described herein as IgG1-CD3) was performed by Antitope
(Cambridge, UK) using their improved version of the germline
humanization (CDR-grafting) technology (EP0629240). Using this
technology, 4 different VH chains (SEQ ID NOs:6, 7, 8, and 9) and 3
different VL chains (SEQ ID NOs:10, 11, and 12) were designed. By
combining these 4 VH with the 3 VL chains, 12 different antibodies
were generated. The humanized variants are described herein as
huCD3. Thus, humanized variants comprising a VH and a VL according
to the invention, are described as, e.g., IgG1-huCD3-H1L1 meaning
that said specific variant is of the IgG1 isotype, is a humanized
SP34 CD3-specific antibody and comprises the VH amino acid sequence
termed "H1" and is defined according to SEQ ID NO:6, and the VL
amino acid sequence termed "L1" and is defined according to SEQ ID
NO:10. Thus, H1 refers to the variable heavy chain region VH1, L1
refers to the variable light chain region VL1, and so forth.
[0659] In particular, the variants IgG1-huCD3-H1L1 (humanized CD3
comprising the VH1 sequence set forth in SEQ ID NO:6 and the VL1
sequence set forth in SEQ ID NO:10), IgG1-huCD3-H1L2 (humanized CD3
comprising the VH1 sequence set forth in SEQ ID NO:6 and the VL2
sequence set forth in SEQ ID NO:11), IgG1-huCD3-H1L3 (humanized CD3
comprising the VH1 sequence set forth in SEQ ID NO:6 and the VL3
sequence set forth in SEQ ID NO:12), IgG1-huCD3-H3L3 (humanized CD3
comprising the VH3 sequence set forth in SEQ ID NO:8 and the VL3
sequence set forth in SEQ ID NO:12), IgG1-huCD3-H4L1 (humanized CD3
comprising the VH4 sequence set forth in SEQ ID NO:9 and the VL1
sequence set forth in SEQ ID NO:10), IgG1-huCD3-H3L1 (humanized CD3
comprising the VH3 sequence set forth in SEQ ID NO:8 and the VL1
sequence set forth in SEQ ID NO:10), IgG1-huCD3-H3L3 (humanized CD3
comprising the VH3 sequence set forth in SEQ ID NO:8 and the VL3
sequence set forth in SEQ ID NO:12), and IgG1-huCD3-H4L3 (humanized
CD3 comprising the VH4 sequence set forth in SEQ ID NO:9 and the
VL3 sequence set forth in SEQ ID NO:12) have been used as the first
antigen-binding region of the bispecific antibodies according to
the invention. Herein, "IgG1-huCD3", if not further defined refers
to IgG1-huCD3-H1L1.
[0660] In some examples the CD3 antibody comprising the heavy and
light chain variable region sequences of huCLB-T3/4 (SEQ ID NOs:17
and 18, respectively) were used as the first antigen-binding region
of the bispecific antibodies according to the invention. huCLB-T3/4
is a humanized version of the murine CD3 antibody CLB-T3/4 (Parren
et al., Res Immunol. 1991, 142(9):749-63). Both sequences (SEQ ID
NOs:17 and 18) were cloned into the relevant pcDNA3.3 (Invitrogen)
expression vectors and expressed by cotransfection in HEK293F
cells. The resulting CD3 antibody is described as
IgG1-huCLB-T3/4.
[0661] The humanized CD3 antibodies are further disclosed in
WO2015001085.
CD20 Antibodies
[0662] The CD20 antibodies used as the second binding arm of the
present bispecific antibodies are further disclosed in WO2004035607
(Genmab) and WO2005103081 (Genmab).
Control Antibodies
[0663] The following antibodies were used as control antibodies in
the examples:
CD3 Antibodies
[0664] IgG1-CD3 (the parental CD3 antibody SP34 having the VH and
VL sequences set forth in SEQ ID NO:25 and SEQ ID NO:26,
respectively)
[0665] IgG1-huCD3 (H1L1) (having the VH and VL sequences set forth
in SEQ ID NO:6 and SEQ ID NO:10, respectively)
[0666] IgG1-huCLB-T3/4
[0667] bsIgG1-huCD3-H1L1-FEALxb12-FEAR (bispecific antibody using
as the second arm the antibody b12 which is a gp120 specific
antibody (Barbas, C F. J Mol Biol. 1993 Apr. 5; 230(3):812-23).
[0668] IgG1-huCD3-H1L1-FEAL
[0669] IgG1-huCLB-T3/4-FEAL
CD20 Antibodies
[0670] IgG1-7D8 (having the VH and VL sequences set forth in SEQ ID
NO:27 and SEQ ID NO:28, respectively)
[0671] IgG1-11B8 (having the VH and VL sequences set forth in SEQ
ID NO:40 and SEQ ID NO:41, respectively)
[0672] IgG1-2F2 (having the VH and VL sequences set forth in SEQ ID
NO:37 and SEQ ID NO:28, respectively)
[0673] IgG1-RTX (having the VH and VL sequences of rituximab)
[0674] IgG1-GA101 (having the VH and VL sequences of obinutuzumab,
CHEMBL1743048, U.S. Pat. No. 8,883,980, with a wild type human IgG1
Fc domain)
[0675] IgG1-2C6 (having the VH and VL sequences set forth in SEQ ID
NO:47 and SEQ ID NO:48, respectively).
[0676] IgG1-7D8-FEAR
[0677] IgG1-11B8-FEAR
[0678] IgG1-2F2-FEAR
[0679] IgG1-GA101-FEAR
[0680] IgG1-2C6-FEAR
TABLE-US-00005 TABLE 4 Quantification of 7D8 CD20 antibody binding
on different B cell lines Quantitative flow cytometry (QIFIKIT
.RTM., Dako; cat. no K0078) was performed as described (Poncelet
and Carayon, 1985, J. Immunol. Meth. 85: 65-74), to quantify the
binding of 7D8 CD20 antibody on different human B-cell lines used
in the examples, as an indication of CD20 expression. To this end,
human B-cell lines were incubated with a saturating concentration
of 7D8, and the number of bound 7D8 molecules was determined using
quantitative flow cytometry. The anti-human CD20 antibody 7D8, that
was engineered to express a murine Fc domain (10 .mu.g/mL,
mmIgG1-7D8 (Overdijk et al. 2012, J. Immunol. 189: 3430-3438), was
used in this assay. B-ALL: B cell acute lymphoblastic leukemia,
ABC-DLBCL: activated B cell diffuse large B-cell lymphoma,
GC-DLBCL: germinal center diffuse large B-cell-lymphoma, FL:
follicular lymphoma. 50,000- 100,000- Lymp 100,000 200,000
>200,000 homa type Cell line ABC*/cell ABC/cell ABC/cell
Burkitt's Daudi X lymphoma Burkitt's Raji X lymphoma B-ALL Nalm-16
X ABC-DLBCL OCI-Ly7 X GC-DLBCL SU-DHL-4 X FL WSU-NHL X *ABC:
antibody-binding capacity
Example 2--Generation of Bispecific Antibodies by 2-MEA-Induced
Fab-Arm Exchange
[0681] An in vitro method for producing bispecific antibodies is
described in WO2008119353 (Genmab) and reported by van der
Neut-Kolfschoten et al. (Science. 2007 Sep. 14; 317(5844):1554-7).
Herein, the bispecific antibodies were formed by "Fab-arm" or
"half-molecule" exchange (swapping of a heavy chain and attached
light chain) between two monospecific IgG4- or IgG4-like antibodies
upon incubation under mildly reducing conditions. Without being
limited to theory, this Fab-arm exchange reaction was the result of
a disulfide-bond isomerization reaction wherein the inter
heavy-chain disulfide bonds in the hinge regions of monospecific
antibodies were reduced and the resulting free cysteines form a new
inter heavy-chain disulfide bond with cysteine residues of another
antibody molecule with a different specificity. The resulting
products were bispecific antibodies having two Fab arms with
different sequences.
[0682] The knowledge of this natural IgG4 Fab-arm exchange was
adapted to generate a method to produce stable IgG1-based
bispecific antibodies (WO2011131746 (Genmab)).
[0683] The bispecific antibody product generated by this method
described below will no longer participate in IgG4 Fab-arm
exchange. The basis for this method was the use of complimentary
CH3 domains, which promote the formation of heterodimers under
specific assay conditions. To enable the production of bispecific
antibodies by this method, IgG1 molecules carrying certain
mutations in the CH3 domain were generated: in one of the parental
IgG1 antibody T350I, K370T and F405L mutations (or minimally F405L)
in the other parental IgG1 antibody the K409R mutation.
[0684] To generate bispecific antibodies, these two parental
antibodies, each antibody at a final concentration of 0.5 mg/mL
(equimolar concentration), were incubated with 25 mM
2-mercaptoethylamine-HCl (2-MEA) in a total volume of 100 .mu.L
Tris-EDTA (TE) at 37.degree. C. for 90 min. The reduction reaction
is stopped when the reducing agent 2-MEA is removed by using spin
columns (Microcon centrifugal filters, 30k, Millipore) according to
the manufacturer's protocol.
Example 3--Generation of Mutants to Optimize the Production of the
Humanized CD3 Antibodies
[0685] Generation of huCD3-L1 Mutant Plasmids
[0686] Several IgG1-huCD3-H1L1 variants with mutations in the L1
light chain were generated in order to improve the expression
levels of IgG1-huCD3-H1L1 in transient transfection assays, cf.
Table 5. The selection of residues was based on comparisons with
germline sequences or screening for the presence of rare residues
in the huCD3-L1 sequence in combination with crystal structures
from homologous antibodies. The selected sequences were synthesized
at GeneArt (Life Technologies, Germany). p33L encodes the constant
domain of the human IgLC2/IgLC3 lambda light chain of SEQ ID NO:29.
p33Glf encodes the IgG1m(f) heavy chain constant region of SEQ ID
NO: 15.
TABLE-US-00006 TABLE 5 Antibody name after co-expression LC
constructs LC Mutants with HC VH1 encoding plasmid p33L-huCD3-VL1
-- IgG1-huCD3-H1L1 p33L-huCD3-VL1-F10L F10L IgG1-huCD3-H1L1-LF10L
p33L-huCD3-VL1-R23A R23A IgG1-huCD3-H1L1-LR23A p33L-huCD3-VL1-A35P
A35P IgG1-huCD3-H1L1-LA35P p33L-huCD3-VL1-T41K T41K
IgG1-huCD3-H1L1-LT41K p33L-huCD3-VL1-K55N K55N
IgG1-huCD3-H1L1-LK55N p33L-huCD3-VL1-L97H L97H
IgG1-huCD3-H1L1-LL97H p33L-huCD3-VL1-LKNH F10L, T41K, K55N, L97H
IgG1-huCD3-H1L1-LLKNH p33L-huCD3-VL1- F10L, R47T, D71G, A82P,
IgG1-huCD3-H1L1-LLTGPEAEY LTGPEAEY D83E, S86A, I87E, F89Y
p33L-huCD3-VL1- F10L, R23A, A35P, R47T, D71G,
IgG1-huCD3-H1L1-LLAPTGPEAEY LAPTGPEAEY A82P, D83E, S86A, I87E,
F89Y
Transient Expression in Expi293F Cells
[0687] For a single antibody, the plasmids encoding heavy chain
(HC) and light chain (LC) were transiently transfected in Freestyle
Expi293F cells (Life technologies, USA) using ExpiFectamine 293
(Life technologies). In total 1.5 .mu.g HC encoding plasmid and 1.5
.mu.g LC encoding plasmid (Table 5) were diluted in 150 .mu.L
Opti-MEM (Gibco, USA). To prepare the transfection mix, 8 .mu.L
ExpiFectamine 293 was diluted in 150 .mu.L Opti-MEM and incubated
for 5 minutes at room temperature. Next, the DNA/Opti-MEM and
ExpiFectamine 293/Opti-MEM solutions were mixed, incubated for 20
minutes at room temperature and added to 2.55 mL Expi293 Expression
Medium containing 7.5x106 Expi293F cells and 50 U/mL Pen-Strep. The
cells were incubated at 37.degree. C., 8% C02 and shaken at 200
rpm. To enhance expression, 21 hours after transfection, 15 .mu.L
enhancer mix 1 and 150 .mu.L enhancer mix 2 were added. The cells
were incubated for 4 days followed by the harvest of the
supernatant. Supematants were spun at 3,000.times.g and filter
sterilized over a 0.2 .mu.m filter. The IgG expression levels were
measured on the Octet RED (ForteBio, US) using anti-human IgG
sensors (ForteBio, USA).
IgG Concentration Analysis
[0688] The IgG1-huCD3-H1L1 antibody expressed at 72 .mu.g/mL. A
4-fold increase in IgG expression was observed for the
IgG1-huCD3-H1L1-LT41K mutant (295 .mu.g/mL). Similar expression
levels were observed for IgG1-huCD3-H1L1-LLKNH mutant (311
.mu.g/mL), including the T41K mutation amongst other mutations. The
other mutations in these constructs did not show expression
enhancement when tested individually (IgG1-huCD3-H1L1-LF10L,
IgG1-huCD3-H1L1-LK55N, IgG1-huCD3-H1L1-LL97H) compared to
IgG1-huCD3-H1L1.
[0689] A second set of expression enhancing mutations was observed
for the combination of R23A and A35P. While
IgG1-huCD3-H1L1-LLTGPEAEY variant lacking R23A and A35P did not
show enhanced expression (83 .mu.g/mL), IgG1-huCD3-H1L1-LLAPTGPEAEY
containing the additional R23A and A35P mutations did show a 3-fold
increase in expression (237 .mu.g/mL). Individually, R23A or A35P
did not show enhanced expression levels (56 and 81 .mu.g/mL,
respectively).
Example 4--Binding of Bispecific CD3xCD20 Antibodies to Daudi and
Jurkat Cells
[0690] Binding of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR to the human
CD3-negative CD20-positive Daudi (American Type Culture Collection,
ATCC.RTM. CCL-213.TM., derived from human Burkitt's lymphoma) and
the human CD3-positive CD20-negative Jurkat (Deutsche Sammlung von
Mikroorgansimen und Zellkulturen, DSMZ.RTM. ACC 282.TM., derived
from acute T-cell leukemia) cell lines was analyzed by flow
cytometry. In addition to the non-activating mutations, L234F,
L235E, D265A, on both arms, the bispecific antibody contained an
F405L mutation on one arm and a K409R mutation on the other
arm.
[0691] Cells (1.times.10.sup.5 cells/well) were incubated in
polystyrene 96-well round-bottom plates (Greiner bio-one, cat. no.
650101) with serial dilutions of antibodies (range 0.041 to 30
.mu.g/mL in 3-fold dilution steps [A-E] and 0.00061 to 10 .mu.g/mL
in 4-fold dilution steps [F-I]) in 100 .mu.L PBS/0.1% BSA/0.02%
azide (from here designated as staining buffer) at 4.degree. C. for
30 min.
[0692] After washing twice in staining buffer, cells were incubated
in 50 .mu.L secondary antibody at 4.degree. C. for 30 min. As a
secondary antibody, R-Phycoerythrin (PE)-conjugated goat-anti-human
IgG F(ab').sub.2 (cat. no. 109-116-098, Jackson ImmunoResearch
Laboratories, Inc., West Grove, Pa.) diluted 1:200 in staining
buffer, was used for all experiments. Next, cells were washed twice
in staining buffer, re-suspended in 30 .mu.L staining buffer and
analyzed on an iQue screener (Intellicyt Corporation, USA) (for
FIG. 1A-E) or re-suspended in 100 .mu.L staining buffer and
analyzed on a FACSCANTOII (BD Biosciences) (FIG. 1F-I). Binding
curves were analyzed using non-linear regression (sigmoidal
dose-response with variable slope) using GraphPad Prism V75.04
software (GraphPad Software, San Diego, Calif., USA).
[0693] FIG. 1 A-F show that bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR
and bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR showed dose-dependent
binding to Daudi cells, with higher maximum binding than
monospecific, bivalent CD20 antibodies IgG1-7D8 and IgG1-2F2. For
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR and
bsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR, the maximum binding was
similar to that of the bivalent, monospecific CD20 antibodies
IgG1-11B8, IgG1-RTX and IgG1-GA101. Maximum binding of
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR, and of the bivalent,
monospecific CD20 antibodies IgG1-11B8, IgG1-RTX and IgG1-GA101 was
lower than that of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR and bivalent, monospecific
CD20 antibodies IgG1-7D8 and IgG1-2F2. Maximum binding of
huCD3-H1L1-FEALxCD20-2C6-FEAR was comparable to that of
monospecific CD20 antibody IgG1-7D8.
[0694] FIG. 1G shows binding to Daudi cells of CD3xCD20 bispecific
antibodies containing the CD3-specific huCLB-T3/4 Fab-arm.
BsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR,
bsIgG1-huCLB-T3/4-FEALxCD20-2F2-FEAR showed binding comparable to
the monospecific CD20 antibody IgG1-7D8. As for the CD3xCD20
bispecifics containing the CD3-specific huCD3-H1L1 Fab-arm, the
binding for bsIgG1-huCLB-T3/4-FEALxCD20-11B8-FEAR and
bsIgG1-huCLB-T3/4-FEALxCD20-GA101-FEAR was lower than that of the
monospecific CD20 antibody IgG1-7D8 and the CD3xCD20 bispecific
antibodies containing a CD20-specific 7D8- or a 2F2-Fab-arm.
[0695] FIGS. 1H and I show binding to Jurkat cells of CD3xCD20
bispecific antibodies containing a CD3-specific huCD3-H1L1- or a
huCLB-T3/4-Fab-arm, respectively. All CD3xCD20 bispecific
antibodies with a CD3-specific Fab-arm originating from
IgG1-huCD3-H1L1-FEAL showed comparable binding to Jurkat cells,
irrespective of the origin of the CD20-specific Fab-arm (FIG. 1H).
Similarly, all CD3xCD20 bispecific antibodies with a CD3 Fab-arm
obtained from IgG1-huCLB-T3/4-FEAL showed comparable binding (FIG.
1G). The monospecific, bivalent parental CD3-specific antibodies,
IgG1-huCD3-H1L1 and IgG1-huCLB-T3/4, bound to Jurkat cells with
lower EC.sub.50 values than the CD3xCD20 bispecific antibodies.
Example 5--Concentration-Dependent Simultaneous Binding of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR to T Cells and B Cells
[0696] Human B cells express the surface antigen CD20, but lack
expression of CD3. In contrast, human T cells express the surface
antigen CD3, but lack expression of CD20. The bispecific antibody
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR recognizes both CD3 and CD20
and is therefore able to bind both human B and T cells.
Simultaneous binding of the bispecific antibody
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR to B and T cells was shown by
incubating 100 .mu.L heparinized whole blood from a healthy donor
in the presence of a concentration range of antibodies (range 0.001
to 100 .mu.g/mL in 10-fold dilution steps, obtained by adding
different volumes of undiluted antibody to the blood sample) at
37.degree. C. for 2 hours. The CD20 antibody 2F2 and
bsIgG1-huCD3-H1L1-FEALxb12-FEAR, that exclusively recognize CD20 or
CD3 respectively, and thus are unable to simultaneously bind B and
T cells, were used as negative control antibodies. Cells were
washed twice in staining buffer (1200 RPM, 3 min.) and incubated
with antibodies specific for CD4 (CD4-PE; Becton Dickinson, cat.
no. 555347) or CD8 (CD8-PE; Miltenyi, cat. no. BW135/80) (to
identify the different T cell subsets) and CD19 (CD19-APC; DAKO,
cat. no. C7224) (to identify B cells) for 30 min at 4.degree. C.
Before analysis, erythrocytes were lysed by addition of 100 .mu.L
erythrocyte lysis buffer (10 mM KHCO3/0.01 mM EDTA/155 mM
NH.sub.4Cl dissolved in dH.sub.2O) (KHCO3: Sigma, cat. no. P9144;
EDTA: FLUKA, cat. no. 036; NH.sub.4Cl: Sigma, cat. no. A-5666).
Samples were analyzed by flow cytometry, using a FACSCANTOII
equipped with an automated plate loader (Becton Dickinson). The
number of CD4.sup.+CD19.sup.+ or CD8.sup.+CD19.sup.+
double-positive events, indicative of simultaneous binding of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR to human T and B cells, was
quantified by CD4/CD19 and CD8/CD19 quadrant analysis.
[0697] FIGS. 2A and 2B show that only in the presence of the
CD3xCD20 bispecific antibody, a population of CD4.sup.+CD19.sup.+
and CD8.sup.+CD19.sup.+ double-positive events, representing T
cell-B cell doublets, was observed, indicating that these
bispecific antibodies can bind two cell types simultaneously. The
appearance of doublets was antibody concentration-dependent and
occurred for both CD4.sup.+ (A) and CD8.sup.+ T cells (B).
Example 6--Induction of Cytotoxicidty In Vitro by CD3xCD20
Bispecific Antibodies
[0698] Different CD3xCD20 bispecific antibodies were tested in an
in vitro cytotoxicity assay using tumor cell lines as target cells
and peripheral blood mononuclear cells (PBMCs) or purified T cells
as effector cells.
[0699] Target Cells:
[0700] The following tumor cell lines were used: Daudi and Raji
(described supra), OCI-Ly7 (DSMZ; cat. no. ACC 688; derived from
DLBCL), SU-DHL-4 (DSMZ; cat. no. ACC 495; derived from DLBCL), RI-1
(DSMZ; cat. no. ACC 585, derived DLBCL]), NALM-16 (DSMZ; cat. no.
ACC 680; derived from B-ALL) and WSU-NHL (DSMZ, cat. no. ACC 58;
derived from NHL). Cells were collected (5.times.10.sup.6 cells) in
RPMI.sup.++ (RPMI-1640 [with 25 mM HEPES and L-glutamin; Lonza,
cat. no. BE12-115F], supplemented with 10% bovine serum [Gibco;
cat. no. 10371-029] and 25,000 units penicillin/25,000 .mu.g
streptomycin [Lonza; cat. no. 17-603E]), spun down (1,200 RPM, 5
min.), re-suspended in 1 mL RPMI.sup.++, 100 .mu.Ci .sup.51Cr
(Chromium-51; Perkin Elmer, cat. no. NEZ030002MC) was added and
incubated (37.degree. C. water bath, shaking; 1 hour). After
washing the cells twice in PBS (1,200 RPM, 5 min.), cells were
re-suspended in RPMI++ and counted by trypan blue exclusion. A cell
suspension of 1.times.10.sup.5 cells/mL was prepared.
[0701] Effector Cells:
[0702] Fresh PBMCs were isolated from 40 mL of buffy coat (Sanquin)
using a Ficoll gradient (Lonza; lymphocyte separation medium, cat.
no. 17-829E) according to the manufacturer's instructions. After
re-suspension of cells in RPMI++, cells were counted using Turk
solution to exclude erythrocytes and adjusted to a concentration of
10.times.10.sup.6 cells/mL. Purified T cells were obtained from a
buffy coat, using the RosetteSepm Human T Cell Enrichment Cocktail
(Stemcell Technologies, cat. no. 15061) or from PBMCs using the
Dynabeads.RTM. Untouched.TM. Human T cells isolation kit
(Invitrogen; cat. no. 11344D), according to the manufacturer's
instructions. Cells were washed twice in PBS and counted using Turk
solution and adjusted to a concentration of 1.times.10.sup.6
cells/mL.
[0703] Cytotoxicity Assay:
[0704] 50 .mu.L .sup.51Cr-labeled target cells were added to a
96-wells round-bottom plate. After addition of 50 .mu.L antibody
(final concentrations ranging from 10 .mu.g/mL to 10 .mu.g/mL) in
RPMI.sup.++, cells were incubated at room temperature for 10
min.
[0705] 50 .mu.L effector cells (effector to target ratio as
indicated), Triton-X-100 (1.7% final concentration; to determine
maximum lysis), or RPMI++(to determine background lysis), were
added. Cells were incubated at 37.degree. C., 5% CO.sub.2, for
24-48 hours. After spinning down the cells (1,200 RPM, 3 min.), 75
.mu.L of supernatant was harvested into 1.4-mL tubes (Micronic;
cat. no. MP226RN), and counted in a gamma counter (Perkin Elmer).
The percentage specific lysis was calculated as follows:
% specific lysis=(cpm sample-cpm target cells only)/(cpm maximal
lysis-cpm target cells only).times.100. Cpm=counts per minute.
[0706] FIG. 3 shows that all bispecific antibodies containing a
CD3-specific Fab arm (half-molecule) (derived from
IgG1-huCD3-H1L1-FEAL or IgG1-huCLB-T3/4-FEAL) and a CD20-specific
Fab arm (i.e. half-molecule) (derived from IgG1-CD20-7D8-FEAR,
IgG1-CD20-11B8-FEAR, IgG1-CD20-2F2-FEAR, IgG1-CD20-RTX-FEAR,
IgG1-CD20-2C6-FEAR or IgG1-CD20-GA101-FEAR) are capable of inducing
cytotoxicity in the B cell lines tested, both when using PBMCs
(FIG. 3A, 3M) and purified T cells (FIG. 3B-3L, 3N) as effector
cells. The monospecific bivalent antibodies with inert Fc domains
(IgG1-7D8-FEAR, IgG1-11B8-FEAR, IgG1-huCD3-H1L1-FEAL,
IgG1-huCLB-T3/4-FEAL) were not capable of inducing T cell- or
PBMC-mediated cytotoxicity in the B cell lines. This indicates that
for the CD3xCD20 bispecific antibodies cytotoxicity was dependent
on both CD3 and CD20 binding by the bispecific antibodies. As
previously disclosed, the monospecific bivalent CD20 antibodies
with active Fc (IgG1-7D8 and IgG1-11B8-F405L) were capable of
inducing antibody-dependent cell-mediated cytotoxicity by PBMCs in
Daudi cells (FIG. 3A, 3M). In this case, the dominant effector
cells are natural killer (NK) cells. The CD3xC20 bispecific
antibodies were active at lower concentrations than the
monospecific bivalent CD20 antibodies. FIGS. 3C-3F show that both
the IgG1-huCLB-T3/4- and the IgG1-huCD3-H1L1-derived CD3 arms
induced cytotoxicity with similar efficacy. FIGS. 3G-3M furthermore
show that similar results were obtained using tumor cell lines
obtained from a wide range of B cell lines. These cell lines were
derived from different B cell tumors as indicated in Table 4. This
table also shows CD20 expression levels on these cell lines.
Example 7--Induction of Cytotoxicity In Vitro by
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR Using Purified Human
Peripheral Blood CD4.sup.+ and CD8.sup.+ T Cells as Effector
Cells
[0707] To determine whether bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR
could induce cytotoxic activity of both CD4 and CD8 T cells, a
cytotoxicity assay was performed using the different T cell subsets
as effector cells. Daudi cells were prepared as target cells as
described supra.
[0708] PBMCs were isolated from a buffycoat from a healthy donor
using lymphocyte separation medium, as described supra.
[0709] T cells (total T cell population, CD4.sup.+ or CD8.sup.+ T
cell populations) were isolated from the PBMCs using Dynabeads.RTM.
Untouched.TM. Human T cells, Dynabeads.RTM. Untouched.TM. Human CD4
T cells or Dynabeads.RTM. Untouched.TM. Human CD8 T cells cell
isolation kits (Invitrogen, cat. no. 11344D, 11352D and 11348D,
respectively). After isolation, the purity of each fraction was
determined by flow cytometry. Cells were incubated with CD3
(CD3-PER-CP; Becton Dickinson, cat. no. 345766) and CD8 (CD8-APC;
Becton Dickinson, cat. no. 555369) antibodies, to identify the
different T cell subsets, at 4.degree. C. for 30 min. Samples were
analyzed by flow cytometry, using a FACSCANTOII equipped with an
automated plate loader (Becton Dickinson). A CD3/CD8 quadrant
analysis was performed to quantify the frequency of CD3+events
(total T cell population), the CD3.sup.+CD8.sup.+ double-positive
events (CD8.sup.+ T cell population) and the CD3.sup.+CD8.sup.-
events (CD4.sup.+ T cell population).
[0710] Total T cells were added to Daudi cells in a 10:1 effector
to target ratio, CD4.sup.+ T cells were added in a 8:1 effector to
target ratio and CD8.sup.+ T cells were added in a 4:1 or 8:1
effector to target (E/T) ratio (as indicated) (FIG. 4A), and a
cytotoxicity assay was performed as described supra. To test
whether CD4.sup.+ T cells inhibited the activity of CD8.sup.+ T
cells, when added as effector cells, a cytotoxicity assay was
performed using either only CD8.sup.+ T cells (E/T ratio 4:1) or
CD8.sup.+ T cells (E/T ratio 4:1) together with CD4.sup.+ T cells
(E/T ratio 8:1) as effector cells (FIG. 4B).
[0711] FIG. 4A shows that bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR
induced T-cell-dependent cytotoxicity in Daudi cells, using total T
cells, CD4.sup.+ T cells or CD8.sup.+ T cells as effector cells.
The antibodies bsIgG1-huCD3-H1L1-FEALxb12-FEAR and IgG1-7D8-FEAR,
used as negative controls here, did not induce cytotoxicity of
Daudi cells (data not shown), indicating that cytotoxicity was
dependent on recognition of both CD3 and CD20 by the bispecific
molecule. FIG. 4B shows that the addition of CD4.sup.+ T cells to
CD8.sup.+ T cells, as effector cells, did not reduce the efficacy
of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR.
[0712] Table 6 shows that the purity of the isolated cell fractions
was 90% or higher.
TABLE-US-00007 TABLE 6 The purity of T-cell subsets, as determined
by flow cytometry. All T cells CD4+ T cells CD8+ T cells
(CD3.sup.+) (CD3.sup.+CD8.sup.-) (CD3.sup.+CD8.sup.+) Total T cells
95 55 43 isolated CD4 isolated 92 95 0.6 CD8 isolated 90 9.0 86
Example 8--Kinetics of Cytotoxicidty Induction In Vitro by
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR Using Purified T Cells as
Effector Cells
[0713] To determine the kinetics of
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR-induced cytotoxicity in vitro,
Daudi cells were incubated with
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR in presence of purified T
cells, and cytotoxicity was assessed at different timepoints. The
cytotoxicity assay was performed as described supra, with the
exception that supernatants were harvested not only after 24 hours,
but at different time points ranging from 3-24 hours after
incubation.
[0714] FIG. 5 shows the results of two independent experiments,
performed with purified T cells derived from two different donors.
Using purified T cells from the first donor, dose-dependent
cytotoxicity was observed after 12 hours, and cytotoxicity was even
more efficient after 48-72 hours (FIG. 5A). In presence of purified
T cells from the second donor, bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR
was able to induce cytotoxicity as early as 3 hrs after incubation,
and the efficiency increased upon 16-24 hours incubation (FIG.
5B).
Example 9--Efficacy of Induction of Cytotoxicidty In Vitro by
CD3xCD20 Bispecific Antibodies at Different Effector to Target
Ratios
[0715] To determine the efficiency of cytotoxicity induction by
CD3xCD20 bispecific antibodies containing CD20 Fab-arms originating
from different CD20 antibodies, a cytotoxicity assay was performed
as described supra, using different effector to target ratios. PBMC
were used as effector cells, and Daudi cells were used as target
cells. As shown in FIG. 6, even at an E/T ratio between 10:1 and
25:1, cell kill was observed for the CD3xCD20 bispecific
antibodies.
Example 10--Cytotoxicity of CD3xCD20 Bispecific Antibodies in the
Raji-Luc Co-Engraftment Model in NOD-SCID Mice
[0716] The in vivo anti-tumor efficacy of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR and
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR was evaluated in a
subcutaneous Raji-luc co-engraftment model. In this model, human
unstimulated PBMCs, as a source of human T cells, were
co-inoculated with tumor cells, analogous to the model described by
Brischwein et al. (Mol. Immunol. 43 (2006), 1129-1143). At day 0, a
mixture containing 5.times.10.sup.6 PBMCs and 5.times.10.sup.6
Raji-luc cells in 200 .mu.L PBS/0.1% BSA were inoculated
subcutaneously (s.c.) in the right flank of each mouse (female
NOD-SCID mice; NOD.C.B-17-Prkdcscid/J, Charles-River, 6-11 week
old). Within one hour of injection, mice were sorted into treatment
groups (4-5 mice per treatment group [experiments shown in FIG.
7A-F] or 10 mice per treatment group [experiment shown in FIG.
7G-I]) and each group was injected intravenously (i.v.) with a
single dose of 100-150 .mu.L (bispecific) antibody in PBS.
Treatment groups are shown in Table 7 (for the experiment shown in
FIG. 7A, B, C), Table 8 (for the experiment shown in FIG. 7D, E, F)
and Table 8.1 (for the experiment shown in FIG. 7G, H, I). Tumor
volumes were determined at least two times per week. Tumor volumes
(mm.sup.3) were calculated from caliper (PLEXX) measurements as:
0.52.times.(length).times.(width).sup.2.
[0717] Raji-luc cells were generated by transfecting gWIZ
luciferase (GTS, San Diego, USA). Cells were thawed, cultured in
RPMI (Lonza, BE12-115F) supplemented with 10% donor bovine serum
with iron (Gibco, cat. no. 10371-029), penicillin/streptomycin and
sodium pyruvate and 1 .mu.g/mL puromycin (Sigma, Zwijndrecht, The
Netherlands; cat. no. P-8833). Cells were harvested in log-phase
and counted by trypan blue exclusion.
[0718] For each study, human PBMCs were isolated from a healthy
donor buffy coat as described supra, frozen and thawed before use.
All cells were washed in PBS/0.1% BSA, filtered through a cell
strainer and resuspended to a concentration of 50.times.10.sup.6
cells/mL in PBS/0.1% BSA.
[0719] The results are shown in FIG. 7.
BsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR efficiently reduced Raji-luc
tumor size at dosages of 0.05 and 0.5 mg/kg. At 0.005 mg/kg,
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR did not affect tumor growth
(FIG. 7A). On day 21 after tumor inoculation (the last day all
treatment groups were complete), the average tumor size in mice
that had been treated with 0.5 mg/kg
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR was significantly smaller than
in mice that had been treated with the vehicle control PBS (FIG.
7B) (p<0.01, Kruskal Wallis test followed by Dunn's multiple
comparison post-test). Kaplan-Meier analysis demonstrated that the
tumor-free survival after treatment with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (0.5 and 0.05 mg/kg) was
significantly better than after treatment with PBS (p<0.01 and
p<0.05 for the 0.5 and 0.05 mg/kg treatment groups,
respectively, Mantel Cox analysis) (FIG. 7C).
[0720] Similarly, treatment with
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR significantly inhibited tumor
growth at doses of 0.05 and 0.5 mg/kg (FIG. 7D). On day 25 after
tumor inoculation (the last day all treatment groups were
complete), the average tumor size in mice that had been treated
with 0.05 and 0.5 mg/kg bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR was
significantly smaller than in mice that had been treated with the
vehicle control (PBS) (p<0.05, Kruskal Wallis test followed by
Dunn's multiple comparison post-test) (FIG. 7E). Kaplan-Meier
analysis demonstrated that the tumor-free survival after treatment
with bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR (0.5 and 0.05 mg/kg) was
significantly better than after treatment with the vehicle control
(PBS) (p<0.01, Mantel Cox analysis) (FIG. 7F).
[0721] FIG. 7G shows that both bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR
(all doses tested) and bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR (0.05
mg/kg) induced a delay in tumor growth. On day 20 after tumor
inoculation (the last day all treatment groups were complete), the
average tumor size in mice that had been treated with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR (0.005, 0.05 and 0.5 mg/kg)
and in mice that had been treated with 0.05 mg/kg
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR was significantly smaller
than in mice that had been treated with vehicle control (PBS)
(p<0.05 for all groups, except for the
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR 0.005 .mu.g/kg group where
p<0.01; one-way ANOVA, followed by Tukey's multiple comparison
post-test) (FIG. 7H). Kaplan-Meier analysis demonstrated that the
tumor-free survival in all treatment groups, except for the
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR at 0.005 mg/kg, was
significantly better than in mice treated with vehicle control
(PBS) (p<0.05, Mantel Cox analysis) (FIG. 7I).
TABLE-US-00008 TABLE 7 Group Antibody Dose 1 PBS 2
bsIgG1-huCD3-H1L1-FEALxCD20- 0.1 .mu.g (~0.005 mg/kg) 7D8-FEAR 3
bsIgG1-huCD3-H1L1-FEALxCD20- 1 .mu.g (~0.05 mg/kg) 7D8-FEAR 4
bsIgG1-huCD3-H1L1-FEALxCD20- 10 .mu.g (~0.5 mg/kg) 7D8-FEAR
TABLE-US-00009 TABLE 8 Group Antibody Dose 1 PBS 2
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR 1 .mu.g (~0.05 mg/kg) 3
bsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR 10 .mu.g (~0.5 mg/kg) 4
bsIgG1-huCLB-T3/4-FEALxb12-FEAR 1 .mu.g (~0.05 mg/kg) 5
bsIgG1-huCLB-T3/4-FEALxb12-FEAR 10 .mu.g (~0.5 mg/kg)
TABLE-US-00010 TABLE 8.1 Group Antibody Dose 1 PBS 2
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR 1 .mu.g (~0.05 mg/kg) 3
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR 10 .mu.g (~0.5 mg/kg) 4
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR 1 .mu.g (~0.05 mg/kg) 5
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR 10 .mu.g (~0.5 mg/kg) 6
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR 1 .mu.g (~0.05 mg/kg) 7
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR 10 .mu.g (~0.5 mg/kg)
Example 11--Anti-Tumor Activity of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR in a Humanized Immune System
Mouse Xenograft Model
[0722] The in vivo anti-tumor efficacy of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR was evaluated in humanized
immune system (HIS) mice that were inoculated with human Daudi-luc
tumor cells (BRGS-HIS-Daudi-luc) (experiments performed at Axenis,
Paris, France). In this model, human hematopoietic CD34.sup.+
progenitor cells (.about.1.times.10.sup.5 cells) were obtained from
cord blood, and injected intrahepatically into neonatal BALB/c
Rag2tm1Fwa IL-2R.gamma.c tm1Cgn SIRP.alpha.NOD (BRGS) mice as
described by Legrand et al. (PNAS. 108 (2011), 13224-13229). After
14 weeks, humanization of the BRGS mice was confirmed by flow
cytometry. Subsequently, mice were divided in three groups (7 mice
per group), based on the percentage of human CD3.sup.+ T cells in
the human CD45.sup.+ population (29.5.+-.7.5, 28.4.+-.9.4 and
28.3.+-.11.6 for the PBS-, bsIgG1-huCD3-H1L1-FEALxb12-FEAR- and
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR-treated groups, respectively).
At week 15, 5.times.10.sup.6 Daudi-luc cells in 100 .mu.L PBS, were
injected intravenously (i.v.) in the BRGS-HIS mice and this was
indicated as day 0 in the study. At day 3 and 7, the BRGS-HIS mice
with Daudi-luc cells were injected i.v. with 1 mg/kg (bispecific)
antibody. Treatment groups are shown in Table 9. Tumor growth was
evaluated weekly (starting at day 2) by bioluminescence imaging
(BLI). Mice were injected intraperitoneally (i.p) with 100 .mu.L
firefly D-luciferin (30 mg/mL; Caliper LifeSciences) and
bioluminescence was measured using a Biospace Bioluminescence
Imaging System (PerkinElmer). In addition, a blood sample was taken
of each individual mouse at day 9, and flow cytometry was performed
to determine the percentage of the different leukocyte populations
(total human leukocytes: hCD45.sup.+mCD45.sup.- population; B
cells: hCD3.sup.+hCD19.sup.+ population; T cells:
hCD3.sup.+hCD19.sup.- population and activated T cells:
hCD3.sup.+hCD19.sup.-FSC.sup.hi population. The following
antibodies were used for staining: anti-hCD45 clone HI30, labeled
with Alexa Fluor.RTM. 700 (BioLegend, cat. no. 304023; final
dilution 1:50; anti-mCD45 clone 30-F11, labeled with
allophycocyanin (APC)-eFluor.RTM. 780 (eBioscience, cat. no.
47-0451-80; final dilution 1:200); anti-hCD3 clone UCHT1, labeled
with eFluor.RTM. 450 (eBioscience, cat. no. 48-0038-80; final
dilution 1:50), anti-hCD19 clone HIB19 labeled with phycoerythrin
(PE) (Becton Dickinson, cat. no. 561741; final dilution 1:25).
[0723] The results are shown in FIG. 8. As can be seen from FIG.
8A, bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR efficiently reduced tumor
burden at a dose of 1 mg/kg. The control bispecific antibody
bsIgG1-huCD3-H1L1-FEALxb12-FEAR did not inhibit tumor growth.
Statistical comparison of tumor burden at day 21 (Kruskal Wallis
test followed by Dunn's multiple comparison post-test) demonstrated
that the tumor burden in the bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR
treatment group was significantly lower than in the vehicle
(PBS)-treated animals (p<0.01). The difference between the
bsIgG1-huCD3-H1L1-FEALxb12-FEAR and vehicle treatment groups was
not significant (FIG. 8B).
[0724] In FIG. 8C, the percentages of different human leukocyte
populations, as determined by flow cytometry, are indicated. The
percentage of circulating human leukocytes (hCD45.sup.+ cells) was
comparable in all groups. However, the percentage of human B cells
in mice treated with bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR was
strongly reduced (p=0.0012, compared to the vehicle control group,
according to the Mann Whitney test). Treatment with the control
bispecific antibody bsIgG1-huCD3-H1L1-FEALxb12-FEAR did not affect
the percentage of human B cells. The percentage of activated T
cells (hCD3.sup.+FSC.sup.hi population) was enhanced in mice
treated with bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR, (p=0.0093
compared to the vehicle control group, according to the Mann
Whitney test). Treatment with the control bispecific antibody
bsIgG1-huCD3-H1L1-FEALxb12-FEAR did not significantly change the
number of activated T cells. This indicates that T cell activation
after treatment with the CD3xCD20 bispecific antibody was dependent
on both CD3 and CD20 binding and not on CD3 binding alone.
TABLE-US-00011 TABLE 9 Group Antibody Dose 1 PBS 2
bsIgG1-huCD3-H1L1-FEALxb12-FEAR 1 mg/kg (~20 .mu.g) 3
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR 1 mg/kg (~20 .mu.g)
Example 12--Pilot Study to Determine the Pharmacology and
Pharmacokinetics of CD3xCD20 Bispecific Antibodies in Cynomolgus
Monkeys
[0725] The safety profile, pharmacokinetics and induction of B cell
depletion in cynomolgus monkeys by one of the CD3xCD20 bispecific
antibodies according to the invention,
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR, was tested according to the
study described below.
[0726] The objective of this study was to determine the
pharmacokinetic characteristics, toxicological and pharmacological
effects of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR in female
cynomolgus monkeys (Macaca fascicularis, originating from
Mauritius, approximately 2-3 years old; weight range of 2.5-3 kg)
following a single intravenous infusion via the tail vein. The
study was performed at Charles River Laboratories, Tranent, UK. The
parental IgG1 antibodies, IgG1-huCD3-H1L1 and IgG1-7D8, that were
engineered to make the bispecific molecule, have been shown to be
cross-reactive with cynomolgus monkey CD3 and CD20, respectively.
Eight female cynomolgus monkeys were assigned to four dose groups
that received bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR at a dose of
0.01, 0.1, 1 or 10 mg/kg at a constant dose volume of 10 mL/kg. One
animal of each dose group was sacrificed 28 days after the
administered dose, whereas the second animal of each dose group was
sacrificed when B-cell counts in that animal had recovered to a
level that was comparable to the pre-dose values, as assessed by
flow cytometry (recovery animals). The practices and procedures
adopted during this study were consistent with the OECD Principles
of Good Laboratory Practice as set forth by the United Kingdom
Department of Health.
[0727] B and T cell populations in the peripheral blood were
analyzed by flow cytometry, at different timepoints after dosing. B
cells were identified using the cell surface markers CD19 and CD21
(CD19.sup.+CD21.sup.+ cells); total T cells were assessed as the
sum of CD4.sup.+ and CD8.sup.+ cells. As shown in FIG. 9A,
administration of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR at dose
levels of 1 and 10 mg/kg resulted in depletion of circulating B
cells to undetectable levels by the first time point measured (1
day post-dose). Dose levels of 0.01 and 0.1 mg/kg showed only
partial depletion or no depletion. The B-cell depletion was
maintained until four to six weeks (28-42 days) after dosing in the
1 mg/kg dose group, followed by a recovery of B-cell levels
reaching pre-dose levels at 9 weeks (63 days) post dosing. In the
10 mg/kg dose group recovery of B-cell levels only started at week
9-10 (70 days) after dosing. A transient decrease in circulating T
cell numbers was observed at 1 day post-dose in all dose groups
(FIG. 9B). T-cell levels had returned to pre-dose levels at the
next measurement on day 3 and remained constant until the end of
the experiment.
[0728] Biopsies (approximately 20 mg) were taken from superficial
lymph nodes (left and right inguinal and axillary) from all
animals, at different timepoints after dosing. Biopsies were
homogenized and the frequency of B and T cells, as a percentage of
the total lymphocyte population (identified based on forward
scatter-side scatter (FSC-SSC), was assessed by flow cytometry. B
cells were identified using the cell surface markers CD19 and CD21
(CD19.sup.+CD21.sup.+ cells); total T cells were assessed as the
sum of CD4.sup.+ and CD8.sup.+ cells. As shown in FIG. 9C,
administration of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR resulted in
depletion of B cells to undetectable levels at the first time point
measured (7 days post-dose) at dose levels of 1 and 10 mg/kg.
B-cell depletion was maintained until 7 weeks after dosing in these
dose groups followed by a recovery of B-cell levels, that was not
yet complete at 13-14 weeks (84-95 days) post dosing. Dose levels
of 0.01 and 0.1 mg/kg induced maximal B-cell depletion at 16 days
post-dosing with complete recovery observed at 28 days after dosing
(0.01 mg/kg) or partial recovery at 14 weeks (95 days) post-dose
(0.1 mg/kg). No major changes in T cell frequencies were observed
in the lymph nodes at any dose level (FIG. 9D).
[0729] Plasma samples were analyzed for cytokine levels (IL-2,
IL-6, IL-8, IL-10, IFN-.gamma. and TNF-.alpha.) using standard
analytical methods. Administration of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR induced a transient increase
in plasma cytokine levels, which appeared to be dose-dependent
(FIG. 9E). All cytokine levels had returned to pre-dose levels at
24 hours post dosing.
[0730] The pharmacokinetic profile of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR was evaluated by analyzing
plasma samples obtained pre-dose and at various time-points after
dosing up to 70 days. The total concentration of bispecific
antibody was determined by an immune PCR. Pharmacokinetic
parameters were calculated by Non-Compartmental Analysis (Phoenix
WinNonLin). Results are shown in Table 10. Dose-normalized
AUC.sub.0-.infin. values (AUC.sub.0-.infin./Dose) indicate a
non-linear increase in plasma exposure. The greater than
proportional increase in these AUC.sub.0-.infin. values indicate
target-mediated clearance of bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR.
In addition, the pharmacokinetic profile of
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR shows a faster initial
distribution and clearance as compared to typical IgG1-type
monoclonal antibodies dosed in cynomolgus monkeys (FIG. 9F).
[0731] In addition, anti-drug antibody (ADA) responses to
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR in cynomolgus serum were
measured (data not shown). ADA responses were observed in all
animals except for the 10 mg/kg animals from day 15 onwards.
TABLE-US-00012 TABLE 10 Pharmacokinetic characteristics of
bsIgG1-huCD3-H1L1-FEALxCD20-7138-FEAR in cynomolgus monkeys
Treatment dose (#indicates individual animal identifier) 0.01 mg/kg
0.1 mg/kg 1 mg/kg 10 mg/kg Parameter Units #151 #157 #152 #158 #153
#159 #154 #160 C.sub.max ng/mL 7.26 10.73 478.5 364.6 36249 29154
364508 286869 C.sub.max/Dose kg*ng/mL/mg 725.8 1074 4785 3646 36249
29154 36451 28687 t.sub.max day 0.042 0.042 0.042 0.042 0.042 0.042
0.042 0.042 AUC.sub.0-.infin. ng*day/mL 0.991 1.385 82.43 43.31
22559 14837 756967 471203 AUC.sub.0-.infin./Dose kg*ng*day/mL/mg
99.06 138.52 824.4 433.1 22559 14837 75697 47120 Vd mL 30787 15797
4232 5078 114.5 136.3 42.2 100.9 Data for each monkey per dose
group are shown separately (monkey number indicated above the
column).
Example 13--Identification of CD20 Amino Acids Involved in Binding
of CD3xCD20 Bispecific Antibodies
[0732] Previous studies have indicated that the alanine residue at
position 170 (A170) and particularly the proline residue at
position 172 (P172) in the extracellular loop of CD20 are critical
for recognition CD20 by rituximab (Polyak et al. 2002, Blood 99:
3256-3262; Perosa et al. 2005, Blood 107: 1070-1077). Rituximab
completely lost binding to CD20 expressed in HEK293F upon
introduction of the A170S and P172S mutations ("AxP mutation") in
the CD20 extracellular domain. The mouse mAb B1 also showed
strongly reduced binding to the AxP mutant, although residual
binding was observed. In contrast, binding of IgG1-2F2, IgG1-7D8
and IgG1-2C6 to CD20 was unaffected by the AxP mutation. However,
changing the asparagine residues at position 163 or 166 into
aspartic acid (N163D or N166D, respectively) completely abrogated
the binding of IgG1-2C6 and reduced that of IgG1-2F2 and IgG1-7D8
by up to 75%. A triple mutant with a threonine-to-lysine mutation
at position 159 (T159K), in addition to the N163D and N166D
mutations (T159K/N163D/N166D, "KDD mutation") abrogated the binding
of 2F2, 7D8 and 2C6. The KDD mutation only had a modest effect on
the binding of rituximab and B1 (Teeling et al. 2006, The Journal
of Immunology 177: 362-371).
To examine the binding of CD3xCD20 bispecific antibodies to wild
type (wt) CD20, the AxP mutant and the KDD mutant, a CD20
expression vector was constructed by amplifying the CD20 coding
sequence using suitable primers introducing restriction sites and
an ideal Kozak sequence for optimal expression. The amplified
fragment was digested and ligated in the expression vector pEE12.4
(Lonza, Slough, UK). After transformation in E. coli, colonies were
screened for inserts and two clones were selected for sequencing to
confirm the correct sequence. The construct was named
pEE12.4CD20HS-GA. Mutagenesis was performed to introduce the AxP or
KDD mutations in the extracellular loop regions of human CD20.
Mutagenesis was checked by restriction enzyme digestion and
sequencing. The constructs were transiently expressed in HEK293F
cells and analyzed 24 hours post-transfection using flow cytometry.
Oligonucleotide PCR Primers: Oligonucleotide primers were
synthesized and quantified by Isogen BV (Maarssen, The
Netherlands). Primers were reconstituted in water in a
concentration of 100 pmol/.mu.L and stored at -20.degree. C. until
use. A summary of PCR and sequencing primers is shown in Table 11.
Optical density determination of nucleic acids: Optical density was
determined using an Ultrospec 2100 pro Classic (Amersham
Biosciences, Uppsala, Sweden), according to the manufacturer's
instructions. The DNA concentration was measured by analysis of the
OD260 nm, where one OD260 nm unit=50 .mu.g/mL. The reference
solution was identical to the solution used to dissolve the nucleic
acids. Plasmid DNA isolation from E. coli culture: Plasmid DNA was
isolated from E. coli cultures using kits from Qiagen (Westburg BV,
Leusden, The Netherlands), according to the manufacturer's
instructions. For `bulk` plasmid preparation either a Hi-Speed
plasmid Maxi kit or a Hi-Speed plasmid Midi kit were used (Qiagen).
For a small scale plasmid preparation (i.e., 2 mL of E. coli
culture) a Qiaprep Spin Miniprep Kit (Qiagen) was used and the DNA
eluted in 50 .mu.L TE (Tris-HCl 10 mM pH 8.0, EDTA 1 mM). PCR
amplification: PCR reactions were performed according to the
manufacturer's instructions for the Pfu-Turbo.COPYRGT. Hotstart DNA
polymerase (Stratagene, Amsterdam, The Netherlands). Each 20
mL-reaction contained 1.times.PCR reaction buffer, 200 mM mixed
dNTPs, 6.7 pmol of each forward and reverse primer, approximately 1
ng template DNA and 1 unit of Pfu-Turbo.COPYRGT. Hotstart DNA
polymerase. PCR reactions were performed on a T-gradient
Thermocycler 96 (Biometra GmbH, Goettingen, Germany) using a 30
cycle program of: +95.degree. C. for 2 min, followed by 30 cycles
of: +95.degree. C. for 30 sec; anneal: a gradient of 45-65.degree.
C. for 30 sec and extension: +72.degree. C. for 2 min, followed by
a final extension step at 72.degree. C. for 10 min and subsequent
storage at 4.degree. C. The completed reactions were analyzed by
agarose gel electrophoresis. Agarose gel electrophoresis: Agarose
gel electrophoresis was performed according to Sambrook (Molecular
Cloning Laboratory Manual, 3rd edition) using gels of 50 mL, in
1.times.Tris/acetic acid/EDTA (TAE) buffer. DNA was visualized by
the inclusion of ethidium bromide in the gel and observation under
UV light. Gel images were recorded by a CCD camera and an image
analysis system (GeneGnome; Syngene, Cambridge, UK). Restriction
enzyme digestions: Restriction enzymes were supplied by New England
Biolabs (Beverly, Mass.) and used according to the supplier's
recommendations. In general, 100 ng was digested with 5 units of
enzyme(s) in appropriate buffer in a final volume of 10 mL.
Reaction volumes were scaled up as appropriate. Digestions were
incubated at the manufacturer's recommended temperature for a
minimum of 60 min. For fragments requiring double digestions with
restriction enzymes which have incompatible buffer or temperature
requirements, digestions were performed sequentially so as to offer
favorable conditions for each enzyme in turn. Alkaline phosphatase
treatment: Shrimp alkaline phosphatase (USB, Cleveland, Ohio) was
used according to the supplier's recommendations. Alkaline
phosphatase removes 5'-phosphate groups from the ends of DNA
fragments thereby preventing self-ligation. This is of particular
relevance when self-re-ligation of a DNA fragment could result in a
replication-competent vector. The enzyme is active in most
restriction enzyme buffers and was added as appropriate. After the
digestion, the enzyme was inactivated by raising the temperature to
70.degree. C. for 15 min. Purification of PCR and restriction
enzyme reaction products: Purification was carried out using the
mini-elute PCR Purification kit (supplied by Qiagen), according to
the manufacturer's instructions. Briefly, DNA samples were diluted
in 5 volumes of binding buffer I (Qiagen) and loaded onto a
mini-elute column within an Eppendorf centrifuge tube. The assembly
was centrifuged in a bench-top micro-centrifuge. The column was
washed twice with buffer II (Qiagen): Following buffer application,
the assembly was centrifuged and the flow-through was discarded.
The column was dried by centrifugation in the absence of added
buffer. DNA was eluted by adding elution buffer to the column and
the eluate collected by centrifugation. Isolated DNA was quantified
by UV spectroscopy and quality assessed by agarose gel
electrophoresis. Isolation of DNA fragments from agarose gel: Where
appropriate (i.e., when multiple fragments were present), digested
DNA samples were separated by gel electrophoresis and the desired
fragment excised from the gel and recovered using the QIAEX II gel
extraction kit (Qiagen), according to the manufacturer's
instructions. Briefly, DNA bands were excised from the agarose gel
and melted in an appropriate buffer at +55.degree. C. QIAEX II
resin was added and incubated for 5 min. QIAEX II resin was
pelleted by a short centrifugation step (1 min, 14000 g, room
temperature) and washed twice with 500 .mu.L of wash buffer PE
(cat. no. 19065, Qiagen). The final pellet was dried in a hood and
DNA was eluted with the appropriate volume of TE and at the
appropriate temperature (depending on the size of the DNA).
Ligation of DNA fragments: Ligations were performed with the Quick
Ligation Kit (New England Biolabs) according to the manufacturer's
instructions. For each ligation, the vector DNA was mixed with
approximately three-fold molar excess of insert DNA such that the
total amount of DNA was lower than 200 ng in 10 .mu.L, with volume
adjusted with water as appropriate. To this was added 10 .mu.L
2.times.Quick Ligation Buffer and 1 .mu.L Quick T4 DNA ligase and
the ligation mix was incubated at room temperature for 5-30 min.
Transformation of DNA into bacteria: Samples of DNA were used to
transform One Shot DH5.alpha.-T1R competent E. coli cells
(Invitrogen, Breda, The Netherlands) using the heat-shock method
according to the manufacturer's instructions. Briefly, 1-5 .mu.L of
DNA solution (typically 2 .mu.L of DNA ligation mix) was added to
an aliquot of transformation competent bacterial cells and the
mixture incubated on ice for 30 min. The cells were then
heat-shocked by transferring to a water bath at 42.degree. C. for
30 sec followed by a further incubation on ice for 5 min. Cells
were left to recover by incubation in a non-selective culture
medium (SOC) with agitation at 37.degree. C. for 1 hour and were
subsequently spread onto agar plates containing appropriate
selective agent (ampicillin at 50 .mu.g/ml). Plates were incubated
at +37.degree. C. for 16-18 hours or until colonies of bacteria
became evident. Screening of bacterial colonies by PCR: Bacterial
colonies were screened for the presence of vectors containing the
desired sequences using the PCR colony screening technique. 20
.mu.L of PCR reaction mix containing 0.5 volumes of HotStarTaq
Master Mix (Qiagen), 4 pmol of the forward and reverse primers and
completed with water was added to a PCR tube. A colony was lightly
touched with a 20 .mu.L pipette tip, once touched in 2 mL LB in a
culture tube (for growing bacteria containing the corresponding
plasmid) and resuspended in the 20 .mu.L PCR mix. PCR was performed
on a Tgradient Thermocycler 96 (Biometra) using a 35 cycle program
of: +95.degree. C. for 15 min, followed by 35 cycles of:
+94.degree. C. for 30 sec, anneal: 55.degree. C. for 30 sec and
extension: +72.degree. C. for 2 min, followed by a final extension
step at 72.degree. C. for 10 min and subsequent storage at
4.degree. C. The completed reactions were analyzed by agarose gel
electrophoresis. See Table 11 for details of primer pairs used for
colony PCR. DNA sequencing: Plasmid DNA samples were send to AGOWA
(Berlin, Germany) for sequence analysis. Sequences were analyzed
using the VectorNTI software package (Informax, Frederick, Md.,
USA).
TABLE-US-00013 TABLE 11 Name Length Oligo Sequence CD20hs- 42
GGGAGTTCTTCTCGCTGCTGTTGCTGGGCTCGCAG GA- TTGTAGA A170S- P172S R
CD2Ohs- 42 TCTACAACTGCGAGCCCAGCAACAGCAGCGAGAAG GA- AACTCCC A170S-
P172S F CD20hs- 43 CTCGCAGTCGTAGATGTCGATGTAGGGCTTGTGGG GA- CCCGGATG
T159K- N163D- N166D R CD20hs- 43
CATCCGGGCCCACAAGCCCTACATCGACATCTACG GA- ACTGCGAG T159K- N163D-
N166D F
Mutagenesis: The mutagenesis was performed, using the
QuikChange.RTM. XL Site-Directed Mutagenesis kit (Cat 200517-5, Lot
1120630, Stratagene Europe) according to the manufacturer's
instructions. Mutagenesis reactions were concentrated using ethanol
precipitation and transformed into either oneshot DH5.alpha.-TIR
competent E. coli cells or electroporated into ElectroTen-Blue.RTM.
Electroporation-Competent Cells. Colonies were checked by colony
PCR and restriction digestion prior to transfection. HEK293F cell
transfection: HEK293F cells were obtained from Invitrogen and
transfected according to the manufacturer's instructions, using
293fectin. Anti-CD20 Antibody binding: HEK293F cells were taken up
in staining buffer (PBS supplemented with 0.1% BSA and 0.02%
NaN.sub.3) and added to round bottom plates
(1-3.times.10.sup.5/well in 100 .mu.L). Then, 50 .mu.L CD3xCD20
bispecific antibody was added, in serial dilutions (0.0015-10
.mu.g/mL, three-fold dilutions) (4.degree. C., 30 min). After
washing twice in staining buffer, cells were incubated in 50 .mu.L
secondary antibody at 4.degree. C. for 30 min. As a secondary
antibody, R-Phycoerythrin (PE)-conjugated goat-anti-human IgG
F(ab').sub.2 was used, as described supra. Next, cells were washed
once in staining buffer, re-suspended in 150 .mu.L staining buffer
and analyzed on a flow cytometer (FACSCanto-720, Becton Dickinson,
San Diego, Calif., USA) and 10,000 events per sample were acquired
at high flow rate. Binding curves were analyzed using non-linear
regression (sigmoidal dose-response with variable slope) using
GraphPad Prism V75.04 software (GraphPad Software, San Diego,
Calif., USA). All CD3xCD20 bispecific antibodies bound efficiently
to HEK293F cells expressing WT CD20 (FIG. 10A). As shown in FIG.
10B and Table 12, bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR and
bsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR bound efficiently to the AxP
mutant. Similarly, bsIgG1-huCLB-3/4-FEALxCD20-7D8-FEAR,
bsIgG1-huCLB-3/4-FEALxCD20-2F2-FEAR and
bsIgG1-huCLB-3/4-FEALxCD20-11B8-FEAR showed efficient binding to
CD20-AxP. As expected, bsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR
completely lost binding to the AxP mutant, as was shown previously
for the parental antibody IgG1-RTX.
BsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR showed greatly reduced
binding to CD20-AxP. BsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR,
bsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR and
bsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR, as well as
bsIgG1-huCLB-3/4-FEALxCD20-7D8-FEAR and
bsIgG1-huCLB-3/4-FEALxCD20-2F2-FEAR lost binding to CD20 upon
introduction of the KDD mutations (Table 12), confirming that these
bispecific antibodies that monovalently bind CD20, showed
comparable binding characteristics as the parental antibodies
IgG1-7D8, IgG1-2F2 and IgG1-2C6, respectively.
BsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR and
bsIgG1-huCLB-3/4-FEALxCD20-11B8-FEAR partially lost binding to CD20
when the KDD mutation was present.
TABLE-US-00014 TABLE 12 Binding of CD3xCD20 bispecific antibodiesto
CD20 mutants. Binding of CD3xCD20 bispecific antibodies to CD20
mutants expressed in HEK293F cells was determined by flow
cytometry. Numbers indicate the percentage of binding to the CD20
mutants, relative to binding to wild type CD20, at 10 .mu.g/mL. The
percentage of binding was calculated by the following formula: (MFI
binding to CD20 mutant)/(MFI binding CD20 wt) .times. 100% Binding
to CD20 mutants (% of wt CD20 binding) CD3xCD20 bispecific antibody
KDD AxP BsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR 4 103
BsIgG1-huCD3-H1L1-FEALxCD20-2F2-FEAR 4 98
BsIgG1-huCD3-H1L1-FEALxCD20-11B8-FEAR 67 95
BsIgG1-huCD3-H1L1-FEALxCD20-2C6-FEAR 3 92
BsIgG1-huCD3-H1L1-FEALxCD20-RTX-FEAR 87 11
BsIgG1-huCD3-H1L1-FEALxCD20-GA101-FEAR 108 57
BsIgG1-huCLB-T3/4-FEALxCD20-7D8-FEAR 3 113
BsIgG1-huCLB-T3/4-FEALxCD20-2F2-FEAR 5 112
BsIgG1-huCLB-T3/4-FEALxCD20-11138-FEAR 54 118
Example 14--Determination of the CD3 Binding Affinity Using
Bio-Layer Interferometry
[0733] To determine the affinity of the CD3xCD20 bispecific
antibodies for CD3, Bio-Layer Interferometry was performed on a
ForteBio Octet HTX. Anti-human Fc Capture (AHC) biosensors
(ForteBio, Portsmouth, UK; cat no. 18-5060) were loaded for 600 s
with the CD3xCD20 bispecific antibodies (1 .mu.g/mL), aiming at a
loading response of 1 nm. After a baseline (200 s), the association
(1000 s) and dissociation (2000 s) of soluble CD3.epsilon.27-GSKa
was determined using concentrations ranging between 1 nM and 1000
nM. The CD3.epsilon.27-GSKa protein consists of the human
CD3.epsilon. peptide (aa1-27) fused to the N-terminus of a kappa LC
(SEQ ID NO: 402). For calculations, the theoretical molecular mass
of CD3.epsilon.27-GSKa based on the amino acid sequence was used,
i.e. 27.1 kDa. Experiments were carried out under shaking
conditions (1000 rpm) at 30.degree. C.
Data was analyzed with ForteBio Data Analysis Software v8.1, using
the 1:1 model and a global full fit with 1000 s association time
and 200 s dissociation time. Data traces were corrected by
subtraction of a reference curve (CD3xCD20 bispecific antibodies
without CD3.epsilon.27-GSKa), the Y-axis was aligned to the last 10
s of the baseline, and interstep correction as well as
Savitzky-Golay filtering was applied. Data traces with a response
lower than 0.05 nm were excluded from analysis. The equilibrium
dissociation constants (K.sub.D) of the CD3xCD20 bispecific
antibodies were all within 2-fold of the K.sub.D of the parental
IgG1-huCD3-H1L1-FEAL molecule.
TABLE-US-00015 TABLE 13 Equilibrium dissociation constants
(K.sub.D), association rates (k.sub.on) and dissociation rates
(k.sub.dis) for selected CD3xCD20 bispecific antibodies Antibody ID
K.sub.D (M) k.sub.on(1/Ms) k.sub.dis(1/s) IgG1-huCD3-H1L1-FEAL
1.4E-08 3.2E+05 4.5E-03 BsIgG1-huCD3-H1L1-FEALxCD20- 1.5E-08
2.7E+05 4.1E-03 2F2-FEAR BsIgG1-huCD3-H1L1-FEALxCD20- 1.5E-08
2.7E+05 4.0E-03 GA101-FEAR BsIgG1-huCD3-H1L1-FEALxCD20- 1.2E-08
4.1E+05 4.8E-03 11B8-FEAR BsIgG1-huCD3-H1L1-FEALxCD20- 0.81E-08
3.3E+05 2.7E-03 2C6-FEAR BsIgG1-huCD3-H1L1-FEALxCD20- 1.1E-08
3.9E+05 4.3E-03 RTX-FEAR BsIgG1-huCD3-H1L1-FEALxCD20- 1.1E-08
3.8E+05 4.3E-03 7D8-FEAR BsIgG1-huCD3-H1L1-FEALxCD20- 2.1E-08
1.7E+05 3.7E-03 b12-FEAR
Example 15--BsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR Induces T Cell
Activation in the Presence of B Cells
[0734] The capacity of CD3xCD20 bispecific antibodies to induce
activation of T cells, in the presence of B cells, was tested by
incubating PBMC with bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR. T cell
activation was assessed by measuring CD69 expression. PBMC,
isolated from healthy donors as described supra, were added to
96-well round bottom culture plates (Greiner bio-one, cat 650180;
100,000 cells/well) and incubated with
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR diluted in RPMI++(final
antibody concentration 0.1-1000 ng/mL). The final volume in each
well was 100 .mu.L. IgG1-huCD3-H1L1-FEAL and IgG1-huCLB-T3/4-FEAL,
both of which are bivalent CD3-specific IgG1 antibodies with
inactive Fc domains, as well as the isotype control antibody
IgG1-b12-FEAL were included as negative control antibodies.
IgE-huCLB-T3/4, a bivalent CD3-specific IgE antibody that is known
to induce activation of T cells, and IgG1-huCLB-T3/4-F405L, a
bivalent CD3 specific IgG1 antibody with an active Fc domain, were
included as positive control antibodies. PBMC were incubated with
antibodies (37.degree. C., 5% CO.sub.2) for 16-24 hours. To assess
T cell activation, PBMC were washed twice in staining buffer and
resuspended in staining buffer (final volume 50 .mu.L) containing
APC-labeled mouse anti-human CD69 antibody (BD Pharmingen, cat
340560; final dilution 1:100) and PE-labeled mouse anti-human CD28
antibody (Milteny Biotech, cat 130-092-921; final dilution 1:40).
After 30 minutes at 4.degree. C., cells were washed twice. Cells
were resuspended in 150 .mu.L staining buffer and analyzed using a
FACS Canto II (BD). The median fluorescence intensity of APC (CD69)
was assessed within the population of CD28-positive cells. CD28 was
used as a marker to identify T cells. As shown in FIG. 11,
bsIgG1-huCD3-H1L1-FEALxCD20-7D8-FEAR induced dose-dependent
activation of T cells, as indicated by an increase in CD69
expression in peripheral blood T cells. T cell activation was also
observed after incubation with the positive control antibodies
IgE-huCLB-T3/4 and IgG1-hu-CLB3/4-F405L. In contrast, the negative
control antibodies IgG1-huCD3-H1L1-FEAL, IgG1-huCLB-T3/4-FEAL and
IgG1-b12-FEAL did not induce CD69 expression.
Sequence CWU 1
1
8718PRTMus Musculus 1Gly Phe Thr Phe Asn Thr Tyr Ala1 5210PRTMus
Musculus 2Ile Arg Ser Lys Tyr Asn Asn Tyr Ala Thr1 5 10316PRTMus
Musculus 3Val Arg His Gly Asn Phe Gly Asn Ser Tyr Val Ser Trp Phe
Ala Tyr1 5 10 1549PRTMus Musculus 4Thr Gly Ala Val Thr Thr Ser Asn
Tyr1 559PRTMus Musculus 5Ala Leu Trp Tyr Ser Asn Leu Trp Val1
56125PRTMus Musculus 6Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Asn Thr Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Arg Ser Lys Tyr Asn
Asn Tyr Ala Thr Tyr Tyr Ala Asp 50 55 60Ser Val Lys Asp Arg Phe Thr
Ile Ser Arg Asp Asp Ser Lys Ser Ser65 70 75 80Leu Tyr Leu Gln Met
Asn Asn Leu Lys Thr Glu Asp Thr Ala Met Tyr 85 90 95Tyr Cys Val Arg
His Gly Asn Phe Gly Asn Ser Tyr Val Ser Trp Phe 100 105 110Ala Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 1257125PRTMus
Musculus 7Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro
Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Asn Thr Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val 35 40 45Ala Arg Ile Arg Ser Lys Tyr Asn Asn Tyr Ala
Thr Tyr Tyr Ala Asp 50 55 60Ser Val Lys Asp Arg Phe Thr Ile Ser Arg
Asp Asp Ser Lys Ser Ile65 70 75 80Leu Tyr Leu Gln Met Asn Asn Leu
Lys Thr Glu Asp Thr Ala Met Tyr 85 90 95Tyr Cys Val Arg His Gly Asn
Phe Gly Asn Ser Tyr Val Ser Trp Phe 100 105 110Ala Tyr Trp Gly Gln
Gly Thr Leu Val Thr Val Ser Ser 115 120 1258125PRTMus Musculus 8Glu
Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Arg1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asn Thr Tyr
20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45Ala Arg Ile Arg Ser Lys Tyr Asn Asn Tyr Ala Thr Tyr Tyr
Ala Asp 50 55 60Ser Val Lys Asp Arg Phe Thr Ile Ser Arg Asp Asp Ser
Lys Ser Ile65 70 75 80Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu
Asp Thr Ala Met Tyr 85 90 95Tyr Cys Val Arg His Gly Asn Phe Gly Asn
Ser Tyr Val Ser Trp Phe 100 105 110Ala Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser 115 120 1259125PRTMus Musculus 9Glu Val Lys Leu
Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Arg1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asn Thr Tyr 20 25 30Ala Met
Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala
Arg Ile Arg Ser Lys Tyr Asn Asn Tyr Ala Thr Tyr Tyr Ala Asp 50 55
60Ser Val Lys Asp Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Ser Ile65
70 75 80Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Met
Tyr 85 90 95Tyr Cys Val Arg His Gly Asn Phe Gly Asn Ser Tyr Val Ser
Trp Phe 100 105 110Ala Tyr Trp Gly Gln Gly Thr Met Val Thr Val Ser
Ser 115 120 12510109PRTMus Musculus 10Gln Ala Val Val Thr Gln Glu
Pro Ser Phe Ser Val Ser Pro Gly Gly1 5 10 15Thr Val Thr Leu Thr Cys
Arg Ser Ser Thr Gly Ala Val Thr Thr Ser 20 25 30Asn Tyr Ala Asn Trp
Val Gln Gln Thr Pro Gly Gln Ala Phe Arg Gly 35 40 45Leu Ile Gly Gly
Thr Asn Lys Arg Ala Pro Gly Val Pro Ala Arg Phe 50 55 60Ser Gly Ser
Leu Ile Gly Asp Lys Ala Ala Leu Thr Ile Thr Gly Ala65 70 75 80Gln
Ala Asp Asp Glu Ser Ile Tyr Phe Cys Ala Leu Trp Tyr Ser Asn 85 90
95Leu Trp Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100
10511109PRTMus Musculus 11Gln Ala Val Val Thr Gln Glu Pro Ser Phe
Ser Val Ser Pro Gly Gly1 5 10 15Thr Val Thr Leu Thr Cys Arg Ser Ser
Thr Gly Ala Val Thr Thr Ser 20 25 30Asn Tyr Ala Asn Trp Val Gln Gln
Thr Pro Gly Gln Ala Phe Arg Gly 35 40 45Leu Ile Gly Gly Thr Asn Lys
Arg Ala Pro Gly Val Pro Ala Arg Phe 50 55 60Ser Gly Ser Ile Leu Gly
Asn Lys Ala Ala Leu Thr Ile Thr Gly Ala65 70 75 80Gln Ala Asp Asp
Glu Ser Ile Tyr Phe Cys Ala Leu Trp Tyr Ser Asn 85 90 95Leu Trp Val
Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 10512109PRTMus Musculus
12Gln Ala Val Val Thr Gln Glu Pro Ser Phe Ser Val Ser Pro Gly Gly1
5 10 15Thr Val Thr Leu Thr Cys Arg Ser Ser Thr Gly Ala Val Thr Thr
Ser 20 25 30Asn Tyr Ala Asn Trp Val Gln Gln Thr Pro Gly Gln Ala Phe
Arg Gly 35 40 45Leu Ile Gly Gly Thr Asn Lys Arg Ala Pro Gly Val Pro
Ala Arg Phe 50 55 60Ser Gly Ser Ile Leu Gly Asn Lys Ala Ala Leu Thr
Ile Thr Gly Ala65 70 75 80Gln Ala Asp Asp Glu Ser Asp Tyr Tyr Cys
Ala Leu Trp Tyr Ser Asn 85 90 95Leu Trp Val Phe Gly Gly Gly Thr Lys
Leu Thr Val Leu 100 10513186PRThomo sapiens 13Gln Asp Gly Asn Glu
Glu Met Gly Gly Ile Thr Gln Thr Pro Tyr Lys1 5 10 15Val Ser Ile Ser
Gly Thr Thr Val Ile Leu Thr Cys Pro Gln Tyr Pro 20 25 30Gly Ser Glu
Ile Leu Trp Gln His Asn Asp Lys Asn Ile Gly Gly Asp 35 40 45Glu Asp
Asp Lys Asn Ile Gly Ser Asp Glu Asp His Leu Ser Leu Lys 50 55 60Glu
Phe Ser Glu Leu Glu Gln Ser Gly Tyr Tyr Val Cys Tyr Pro Arg65 70 75
80Gly Ser Lys Pro Glu Asp Ala Asn Phe Tyr Leu Tyr Leu Arg Ala Arg
85 90 95Val Cys Glu Asn Cys Met Glu Met Asp Val Met Ser Val Ala Thr
Ile 100 105 110Val Ile Val Asp Ile Cys Ile Thr Gly Gly Leu Leu Leu
Leu Val Tyr 115 120 125Tyr Trp Ser Lys Asn Arg Lys Ala Lys Ala Lys
Pro Val Thr Arg Gly 130 135 140Ala Gly Ala Gly Gly Arg Gln Arg Gly
Gln Asn Lys Glu Arg Pro Pro145 150 155 160Pro Val Pro Asn Pro Asp
Tyr Glu Pro Ile Arg Lys Gly Gln Arg Asp 165 170 175Leu Tyr Ser Gly
Leu Asn Gln Arg Arg Ile 180 18514150PRThomo sapiens 14Phe Lys Ile
Pro Ile Glu Glu Leu Glu Asp Arg Val Phe Val Asn Cys1 5 10 15Asn Thr
Ser Ile Thr Trp Val Glu Gly Thr Val Gly Thr Leu Leu Ser 20 25 30Asp
Ile Thr Arg Leu Asp Leu Gly Lys Arg Ile Leu Asp Pro Arg Gly 35 40
45Ile Tyr Arg Cys Asn Gly Thr Asp Ile Tyr Lys Asp Lys Glu Ser Thr
50 55 60Val Gln Val His Tyr Arg Met Cys Gln Ser Cys Val Glu Leu Asp
Pro65 70 75 80Ala Thr Val Ala Gly Ile Ile Val Thr Asp Val Ile Ala
Thr Leu Leu 85 90 95Leu Ala Leu Gly Val Phe Cys Phe Ala Gly His Glu
Thr Gly Arg Leu 100 105 110Ser Gly Ala Ala Asp Thr Gln Ala Leu Leu
Arg Asn Asp Gln Val Tyr 115 120 125Gln Pro Leu Arg Asp Arg Asp Asp
Ala Gln Tyr Ser His Leu Gly Gly 130 135 140Asn Trp Ala Arg Asn
Lys145 15015330PRThomo sapiens 15Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile
Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105
110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230
235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 325 33016330PRThomo sapiens 16Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe
Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40
45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser
50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln
Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys
Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Ala Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185
190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310
315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 33017119PRTMus
Musculus 17Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Ser Tyr 20 25 30Gly Met Phe Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val 35 40 45Ala Thr Ile Ser Arg Tyr Ser Arg Tyr Ile Tyr
Tyr Pro Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Arg Pro Leu Tyr Gly
Ser Ser Pro Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val
Ser Ser 11518106PRTMus Musculus 18Glu Ile Val Leu Thr Gln Ser Pro
Ala Thr Leu Ser Leu Ser Pro Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys
Ser Ala Ser Ser Ser Val Thr Tyr Val 20 25 30His Trp Tyr Gln Gln Lys
Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr 35 40 45Asp Thr Ser Lys Leu
Ala Ser Gly Ile Pro Ala Arg Phe Ser Gly Ser 50 55 60Gly Ser Gly Thr
Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu65 70 75 80Asp Phe
Ala Val Tyr Tyr Cys Phe Gln Gly Ser Gly Tyr Pro Leu Thr 85 90 95Phe
Gly Ser Gly Thr Lys Leu Glu Met Arg 100 10519177PRTMacaca
Fascicularis 19Gln Asp Gly Asn Glu Glu Met Gly Ser Ile Thr Gln Thr
Pro Tyr Gln1 5 10 15Val Ser Ile Ser Gly Thr Thr Val Ile Leu Thr Cys
Ser Gln His Leu 20 25 30Gly Ser Glu Ala Gln Trp Gln His Asn Gly Lys
Asn Lys Glu Asp Ser 35 40 45Gly Asp Arg Leu Phe Leu Pro Glu Phe Ser
Glu Met Glu Gln Ser Gly 50 55 60Tyr Tyr Val Cys Tyr Pro Arg Gly Ser
Asn Pro Glu Asp Ala Ser His65 70 75 80His Leu Tyr Leu Lys Ala Arg
Val Cys Glu Asn Cys Met Glu Met Asp 85 90 95Val Met Ala Val Ala Thr
Ile Val Ile Val Asp Ile Cys Ile Thr Leu 100 105 110Gly Leu Leu Leu
Leu Val Tyr Tyr Trp Ser Lys Asn Arg Lys Ala Lys 115 120 125Ala Lys
Pro Val Thr Arg Gly Ala Gly Ala Gly Gly Arg Gln Arg Gly 130 135
140Gln Asn Lys Glu Arg Pro Pro Pro Val Pro Asn Pro Asp Tyr Glu
Pro145 150 155 160Ile Arg Lys Gly Gln Gln Asp Leu Tyr Ser Gly Leu
Asn Gln Arg Arg 165 170 175Ile20177PRTMacaca Mulatta 20Gln Asp Gly
Asn Glu Glu Met Gly Ser Ile Thr Gln Thr Pro Tyr His1 5 10 15Val Ser
Ile Ser Gly Thr Thr Val Ile Leu Thr Cys Ser Gln His Leu 20 25 30Gly
Ser Glu Val Gln Trp Gln His Asn Gly Lys Asn Lys Glu Asp Ser 35 40
45Gly Asp Arg Leu Phe Leu Pro Glu Phe Ser Glu Met Glu Gln Ser Gly
50 55 60Tyr Tyr Val Cys Tyr Pro Arg Gly Ser Asn Pro Glu Asp Ala Ser
His65 70 75 80His Leu Tyr Leu Lys Ala Arg Val Cys Glu Asn Cys Met
Glu Met Asp 85 90 95Val Met Ala Val Ala Thr Ile Val Ile Val Asp Ile
Cys Ile Thr Leu 100 105 110Gly Leu Leu Leu Leu Val Tyr Tyr Trp Ser
Lys Asn Arg Lys Ala Lys 115 120 125Ala Lys Pro Val Thr Arg Gly Ala
Gly Ala Gly Gly Arg Gln Arg Gly 130 135 140Gln Asn Lys Glu Arg Pro
Pro Pro Val Pro Asn Pro Asp Tyr Glu
Pro145 150 155 160Ile Arg Lys Gly Gln Gln Asp Leu Tyr Ser Gly Leu
Asn Gln Arg Arg 165 170 175Ile21330PRThomo sapiens 21Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe
Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40
45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser
50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln
Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys
Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185
190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Leu 275 280 285Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310
315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 33022330PRThomo
sapiens 22Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser
Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys
Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val
Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150
155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265
270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
275 280 285Leu Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 325 33023330PRThomo sapiens 23Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile
Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105
110Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys 130 135 140Val Val Val Ala Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230
235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Leu 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 325 33024330PRThomo sapiens 24Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe
Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40
45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser
50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln
Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys
Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Ala Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185
190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser
Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310
315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 33025125PRTMus
Musculus 25Glu Val Lys Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro
Lys Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Asn Thr Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val 35 40 45Ala Arg Ile Arg Ser Lys Tyr Asn Asn Tyr Ala
Thr Tyr Tyr Ala Asp 50 55 60Ser Val Lys Asp Arg Phe Thr Ile Ser Arg
Asp Asp Ser Gln Ser Ile65 70 75 80Leu Tyr Leu Gln Met Asn Asn Leu
Lys Thr Glu Asp Thr Ala Met Tyr 85 90 95Tyr Cys Val Arg His Gly Asn
Phe Gly Asn Ser Tyr Val Ser Trp Phe 100 105 110Ala Tyr Trp Gly Gln
Gly Thr Leu Val Thr Val Ser Ala 115 120 12526109PRTMus Musculus
26Gln Ala Val Val Thr Gln Glu Ser Ala Leu Thr Thr Ser Pro Gly Glu1
5 10 15Thr Val Thr Leu Thr Cys Arg Ser Ser Thr Gly Ala Val Thr Thr
Ser 20 25 30Asn Tyr Ala Asn Trp Val Gln Glu Lys Pro Asp His Leu Phe
Thr Gly 35 40 45Leu Ile Gly Gly Thr Asn Lys Arg Ala Pro Gly Val Pro
Ala Arg Phe 50 55 60Ser Gly Ser Leu Ile Gly Asp Lys Ala Ala Leu Thr
Ile Thr Gly Ala65 70 75 80Gln Thr Glu Asp Glu Ala Ile Tyr Phe Cys
Ala Leu Trp Tyr Ser Asn 85 90 95Leu Trp Val Phe Gly Gly Gly Thr Lys
Leu Thr Val Leu 100 10527122PRThomo sapiens 27Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Asp Arg1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe His Asp Tyr 20 25 30Ala Met His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Thr
Ile Ser Trp Asn Ser Gly Thr Ile Gly Tyr Ala Asp Ser Val 50 55 60Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys
85 90 95Ala Lys Asp Ile Gln Tyr Gly Asn Tyr Tyr Tyr Gly Met Asp Val
Trp 100 105 110Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115
12028107PRThomo sapiens 28Glu Ile Val Leu Thr Gln Ser Pro Ala Thr
Leu Ser Leu Ser Pro Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala
Ser Gln Ser Val Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn Arg Ala
Thr Gly Ile Pro Ala Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala
Val Tyr Tyr Cys Gln Gln Arg Ser Asn Trp Pro Ile 85 90 95Thr Phe Gly
Gln Gly Thr Arg Leu Glu Ile Lys 100 10529106PRThomo sapiens 29Gly
Gln Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser1 5 10
15Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp
20 25 30Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser
Pro 35 40 45Val Lys Ala Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser
Asn Asn 50 55 60Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu
Gln Trp Lys65 70 75 80Ser His Arg Ser Tyr Ser Cys Gln Val Thr His
Glu Gly Ser Thr Val 85 90 95Glu Lys Thr Val Ala Pro Thr Glu Cys Ser
100 10530109PRTMus Musculus 30Gln Ala Val Val Thr Gln Glu Pro Ser
Leu Ser Val Ser Pro Gly Gly1 5 10 15Thr Val Thr Leu Thr Cys Arg Ser
Ser Thr Gly Ala Val Thr Thr Ser 20 25 30Asn Tyr Ala Asn Trp Val Gln
Gln Lys Pro Gly Gln Ala Phe Arg Gly 35 40 45Leu Ile Gly Gly Thr Asn
Asn Arg Ala Pro Gly Val Pro Ala Arg Phe 50 55 60Ser Gly Ser Leu Ile
Gly Asp Lys Ala Ala Leu Thr Ile Thr Gly Ala65 70 75 80Gln Ala Asp
Asp Glu Ser Ile Tyr Phe Cys Ala Leu Trp Tyr Ser Asn 85 90 95His Trp
Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 10531109PRTMus
Musculus 31Gln Ala Val Val Thr Gln Glu Pro Ser Phe Ser Val Ser Pro
Gly Gly1 5 10 15Thr Val Thr Leu Thr Cys Arg Ser Ser Thr Gly Ala Val
Thr Thr Ser 20 25 30Asn Tyr Ala Asn Trp Val Gln Gln Lys Pro Gly Gln
Ala Phe Arg Gly 35 40 45Leu Ile Gly Gly Thr Asn Lys Arg Ala Pro Gly
Val Pro Ala Arg Phe 50 55 60Ser Gly Ser Leu Ile Gly Asp Lys Ala Ala
Leu Thr Ile Thr Gly Ala65 70 75 80Gln Ala Asp Asp Glu Ser Ile Tyr
Phe Cys Ala Leu Trp Tyr Ser Asn 85 90 95Leu Trp Val Phe Gly Gly Gly
Thr Lys Leu Thr Val Leu 100 105328PRThomo sapiens 32Gly Phe Thr Phe
His Asp Tyr Ala1 5338PRThomo sapiens 33Ile Ser Trp Asn Ser Gly Thr
Ile1 53415PRThomo sapiens 34Ala Lys Asp Ile Gln Tyr Gly Asn Tyr Tyr
Tyr Gly Met Asp Val1 5 10 15356PRThomo sapiens 35Gln Ser Val Ser
Ser Tyr1 5369PRThomo sapiens 36Gln Gln Arg Ser Asn Trp Pro Ile Thr1
537122PRThomo sapiens 37Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Asn Asp Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Thr Ile Ser Trp Asn Ser Gly
Ser Ile Gly Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Lys Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys 85 90 95Ala Lys Asp Ile
Gln Tyr Gly Asn Tyr Tyr Tyr Gly Met Asp Val Trp 100 105 110Gly Gln
Gly Thr Thr Val Thr Val Ser Ser 115 120388PRThomo sapiens 38Gly Phe
Thr Phe Asn Asp Tyr Ala1 5398PRThomo sapiens 39Ile Ser Trp Asn Ser
Gly Ser Ile1 540125PRThomo sapiens 40Glu Val Gln Leu Val Gln Ser
Gly Gly Gly Leu Val His Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys
Thr Gly Ser Gly Phe Thr Phe Ser Tyr His 20 25 30Ala Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Gly
Thr Gly Gly Val Thr Tyr Tyr Ala Asp Ser Val Lys 50 55 60Gly Arg Phe
Thr Ile Ser Arg Asp Asn Val Lys Asn Ser Leu Tyr Leu65 70 75 80Gln
Met Asn Ser Leu Arg Ala Glu Asp Met Ala Val Tyr Tyr Cys Ala 85 90
95Arg Asp Tyr Tyr Gly Ala Gly Ser Phe Tyr Asp Gly Leu Tyr Gly Met
100 105
110Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115 120
12541107PRThomo sapiens 41Glu Ile Val Leu Thr Gln Ser Pro Ala Thr
Leu Ser Leu Ser Pro Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala
Ser Gln Ser Val Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn Arg Ala
Thr Gly Ile Pro Ala Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala
Val Tyr Tyr Cys Gln Gln Arg Ser Asp Trp Pro Leu 85 90 95Thr Phe Gly
Gly Gly Thr Lys Val Glu Ile Lys 100 105428PRThomo sapiens 42Gly Phe
Thr Phe Ser Tyr His Ala1 5437PRThomo sapiens 43Ile Gly Thr Gly Gly
Val Thr1 54419PRThomo sapiens 44Ala Arg Asp Tyr Tyr Gly Ala Gly Ser
Phe Tyr Asp Gly Leu Tyr Gly1 5 10 15Met Asp Val456PRThomo sapiens
45Gln Ser Val Ser Ser Tyr1 5469PRThomo sapiens 46Gln Gln Arg Ser
Asp Trp Pro Leu Thr1 547123PRThomo sapiens 47Ala Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30Thr Met His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly
Ile Ser Trp Asn Ser Gly Ser Ile Gly Tyr Ala Asp Ser Val 50 55 60Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Leu Tyr Tyr Cys
85 90 95Thr Lys Asp Asn Gln Tyr Gly Ser Gly Ser Thr Tyr Gly Leu Gly
Val 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115
12048107PRThomo sapiens 48Glu Ile Val Leu Thr Gln Ser Pro Ala Thr
Leu Ser Leu Ser Pro Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala
Ser Gln Ser Val Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro
Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn Arg Ala
Thr Gly Ile Pro Ala Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala
Val Tyr Tyr Cys Gln Gln Arg Ser Asn Trp Pro Leu 85 90 95Thr Phe Gly
Gly Gly Thr Lys Val Glu Ile Lys 100 105498PRThomo sapiens 49Gly Phe
Thr Phe Gly Asp Tyr Thr1 5508PRThomo sapiens 50Ile Ser Trp Asn Ser
Gly Ser Ile1 55116PRThomo sapiens 51Thr Lys Asp Asn Gln Tyr Gly Ser
Gly Ser Thr Tyr Gly Leu Gly Val1 5 10 15526PRThomo sapiens 52Gln
Ser Val Ser Ser Tyr1 5539PRThomo sapiens 53Gln Gln Arg Ser Asn Trp
Pro Leu Thr1 5549PRTMus Musculus 54Ala Leu Trp Tyr Ser Asn His Trp
Val1 5558PRTMus Musculus 55Gly Phe Thr Phe Ser Ser Tyr Gly1
5568PRTMus Musculus 56Ile Ser Arg Tyr Ser Arg Tyr Ile1 55712PRTMus
Musculus 57Ala Arg Arg Pro Leu Tyr Gly Ser Ser Pro Asp Tyr1 5
10585PRTMus Musculus 58Ser Ser Val Thr Tyr1 5599PRTMus Musculus
59Phe Gln Gly Ser Gly Tyr Pro Leu Thr1 560107PRThomo sapiens 60Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp1 5 10
15Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
20 25 30Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu 35 40 45Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe 50 55 60Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln Gln Gly65 70 75 80Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu His Asn His Tyr 85 90 95Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 100 10561107PRThomo sapiens 61Gly Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu1 5 10 15Glu Met Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly65 70 75 80Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 10562107PRThomo sapiens
62Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp1
5 10 15Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly
Phe 20 25 30Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu 35 40 45Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe 50 55 60Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly65 70 75 80Asn Val Phe Ser Cys Ser Val Met His Glu
Gly Leu His Asn His Tyr 85 90 95Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 100 10563330PRThomo sapiens 63Ala Ser Thr Lys Gly Pro Ser
Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val
Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr
Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser
Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr
Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90
95Arg Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys
100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe
Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro
Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215
220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu
Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys
Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 33064330PRThomo sapiens
64Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1
5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp
Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu
Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly
Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu
Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser
Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys Asp Lys
Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155
160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Leu 275 280
285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325
33065330PRThomo sapiens 65Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr
Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn
Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro
Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120
125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235
240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe 275 280 285Leu Tyr Ser Arg Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys 325 33066330PRThomo sapiens 66Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser
Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro
Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly
Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55
60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65
70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp
Lys 85 90 95Arg Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro
Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr
Gln Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200
205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315
320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 33067330PRThomo
sapiens 67Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser
Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys
Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Phe
Glu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val
Val Val Ala Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150
155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu 165 170 175Glu Gln Tyr Gln Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Ser Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265
270Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280
285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325
33068330PRThomo sapiens 68Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr
Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn
Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro
Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120
125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Gln Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235
240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Leu 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys 325 33069330PRThomo sapiens 69Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser
Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro
Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly
Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55
60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65
70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp
Lys 85 90 95Arg Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro
Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr
Gln Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200
205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu225 230 235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Arg Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315
320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 33070330PRThomo
sapiens 70Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser
Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys
Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Phe
Glu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val
Val Val Ala Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150
155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu 165 170 175Glu Gln Tyr Gln Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Ser Ile Glu Lys
Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230 235 240Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265
270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Leu
275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 325 33071330PRThomo sapiens 71Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile
Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105
110Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys 130 135 140Val Val Val Ala Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Gln Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu
Pro Ala Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230
235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Arg Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 325 330728PRTMus
Musculusmisc(5)..(5)wherein X is selected from V, H, F, T, P, L, Q,
D, K, W, S, G, A, C and R 72Gly Phe Thr Phe Xaa Thr Tyr Ala1
5738PRTMus MusculusMISC_FEATURE(6)..(6)wherein X is selected from
S, N, G, A, K, V, R, H, Q, P, I, F, M, Y, L, W, D, E and C 73Gly
Phe Thr Phe Asn Xaa Tyr Ala1 5748PRTMus
MusculusMISC_FEATURE(7)..(7)wherein X is selected from F, H, N, M,
W, G, Q, V, T, S, L, P, I, A, K, R and C 74Gly Phe Thr Phe Asn Thr
Xaa Ala1 57510PRTMus MusculusMISC_FEATURE(7)..(7)wherein X is
selected from S, Y, Q, W, L, A, I, M, D, T, K, R, G, F, E, V, C and
P 75Ile Arg Ser Lys Tyr Asn Xaa Tyr Ala Thr1 5 107610PRTMus
MusculusMISC_FEATURE(9)..(9)wherein X is selected from N, L, Y, W,
H, M, G, F, K, S, V, R, Q, D, C, E, P and T 76Ile Arg Ser Lys Tyr
Asn Asn Tyr Xaa Thr1 5 107716PRTMus
MusculusMISC_FEATURE(3)..(3)wherein X is selected from A, S, V, N,
K, L, T, I, P, Q, C, G, Y, W, F, and R 77Val Arg Xaa Gly Asn Phe
Gly Asn Ser Tyr Val Ser Trp Phe Ala Tyr1 5 10 157816PRTMus
MusculusMISC_FEATURE(7)..(7)wherein X is selected from P, Q, A, Y,
H, I, N, V, E, L, F, W, M, R, C, S and T 78Val Arg His Gly Asn Phe
Xaa Asn Ser Tyr Val Ser Trp Phe Ala Tyr1 5 10 157916PRTMus
MusculusMISC_FEATURE(12)..(12)wherein X is selected from A, T, G,
L, N, C, P, F, Q, H, R, K, E, W, and Y 79Val Arg His Gly Asn Phe
Gly Asn Ser Tyr Val Xaa Trp Phe Ala Tyr1 5 10 158016PRTMus
MusculusMISC_FEATURE(16)..(16)wherein X is selected from H, S, F,
N, W, T, C, A, I, L, Q, V, E, M, K, R, G and P 80Val Arg His Gly
Asn Phe Gly Asn Ser Tyr Val Ser Trp Phe Ala Xaa1 5 10 15819PRTMus
MusculusMISC_FEATURE(6)..(6)wherein X is selected from S, A, G, R,
V, F, I, E, M, H, N, Y, P, Q, D, K and L 81Thr Gly Ala Val Thr Xaa
Ser Asn Tyr1 5829PRTMus MusculusMISC_FEATURE(2)..(2)wherein X is
selected from C, F, Y, I, T, V, M, A, S, N, G, W, E, K, P, R and D
82Ala Xaa Trp Tyr Ser Asn Leu Trp Val1 5839PRTMus
MusculusMISC_FEATURE(7)..(7)wherein X is selected from D, K, Q, R,
G, V, E, T, N, Y, S, P, W, F and M 83Ala Leu Trp Tyr Ser Asn Xaa
Trp Val1 58442DNAArtificial SequencePrimer 84gggagttctt ctcgctgctg
ttgctgggct cgcagttgta ga 428542DNAArtificial SequencePrimer
85tctacaactg cgagcccagc aacagcagcg agaagaactc cc
428643DNAArtificial SequencePrimer 86ctcgcagtcg tagatgtcga
tgtagggctt gtgggcccgg atg 438743DNAArtificial SequencePrimer
87catccgggcc cacaagccct acatcgacat ctacgactgc gag 43
* * * * *
References