U.S. patent application number 16/698473 was filed with the patent office on 2020-06-18 for methods for increasing intracellular activity of hsp70.
The applicant listed for this patent is Orphazyme A/S. Invention is credited to Anders Morkeberg Hinsby, Thomas Kirkegaard Jensen.
Application Number | 20200188492 16/698473 |
Document ID | / |
Family ID | 46171210 |
Filed Date | 2020-06-18 |
![](/patent/app/20200188492/US20200188492A1-20200618-D00001.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00002.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00003.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00004.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00005.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00006.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00007.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00008.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00009.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00010.png)
![](/patent/app/20200188492/US20200188492A1-20200618-D00011.png)
View All Diagrams
United States Patent
Application |
20200188492 |
Kind Code |
A1 |
Jensen; Thomas Kirkegaard ;
et al. |
June 18, 2020 |
METHODS FOR INCREASING INTRACELLULAR ACTIVITY OF HSP70
Abstract
The present invention relates to a bioactive agent capable of
increasing the intracellular concentration and/or activity of Hsp70
for use in the treatment of a lysosomal storage disease which arise
from a defect in an enzyme whose activity is not directly
associated with the presence of lysosomal BMP as a co-factor, such
as glycogen storage diseases, gangliosidoses, neuronal ceroid
lipofuscinoses, cerebrotendinous cholesterosis, Wolman's disease,
cholesteryl ester storage disease, disorders of glycosaminoglycan
metabolism, mucopolysaccharidoses, disorders of glycoprotein
metabolism, mucolipidoses, aspartylglucosaminuria, fucosidosis,
mannosidoses, and sialidosis type II.
Inventors: |
Jensen; Thomas Kirkegaard;
(Rodovre, DK) ; Hinsby; Anders Morkeberg;
(Hellerup, DK) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Orphazyme A/S |
Copenhagen N |
|
DK |
|
|
Family ID: |
46171210 |
Appl. No.: |
16/698473 |
Filed: |
November 27, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15600407 |
May 19, 2017 |
10532085 |
|
|
16698473 |
|
|
|
|
13885553 |
May 15, 2013 |
9662375 |
|
|
PCT/DK2011/050444 |
Nov 22, 2011 |
|
|
|
15600407 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 3/00 20180101; A61K
45/06 20130101; A61K 38/46 20130101; A61K 31/5395 20130101; A61K
38/17 20130101; A61K 31/4545 20130101 |
International
Class: |
A61K 38/46 20060101
A61K038/46; A61K 45/06 20060101 A61K045/06; A61K 31/5395 20060101
A61K031/5395; A61K 31/4545 20060101 A61K031/4545; A61K 38/17
20060101 A61K038/17 |
Foreign Application Data
Date |
Code |
Application Number |
Nov 30, 2010 |
DK |
PA201070520 |
Claims
1. A method of treatment of a lysosomal storage disease selected
from the group consisting of glycogen storage diseases,
gangliosidoses, lysosomal cholesterol storage diseases, disorders
of glycosaminoglycan metabolism, mucopolysaccharidoses, disorders
of glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, sialidosis type II, and neuronal ceroid
lipofuscinoses, said method comprising administering to an
individual in need thereof a bioactive agent capable of increasing
the intracellular concentration of Hsp70, wherein said bioactive
agent is selected from the group consisting of a hydroxylamine
derivative capable of amplifying Hsp70 gene expression; Hsp70; and
a functional fragment or variant of Hsp70 having at least 95%
sequence identity to Hsp70.
2. The method according to claim 1, wherein said disease is a
glycogen storage disease selected from the group consisting of
cardiac glycogenosis, Andersen disease, Cori disease (Forbes
disease), Hers disease, McArdle disease, Pompe disease, Tauri
disease (Tarui disease), and von Gierke disease.
3. The method according to claim 1, wherein said disease is a
aanaliosidosis selected from the group consisting of Sandhoff
disease (or GM2 gangliosidosis type II), classic infantile Sandhoff
disease, juvenile Sandhoff disease, adult/late onset Sandhoff
disease, Tay-Sachs disease (or GM2 gangliosidosis type I),
infantile Tay-Sachs disease, juvenile Tay-Sachs disease, adult/late
onset Tay-Sachs disease, GM2-gangliosidosis AB variant, GM1
gangliosidosis, early infantile GM1 gangliosidosis, late infantile
GM1 gangliosidosis, adult GM1 gangliosidosis, GM3 gangliosidosis,
and Mucolipidosis IV.
4. The method according to claim 1, wherein said lysosomal
cholesterol storage disease is selected from the group consisting
of cerebrotendinous cholesterosis, Wolman's disease and cholesteryl
ester storage disease.
5. The method according to claim 1, wherein said disease is a
mucopolysaccharidosis selected from the group consisting of a type
I mucopolysaccharidosis, a type II mucopolysaccharidosis, a type
III mucopolysaccharidosis, a type IV mucopolysaccharidosis, a type
VI mucopolysaccharidosis, a type VII mucopolysaccharidosis, a type
VIII mucopolysaccharidosis, and a type IX
mucopolysaccharidosis.
6. The method according to claim 1, wherein said
mucopolysaccharidosis is selected from the group consisting of
Hurler syndrome, Hurler-Scheie syndrome, Scheie syndrome, Hunter's
syndrome, DiFerrante syndrome, Maroteaux-Lamy syndrome (mild or
severe), Morquio syndrome (classic or Morquio-like), and Sanfilippo
syndrome (type A, B, C, or D).
7. The method according to claim 1, wherein said disease is a
mucolipidosis selected from the group consisting of mucolipidosis
II (I-cell disease) and mucolipidosis III (pseudo-Hurler
polydystrophy).
8. The method according to claim 1, wherein said disease is a
disorder of glycoprotein metabolism selected from the group
consisting of aspartylglucosaminuria, fucosidosis, mannosidosis,
alpha-mannosidosis, alpha-mannosidosis type I, alpha-mannosidosis
type II, beta-mannosidosis, and sialidosis type II (mucolipidosis
I).
9. The method according to claim 1, wherein said disease is a
neuronal ceroid lipofuscinosis selected from the group consisting
of Batten disease (Spielmeyer-Vogt disease), Bielschowsky-Jansky
disease, Kufs disease, and Santavuori-Haltia disease.
10. The method according to claim 1, wherein said bioactive agent
is administered in combination with at least one other treatment
modality.
11. The method according to claim 10, wherein said at least one
other treatment modality is selected from the group consisting of
enzyme replacement therapy (ERT), pain relievers, corticosteroids,
substrate reduction therapy, a transplantation and physical
therapy.
12. The method according to claim 1, wherein said hydroxylamine
derivative is selected from the group consisting of arimoclomol,
BRX-220, BRX-345, iroxanadine, bimoclomol and BGP-15.
13. The method according to claim 1, wherein said hydroxylamine
derivative is selected from the group consisting of arimoclomol,
BRX-220 and BRX-345.
14. The method according to claim 1, wherein said hydroxylamine
derivative is iroxanadine.
15. The method according to claim 1, wherein said Hsp70 is derived
from a mammal selected from the group consisting of human (homo
sapiens), mouse (mus musculus), cow, dog, rat, ferret, pig, sheep,
and monkey.
16. The method according to claim 1, wherein said bioactive agent
is Hsp70.
17. The method according to claim 1, wherein said bioactive agent
is recombinant Hsp70 (rHsp70).
18. The method according to claim 1, wherein said bioactive agent
is a functional fragment or variant of Hsp70 having at least 95%
sequence identity to Hsp70.
19. The method according to claim 1, wherein said functional
fragment or variant of Hsp70 having at least 95% sequence identity
to Hsp70 comprises all or part of the ATPase domain of Hsp70;
and/or comprises tryptophan at amino acid position 90 of the Hsp70
ATPase domain.
20. The method according to claim 1, wherein administering said
Hsp70 or said functional fragment or variant of Hsp70 having at
least 95% sequence identity to Hsp70 comprises administering an
expression vector encoding said Hsp70 or said functional fragment
or variant of Hsp70 having at least 95% sequence identity to Hsp70.
Description
REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 15/600,407, filed May 19, 2017, which is a
continuation of U.S. patent application Ser. No. 13/885,553, filed
May 15, 2013, now U.S. Pat. No. 9,662,375, which is a U.S. national
stage patent application of PCT/DK2011/050444, filed Nov. 22, 2011,
which claims priority from Danish Patent Application No. PA 2010
70520, filed Nov. 30, 2010. The entire content of each application
is incorporated herein by reference.
FIELD OF THE INVENTION
[0002] The present invention relates to a bioactive agent capable
of increasing the intracellular concentration and/or activity of
Hsp70 for use in the treatment of a lysosomal storage disease which
arise from a defect in an enzyme whose activity is not directly
associated with the presence of lysosomal BMP as a co-factor; such
as glycogen storage diseases, gangliosidoses, neuronal ceroid
lipofuscinoses, cerebrotendinous cholesterosis, Wolman's disease,
cholesteryl ester storage disease, disorders of glycosaminoglycan
metabolism, mucopolysaccharidoses, disorders of glycoprotein
metabolism, mucolipidoses, aspartylglucosaminuria, fucosidosis,
mannosidoses, and sialidosis type II.
BACKGROUND OF THE INVENTION
[0003] The molecular chaperones are found in all compartments of a
cell where conformational rearrangements of proteins occur, and
although protein synthesis is the major source of unfolded peptides
in the cell, a challenge to the cell by high temperature or other
stimuli that might render proteins structurally labile, and hence
prone to unfolding and aggregation, is met with a specific cellular
response involving the production of protective proteins. This
response is a phenomenon observed in every cell type ranging from
prokaryotes to eukaryotes and is referred to as the heat-shock- or
stress-response. The proteins induced by this response are known as
the heat shock proteins (HSPs), of which there exist several
families.
[0004] A primary example of a family of chaperones is the Hsp70
proteins. This family has recently been implicated in other aspects
of cellular homeostasis besides serving as a chaperone--most
markedly through its anti-apoptotic features, its functions in
immunity, and the apparent dependence of cancer cells on the
upregulation of Hsp70. Furthermore, Hsp70 can serve a role in
safeguarding lysosomal integrity.
[0005] The lysosomal storage diseases are a rare group of diseases,
characterized by the accumulation of substances in the lysosomal
compartment and resulting destabilization hereof, with a resulting
devastating effect for affected individuals. Substances accumulate
in the lysosomal compartment due to deficiencies in the enzymes
involved in their catabolism. To this date, no treatment is
available for most lysosomal storage diseases. The use of enzyme
replacement therapy (ERT), by providing to a patient the
recombinant enzyme that is deficient, has been employed for a
subset of these diseases. However, ERT is a very expensive form of
therapy which may limit its use in some areas, and also is
effective only towards the specific type of disease to which the
recombinant enzyme has been produced.
[0006] International patent application WO 2009/155936 is aimed at
providing new means for treating lysosomal storage disorders by
exploiting the newly identified interaction between Hsp70 and the
lysosomal phospholipid Bis(monoacylglycero)phosphate (BMP) to
promote lysosomal stabilization. This interaction was shown to
reverse the pathology of lysosomal storage diseases which arise
from a defect in an enzyme whose activity is associated with the
presence of lysosomal BMP as a co-factor; such as Niemann-Pick
disease and Farber disease.
[0007] The present inventors have now surprisingly found that HSP70
is also beneficial in reversing the pathology of lysosomal storage
diseases which arise from a defect in an enzyme whose activity is
not directly associated with the presence of lysosomal BMP as a
co-factor; such as glycogen storage diseases, gangliosidoses,
neuronal ceroid lipofuscinoses, cerebrotendinous cholesterosis,
Wolman's disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidases, and sialidosis type II.
SUMMARY OF THE INVENTION
[0008] It is known from the literature that Hsp70 can serve a role
in safeguarding lysosomal integrity. However, the molecular
mechanism has remained unclear. In the present invention, the
molecular basis for the contribution of Hsp70 to lysosomal membrane
stability is further examined, and its effect on reversing the
pathology of lysosomal storage diseases is addressed; specifically
when said lysosomal storage diseases does not arise from a defect
in an enzyme whose activity is associated with the presence of
lysosomal BMP as a co-factor.
[0009] The present invention provides a method for treating a
lysosomal storage disease by increasing directly or indirectly the
intracellular concentration and/or activity of Hsp70 in individuals
in need thereof, by providing Hsp70, or a functional fragment or
variant thereof, or by providing an Hsp70 inducer or
co-inducer.
[0010] The present invention relates in one aspect to a bioactive
agent capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of a lysosomal storage
disease which does not arise from a defect in an enzyme whose
activity is associated with the presence of lysosomal BMP as a
co-factor.
[0011] The present invention relates in one aspect to a bioactive
agent capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of a disease selected
from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
[0012] It is a further aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a lysosomal storage disease, wherein said said lysosomal storage
disease is not selected from the group of Niemann-Pick disease,
Farber disease, Krabbe disease, Sialidosis type I, Metachromatic
leukodystrophy, Gaucher disease, Fabry disease and
saposin-deficiency.
[0013] In one embodiment, said bioactive agent is Hsp70, or a
functional fragment or variant thereof. In another embodiment, said
bioactive agent is an Hsp70 inducer or co-inducer.
[0014] It is also an aspect of the present invention to provide a
method for treatment of a lysosomal storage disease comprising
administration of the bioactive agent according to the present
invention to an individual in need thereof. Said treatment may be
prophylactic, curative or ameliorating.
[0015] The invention also concerns a method for increasing the
uptake of a compound, said method comprising the step of
administering said compound together with Hsp70 or a functional
fragment or variant thereof. In one embodiment, said Hsp70 or a
functional fragment or variant thereof is covalently bound to said
compound. In another embodiment, said Hsp70 or a functional
fragment or variant thereof is non-covalently bound to said
compound.
[0016] The present invention also relates to a method of treatment
of a lysosomal storage disease comprising administration of the
bioactive agent according to the present invention in combination
with at least one other treatment modality.
[0017] In an embodiment of the invention, Hsp70 is administered
together with enzyme replacement therapy in the treatment of a
lysosomal storage disorder.
[0018] In another embodiment, Hsp70 is used to facilitate the
uptake of enzymes in enzyme replacement therapy, thereby increasing
the amount of enzyme having been taken up by the relevant
cells.
Definitions
[0019] Lysosomal storage disorder (LSD): The terms "lysosomal
storage disorder" and "lysosomal storage disease" are used as
synonyms.
[0020] Functional fragment of Hsp70: The term "functional fragment
of Hsp70" is to be construed as meaning any fragment of Hsp70
having the desired function. In one embodiment a functional
fragment is a fragment capable of reversing the pathology of a
lysosomal storage disease as specified herein. In another
embodiment a functional fragment is a fragment capable of inducing
autophagy. In relation to increasing the uptake of a substance, a
functional fragment of Hsp70 is a fragment capable of increasing
the uptake of said substance. It is appreciated that the exact
quantitative effect of the functional fragment may be different
from the effect of the full-length molecule. In some instances, the
functional fragment may indeed be more effective than the
full-length molecule. Furthermore, the use of fragments instead of
full-length molecules may be advantageous in view of the smaller
size of the fragments.
[0021] Functional variant of Hsp70: The term "functional variant of
Hsp70" is to be construed as meaning any variant of Hsp70 having
the desired function. In one embodiment a functional fragment is a
fragment capable of reversing the pathology of a lysosomal storage
disease as specified herein. In another embodiment a functional
variant is a fragment capable of inducing autophagy. In relation to
increasing the uptake of a substance, a functional variant of Hsp70
is a fragment capable of increasing the uptake of said substance.
It is appreciated that the exact quantitative effect of the
functional variant may be different from the effect of the
full-length molecule. In some instances, the functional variant may
indeed be more effective than the full-length molecule.
[0022] A "Bioactive agent" (i.e., biologically active
substance/agent) is any agent, drug, compound, composition of
matter or mixture which provides some pharmacologic, often
beneficial, effect that can be demonstrated in vivo or in vitro. As
used herein, this term further includes any physiologically or
pharmacologically active substance that produces a localized or
systemic effect in an individual. Further examples of bioactive
agents include, but are not limited to, agents comprising or
consisting of an oligosaccharide, agents comprising or consisting
of a polysaccharide, agents comprising or consisting of an
optionally glycosylated peptide, agents comprising or consisting of
an optionally glycosylated polypeptide, agents comprising or
consisting of a nucleic acid, agents comprising or consisting of an
oligonucleotide, agents comprising or consisting of a
polynucleotide, agents comprising or consisting of a lipid, agents
comprising or consisting of a fatty acid, agents comprising or
consisting of a fatty acid ester and agents comprising or
consisting of secondary metabolites. It may be used either
prophylactically, therapeutically, in connection with treatment of
an individual, such as a human or any other animal. As used herein,
a bioactive agent is a substance capable of increasing the
intracellular concentration and/or activity of Hsp70.
[0023] The terms "drug" or "medicament" as used herein includes
biologically, physiologically, or pharmacologically active
substances that act locally or systemically in the human or animal
body.
[0024] The terms "treating", "treatment" and "therapy" as used
herein refer equally to curative therapy, prophylactic or
preventative therapy and ameliorating or palliative therapy. The
term includes an approach for obtaining beneficial or desired
physiological results, which may be established clinically. For
purposes of this invention, beneficial or desired clinical results
include, but are not limited to, alleviation of symptoms,
diminishment of extent of disease, stabilized (i.e., not worsening)
condition, delay or slowing of progression or worsening of
condition/symptoms, amelioration or palliation of the condition or
symptoms, and remission (whether partial or total), whether
detectable or undetectable. The term "palliation", and variations
thereof, as used herein, means that the extent and/or undesirable
manifestations of a physiological condition or symptom are lessened
and/or time course of the progression is slowed or lengthened, as
compared to not administering compositions of the present
invention.
[0025] A "treatment effect" or "therapeutic effect" is manifested
if there is a change in the condition being treated, as measured by
the criteria constituting the definition of the terms "treating"
and "treatment." There is a "change" in the condition being treated
if there is at least 5% improvement, preferably 10% improvement,
more preferably at least 25%, even more preferably at least 50%,
such as at least 75%, and most preferably at least 100%
improvement. The change can be based on improvements in the
severity of the treated condition in an individual, or on a
difference in the frequency of improved conditions in populations
of individuals with and without treatment with the bioactive agent,
or with the bioactive agent in combination with a pharmaceutical
composition of the present invention.
[0026] "Pharmacologically effective amount", "pharmaceutically
effective amount" or "physiologically effective amount of a
"bioactive agent" is the amount of an active agent present in a
pharmaceutical composition as described herein that is needed to
provide a desired level of active agent in the bloodstream or at
the site of action in an individual (e.g. the lungs, the gastric
system, the colorectal system, prostate, etc.) to be treated to
give an anticipated physiological response when such composition is
administered. The precise amount will depend upon numerous factors,
e.g., the active agent, the activity of the composition, the
delivery device employed, the physical characteristics of the
composition, intended patient use (i.e. the number of doses
administered per day), patient considerations, and the like, and
can readily be determined by one skilled in the art, based upon the
information provided herein. An "effective amount" of a bioactive
agent can be administered in one administration, or through
multiple administrations of an amount that total an effective
amount, preferably within a 24-hour period. It can be determined
using standard clinical procedures for determining appropriate
amounts and timing of administration. It is understood that the
"effective amount" can be the result of empirical and/or
individualized (case-by-case) determination on the part of the
treating health care professional and/or individual.
[0027] The terms "enhancing" and "improving" a beneficial effect,
and variations thereof, as used herein, refers to the therapeutic
effect of the bioactive agent against placebo, or an increase in
the therapeutic effect of a state-of-the-art medical treatment
above that normally obtained when a pharmaceutical composition is
administered without the bioactive agent of this invention. "An
increase in the therapeutic effects" is manifested when there is an
acceleration and/or increase in intensity and/or extent of the
therapeutic effects obtained as a result of administering the
bioactive agent(s). It also includes extension of the longevity of
therapeutic benefits. It can also manifest where a lower amount of
the pharmaceutical composition is required to obtain the same
benefits and/or effects when it is co-administered with bioactive
agent(s) provided by the present invention as compared to the
administration in a higher amount of the pharmaceutical composition
in the absence of bioactive agent. The enhancing effect preferably,
but not necessarily, results in treatment of acute symptoms for
which the pharmaceutical composition alone is not effective or is
less effective therapeutically. Enhancement is achieved when there
is at least a 5% increase in the therapeutic effects, such as at
least 10% increase in the therapeutic effects when a bioactive
agent of the present invention is co-administered with a
pharmaceutical composition compared with administration of the
pharmaceutical composition alone. Preferably the increase is at
least 25%, more preferably at least 50%, even more preferably at
least 75%, most preferably at least 100%.
[0028] "Co-administering" or "co-administration" of bioactive
agent(s), or bioactive aaents and state-of-the-art medicaments, as
used herein, refers to the administration of one or more bioactive
agents of the present invention, or administration of one or more
bioactive agents of the present invention and a state-of-the-art
pharmaceutical composition within a certain time period. The time
period is preferably less than 72 hours, such as less than 48
hours, for example less than 24 hours, such as less than 12 hours,
for example less than 6 hours, such as less than 3 hours. However,
these terms also mean that the bioactive agent and a therapeutic
composition can be administered together (simultaneously or
essentially simultaneously).
[0029] The term "Individual" refers to vertebrates, in particular a
member of a mammalian species, preferably primates including
humans. In a preferred embodiment, an individual as used herein is
a human being, male or female, of any age.
[0030] An "individual in need thereof" refers to an individual who
may benefit from the present invention. In one embodiment, said
individual in need thereof is a diseased individual, wherein said
disease is a lysosomal storage disease.
[0031] The term "natural nucleotide" or "nucleotide" refers to any
of the four deoxyribonucleotides, dA, dG, dT, and dC (constituents
of DNA), and the four ribonucleotides, A, G, U, and C (constituents
of RNA), as found in nature. Each natural nucleotide comprises or
essentially consists of a sugar moiety (ribose or deoxyribose), a
phosphate moiety, and a natural/standard base moiety. Natural
nucleotides bind to complementary nucleotides according to
well-known rules of base pairing (Watson and Crick), where adenine
(A) pairs with thymine (T) or uracil (U); and where guanine (G)
pairs with cytosine (C), wherein corresponding base-pairs are part
of complementary, anti-parallel nucleotide strands. The base
pairing results in a specific hybridization between predetermined
and complementary nucleotides. The base pairing is the basis by
which enzymes are able to catalyze the synthesis of an
oligonucleotide complementary to the template oligonucleotide. In
this synthesis, building blocks (normally the triphosphates of ribo
or deoxyribo derivatives of A, T, U, C, or G) are directed by a
template oligonucleotide to form a complementary oligonucleotide
with the correct, complementary sequence. The recognition of an
oligonucleotide sequence by its complementary sequence is mediated
by corresponding and interacting bases forming base pairs. In
nature, the specific interactions leading to base pairing are
governed by the size of the bases and the pattern of hydrogen bond
donors and acceptors of the bases. A large purine base (A or G)
pairs with a small pyrimidine base (T, U or C). Additionally, base
pair recognition between bases is influenced by hydrogen bonds
formed between the bases. In the geometry of the Watson-Crick base
pair, a six membered ring (a pyrimidine in natural
oligonucleotides) is juxtaposed to a ring system composed of a
fused, six membered ring and a five membered ring (a purine in
natural oligonucleotides), with a middle hydrogen bond linking two
ring atoms, and hydrogen bonds on either side joining functional
groups appended to each of the rings, with donor groups paired with
acceptor groups.
[0032] As used herein, "nucleic acid" or "nucleic acid molecule"
refers to polynucleotides, such as deoxyribonucleic acid (DNA) or
ribonucleic acid (RNA), oligonucleotides, fragments generated by
the polymerase chain reaction (PCR), and fragments generated by any
of ligation, scission, endonuclease action, and exonuclease action.
Nucleic acid molecules can be composed of monomers that are
naturally-occurring nucleotides (such as DNA and RNA), or analogs
of naturally-occurring nucleotides (e.g. alpha-enantiomeric forms
of naturally-occurring nucleotides), or a combination of both.
Modified nucleotides can have alterations in sugar moieties and/or
in pyrimidine or purine base moieties. Sugar modifications include,
for example, replacement of one or more hydroxyl groups with
halogens, alkyl groups, amines, and azido groups, or sugars can be
functionalized as ethers or esters. Moreover, the entire sugar
moiety can be replaced with sterically and electronically similar
structures, such as aza-sugars and carbocyclic sugar analogs.
Examples of modifications in a base moiety include alkylated
purines and pyrimidines, acylated purines or pyrimidines, or other
well-known heterocyclic substitutes. Nucleic acid monomers can be
linked by phosphodiester bonds or analogs of such linkages. Analogs
of phosphodiester linkages include phosphorothioate,
phosphorodithioate, phosphoroselenoate, phosphorodiselenoate,
phosphoroanilothioate, phosphoranilidate, phosphoramidate, and the
like. The term "nucleic acid molecule" also includes e.g. so-called
"peptide nucleic acids," which comprise naturally-occurring or
modified nucleic acid bases attached to a polyamide backbone.
Nucleic acids can be either single stranded or double stranded.
[0033] The term "complement of a nucleic acid molecule" refers to a
nucleic acid molecule having a complementary nucleotide sequence
and reverse orientation as compared to a reference nucleotide
sequence. For example, the sequence 5' ATGCACGGG 3' is
complementary to 5' CCCGTGCAT 3'.
[0034] An "isolated nucleic acid molecule" is a nucleic acid
molecule that is not integrated in the genomic DNA of an organism.
For example, a DNA molecule that encodes a growth factor that has
been separated from the genomic DNA of a cell is an isolated DNA
molecule. Another example of an isolated nucleic acid molecule is a
chemically-synthesized nucleic acid molecule that is not integrated
in the genome of an organism. A nucleic acid molecule that has been
isolated from a particular species is smaller than the complete DNA
molecule of a chromosome from that species.
[0035] A "nucleic acid molecule construct" is a nucleic acid
molecule, either single- or double-stranded, that has been modified
through human intervention to contain segments of nucleic acid
combined and juxtaposed in an arrangement not existing in
nature.
[0036] "Linear DNA" denotes non-circular DNA molecules having free
5' and 3' ends. Linear DNA can be prepared from closed circular DNA
molecules, such as plasmids, by enzymatic digestion or physical
disruption.
[0037] "Complementary DNA (cDNA)" is a single-stranded DNA molecule
that is formed from an mRNA template by the enzyme reverse
transcriptase. Typically, a primer complementary to portions of
mRNA is employed for the initiation of reverse transcription. Those
skilled in the art also use the term "cDNA" to refer to a
double-stranded DNA molecule consisting of such a single-stranded
DNA molecule and its complementary DNA strand. The term "cDNA" also
refers to a clone of a cDNA molecule synthesized from an RNA
template.
[0038] "Heterologous DNA" refers to a DNA molecule, or a population
of DNA molecules, that does not exist naturally within a given host
cell. DNA molecules heterologous to a particular host cell may
contain DNA derived from the host cell species (i.e., endogenous
DNA) so long as that host DNA is combined with non-host DNA (i.e.,
exogenous DNA). For example, a DNA molecule containing a non-host
DNA segment encoding a polypeptide operably linked to a host DNA
segment comprising a transcription promoter is considered to be a
heterologous DNA molecule. Conversely, a heterologous DNA molecule
can comprise an endogenous gene operably linked with an exogenous
promoter. As another illustration, a DNA molecule comprising a gene
derived from a wild-type cell is considered to be heterologous DNA
if that DNA molecule is introduced into a mutant cell that lacks
the wild-type gene.
[0039] A "polypeptide" is a polymer of amino acid residues
preferably joined exclusively by peptide bonds, whether produced
naturally or synthetically. A polypeptide produced by expression of
a non-host DNA molecule is a "heterologous" peptide or polypeptide.
The term "polypeptide" as used herein covers proteins, peptides and
polypeptides, wherein said proteins, peptides or polypeptides may
or may not have been post-translationally modified.
Post-translational modification may for example be phosphorylation,
methylation and glycosylation.
[0040] The term "expression" refers to the biosynthesis of a gene
or a gene product.
[0041] To "hybridize" means annealing nucleic acid strands from
different sources; that is, to form base pairs between
complementary regions of two strands of DNA that were not
originally paired. The term "hybridization under stringent
conditions" is defined according to Sambrook et al., Molecular
Cloning, A Laboratory Manual, Cold Spring Harbor, Laboratory Press
(1989), 1.101-1.104. Preferably, hybridization under stringent
conditions means that after washing for 1 h with 1 times SSC and
0.1% SDS at 50 degree C., preferably at 55 degree C., more
preferably at 62 degree C. and most preferably at 68 degree C.,
particularly for 1 h in 0.2 times SSC and 0.1% SDS at 50 degree C.,
preferably at 55 degree C., more preferably at 62 degree C. and
most preferably at 68 degree C., a positive hybridization signal is
observed.
[0042] A stretch of "Complete homology" is defined as a match of
pairing nucleotides along the sequence of the interacting
nucleotides; e.g. in natural occurring RNA the pairing of A with U
and G with C.
[0043] A "promoter" is a nucleotide sequence that directs the
transcription of a structural gene. Typically, a promoter is
located in the 5' non-coding region of a gene, proximal to the
transcriptional start site of a structural gene. Sequence elements
within promoters that function in the initiation of transcription
are often characterized by consensus nucleotide sequences. If a
promoter is an inducible promoter, then the rate of transcription
increases in response to an inducing agent. In contrast, the rate
of transcription is not regulated by an inducing agent if the
promoter is a constitutive promoter. Repressible promoters are also
known.
[0044] A "regulatory element" is a nucleotide sequence that
modulates the activity of a promoter. For example, a regulatory
element may contain a nucleotide sequence that binds with cellular
factors enabling transcription exclusively or preferentially in
particular cells, tissues, or organelles. These types of regulatory
elements are normally associated with genes that are expressed in a
"cell-specific," "tissue-specific," or "organelle-specific"
manner.
[0045] An "enhancer" is a type of regulatory element that can
increase the efficiency of transcription, regardless of the
distance or orientation of the enhancer relative to the start site
of transcription.
[0046] A "cloning vector" is a nucleic acid molecule, such as a
plasmid, cosmid, or bacteriophage that has the capability of
replicating autonomously in a host cell. Cloning vectors typically
contain one or a small number of restriction endonuclease
recognition sites that allow insertion of a nucleic acid molecule
in a determinable fashion without loss of an essential biological
function of the vector, as well as nucleotide sequences encoding a
marker gene that is suitable for use in the identification and
selection of cells transformed with the cloning vector. Marker
genes typically include genes that provide tetracycline or
ampicillin resistance.
[0047] An "expression vector" is a nucleic acid molecule encoding a
gene that is expressed in a host cell. Typically, an expression
vector comprises a transcription promoter, a gene, and a
transcription terminator. Gene expression is usually placed under
the control of a promoter, and such a gene is said to be "operably
linked to" the promoter. Similarly, a regulatory element and a core
promoter are operably linked if the regulatory element modulates
the activity of the core promoter. Simpler vectors called
"transcription vectors" are only capable of being transcribed but
not translated: they can be replicated in a target cell but not
expressed, unlike expression vectors. Transcription vectors are
used to amplify their insert.
[0048] A "recombinant host" is a cell that contains a heterologous
nucleic acid molecule, such as a cloning vector or expression
vector.
[0049] Transfection describes the introduction of foreign material
into eukaryotic cells. The term `transfection` for non-viral
methods is most often used in reference to mammalian cells, while
the term `transformation` is preferred to describe non-viral DNA
transfer in bacteria and non-animal eukaryotic cells such as fungi,
algae and plants. Both chemical and physical methods may be
employed to transfect cells.
[0050] A "polypeptide" is a polymer of amino acid residues
preferably joined exclusively by peptide bonds, whether produced
naturally or synthetically. A polypeptide produced by expression of
a non-host DNA molecule is a "heterologous" peptide or polypeptide.
The term "polypeptide" as used herein covers proteins, peptides and
polypeptides, wherein said proteins, peptides or polypeptides may
or may not have been post-translationally modified.
Post-translational modification may for example be phosphorylation,
methylation and glucosylation.
[0051] An "amino acid residue" can be a natural or non-natural
amino acid residue linked peptide bonds or bonds different from
peptide bonds. The amino acid residues can be in D-configuration or
L-configuration. An amino acid residue comprises an amino terminal
part (NH.sub.2) and a carboxy terminal part (COOH) separated by a
central part comprising a carbon atom, or a chain of carbon atoms,
at least one of which comprises at least one side chain or
functional group. NH.sub.2 refers to the amino group present at the
amino terminal end of an amino acid or peptide, and COOH refers to
the carboxy group present at the carboxy terminal end of an amino
acid or peptide. The generic term amino acid comprises both natural
and non-natural amino acids. Natural amino acids of standard
nomenclature as listed in J. Biol. Chem., 243:3552-59 (1969) and
adopted in 37 C.F.R., section 1.822(b)(2) belong to the group of
amino acids listed in the Table herein below. Non-natural amino
acids are those not listed in Table I. Examples of non-natural
amino acids are those listed e.g. in 37 C.F.R. section 1.822(b)(4),
all of which are incorporated herein by reference. Also,
non-natural amino acid residues include, but are not limited to,
modified amino acid residues, L-amino acid residues, and
stereoisomers of D-amino acid residues.
TABLE-US-00001 TABLE I Symbols 1-Letter 3-Letter Amino acid Y Tyr
tyrosine G Gly glycine F Phe phenylalanine M Met methionine A Ala
alanine S Ser serine I Ile isoleucine L Leu leucine T Thr threonine
V Val valine P Pro proline K Lys lysine H His histidine Q Gln
glutamine E Glu glutamic acid W Trp tryptophan R Arg arginine D Asp
aspartic acid N Asn asparagine C Cys cysteine Natural amino acids
and their respective codes.
[0052] An "equivalent amino acid residue" refers to an amino acid
residue capable of replacing another amino acid residue in a
polypeptide without substantially altering the structure and/or
functionality of the polypeptide. Equivalent amino acids thus have
similar properties such as bulkiness of the side-chain, side chain
polarity (polar or non-polar), hydrophobicity (hydrophobic or
hydrophilic), pH (acidic, neutral or basic) and side chain
oraanization of carbon molecules (aromatic/aliphatic). As such,
"equivalent amino acid residues" can be regarded as "conservative
amino acid substitutions".
[0053] The classification of equivalent amino acids refers in one
embodiment to the following classes: 1) HRK, 2) DENQ, 3) C, 4)
STPAG, 5) MILV and 6) FYW
[0054] Within the meaning of the term "equivivalent amino acid
substitution" as applied herein, one amino acid may be substituted
for another, in one embodiment, within the groups of amino acids
indicated herein below: [0055] i) Amino acids having polar side
chains (Asp, Glu, Lys, Arg, His, Asn, Gln, Ser, Thr, Tyr, and Cys,)
[0056] ii) Amino acids having non-polar side chains (Gly, Ala, Val,
Leu, Ile, Phe, Trp, Pro, and Met) [0057] iii) Amino acids having
aliphatic side chains (Gly, Ala Val, Leu, Ile) [0058] iv) Amino
acids having cyclic side chains (Phe, Tyr, Trp, His, Pro) [0059] v)
Amino acids having aromatic side chains (Phe, Tyr, Trp) [0060] vi)
Amino acids having acidic side chains (Asp, Glu) [0061] vii) Amino
acids having basic side chains (Lys, Arg, His) [0062] viii) Amino
acids having amide side chains (Asn, Gln) [0063] ix) Amino acids
having hydroxy side chains (Ser, Thr) [0064] x) Amino acids having
sulphor-containing side chains (Cys, Met), [0065] xi) Neutral,
weakly hydrophobic amino acids (Pro, Ala, Gly, Ser, Thr) [0066]
xii) Hydrophilic, acidic amino acids (Gln, Asn, Glu, Asp), and
[0067] xiii) Hydrophobic amino acids (Leu, Ile, Val)
[0068] The present invention also relates to variants of Hsp70, or
fragments thereof, wherein the substitutions have been designed by
computational analysis that uses sequence homology to predict
whether a substitution affects protein function (e.g. Pauline C. Ng
and Steven Henikoff, Genome Research, Vol. 11, Issue 5, 863-874,
May 2001).
[0069] Due to the imprecision of standard analytical methods,
molecular weights and lengths of polymers are understood to be
approximate values. When such a value is expressed as "about" X or
"approximately" X, the stated value of X will be understood to be
accurate to +/-20%, such as +/-10%, for example +/-5%.
BRIEF DESCRIPTION OF THE DRAWINGS
[0070] FIG. 1: Scheme of major sphingolipid hydrolysis and
associated diseases. Exohydrolytic breakdown of sphingolipids with
short hydrophilic headgroups requires non-enzymatic co-factors,
sphingolipid activator proteins (SAPs or saposins). Inherited
deficiencies of the respective enzyme as well as of the
corresponding activator protein causes lysosomal lipid storage and
results in the expression of various sphingolipidoses. From
Ferlintz et al., Chem. Phys. Lipids, (102) 35-43, 1999. A stippled
circle marks the diseases which are associated with a deficiency in
an enzyme which interact with BMP; diseases not marked with a
stippled circle are thus not associated with BMP-dependent
enzymes.
[0071] FIG. 2: Lysosomal Hsp70 stabilizes lysosomal membranes. (a)
Representative confocal images of U-2-OS cells incubated with 300
nM rHsp70-AF488 (green) for 24 h, fixed and stained for lysosomal
integral membrane protein-1 (LIMP-1; red). For co-localization with
other organelle markers see FIG. 3. (b) U-2-OS cells were incubated
with 300 nM rHsp70-AF488 for 24 h before quantification of
rHsp70-AF488 in membranes (memb.) and supernatant (sup.) obtained
by repeated freeze/thaw cycles and centrifugation the light
membrane fraction (LMF). The immunoblot analyses of
lysosome-associated membrane protein 2 (LAMP-2) and cathepsin B
(Cat B) demonstrate the validity of the fractionation procedure.
(c) Representative still images of U-2-OS cells exposed to
photo-oxidation (acridine orange and blue light). The loss of
lysosomal integrity is visualized by the loss of red and increase
in green staining. (d and e) U-2-OS cells were incubated with
indicated recombinant proteins (300 nM) for 24 h, and analyzed for
lysosomal integrity upon photo-oxidation. When indicated, cells
were treated with indicated siRNAs for 48 h prior to the addition
of recombinant proteins (e). The values represent means.+-.SD
(standard deviation) for three (d) or five (e) independent
experiments. Representative immunoblots of indicated proteins from
U-2-OS cells left untreated or treated with control or Hsp70 siRNAs
are shown on the right. Scale bars: 20 .mu.m (a and c).
[0072] FIG. 3: Colocalization of endocytosed rHsp70-AF488 with
lysosomes. Representative confocal images of U-2-OS cells incubated
with 300 nM rHsp70-AF488 (green) for 24 h, fixed and stained for
the following organelle markers (red): lysosome-associated
membrane-protein-1 (LAMP-1; lysosomes), LAMP-2 (lysosomes),
LBPA/BMP (6C4; endo-lysosomal compartment), cut c (mitochondria),
SERCA (ER) and golgin-97 (Golgi). Scale bars: 20 .mu.m (LAMP-1,
LAMP-2 and BMP) or 10 .mu.m (Cyt c, SERCA and Golgin-97).
[0073] FIG. 4: Hsp70 increases endocytic uptake of other molecules.
Panel A: immortalized mouse embryonic fibroblasts (iMEF), either
wildtype (WT) or transgenic for Hsp70 (TG) where incubated with 20
.mu.g/mL Alexa Fluor-488-labelled BSA (BSA*) for 24 h. Endocytic
uptake was verified by fluorescence microscopy (not shown). Cells
where then harvested and analyzed for uptake of BSA*. As evident
from the figure the Hsp70-transgenic iMEFs had a significantly
higher uptake of BSA* than wildtype iMEFs. Panel B: U2OS
osteosarcoma cells where incubated with 20 .mu.g/mL BSA* for 24 h
either with 3000 nM rHsp70 or without as indicated. Endocytic
uptake was verified by fluorescence microscopy (not shown). Cells
where then harvested and analyzed for uptake of BSA*. As evident
from the figure, the U2OS cells in which BSA* and rHsp70 where
added together had a significantly higher uptake of BSA* than cells
incubated with BSA* alone.
[0074] FIG. 5: Pulse-Chase experiment. rhHSP70 (recombinant human
HSP70) was added to primary fibroblasts from Niemann-Pick Disease
type A patient (patient id: 83/24) at T=0, measurements of
lysosomal cross-sectional area were performed at 24 h, 48 h, 72 h
and 1 week after administration. Upper panel A shows raw data,
lower panel B shows rhHSP70 treated cells normalized to untreated
cells at same timepoint. Conclusion: The effect of rhHSP70 is
reversible and lasts ca. 1 week.
[0075] FIG. 6: Arimoclomol dose-titration experiment. Various
concentrations of Arimoclomol (`Ari`) added for 48 h to primary
fibroblasts from Niemann-Pick Disease type A patient (patient id:
83/24). Read-out: lysosomal cross-sectional area. Conclusion: The
small molecule HSP70-inducer Arimoclomol effectively reverts the
lysosomal primary pathology (accumulation of lysosomes) in a
dose-dependent manner.
[0076] FIG. 7: Test of rhHSP70 in non-sphingolipidosis. rhHSP70
labelled with Alexa Fluor 488 (for visualization of uptake) was
added for 48 h to primary fibroblasts from Niemann-Pick Disease
type C1 patient (Correll Cell Repository ID: GM17918). Read-out:
lysosomal cross-sectional area (Primary cellular pathology),
performed by laser confocal microscopy. Conclusion: rhHSP70
effectively reverts the lysosomal primary pathology in Niemann-Pick
Disease type C1 (i.e. accumulation of lysosomes).
[0077] FIG. 8: Test of rhHSP70 in non-sphingolipidosis. rhHSP70
labelled with Alexa Fluor 488 (for visualization of uptake) was
added for 48 h to primary fibroblasts from Mucopolysaccharidosis
type IIIA (aka Sanfilippo type IIIA) patient (Coriell Cell
Repository ID: GM00879). Read-out: lysosomal cross-sectional area
(Primary cellular pathology), performed by laser confocal
microscopy. Conclusion: rhHSP70 effectively reverts the lysosomal
primary pathology in Mucopolysaccharidosis type IIIA (i.e.
accumulation of lysosomes)
[0078] FIG. 9: Test of rhHSP70 in non-sphingolipidosis. rhHSP70
labelled with Alexa Fluor 488 (for visualization of uptake) was
added for 48 h to primary fibroblasts from Mucopolysaccharidosis
type WA (aka (Morbus) Morquio type WA) patient (Coriell Cell
Repository ID: GM00958). Read-out: lysosomal cross-sectional area
(Primary cellular pathology), performed by laser confocal
microscopy. Conclusion: rhHSP70 effectively reverts the lysosomal
primary pathology in Mucopolysaccharidosis type WA (i.e.
accumulation of lysosomes).
[0079] FIG. 10: Test of rhHSP70 in non-sphingolipidosis. rhHSP70
was added for 48 h to primary fibroblasts from Sandhoff Disease and
Mucopolysaccharidosis type IIIA (aka Sanfilippo type IIIA) patients
(Coriell Cell Repository ID: Sandhoff: GM11098, MPSIIIA: GM00879).
Ctrl=Normal Control fibroblasts. Read-out: Volume of Acidic
Compartment (VAC) (Primary cellular pathology), performed by FACS.
Conclusion: rhHSP70 effectively reverts the lysosomal primary
pathology in Sandhoff Disease and Mucopolysaccharidosis type IIIA
primary patient fibroblasts (i.e. accumulation of lysosomes).
[0080] FIG. 11: rhHSP70 induces autophagy in MCF-7-LC3-EGFP cells.
The addition of 20 .mu.g/mL rhHSP70 to culture medium leads to
translocation and accumulation of LC3-EGFP, a marker for
macroautophagy.
[0081] FIG. 12: Control NPC-/-mice (A) have shallower and more
sporadic growth patterns than HSP70 treated mice (B). Points where
growth curves stop abruptly, indicates mice killed for organs. In
panel A: Series 1 and 3 are female; Series 2 and 5-8 are male. In
panel B: Series 2 and 4-7 are female; Series 1, 3, and 8 are
male.
[0082] FIG. 13: (A) Representative tremor frequency distribution
shows average increase in treated mice, especially in the lower
frequency range. (n=5 for treated & control. Wt n=1). Side
rearing attempts (B) are relatively equal, but control mice do not
manage to complete any successfully (C). The situation is similar
for the centre rearing (D), although control mice manage to
complete 50% of these (E). (n=5, treated, n=4 control).
[0083] FIG. 14: Cholesterol measured after 7 weeks (panel A) and 9
weeks (panel B) in control and treated animals.
[0084] FIG. 15: GSL measured after 7 weeks (panel A) and 9 weeks
(panel B) in control and treated animals.
[0085] FIG. 16: Sphingosine measured after 7 and 9 weeks in control
and treated animals.
[0086] FIG. 17: Arimoclomol induces an increased HSP70 expression
in Niemann-Pick Disease type C patient cells. Panel A: NPC GM18453
patient cells subjected to 60 min HS at 42 degree. Panel B: NPC
GM18453 patient cells--No HS.
[0087] FIG. 18: Iroxanadine induces an increased HSP70 expression
in Niemann-Pick Disease type A patient cells. NPDA Cells (B534
R496L), 40 degree Heat Shock for 60 min. Vertical axis: Heat Shock
Protein 70 induction (A.U.).
[0088] FIG. 19: Arimoclomol induces an increased HSP70 expression
in Fabry disease patient cells. Fabrys Disease patient cells
treated with Arimoclomol. Vertical axis: Heat Shock Protein 70
induction (A.U.).
DETAILED DESCRIPTION OF THE INVENTION
[0089] As is demonstrated by the present inventors, HSP70 is
beneficial in reversing the pathology of lysosomal storage
diseases; including those lysosomal storage diseases which arise
from a defect in an enzyme whose activity is not directly
associated with the presence of lysosomal BMP as a co-factor; such
as glycogen storage diseases, gangliosidoses, neuronal ceroid
lipofuscinoses, cerebrotendinous cholesterosis, Wolman's disease,
cholesteryl ester storage disease, disorders of glycosaminoglycan
metabolism, mucopolysaccharidoses, disorders of glycoprotein
metabolism, mucolipidoses, aspartylglucosaminuria, fucosidosis,
mannosidoses, and sialidosis type II.
Lysosomes
[0090] Since the discovery of lysosomes by de Duve in 1955, the
view of this organelle has been dominated by the dogma that it is
solely the terminus of the endocytic pathway in animal cells--a
compartment housing a vast array of hydrolases, that, if released
into the cytosol, cause necrosis and tissue inflammation. This view
of the lysosomes as, at best, a garbage disposal unit, and at
worst, an unspecific "suicide bag" has changed dramatically due to
recent discoveries that provide evidence for numerous more specific
tasks for lysosomes and their contents.
Lysosoinal Hydrolases
[0091] As the main compartment for intracellular degradation and
subsequent recycling of cellular constituents, the lysosomes
receive both hetero- and autophagic cargo, which in the lumen of
this organelle find their final destination. The degradation is
carried out by a number of acid hydrolases (phosphatases,
nucleases, glycosidases, proteases, peptidases, sulfatases,
lipases, etc.) capable of digesting all major cellular
macromolecules. Among the best-studied lysosomal proteases is the
family of cathepsin proteases. The cathepsins can be divided into
three sub-groups according to their active site amino acid, i.e.
cysteine (B, C, H, F, K, L, O, S, V, W and X/Z), aspartate (D and
E) and serine (G) cathepsins. The cathepsins function optimally at
the acidic pH of the lysosomes (pH 4-5) although they can still
function at the neutral pH outside the lysosomes, albeit having
decreased stability and/or altered specificity.
[0092] Until recently the function of cathepsins was thought to be
limited to intralysosomal protein-turnover, and the degradation of
the extracellular matrix once secreted. However, during the past
few years many of the cathepsins have been accredited with more
specific functions including roles in bone remodeling, antigen
presentation, epidermal homeostasis, prohormone processing,
protection of cytotoxic lymphocytes from self-destruction after
degranulation, maintenance of the central nervous system in mice,
angiogenesis, cancer cell invasion as well as programmed cell death
(PCD).
[0093] Apart from the breakdown of proteins, the lysosomes and late
endosomes are also responsible for the metabolism of cellular
lipids, such as the glycosphingolipids, through a series of
endolysomal enzymes and co-enzymes, whose proper function depend on
the lipid composition of the intra-lysosomal membranes. The
importance of functional endolysosomal lipid metabolism can be
easily appreciated by the fact that clinical disease is apparent in
case of dysfunction at any stage of sphingolipid metabolism, giving
rise to diseases such as Tay-Sachs, Sandhoff, Farber, Fabry,
Gaucher, Krabbe and Niemann-Pick disease.
Trafficking To and From the Lysosomes
[0094] The traffic of endocytic membranes serves an essential role
in the mammalian cell through its delivery of membrane components,
various solute molecules and receptor-associated ligands to a range
of intracellular compartments. Whilst the various endocytic routes
until recently appeared simple, with the main pathways converging
on the lysosomes, where degradation and possible recycling back to
the plasma membrane would take place, recent evidence shows that
these pathways are more complex than first imagined.
The Endocytic Route
[0095] Endocytosis is best understood in terms of the
receptor-mediated endocytosis of molecules via the formation of
clathrin-coated pits, although a variety of non-clathrin mediated
endocytic routes (e.g. macropinocytosis, phagocytosis, uptake via
caveolae-formation and non-clathrin-coated-pit formation) have also
been identified. The nomenclature of the endocytic system has not
been fully standardized, and the commonly used term "early
endosome" actually describes two distinct endosomal
compartments--the sorting endosome and the endocytic recycling
compartment (ERC). In the conventional receptor-mediated endocytic
pathway, receptors such as the transferrin receptor, the low
density lipoprotein receptor and the mannose 6-phosphate receptor
(MPR) concentrate into clathrin-coated pits on the surface of the
plasma membrane by virtue of interactions between sequence motifs
in their cytoplasmic tails and elements in the clathrin coat. After
shedding of its clathrin-coat, the newly formed endosome fuses with
other endosomes and pre-existing sorting endosomes to become a
sorting endosome. As the name implies, its primary task is to sort
newly acquired components to their correct locations. The three
known destinations include the plasma membrane, the late endosomes
and the ERC. As the sorting endosome matures, it experiences a drop
in pH, which facilitates the release of receptor-bound ligands into
the lumen of the endosome. Before the full maturation of the
sorting endosome into the late endosome, however, the molecules
destined to recycling must be sorted out. It is believed that this
process takes place through the pinching off of narrow tubules, a
process, which favors the sorting of membrane proteins from solute
molecules as the surface-area-to-volume ratio of the tubules is
greater than that of the vesicular sorting endosome. The
pinched-off-tubules can either relay the membrane proteins directly
back to the plasma membrane (the direct return pathway) or to the
ERC. The ERC is mainly a collection of tubular organelles, whose
localization varies between cell types. While the ERC is capable of
sorting molecules to several different destinations, most of the
molecules that transit via the ERC return to the plasma
membrane.
[0096] As the sorting endosome matures, its luminal pH steadily
drops, mainly due to the action of the vacuolar-type proton ATPase
(V-ATPase), while shifts in membrane lipid and protein composition
also occur. The membrane traffic from the sorting endosome to the
late endosome and further into the lysosome has been the scene of
some controversy. The dispute concerns whether this transport is
best explained via vesicular transport or by the maturation of the
sorting endosome. Both models provide for an intermediate between
the sorting and the late endosome. While the maturation model
argues that the vesicle, which reaches the late endosome, is what
remains after the removal of components from the former sorting
endosome, the pre-existing compartment model argues that transport
of molecules to the late endosomes occurs via an endocytic carrier
vesicle (ECV), a specific transport vesicle between pre-existing
sorting and late endosomal compartments. Both the sorting and late
endosomal compartments are considered to be structurally more
complex and to have more specialized functions than the carrier
vesicles. Recent live-cell imaging studies have reconciled
mechanistic aspects of both models, however, as vesicles arising
from a dynamic early endosome network can undergo a conversion in
which they loose the small GTPase RAB5 and recruit RAB7, a marker
of late endosomes. Although the organization of the endocytic
pathway is functionally well defined, the nomenclature can be
confusing. Functionally, the endocytic pathway is defined by
housekeeping receptors (e.g. the transferrin receptor) and other
lipids and proteins being cycled through the early endosome/sorting
endosome where receptor-ligand uncoupling occurs - but not through
late endosomes where proteolysis can occur. Beyond these functional
criteria however, the picture becomes cloudier when it comes to
nomenclature, not least so as the generation of intraluminal
vesicles, starting in the early endosomes and becoming more and
more prominent during the maturation to late endosomes, has given
rise to the term "multivesicular bodies" (MVB). This term has been
used interchangeably as another name for the ECVs and late
endosomes as well as for all endocytic vesicles containing
multivesicular regions or elements, including the hybrid organelle
that forms when the lysosomes fuse with the late endosomes (which
contain multivesicular structures). However, late endosomes contain
more luminal membrane vesicles than early endosomes and are thus
often the compartment described by the term "multivesicular
bodies".
[0097] Finally, a substantial amount of confusion in the field has
arisen from the definition, or rather lack thereof, of late
endosomes versus lysosomes. Both compartments are equally acidic
and most, if not all, proteins present in lysosomes are also found
in late endosomes. According to the maturation model, the late
endosomes would be precursors for the lysosomes, but given the
gradual development, as the theory suggests, a stringent
classification could be very difficult to achieve. Recently,
however, evidence has been presented for lysosomes and late
endosomes being separate compartments, which then undergo both
"kissing" events (transient fusions) as well as complete fusion
events, after which the lysosomes can reform from the hybrid
organelle.
The Biosynthetic Route
[0098] Apart from endocytosis, the late endosomes also receive
cargo via the MPR pathway from the trans-golgi network (TGN) (the
biosynthetic route). The cation-dependent MPR and the
cation-independent MPR/Insulin-like growth factor-II (IGF-II)
receptor share the task of delivery of newly synthesized acid
hydrolases from the TGN to the lysosomes. The recognition of acid
hydrolases by MPRs requires the addition of carbohydrates in the
endoplasmic reticulum and the subsequent modification and
phosphorylation of the carbohydrate residues to mannose-6-phosphate
moieties in the cis-Golgi The MPR-bound hydrolases are first
delivered to endosomes, where they dissociate from the receptors
due to the drop in the lumenal pH, hereby allowing the receptors to
recycle back to the TGN. The protein mainly responsible for the
sorting of the MPRs into clathrin-coated pits at the TGN, is an
adaptor protein-1 (AP-1), although the Golgi-localized,
.gamma.-ear-containing ADP ribosylation factor-binding proteins
(GGAs) also play a part. Whether AP-1 and the GGAs work in concert
or in fact target the two MPRs to different subcellular
localizations is presently unknown. AP-1 is part of an adaptor
protein family consisting of four members, all of which are
heterotetrameric proteins utilized extensively in the secretory and
endocytic pathways. In addition to the above-mentioned role of AP-1
in clathrin-coated pits formed in TGN, AP-1 and AP-2 are used in
clathrin-coated pits during endocytosis at the plasma membrane,
while AP-3 and AP-4 function in the trafficking of the
lysosome-associated membrane proteins (LAMPs).
[0099] The Autophagic Route
[0100] Autophagy is the third well-characterized route by which
macromolecules reach the lysosome. Autophagy is an evolutionary
conserved pathway involved in the turnover of long-lived proteins
and organelles. It usually operates at low basal levels, although
it can be induced, for example under conditions of nutrient
starvation. Under these conditions macroautophagy is the major
pathway responsible for delivering material to the lysosomes.
Macroautophagy is characterized by a flat membrane cistern wrapping
around cytoplasmic organelles and/or a portion of cytosol thereby
forming a closed double-membrane bound vacuole, the autophagosome.
The autophagosome finally fuses with lysosomes forming
autophagolysosomes/autolysosomes, where the degradation and
recycling of the engulfed macromolecules occur. The origin of the
autophagosome membrane is still not clarified. The endoplasmic
reticulum, Golgi, a less-well characterized membrane compartment
called the phagophore as well as de novo synthesis have all been
proposed as origins of the autophagosome membrane. Recent progress
through yeast genetics and the subsequent discovery of mammalian
homologues is rapidly enhancing the understanding of the process of
autophagy and will hopefully shed light also on the origin of the
autophagosomal membrane in the near future.
[0101] There are also other routes by which the lysosomes receive
autophagic cargo. A rather indiscriminate process termed
microautophagy is characterized by engulfment of cytosol by the
lysosomes through invaginations of the lysosomal membrane. Besides
the macromolecules, which are present in the engulfed cytosol, this
process may also involve the uptake of organelles such as
peroxisomes. Finally, chaperone-mediated transport of cytosolic
proteins into the lysosomal lumen presents a more direct and
selective form of autophagy. This pathway is dependent on the
presence of the constitutively expressed member of the Heat shock
protein 70 family, Hsc70, on both sides of the lysosomal membrane.
The process is furthermore dependent on the recognition of a KDEL
sequence motif in target proteins by LAMP-2a.
[0102] It has previous been shown by the present inventors that
rhHSP70 binds to BMP and facilitates an increased enzyme activity
for those enzymes that that are dependent on BMP as a cofactor. The
HSP70-BMP interaction was shown to be of importance for reversing
the pathology of LSDs associated with BMP-interacting enzymes (WO
2009/155936).
[0103] The present inventors have now further shown that rhHSP70 is
a potential inducer of autophagy (see FIG. 11). An increased
autophagic flux may be contemplated taffect the lysosomes due to
the fusion of autophagosomes to lysosomes, as the last step in the
autophagic pathway. It may also be contemplated that an induction
of autophagy by HSP70 leads to an increased autophagic clearance of
lysosomes having a pathologic accumulation of substrate due to a
LSD.
Reformation of Lysosomes and Lysosomal Secretion
[0104] After fusion of lysosomes with late endosomes or
autophagosomes, the lysosomes are reformed from the resultant
hybrid organelles through sequestration of membrane proteins and
condensation of the lumenal content. Of the membrane proteins that
need to be removed or recycled from the hybrid organelle, the most
obvious are the MPRs, as they by definition are absent from
lysosomes. The lysosomes, however, cannot be seen as the terminal
point of the endocytic pathways as they are also able to form
secretory lysosomes through fusion with secretory granules, a
process that is Ca.sup.2+-dependent and was first recognised in
secretory cells of haematopoietic origin. However, evidence also
exists for a Ca.sup.2+-regulated membrane-proximal lysosomal
compartment responsible for exocytosis in non-secretory cells. The
process of exocytosis is dependent on the protein Rab27a, a member
of the Rab protein family, which counts more than 60 members. The
Rabs are small GTPases that have key regulatory roles in most
membrane-transport steps including vesicle formation, motility,
docking and fusion. At least 13 Rab proteins are utilised in the
endocytic pathways in order to determine the fate of the various
endocytosed molecules and their vesicles.
Programmed Cell Death
[0105] Regulation of overall cell number as well as the amount of
cells constituting the different tissues along with the need for a
mechanism of eliminating unwanted cells is of fundamental
importance in multicellular organisms. Programmed cell death is the
means to this end, endowing the multicellular organism with the
potential to rid itself of unwanted cells without the leakage of
cellular constituents, thus avoiding the inflammation associated
with necrosis, the conceptual counterpart to programmed cell
death.
Apoptosis
[0106] The word apoptosis is used in Greek to describe the
"dropping off" or "falling off" of petals from flowers, or leaves
from trees and was first coined by Currie and colleagues in 1972 to
describe a common type of programmed cell death, which the authors
had observed in a number of tissues and cell types. The authors had
noticed that the events they observed had significant morphological
similarities, which were distinct from the morphological features
characterizing cells undergoing pathological, necrotic death and
suggested that these common morphological features might be due to
an identical underlying process.
[0107] When cells die by apoptosis, they undergo a series of
transforming events. Amongst these events, and essential for the
characteristic apoptotic phenotype, is the activation of caspases
(cysteine aspartate-specific protease)--a family of cysteine
endopeptidases, which cleave substrates at specific aspartate
residues, hence the name. The activation of the caspases lead to
proteolytic processing of other caspases as well as a host of other
changes in the overall protein activities within the cells,
ultimately producing the characteristic morphological features
associated with the caspase-activation and thus, per definition,
apoptosis. The classical apoptotic features include cell shrinkage
and blebbing of the cytoplasmic membrane, condensation of chromatin
within the nucleus in clear, geometrical shapes, fragmentation of
DNA into .about.200 bp integers, the so-called nucleosomal ladder,
cellular detachment from its neighboring cells and disintegration
of the cell into small, enclosed vesicles termed apoptotic bodies.
In a multicellular environment these apoptotic bodies are
ultimately phagocytosed by macrophages or neighboring cells hereby
completing the removal of the unwanted cell.
Programmed Cell Death
[0108] Programmed cell death (PCD) is not synonymous with apoptosis
although one could be inclined to think so based on the amount of
literature using these terms indiscriminately. The term PCD is
gradually taking over, but the term apoptosis is still used to
describe a cell death program orchestrated by the activation of
caspases, in particular caspase-3. However, the ability of certain
cells to survive the activation of pro-apoptotic caspases as well
as PCD with complete absence of caspase activation and
caspase-activation leading to non-apoptotic PCD, has revealed a
remarkable plasticity of the cellular death programme(s) and PCD
can thus be more accurately defined as cell death dependent on
signals or activities within the dying cell. It has been suggested
that PCD can be subdivided into apoptosis, apoptosis-like and
necrosis-like PCD, according to the nuclear morphology of the dying
cells, each definition coined to distinct morphological
characteristics, the main feature being the shape of chromatin
condensation or the absence hereof, although it would be preferable
to make distinctions of PCD based on the signaling pathways
participating under any given set of conditions leading to PCD.
This way of distinguishing between different modes of PCD is not
yet applicable however, as the threads leading to the varying kinds
of cell death remains to be sorted out.
Necrosis
[0109] Necrosis is the conceptual counterpart to PCD, as it cannot
be prevented by any other means than removing the stimulus giving
rise to the necrosis. This mode of cell death is usually seen
during pathological insults to an organism.
The Molecular Machinery of Programmed Cell Death
Apoptosis
[0110] As mentioned in the previous section, apoptosis is defined
by the activation of members of the family of cysteine
endopeptidases known as the caspases and the morphology associated
with their activation. The caspases reside in cells as inactive
zymogens, which can be rapidly activated by proteolytic processing.
This processing proceeds in a hierarchic cascade in which an
apoptotic stimulus activates an initiator caspase (e.g. caspase-8
and -9), which in turn activates the next level in the hierarchy,
the effector caspases (e.g. caspase-3, -6 and -7). The latter are
considered the executioners of apoptosis as they cleave a number of
substrates, the processing of which ultimately leads to the
phenotype associated with apoptosis. The apoptotic programme can be
activated by a variety of stimuli, which can be broadly divided
into extracellular and intracellular stimuli, the latter seeing the
mitochondrion as an essential player. The extracellular stimuli and
the following response giving rise to apoptosis are also referred
to as the extrinsic signaling pathway and are comprised of a series
of events starting with activation of one of a variety of death
receptors such as Fas/Apo-1/CD95, TNFR or TRAIL. Upon binding of
their appropriate ligand, these receptors recruit death domain
(DD)-containing adaptor molecules, such as TRADD (TNFR1-associated
death domain protein) and FADD (Fas-associating protein with death
domain), through interaction with the DD present in the receptors.
These adaptor molecules then recruit caspase-8 to the receptor
complex, where the caspase is activated, possibly by
proximity-induced autocatalytic processing. In certain cells (the
so-called type I cells) caspase-8 then directly cleaves and
activates procaspase-3, whereas in type II cells, the substratum
for caspase-8 is the cytoplasmic protein Bid. The cleavage of Bid
generates a fragment (truncated Bid (tBid)), which induces the
oligomerisation, translocation and insertion of two pro-apoptotic
Bcl-2 family members, Bax and Bak into the outer mitochondrial
membrane. This insertion mediates the release of the
electron-carrier cytochrome c (CytC) from the mitochondrial
intermembrane space along with a host of other proteins, the most
prominent of which include Apoptosis Inducing Factor (AIF),
Smac/DIABLO which antagonizes the effects of the proteins known as
inhibitors-of-apoptosis (IAP) proteins and endonuclease G, a DNAse.
It should be noted, that although this is the pivotal point in the
theories of caspase activation through mitochondria, no conclusive
evidence has been presented with regard to how the insertion of Bax
and Bak facilitates the release of cytochrome c. Upon release from
the mitochondrion, CytC accumulates in the cytoplasm, where it
binds to the protein Apaf-1 (apoptotic protease-activating
factor-1) resulting in a conformational change, which promote
oligomerisation of Apaf-1. This oligomer then binds procaspase-9
through homotypic interactions between caspase recruitment domains
(CARDS) resulting in the formation of a complex called the
apoptosome. The formation of this complex leads to a greatly
enhanced enzymatic activity of pro-caspase-9, the activity of which
leads to the proteolytic activation of caspase-3.
[0111] Apoptosis can also be triggered by intracellular factors
eliciting mitochondrial outer membrane permeabilisation (MOMP), a
process known as the intrinsic pathway. These factors include
second messengers associated with cellular stress such as
Ca.sup.2+, NO and arachidonic acid as well as bilirubin, bile salts
and stimuli which can give rise to protein denaturation and nuclear
and mitochondrial DNA damage such as ionizing radiation, heat
stress, reactive oxygen species (ROS) and chemotherapeutic agents.
In the event of nuclear DNA damage, this is sensed by a variety of
protein kinases, which depends on the form of DNA damage but also
the noxa eliciting it. The activity of these kinases induce the
accumulation of p53, which can then act as a transcription factor,
giving rise to an enhanced transcription of pro-apoptotic genes
such as Bax, Noxa and PUMA, all of which can induce MOMP. At the
mitochondrial level, p53 induces the expression of mitochondrial
enzymes that locally generate ROS as well as a mitochondrial matrix
protein (p53AIP1), which overexpression triggers loss of
mitochondrial membrane potential and apoptosis.
[0112] The induction of MOMP by p53 or by the action of the
intrinsic stimuli described above is the point at which the
intrinsic and extrinsic pathways converge, the route of the
intrinsic pathway following the one already described for the
extrinsic with release of cytochrome c, formation of the apoptosome
and activation of caspase-3 constituting the final steps towards
the demise of the unwanted cell.
The Alternatives to Apoptosis
[0113] Within the past decade, the exclusive role of caspases as
the executioners of PCD has been challenged and mounting evidence
suggest that there is more to life--and especially death--of a cell
than can be ascribed to the caspases alone.
[0114] As newly developed caspase-specific pharmacological
inhibitors as well as inactivation of caspase-pathways by factors
such as energy depletion, nitrative/oxidative stress and members of
the inhibitor of apoptosis protein (IAP) family did not always stop
the progression towards death, they revealed, or even enhanced, a
subset of underlying caspase-independent death-programs. These
programs include death-receptor initiated pathways as well as
pathways elicited by cancer drugs, growth-factor deprivation,
staurosporine, Bax-related proteins and the depletion of Hsp70. The
morphological features of these caspase-independent death programs
are often reminiscent of the ones observed for classical apoptosis,
and experimental support for a role for other proteases such as
cathepsins, calpains and serine proteases as essential cofactors
either upstream or downstream of caspases was rapidly growing. The
argument is strengthened by the findings that many non-caspase
proteases are able to cleave at least some of the classic caspase
substrates, which might explain some of the similarities observed
between the caspase-dependent and -independent death
programmes.
[0115] Although one can argue the relevance of such death
programmes, as they are masked by the efficacy of the caspases,
evidence is gathering for an evolutionarily conserved role for
lysosomal cathepsin proteases in cell death programs initiated as a
response to various stimuli such as death receptors of the tumor
necrosis factor receptor family, hypoxia, oxidative stress, osmotic
stress, heat and anti-cancer drugs.
Lysosomal Involvement in Programmed Cell Death
[0116] While the role of lysosomes and their hydrolases in the
clean-up phase of PCD, i.e. the engulfment of apoptotic cells and
bodies by neighboring cells or phagocytes, is well established, it
has taken a long time to recognize the importance of lysosomes and
lysosomal hydrolases in the more immediate events of PCD. One of
the reasons for this delay may be the fact that the methyl ketone
peptide inhibitors commonly used to assess the role of caspases in
PCD (e.g. zVAD-fmk, Ac-DEVD-fmk, Boc-D-frnk, etc.) also inhibit
other cysteine proteases, including several cysteine cathepsins.
Even nine years after the recognition of this cross-reaction,
protective effects with these inhibitors at concentrations capable
of inhibiting non-caspase proteases are still often interpreted as
a proof for caspase-mediated death pathways, and the role of other
cysteine proteases in PCD thus continues to be underestimated. The
discovery of lysosomal PCD may have been additionally delayed,
because the lysosomal ultrastructure appears intact in apoptotic
cells analysed by electron microscopy. Thus, the lysosomal rupture
has until recently been considered as an all-or-nothing switch
during late stages of uncontrolled necrotic cell death and tissue
autolysis. However, new techniques allowing a more precise
assessment of the lysosomal membrane integrity have revealed that
lysosomes with normal ultrastructure may have leaked part of their
enzymes, and that partial lysosomal membrane permeabilization (LMP)
not only occurs early in many death paradigms, but can in fact
trigger apoptosis and apoptosis-like PCD.
Lysosomal Membrane Permeabilization (LMP) and Its Consequences
[0117] Studies with various compounds that directly target the
integrity of the lysosomal membranes, such as H.sub.2O.sub.2,
L-leucyl-L-leucine methyl ester, osmotic stress, sphingosine, the
lysosomotropic antibiotics norfloxacin and ciprofloxacin and
photo-oxidative lysosomal damage (photolysis), have convincingly
proven that moderate lysosomal permeabilization can result in PCD.
A quantitative relationship between the amount of lysosomal rupture
and the mode of cell death has been suggested to explain the widely
different morphological outcomes following LMP. According to this
model, low stress intensities trigger a limited release of
lysosomal contents to the cytoplasm followed by apoptosis or
apoptosis-like cell death, while high intensity stresses lead to a
generalized lysosomal rupture and rapid cellular necrosis.
Accordingly, low concentrations of sphingosine, an acid
ceramidase-generated metabolite of ceramide with detergent-like
properties at low pH, induces partial LMP and caspase-mediated
apoptosis, whereas higher concentrations result in massive LMP and
caspase-independent necrotic cell death. In this model, the death
triggered by partial LMP can be inhibited by pharmacological
inhibitors of cysteine and aspartate cathepsins, and the increase
in the cytosolic cathepsin activity precedes the activation of
caspases and mitochondrial membrane potential changes suggesting a
direct role for cytosolic cathepsins in the death process.
Importantly, the role of LMP and cathepsins in cell death is not
limited to the experimental models employing direct lysosomal
disrupters. LMP also participates in the execution of cell death in
response to a wide variety of classic apoptotic stimuli, such as
activation of death receptors of tumour necrosis factor (TNF)
receptor family, interleukin-1, p53 activation, growth factor
starvation, microtubule stabilizing agents, etoposide, sigma-2
receptor activation, synthetic retinoid CD437, B cell receptor
activation, staurosporine, osmotic stress, as well as small
molecules identified in a screen for novel cancer drugs that induce
p53 independent apoptosis.
LMP as a Trigger of the Mitochondrial Apoptosis Pathway
[0118] The cytotoxic effects of LMP often rely, at least partially,
on the activation of the mitochondrial death pathway. An elegant
microinjection study has demonstrated that when localized to the
cytosol, a single lysosomal hydrolase, cathepsin D, is sufficient
to trigger the mitochondrial outer membrane permeabilization and
apoptosis in human fibroblasts at cellular doses corresponding to
half of the total cellular cathepsin D activity. Cathepsin D is,
however, not sufficient to trigger PCD in all cell death models
involving LMP. Other well-documented mediators of LMP-triggered PCD
include cysteine cathepsins B and L as well as reactive oxygen
species. It should, however, be emphasized that the role of other
lysosomal hydrolases, lysosome-derived second messengers and
LMP-induced acidification of cytosol has not been appropriately
ruled out. One of the links between cathepsins and mitochondrial
membrane permeabilization may be Bid, a proapoptotic BH3-only
protein of the Bcl-2 family that can be processed and activated by
several cysteine cathepsins, but not by cathepsin D, at cytosolic
pH. Cathepsin D has, however, been suggested to cleave and activate
Bid in the acidic environment of the endolysosomal compartment
following TNF receptor-1 (TNF-R1) internalization. According to
this model, the endocytosis of the ligand-activated TNF-R1 results
in acid sphingomyelinase-mediated generation of ceramide, which
then binds to the inactive cathepsin D and activates it via
autocatalytic processing. Cathepsin D may also activate Bax in a
Bid-independent manner as demonstrated in staurosporine-treated T
cells. Also in fibroblasts treated with ciprofloxacine, LMP
triggers mitochondrial membrane permeabilization through a
Bid-independent activation of Bax and Bak. In this model system the
Bax activation is independent of cathepsin D, but relies instead on
reactive oxygen species. It should be noted that
ciprofloxacine-induced mitochondrial membrane permeabilization is
not fully inhibited in cells lacking both Bax and Bak. The
alternative mechanisms connecting LMP to the mitochondrial membrane
permeabilization may include the direct effects of reactive oxygen
species and/or lipid mediators such as arachidonic acid that can be
generated in a cathepsin B-dependent manner.
[0119] Studies employing immortalized murine embryonic fibroblasts
(MEFs) from mice deficient for individual cathepsins have clearly
revealed that different cathepsins are engaged in the cell death
execution depending on the stimulus triggering LMP. Immortalized
MEFs from cathepsin B and L deficient mice, but not from cathepsin
D deficient mice, are highly resistant to TNF, whereas the opposite
picture emerges when the cells are treated with staurosporine.
Extensive studies on TNF-induced cell death pathways have further
revealed that the role of individual cathepsins in PCD depends on
the cell type studied. As indicated above, TNF-induced death of
immortalized MEFs depends on cysteine cathepsins, but not cathepsin
D. Yet, cathepsin D depletion effectively protects HeLa cervix
cancer cells against TNF- and cisplatin-induced cytotoxicity. This
difference does not appear to be due to general differences between
human and murine cells, because cathepsin B alone or together with
other cysteine cathepsins is also crucial for the effective
TNF-induced killing in human cervix (ME-180) and breast (MCF-7)
cancer cell lines. The explanation for this diversity is as yet
unknown, but varying expression levels of individual cathepsins and
their inhibitors in different cell lines could play a role.
Accordingly, the varying ability of different death stimuli to
regulate the expression levels of individual cathepsins or their
inhibitors could explain the difference in response to different
stimuli. For example, adriamycin and etoposide are known to enhance
the expression of cathepsin D via the activation of p53.
Alternatively, other signaling pathways induced by various stimuli
may co-operate with specific cathepsins.
Mitochondrion-Independent Death Pathways Induced by LMP
[0120] Importantly, the lethal effects of LMP and cytosolic
cathepsins are not limited to the activation of the intrinsic
apoptosis pathway. In small cell lung cancer cells treated with
microtubule stabilizing drugs (paclitaxel, epothilone B and
discodeimolide), LMP occurs early in the death process and cysteine
cathepsins mediate micronucleation and cell death in a
caspase-independent manner. In TNF-treated human carcinoma cell
lines LMP occurs downstream of mitochondrial outer membrane
permeabilization. However, the inhibition of cysteine cathepsin
activity or expression confers significant protection against
TNF-induced cell death without significantly inhibiting the
effector caspase activation. Furthermore, cathepsin B is
responsible for apoptosis-like changes, such as chromatin
condensation, phosphatidylserine exposure and plasma membrane
blebbing, in the absence of caspase activity in TNF-treated murine
WEHI-S fibrosarcoma cells. Furthermore, the depletion of heat shock
protein 70 (Hsp70) in various human cancer cells as well as
supraoptimal activation of T cells triggers LMP and
cathepsin-mediated apoptosis-like PCD without the activation of the
intrinsic apoptosis pathway. In line with these data, cathepsin B
can induce nuclear apoptosis in isolated nuclei. Thus, cathepsins
appear to carry both the ability to act as initiator- as well as
effector proteases of programmed cell death depending on the
stimulus and the cellular context. Especially their ability to
mediate PCD in cancer cells, where the mitochondrial death pathway
is blocked for example due to overexpression of Bcl-2, raises hopes
that treatments inducing LMP may prove effective in treatment of
cancers that are resistant to inducers of classis apoptosis. This
idea is further supported by data showing that immortalization and
transformation can sensitize cells to the lysosomal cell death.
Signaling to LMP
[0121] As described above, LMP followed by the release of lysosomal
contents, especially cathepsins, to the cytosol is considered to be
the key activation step of the lysosomal death pathway. However,
the signaling pathways leading to LMP are still only beginning to
emerge. One of the best studied mechanisms is the signaling from
the tumor necrosis factor receptor 1 although the clarification of
this signaling pathway to LMP has been greatly complicated by
widely different responses in different target cells.
[0122] In summary, TNF can either induce caspase-dependent or
-independent LMP depending on cellular context. In addition, the
TNF-related ligands FasL, TRAIL and TWEAK have also all been
associated with caspase-independent PCD with either apoptotic or
necrotic morphology. Pharmacological and genetic studies indicate
that the caspase-mediated pathway leading from TNF to LMP is
dependent on caspases -8 and -9, although activation of caspase-9
differs widely between human and murine cells. The link between
caspases and LMP is as yet unknown, and although TNF-induced
caspase-8-mediated cleavage of Bid has been suggested to contribute
to LMP, these findings could not be verified by TNF-induced LMP in
Bid-deficient iMEFs. Bid has furthermore been suggested to be a
target for cathepsins in lysosomal death pathways implicating Bid
downstream, rather than upstream, of the LMP.
[0123] TNF also stimulates sphingomyelin breakdown to
phosphorylcholine and ceramide by activating neutral
sphingomyelinase (SMase) at the plasma membrane and acid or acidic
SMase (aSMase) in the lysosomal compartment. Both events have been
implicated in TNF-induced cell death pathways, but so far only
neutral SMase has been connected to LMP through the factor
associated with neutral SMase (FAN). Studies based on FAN deficient
iMEFs as well as human fibroblasts expressing a dominant negative
form of FAN have shown that FAN does not only mediate TNF-induced
ceramide production, but also contributes to the caspase-8
processing and cell death. Since the TNF-induced LMP in murine
hepatocytes depends on caspase-8, its reduced processing may
explain the reduced LMP in TNF-treated hepatocytes expressing
dominant negative FAN. The role of ceramide and its metabolites
can, however, not be ruled out. Their role in TNF-induced death
signaling is supported by the reduced TNF and Fas-induced
hepatotoxicity in mice deficient for aSMase, which is activated
downstream of caspase-8. Especially sphingosine that is generated
from ceramide in a reaction catalyzed by the lysosomal enzyme acid
ceramidase is a tempting candidate, as it, contrary to ceramide,
can act as a detergent, directly destabilizing the lysosomal
membrane. In addition to increasing the generation of the
sphingosine precursor, ceramide, by activating SMases, TNF
regulates sphingosine levels also by cathepsin B-mediated
downregulation of sphingosine kinase-1, en enzyme that converts the
pro-apoptotic sphingosine to an anti-apoptotic
sphingosine-l-phospate. This activity of cathepsin B could result
in the accumulation of sphingosine in the lysosomes and may thus,
at least partially, explain the requirement of cathepsin B for an
efficient LMP in TNF-treated hepatocytes.
[0124] TNF can also trigger LMP and cell death in the presence of
caspase inhibitors. This pathway is independent of caspase-8, but
requires the death domain-containing receptor interacting protein-1
(RIP-1) and involves the generation of reactive oxygen species.
Oxidative stress can, together with intra-lysosomal iron, generate
oxygen radicals through a Fenton-type chemistry and thereby may
cause oxidation of lysosomal membrane lipids, resulting in the
destabilization of the membrane and the release of the lysosomal
content. The molecular links between RIP-1, oxidative stress and
LMP are, however, still missing.
[0125] The induction of cell death by several classic apoptosis
inducers (e.g. p53, etoposide and staurosporine) also involves LMP
followed by cathepsin-dependent mitochondrial membrane
permeabilization. However, the signaling pathways from these
stimuli to LMP remain to be revealed.
Cellular Defense Mechanisms against LMP
[0126] Given the potential fatal outcome of LMP, it is not
surprising that cells have developed numerous strategies to
counteract it--either by inhibiting the LMP itself or by protecting
cells against the acid hydrolases leaking to the cytosol as a
consequence of LMP.
[0127] Among its many other functions, phosphatidylinositol
3-kinase (PI3K) has been reported to protect lysosomes against
destabilization. Inhibition of PI3K in human vascular endothelial
cells induces the release of cathepsin B to the cytosol arguing for
a rather direct role of PI3K in preserving lysosomal membrane
integrity. Furthermore, PI3K inhibitors sensitize the cells to the
TNF- and interleukin-1-induced lysosomal death pathways. Altered
lysosomal functions and increased expression levels of cathepsins
in cancer cells may pose a threat in form of decreased stability of
lysosomes. Thus, PI3K, which is commonly activated in human cancer
cells, may also contribute to lysosomal stability of tumor cells
and thereby increase their cell death resistance. Whereas the role
of PI3K on the stability of tumor cell lysosomes is purely
speculative, recent data advocate for a role for Hsp70 in the
protection of lysosomes against membrane-disruptive stimuli. This
work has been mainly done in tumor cells, which also often
demonstrate a localization of Hsp70 on the plasma membrane as well
as in the endolysosomal compartment.
[0128] In the event of release of lysosomal proteases to the
cytosol upon LMP, cytosolic protease inhibitors present a bulwark
against its deleterious consequences. Whereas no endogenous
inhibitors of cathepsin D are known, cysteine cathepsins can be
effectively inhibited by at least three cytosolic protease
inhibitors, i.e. cystatin A and B and serine protease inhibitor 2A
(Spi2A) which was recently found to possess potent inhibitor
activity also against several cysteine cathepsins (B, H, K, L and
V) and cathepsin G. The importance of these inhibitors in
preventing PCD in physiological and pathological conditions is
demonstrated by cystatin B-deficient mice which display increased
apoptosis of cerebellar granule cells. Moreover, the expression of
Spi2A is induced upon TNF-treatment via the NF-.kappa.B pathway,
and effectively inhibits TNF-induced cytosolic cathepsin B activity
and cell death in MEFs. Interestingly, it has just been reported
that in C. Elegans, the cytosolic serine protease inhibitor
(serpin)-6 can protect against both the induction as well as the
lethal effects from lysosomal injury caused by hypo-osmotic stress
as well as a variety of other lysosomal stresses, demonstrating
that protection against LMP is an evolutionarily conserved
mechanism.
Lysosomal Storage Diseases
[0129] Lysosomal storage diseases (LSDs) are a group of
approximately 40 rare inherited metabolic disorders that result
from defects in lysosomal function. LSDs are caused by lysosomal
dysfunction usually as a consequence of deficiency of a single
enzyme required for the metabolism of lipids, glycoproteins or
mucopolysaccharides. Although each disorder results from different
gene mutations that translate into a deficiency in enzyme activity,
they all share a common biochemical characteristic--all lysosomal
disorders originate from an abnormal accumulation of substances
inside the lysosome.
[0130] Individually, most LSDs occur with incidences of less than
1:100.000, however, as a group the incidence is about
1:5000-1:10.000. Most of these disorders are autosomal recessively
inherited, however a few are X-linked recessively inherited. The
mucopolysaccharidoses represent a group of diseases with a
prevalence of approx. 1:25.000.
[0131] The lysosomal storage diseases are generally classified by
the nature of the primary stored material involved, and can be
broadly broken into the following: [0132] lipid storage disorders
(or lipidoses) [0133] sphingolipidoses (including Gaucher's and
Niemann-Pick diseases) [0134] gangliosidoses (including Tay-Sachs
disease) [0135] leukodystrophies [0136] mucopolysaccharidoses
(including Hunter syndrome and Hurler disease) [0137] mucolipidoses
[0138] glycoprotein storage disorders (glycoproteinosis) [0139]
mannosidoses [0140] fucosidosis [0141] glycogen storage
diseases
[0142] Depending on the severity of the disease patients either die
at a young and unpredictable age, many within a few months or years
of birth, whereas others survive into early adulthood finally
succumbing to the various pathologies of their particular disorder.
The symptoms of LSD vary, depending on the particular disorder and
can be mild to severe. They can include developmental delay,
movement disorders, seizures, dementia, deafness and/or blindness.
Some people with LSD have enlarged livers (hepatomegaly) and
enlarged spleens (splenomegaly), pulmonary and cardiac problems,
and abnormal bone growth.
[0143] The majority of patients are initially screened by an enzyme
assay, which is the most efficient method to arrive at a definitive
diagnosis. In some families where the disease-causing mutation(s)
is known and in certain genetic isolates, mutation analysis may be
performed. As there may be numerous different mutations, sequencing
of the gene encoding the particular affected enzyme is sometimes
necessary to confirm the diagnosis. Prenatal diagnosis may be
useful when there is a known genetic risk factor.
[0144] The present invention is in one embodiment related to a
method for treating a lysosomal storage disease which arises from a
defect in an enzyme whose activity is not directly associated with
the presence of lysosomal BMP as a co-factor.
[0145] In one embodiment, said lysosomal storage disease is not
selected from the group of Niemann-Pick disease, Farber disease,
Krabbe disease, Sialidosis type I, Metachromatic leukodystrophy,
Gaucher disease, Fabry disease and saposin-deficiency.
[0146] In one embodiment, said lysosomal storage disease is
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
Lysosomal Sphingolipid Hydrolysis
[0147] A multitude of enzymes are involved in the lysosomal
catabolism of sphingolipids (or glycophingolipids) (see FIG. 1).
These enzymes, or more specifically hydrolases, are each
responsible for the degradation of a specific sphingolipid.
[0148] The lysosomal sphingolipid hydrolases interacts with
sphingolipid activator proteins (SAP or saposins) to stimulate the
activity of said hydrolases. SAPs are considered to facilitate the
enzyme/substrate interaction between water-soluble enzymes and
membrane-bound substrates.
[0149] Further, the lipid composition of late endosomal and
lysosomal compartments are characterized by the presence of
negatively charged phospholipids such as BMP and PI
(phosphatidylinositol), which also stimulates the activity of some
hydrolases. The BMP-dependent lysosomal hydrolases include
sialidase, .alpha.-galactosidase A, alucosylceramidase,
.beta.-galactosylceramidase, arylsulfatase A, acid ceramidase and
Sphingomyelinase.
Co-Factor Saposins
[0150] Saposins are small lysosomal proteins that serve as
activators of various lysosomal lipid-degrading enzymes. They
probably act by isolating the lipid substrate from the membrane
surroundings, thus making it more accessible to the soluble
degradative enzymes. All mammalian saposins are synthesized as a
single precursor molecule (prosaposin) which contains four
Saposin-B domains, yielding the active saposins after proteolytic
cleavage, and two Saposin-A domains that are removed in the
activation reaction. The Saposin-B domains also occur in other
proteins, many of them active in the lysis of membranes.
[0151] Prosaposin (PSAP) is a protein which in humans is encoded by
the PSAP gene. This gene encodes a highly conserved glycoprotein
which is a precursor for 4 cleavage products: saposin A, B, C, and
D. Saposin is an acronym for Sphingolipid Activator Protein or SAP.
Each domain of the precursor protein is approximately 80 amino acid
residues long with nearly identical placement of cysteine residues
and glycosylation sites. Saposins A-D localize primarily to the
lysosomal compartment where they facilitate the catabolism of
glycosphingolipids with short oligosaccharide groups. The precursor
protein exists both as a secretory protein and as an integral
membrane protein and has neurotrophic activities. Saposins A-D are
required for the hydrolysis of certain shingolipids by specific
lysosomal hydrolases.
[0152] The saposins are important co-activators of sialidase
(SAP-B), .alpha.-galactosidase A (SAP-B), glucosylceramidase
(SAP-C), .beta.-galactosylceramidase (SAP-C), arylsulfatase A
(SAP-B) and acid ceramidase (SAP-D). Acidic sphingomyelinase
(aSMase) is not critically dependent on any of the known activator
proteins, however the presence of saposins increases the activity
of this enzyme. A fifth saposin; GM2-activator protein has also
been characterised.
BMP
[0153] Bis(monoacylglycero)phosphate (BMP), also known as
Lysobisphosphatidic acid, is a major part of the lipid composition
of late endosomal and lysosomal compartments. It is a negatively
charged phospholipid, more specifically a
glycerol-phospholipid.
[0154] BMP was first isolated from rabbit lung but is now known to
be a common if minor constituent of all animal tissues. Its
stereochemical configuration differs from that of other animal
glycero-phospholipids in that the phosphodiester moiety is linked
to positions sn-1 and sn-1' of glycerol, rather than to position
sn-3. It remains unclear whether positions sn-3 and 3' or sn-2 and
sn-2' in the glycerol moieties are esterified with fatty acids.
Whatever the positions of the fatty acids on the glycerol molecule,
their compositions can be distinctive with 18:1(n-9) and 18:2(n-6),
20:4 and 22:6(n-3) being abundant, although this is highly
dependent on the specific tissue, cell type or organelle. Such
distinctive compositions suggest quite specific functions, some of
which have yet to be revealed.
[0155] BMP is usually a rather minor component of animal tissues.
However, it is highly enriched in the lysosomes of liver and other
tissues, where it can amount to 15% or more of the membrane
phospholipids, and it is now recognized as a marker for this
organelle. It is the late endosomes and the lysosomes that contain
the unique lipid, BMP. Indeed, there appear to be internal
membranes of the late endosomes that contain as much as 70% of the
phospholipids as BMP.
[0156] There is good evidence that BMP is synthesised from
phosphatidylglycerol, primarily in the endosomal system. In what is
believed to be the primary route, a phospholipase A.sub.2 removes
the fatty acid from position sn-2 of phosphatidylglycerol in the
first step. In the second step, the lysophosphatidylglycerol is
acylated on the sn-2' position of the head group glycerol moiety to
yield sn-3:sn-1' lysobisphosphatidic acid, by means of a
transacylase reaction with lysophosphatidylglycerol as both the
acyl donor and acyl acceptor. The third step has still to be
adequately described but must involve removal of the fatty acid
from position sn-1 of the primary glycerol unit and a rearrangement
of the phosphoryl ester from the sn-3 to the sn-1 position. Finally
position sn-2 of the primary glycerol unit is esterified, probably
by a transacylation reaction with another phospholipid as donor
(hence the distinctive fatty acid compositions). Other biosynthetic
routes may be possible.
[0157] The function of BMP in lysosomes is under active
investigation. It may have a structural role in developing the
complex intraluminal membrane system, aided by a tendency not to
form a bilayer. It is a cone-shaped molecule, and it encourages
fusion of membranes at the pH in the endosomes. Further, its unique
stereochemistry means that it is resistant to phospholipases, so it
will hinder or prevent self digestion of the lysosomal membranes.
The fatty acid constituents may turn over rapidly by
transacylation, but the glycerophosphate backbone is stable. A
further possibility is that this lipid may associate with specific
proteins in membrane domains, functionally similar to rafts. It has
been suggested that that the characteristic network of BMP-rich
membranes contained within multivesicular late endosomes regulates
cholesterol transport by acting as a collection and re-distribution
point. For example, when lysosomal membranes are incubated with
antibodies to BMP, cholesterol tends to accumulate. The process is
under the control of Alix/A1P1, which is a protein that interacts
specifically with BMP and is involved in sorting into
multivesicular endosomes.
[0158] BMP is known to greatly stimulate the enzymes involved in
the degradation of glycosylceramides, such as the sphingolipid
activator proteins like the saposins. In this instance, it may
simply function to provide a suitable environment for the
interaction of the glycosphingolipid hydrolases and their
activator. In addition, it has a dynamic role in the provision of
arachidonate for eicosanoid production in alveolar macrophages.
[0159] For BMP-dependent enzymes, the rate of hydrolysis is
increased dramatically when BMP is present in the membrane, for
aSMase even without the presence of an activator protein such as
saposin. In FIG. 1, a stippled circle marks the enzymes, or the
disease in which this enzyme is defect, which show a dependence on
BMP.
[0160] BMP is involved in the pathology of lysosomal storage
diseases such as Niemann-Pick C disease (cholesterol accumulation)
and certain drug-induced lipidoses. In these circumstances, its
composition tends to change to favour molecular species that
contain less of the polyunsaturated components. It is an antigen
recognized by autoimmune sera from patients with a rare and poorly
understood disease known as antiphospholipid syndrome, so it is
probably a factor in the pathological basis of this illness.
The Lipid Storage Disorders
[0161] Lipid storage disorders (or lipidoses) are a subgroup of the
lysosomal storage disorders in which harmful amounts of lipids
accumulate in the intracellular space due to reduced expression or
function of the enzymes needed to metabolize lipids. Over time,
this excessive storage of lipids can cause permanent cellular and
tissue damage, particularly in the brain, peripheral nervous
system, liver, spleen and bone marrow.
[0162] Several lysosomal storage disorders characterized by the
accumulation of lipids (i.e., lipid storage disorders) have been
characterized; including Niemann-Pick disease (NPD), Farber
disease, Krabbe disease, Fabry disease, Gaucher disease, Sialidosis
type I, Metachromatic leukodystrophy and Saposin-deficiency.
[0163] Further lipid storage disorders include: gangliosidoses,
neuronal ceroid lipofuscinosis and other lipid storage disorders,
as outlined herein below.
Gangliosidoses
[0164] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
gangliosidoses.
[0165] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
gangliosidoses selected from the group consisting of Sandhoff
disease (or GM2 gangliosidosis type II), classic infantile Sandhoff
disease, juvenile Sandhoff disease, adult/late onset Sandhoff
disease, Tay-Sachs disease (or GM2 gangliosidosis type I),
infantile Tay-Sachs disease, juvenile Tay-Sachs disease, adult/late
onset Tay-Sachs disease, GM2-gangliosidosis AB variant, GM1
gangliosidosis, early infantile GM1 gangliosidosis, late infantile
GM1 gangliosidosis, adult GM1 gangliosidosis, GM3 gangliosidosis,
and Mucolipidosis IV.
[0166] The above mentioned diseases are grouped together as
gangliosidoses according to the International Classification of
Disease by WHO.
[0167] Gangliosidoses are lipid storage disorders caused by the
accumulation of lipids known as gangliosides. Gangliosides are
molecules composed of a glycosphingolipid (ceramide and
oligosaccharide) with one or more sialic acids (AKA
n-acetylneuraminic acid, NANA) linked on the sugar chain. The 60+
known gangliosides differ mainly in the position and number of NANA
residues. It is a component of the cell plasma membrane that
modulates cell signal transduction events. They are found
predominantly in the nervous system where they constitute 6% of all
phospholipids.
[0168] The GM1 gangliosidoses (also known as NOS gangliosidosis)
are caused by a deficiency of beta-galactosidase, with resulting
abnormal storage of acidic lipid materials in cells of the central
and peripheral nervous systems, but particularly in the nerve
cells. GM1 has three forms: early infantile, late infantile, and
adult.
[0169] The GM2 gangliosidoses are a group of related genetic
disorders that result from a deficiency of the enzyme
beta-hexosaminidase. This enzyme catalyzes the biodegradation of
fatty acid derivatives known as gangliosides. The diseases are
better known by their individual names.
[0170] Beta-hexosaminidase is a vital hydrolytic enzyme, found in
the lysosomes, that breaks down lipids. When beta-hexosaminidase is
no longer functioning properly, the lipids accumulate in the
nervous tissue of the brain. Gangliosides are made and biodegraded
rapidly in early life as the brain develops.
[0171] All three disorders are rare in the general population:
Tay-Sachs disease, AB variant, and Sandhoff disease might easily
have been defined together as a single disease, because the three
disorders are associated with failure of the same metabolic pathway
and have the same outcome. Each represents a distinct molecular
point of failure in a subunit that is required for activation of
the enzyme.
[0172] Tay-Sachs disease (abbreviated TSD, also known as GM2
gangliosidosis type I or Hexosaminidase A deficiency) is a rare,
autosomal recessive metabolic disorder that causes progressive
destruction of nerve cells in the brain and spinal cord. The
disease results from mutations on chromosome 15 in the HEXA gene
encoding the alpha-subunit of the lysosomal enzyme
beta-N-acetylhexosaminidase A.
[0173] Tay-Sachs disease is classified in variant forms, based on
the time of onset of neurological symptoms. The variant forms
reflect diversity in the mutation base: Infantile, juvenile and
adult/late onset TSD.
[0174] Sandhoff disease (also known as Jatzkewitz-Pilz syndrome,
GM2 gangliosidosis type II and Hexosaminidase A and B deficiency)
is a rare, autosomal recessive metabolic disorder that causes
progressive destruction of nerve cells in the brain and spinal
cord. The disease results from mutations on chromosome 5 in the
HEXB gene, critical for the lysosomal enzymes
beta-N-acetylhexosaminidase A and B. Sandhoff Disease is clinically
indistinauishable from Tay-Sachs Disease. There are three subsets
of the disease based on when the patient shows symptoms: classic
infantile, juvenile and adult late onset.
[0175] GM2-gangliosidosis, AB variant is a rare, autosomal
recessive metabolic disorder that causes progressive destruction of
nerve cells in the brain and spinal cord. AB variant is caused by a
failure in the gene that makes an enzyme cofactor for
beta-hexosaminidase, called the GM2 activator.
[0176] GM13 gangliosidosis is a ganglioside biosynthesis disorder
caused by (N-acetylneuraminyl)-galactosylglucosylceramide N-acetyl
transferase deficiency with excessive accumulation of ganglioside
GM3 in the liver and brain tissue and absence of higher ganglioside
homologs.
[0177] Mucolipidosis type IV (ML IV) is an autosomal recessive
lysosomal storage disorder. The disorder is caused by mutations in
the MCOLN1 gene, which encodes a non-selective cation channel,
mucolipinl. Mucolipin1 is thought to be localized in endosomes. An
important property of mucolipinl is that decreasing pH
(acidification) results in deactivation of the protein, likely
through an assembly defect. There are at least 29 known mutations
in MCOLN1, located throughout the gene. Many of the known mutations
result in no expression of mucolipinl, whereas milder mutations
produce a dysfunctioning form of the cation channel Mutations that
alter only the C-terminal of the protein result in a mild phenotype
of the disorder, usually sparing the brain. ML IV causes affected
cells to accumulate auto-fluorescent vacuoles considered to be
aberrant lysosomes.
Neuronal Ceroid Lipofuseinosis
[0178] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
neuronal ceroid lipofuscinosis.
[0179] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
neuronal ceroid lipofuscinosis selected from the group consisting
of Batten disease (or Spielmeyer-Vogt disease), Bielschowsky-Jansky
disease, Kufs disease and Santavuori-Haltia disease.
[0180] The above mentioned diseases are grouped together as
neuronal ceroid lipofuscinosis according to the International
Classification of Disease by WHO.
[0181] Neuronal Ceroid Lipofiiscinoses (NCL) is the general name
for a family of genetically separate neurodegenerative disorders
that result from excessive accumulation of lipopigments
(lipofuscin) in the body's tissues. These lipopigments are made up
of fats and proteins. The older classification of NCL divided the
condition into four types based upon age of onset, while newer
classifications divide it by the associated gene. [0182] Infantile
NCL (Santavuori-Haltia disease, INCL or type 1) has been associated
with palmitoyl-protein thioesterase. [0183] Late Infantile NCL
(Bielschowsky-Jansky or Jansky-Bielschowsky disease, LINCL or type
II) is associated with a deficiency in tripeptidyl peptidase I.
[0184] Juvenile NCL (Batten disease, JNCL or type III, also known
as Spielmeyer-Vogt-Sjogren-Batten disease or Spielmeyer-Vogt
disease) has been linked to mutations in the CLN3 gene. It is the
most prevalent form. [0185] Adult NCL (Kufs disease, ANCL or type
IV)--the implicated gene is not identified.
Other Lipid Storage Disorders
[0186] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a disease selected from the group consisting of cerebrotendinous
cholesterosis, Wolman's disease and cholesteryl ester storage
disease.
[0187] Lysosomal acid lipase is the essential enzyme for hydrolysis
of triglycerides and cholesteryl esters in lysosomes. Its
deficiency produces 2 human phenotypes: Wolman disease and
cholesteryl ester storage disease. Wolman disease is fatal in
infancy, and cholesteryl ester storage disease is a milder foul'
and usually manifests in adulthood.
[0188] The more severe course of Wolman disease is caused by
genetic defects of lysosomal acid lipase that leave no residual
enzyme activity. Wolman disease is also called primary familial
xanthomatosis with involvement and calcification of the adrenal
glands.
[0189] Wolman disease has accumulation of both triglycerides and
cholesteryl esters, while cholesteryl ester storage disease has
mainly elevated cholesteryl esters. Lysosomal acid lipase genotypes
determine the level of residual enzymatic activity, resulting in
the severity of the phenotype.
[0190] Cerebrotendineous xanthomatosis or cerebrotendinous
xanthomatosis (CTX), also called cerebral cholesterosis (or "Van
Bogaert-Scherer-Epstein syndrome) is an autosomal recessive form of
xanthomatosis associated with the deposition of a form of
cholesterol (cholestanol) in the brain and other tissues and with
elevated levels of cholesterol in plasma but with normal total
cholesterol level. CTX is associated with mutations in the CYP27A1
gene (sterol 27-hydroxylase).
Mucopolysaccharidoses
[0191] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
mucopolysaccharidoses.
[0192] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a disease selected from the group consisting of a type I
mucopolysaccharidosis, a type II mucopolysaccharidosis, a type III
mucopolysaccharidosis, a type IV mucopolysaccharidosis, a type VI
mucopolysaccharidosis, a type VII mucopolysaccharidosis, a type
VIII mucopolysaccharidosis, and a type IX
mucopolysaccharidosis.
[0193] It is also an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a disease selected from the group consisting of Hurler syndrome,
Hurler-Scheie syndrome, Scheie syndrome, Hunter's syndrome,
DiFerrante syndrome, Maroteaux-Lamy syndrome (mild or severe),
Morquio syndrome (classic or Morquio-like), and Sanfilippo syndrome
(type A, B, C, or D).
[0194] The above mentioned diseases are grouped together as
mucopolysaccharidoses according to the International Classification
of Disease by WHO.
[0195] Mucopolysaccharides are sulfated polymers composed of a
central protein moiety attached to repeating disaccharide branches
normally degraded into inorganic sulfated monosaccharides in
lysosomes. [0196] Dermatan sulfate consists of alternating units of
L-iduronic acid and N-acetylgalactosamine, usually found in the
matrix of many different connective tissues. [0197] Heparan sulfate
is formed by the joining of a uronic acid (D-glucuronic acid or
L-iduronic acid) alternating with N -acetylglucosamine and is
associated with the cell plasma membrane of almost all cells.
[0198] Keratan sulfate is made of D-galactose residues alternating
with N -acetylglucosamine and is found largely in cartilage,
nucleus pulposus, and cornea. [0199] Chondroitin sulfate is
composed of D-glucuronic acid and N -acetylgalactosamine and is
largely found in cartilage and cornea.
[0200] Mucopolysaccharidoses (MSP) result from abnormal degradation
of glycosaminoglycans such as dermatan sulfate, keratan sulfate,
heparan sulfate, and chondroitin sulfate resulting in organ
accumulation and eventual dysfunction. Glycosaminoglycans or
mucopolysaccharides are normally a component of the cornea,
cartilage, bone, connective tissue, and the reticuloendothelial
system and are therefore target organs for excessive storage.
[0201] The catabolic enzymes involved in the breakdown of
glycosaminoglycans or mucopolysaccharides are deficient. The
stepwise degradation of the glycosaminoglycans requires 4
glycosidases, 5 sulfatases, and 1 nonhydrolytic transferase. The
MPSs share similar clinical features of a chronic and progressive
course, multisystem involvement, organomegaly, dysostosis
multiplex, and abnormal facies. Mode of transmission is autosomal
recessive except for MPS II, which is X-linked. A variety of
mutations are described, and correlation of genotype with disease
severity is beginning to emerge from mutation analysis.
[0202] In general, MPSs are progressive disorders, characterized by
involvement of multiple organs, including brain, liver, spleen,
heart and blood vessels and many are associated with coarse facial
features, clouding of the cornea and mental retardation. Diagnosis
can often be made by examination of urine, which reveals increased
concentration of glycosaminoglycan fragments.
[0203] MPS type I includes Hurler (MPS type I H), Hurler-Scheie
(MPS type I HIS), and Scheie syndromes (MPS type I S).
Alpha-L-iduronidase, which cleaves terminal L-iduronic acid
residues from both dermatan and heparan sulfate, is deficient.
[0204] In MPS type II (Hunter syndrome), Iduronate-2 sulfatase
(known as the Hunter corrective factor), which specifically removes
the sulfate group from the 2 position of L-iduronic acid in
dermatan sulfate and in heparan sulfate, is deficient. Purified
human recombinant idursulfase has been shown to alter disease
manifestations in individuals with Hunter syndrome.
[0205] In MPS type III (Sanfilippo syndrome), deficiencies in
heparan N-sulfatase (type A), alpha. N-acetylglucosaminidase (type
B), acetyl CoA:alpha-glucosaminide acetyltransferase (type C), and
N-acetylglucosamine 6-sulfatase (type D) can occur. All 4 enzymes
are required for the degradation of heparan sulphate.
[0206] MPS type IV (Morquio syndrome) results from defective
degradation of keratan sulfate. Two enzyme deficiencies are
recognized: N -acetylgalactosamine-6-sulfatase (also known as
galactose-6-sulfatase) in type IV A, and beta-galactosidase in type
IV B.
[0207] In MPS type VI (Maroteaux-Lamy syndrome), a deficiency in
arylsulfatase B (i.e., N-acetylgalactosamine 4-sulfatase) occurs.
It hydrolyses the sulfate group in the 4 position of
N-acetylgalactosamine residues of dermatan sulphate.
[0208] MPS type VII (Sly syndrome or beta-glucuronidase deficiency)
is caused by a deficiency in beta-glucuronidase, which removes the
glucuronic acid residues present in dermatan sulfate, heparan
sulfate, and chondroitin sulfates.
[0209] DiFerrante syndrome (mucopolysaccharidosis VIII) is a
disorder described in very few patients.
Glycogen Storage Diseases
[0210] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a glycogen storage disease (GSD).
[0211] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a glycogen storage disease selected from the group consisting of
cardiac glycogenosis, Andersen disease, Cori disease (or Forbes
disease), Hers disease, McArdle disease, Pompe disease, Tauri
disease (or Tarui disease), and von Gierke disease.
[0212] The above mentioned diseases are grouped together as
glycogen storage diseases according to the International
Classification of Disease by WHO
(http://www.who.int/classifications/icd/en/).
[0213] Glycogen storage disease (GSD, also glycogenosis and
dextrinosis) is the result of defects in the processing of glycogen
synthesis or breakdown within muscles, liver, and other cell types.
GSD has two classes of cause: genetic and acquired. Genetic GSD is
caused by any inborn error of metabolism (genetically defective
enzymes) involved in these processes.
[0214] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Cardiac glycogenosis
(cardiomegaly due to excessive glycogen deposition in cardiac
muscle as part of a generalized glycogenosis).
[0215] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Andersen disease
(also known as GSD type IV; enzyme deficiency: glycogen branching
enzyme).
[0216] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Cori disease or
Forbes disease (also known as GSD type III; enzyme deficiency:
glucogen debrancher).
[0217] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Hers disease (also
known as GSD type VI; enzyme deficiency: liver glycogen
phosphorylase).
[0218] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of McArdle disease (also
known as GSD type V; enzyme deficiency: muscle glycogen
phosphorylase).
[0219] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Pompe disease (also
known as GSD type II; enzyme deficiency: acid
alpha-glucosidase/acid maltase).
[0220] Pompe disease is also known as infantile acid maltase
disease; a variant of GSD type II. Another variant of GSD type II
is `slowly progressive acid maltase disease` or Danon disease.
[0221] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Tauri disease or
Tarui disease (also known as GSD type VII; enzyme deficiency:
muscle phosphofructokinase).
[0222] In one embodiment there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of von Gierke disease
(also known as GSD type I; enzyme deficiency:
glucose-6-phosphatase).
Defects in Post-Translational Modification of Lysosomal Enzymes
[0223] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a disease selected from the group consisting of mucolipidosis II
(I-cell disease) and mucolipidosis III (pseudo-Hurler
polydystrophy).
[0224] Both I-cell disease (mucolipidosis II) and the pseudo-Hurler
polydystrophy (mucolipidosis III) result from abnormalities in
lysosomal enzyme transport in which the newly synthesized lysosomal
enzymes are secreted into the extracellular medium instead of being
targeted correctly to lysosomes.
[0225] The defective enzyme is UDP-N-acetylglucosamine lysosomal
enzyme N-acetylglucosamine 1-phosphotransferase. This enzyme
catalyzes the first step in the synthesis of the mannose
6-phosphate recognition marker, which mediates lysosomal enzymes to
reach their target lysosome after being processed in the Golgi
complex. Its mode of transmission is autosomal recessive.
Defects in Glycoprotein Degradation--Glycoprotein Storage
Disorders
[0226] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a disease selected from the group consisting of
aspartylglucosaminuria, fucosidosis, mannosidosis,
alpha-mannosidosis, alpha-mannosidosis type I, alpha-mannosidosis
type II, beta-mannosidosis, and sialidosis type II (mucolipidosis
I).
[0227] In one embodiment, there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of mannosidoses, such as
alpha-mannosidosis and/or beta-mannosidosis.
[0228] Lysosomal alpha-mannosidase is a major exoglycosidase in the
glycoprotein degradation pathway. A deficiency of this enzyme
causes the lysosomal storage disease alpha-mannosidosis. Lysosomal
alpha-D-mannosidase is involved in the catabolism of N-linked
glycoproteins through the sequential degradation of high-mannose,
hybrid, and complex oligosaccharides.
[0229] Alpha-mannosidosis can be divided into the infantile
phenotype (or type I) and the juvenile-adult phenotype (or type II)
according to its clinical manifestations.
[0230] Beta-mannosidosis is an autosomal recessive lysosomal
storage disease resulting from a deficiency of the lysosomal enzyme
beta-mannosidase. The clinical manifestations of this disease in
reported human cases are heterogeneous, ranging from relatively
mild to moderately severe. The enzyme cleaves the beta-mannoside
linkage of the disaccharide Man-beta 1,4-GlcNAc. Genetic deficiency
of this enzyme activity results in pathologic manifestation of the
lysosomal storage disease beta-mannosidosis, which is characterized
by accumulation and excretion of undegraded storage products
containing beta-1,4 linkages.
[0231] In one embodiment, there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of
aspartylglucosaminuria.
[0232] Aspartylglucosaminuria (AGU), also called
aspartylglycosaminuria, is a rare, autosomal recessive lysosomal
storage disorder caused by deficient activity of the enzyme
N-aspartyl-beta-glucosaminidase (aspartylglucosaminidase). This
enzyme normally cleaves long sugar chains known as oligosaccharides
in the lysosome.
[0233] In one embodiment, there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of fucosidosis.
[0234] Fucosidosis, also called alpha-1-fucosidase deficiency, is a
rare autosomal recessive lysosomal storage disease in which the
enzyme fucosidase is not properly used in the cells to break down
fucose. This enzyme normally cleaves long sugar chains known as
oligosaccharides in the lysosome
[0235] In one embodiment, there is provided a bioactive agent
capable of increasing the intracellular concentration and/or
activity of Hsp70 for use in the treatment of Sialidosis type II or
mucolipidosis I (also known as Neuraminidase deficiency).
[0236] In one embodiment, Sialidosis type I is not a target of the
present invention.
[0237] It is understood, that sialidosis type II in the context of
the present invention is meant to refer to the variant or disease
associated with an enzyme that is not directly dependent on BMP as
a co-factor--more correctly denoted mucolipidosis I (or
neuraminidase deficieny).
[0238] Mucolipidosis type I (ML I) is a rare inherited lysosomal
storage disease that has clinical and histologic findings similar
to the mucopolysaccharidoses and the sphingolipidoses. Initially
classified as a lipomucopolysaccharidosis, this disease was later
classified into the group of similar diseases now known as the
mucolipidoses. Patients with ML I were subsequently found to have
an isolated deficiency of alpha-N -acetyl neuraminidase
(neuraminidase or sialidase) in leukocytes and cultured fibroblasts
and, thus, have increased amounts of sialyloligosaccharide in the
urine. Because of the neuraminidase deficiency, ML I is now
categorized with the sialidoses, a group of biochemically distinct
disease entities due to an isolated neuraminidase deficiency. Two
major clinical phenotypes of ML I are recognized.
Various Types of Defects
[0239] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a lysosomal storage disease selected from the group consisting of a
disease which involves an enzyme defect, a defect in the
posttranslational modification of enzymes, a defect in a non-enzyme
protein, a defect in a membrane transport protein, a defect in an
enzyme protecting protein, a defect in a transmembrane protein,
and/or a defect in a non-transmembrane protein.
Current Treatment Modalities for LSD
[0240] There are no cures for the lysosomal storage diseases and
treatment is mostly symptomatic, although bone marrow
transplantation and enzyme replacement therapy (ERT) have been
tried with some success. In addition, umbilical cord blood
transplantation is being performed at specialized centers for a
number of these diseases. Transplantation therapy is however
accompanied by major side effects and often poses complications to
the patients. In addition, substrate reduction therapy, a method
used to decrease the accumulation of storage material, is currently
being evaluated for some of these diseases.
[0241] For most of the lysosomal storage diseases, a major unmet
need for providing an effective treatment modality remains.
[0242] Enzyme replacement therapy has been developed for a subset
of the lysosomal storage diseases, and Cerezyme.RTM. has been on
the market for a number of years for the treatment of Gaucher
disease. The defective enzyme, glucocerebrosidase, is made by
recombinant techniques, and given by intravenous infusion over a
few hours. Treatment is not a cure and patients require lifelong
treatment to halt disease progression. Some symptoms may improve by
ERT.
[0243] However, for most LSDs, an efficient ERT has not been
developed. This may be because the production of active enzyme has
proven a difficult task, due to the complex sub-unit structure of
the defective enzymes. Indeed, enzymes may fold incorrectly upon
production.
[0244] For those LSDs in which ERT is available, there are
drawbacks which make this form of therapy less desirable. First and
foremost, ERT is a very expensive form of therapy, which is a
financial burden to the society and makes it inaccessible to some
patients. Also, ERT is targeted specifically at one disease only.
Some side effects has been reported for Cerezyme.RTM., including
the development of an immune response, nausea, vomiting, abdominal
pain, diarrhea, rash, fatigue, headache, fever, dizziness, chills,
backache, and rapid heart rate as well as symptoms suggestive of
allergic reactions.
[0245] The disclosures made in the present invention thus provide a
new and innovative method for treatment of the lysosomal storage
diseases. This is particularly relevant for these diseases for
which no effective therapy has been developed, those that may
benefit from a less expensive treatment, and those that may benefit
from a combination therapy comprising the bioactive agent of the
present invention.
[0246] As disclosed herein, the method according to the present
invention provides for a treatment modality which is substantially
cheaper to produce than ERT and which targets more than one
specific lysosomal storage disorder.
The Molecular Chaperones
[0247] Having spent vast amounts of enemy upon first transcribing
and then translating the genetic code of DNA, the cell has finally
produced a polypeptide, whose function presumably is required at
this point in the cell's life. However, some final obstacles has to
be overcome in order to achieve a fully functional protein--one of
these being correct folding of this nascent polypeptide chain. The
evolutionary imperatives of achieving correct folding are
obvious--not only would it be a terrible waste of energy to have
synthesized a peptide without the proper conformation and hence
function, but also the aggregation of such proteins in the cellular
lumen could prove detrimental to the cell. This aggregation is in
fact a very likely outcome, considering the intracellular
environment of high protein concentration, so it comes as no
surprise that a complicated and sophisticated machinery of proteins
exists to assist protein folding, allowing the functional state of
proteins to be maintained under such conditions. These proteins are
collectively called molecular chaperones, because, like their human
counterparts, they prevent unwanted interactions between their
immature clients.
[0248] The molecular chaperones are found in all compartments of a
cell where confolinational rearranaements of proteins occur, and
although protein synthesis is the major source of unfolded peptides
in the cell, a challenge to the cell by high temperature or other
stimuli that might render proteins structurally labile, and hence
prone to unfolding and aggregation, is met with a specific cellular
response involving the production of protective proteins. This
response is a phenomenon observed in every cell type ranging from
prokaryotes to eukaryotes and is referred to as the heat-shock- or
stress-response. The proteins induced by this response are known as
the heat shock proteins (HSPs), of which there exist several
families. These families are composed of both sequentially,
structurally and functionally related proteins, whereas chaperones
from different families can differ markedly both in structure as
well as cellular function. A primary example of a family of
chaperones are the Hsp70 proteins, which constitute the central
part of an ubiquitous chaperone system present in most compartments
of eukaryotic cells, in eubacteria, and in many archae. This family
has recently been implicated in other aspects of cellular
homeostasis besides serving as a chaperone--most markedly through
its anti-apoptotic features, its functions in immunity, and the
apparent dependence of cancer cells on the upregulation of
Hsp70.
[0249] The Heat Shock Protein 70 Family
[0250] Hsp70 proteins are involved in a wide range of cellular
processes including protein folding and degradation of unstable
cellular proteins as well as serving other cytoprotective roles.
The common function of Hsp70 in these processes appears to be the
binding of short hydrophobic segments in partially folded
polypeptides, thereby facilitating proper folding and preventing
aggregation. In eukaryotes, Hsp70 chaperones interact in vivo with
different classes of proteins that serve to regulate critical steps
of their functional cycle; amongst these the J-domain family
protein Hsp40. Furthermore, additional partner proteins have been
identified, some of which are linking Hsp70 to other chaperone
systems such as the Hsp90 system.
Members of the Human Hsp70 Family
[0251] Some of the important functions attributed to the molecular
chaperones include import of proteins into cellular compartments,
folding of proteins in the cytosol, endoplasmic reticulum and
mitochondria, prevention of protein aggregation and refolding of
misfolded proteins. At present the human Hsp70 family includes 10
members encoded by different genes, and this section is meant to
provide an overview of these family members with respect to
function, expression patterns and homology/sequence identity. Some
confusion exists about the nomenclature of the different human
Hsp70 family members, although a set of general guidelines has been
set forth by Tavaria et al., which provides a logical link between
locus names, genes and proteins. However, as there still exist some
interspecies confusion, the Hsp70 genes and proteins are referred
to herein by their locus name. The name Hsp70 may refer to the two
inducible Hsp70 family members with loci names HSPA1A and HSPA1B or
to the whole Hsp70 family in general as evident from the consensus
of the text. However, as used throughout the present invention,
Hsp70 is meant to denote any of the two inducible Hsp70 family
members with loci names HSPA1A and HSPA1B.
HspA1A and HspA1B
[0252] The genes transcribed from the loci HSPA1A and HSPA1B are
the two heatlstress-inducible Hsp70-genes and the majority of the
literature concerning human Hsp70 refers to the proteins encoded by
these two genes. The genes give rise to proteins consisting of 641
amino acids, having 99% identity to each other and were the first
human Hsp70 family members to be cloned and characterized. The
genes are linked in the MHC-class III complex at 6p21.3, are
intron-less and with promoter regions containing HSEs, enabling
them to bind HSFs and induce transcription in response to a variety
of cellular assaults.
[0253] The protein sequence for Homo sapiens heat shock 70 kDa
protein 1A (HSPA1A) is (SEQ ID NO:1) (Accession no.
NM_005345.5):
TABLE-US-00002 MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
IGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDK
PKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYF
NDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL
GGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHK
KDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL
QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLS
LGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT
KDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANK
ITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
[0254] The nucleic acid (DNA) sequence for Homo sapiens heat shock
70 kDa protein 1A (HSPA1A) is (SEQ ID NO:2) (Accession no.
NM_005345.5):
TABLE-US-00003 1 ataaaagccc aggggcaagc ggtccggata acggctagcc
tgaggagctg ctgcgacagt 61 ccactacctt tttcgagagt gactcccgtt
gtcccaaggc ttcccagagc gaacctgtgc 121 ggctgcaggc accggcgcgt
cgagtttccg gcgtccggaa ggaccgagct cttctcgcgg 181 atccagtgtt
ccgtttccag cccccaatct cagagcggag ccgacagaga gcagggaacc 241
ggcatggcca aagccgcggc gatcggcatc gacctgggca ccacctactc ctgcgtgggg
301 gtgttccaac acggcaaggt ggagatcatc gccaacgacc agggcaaccg
caccaccccc 361 agctacgtgg ccttcacgga caccgagcgg ctcatcgggg
atgcggccaa gaaccaggtg 421 gcgctgaacc cgcagaacac cgtgtttgac
gcgaagcggc tgattggccg caagttcggc 481 gacccggtgg tgcagtcgga
catgaagcac tggcctttcc aggtgatcaa cgacggagac 541 aagcccaagg
tgcaggtgag ctacaagggg gagaccaagg cattctaccc cgaggagatc 601
tcgtccatgg tgctgaccaa gatgaaggag atcgccgagg cgtacctggg ctacccggtg
661 accaacgcgg tgatcaccgt gccggcctac ttcaacgact cgcagcgcca
ggccaccaag 721 gatgcgggtg tgatcgcggg gctcaacgtg ctgcggatca
tcaacgagcc cacggccgcc 781 gccatcgcct acggcctgga cagaacgggc
aagggggagc gcaacgtgct catctttgac 841 ctgggcgggg gcaccttcga
cgtgtccatc ctgacgatcg acgacggcat cttcgaggtg 901 aaggccacgg
ccggggacac ccacctgggt ggggaggact ttgacaacag gctggtgaac 961
cacttcgtgg aggagttcaa gagaaaacac aagaaggaca tcagccagaa caagcgagcc
1021 gtgaggcggc tgcgcaccgc ctgcgagagg gccaagagga ccctgtcgtc
cagcacccag 1081 gccagcctgg agatcgactc cctgtttgag ggcatcgact
tctacacgtc catcaccagg 1141 gcgaggttcg aggagctgtg ctccgacctg
ttccgaagca ccctggagcc cgtggagaag 1201 gctctgcgcg acgccaagct
ggacaaggcc cagattcacg acctggtcct ggtcgggggc 1261 tccacccgca
tccccaaggt gcagaagctg ctgcaggact tcttcaacgg gcgcgacctg 1321
aacaagagca tcaaccccga cgaggctgtg gcctacgggg cggcggtgca ggcggccatc
1381 ctgatggggg acaagtccga gaacgtgcag gacctgctgc tgctggacgt
ggctcccctg 1441 tcgctggggc tggagacggc cggaggcgtg atgactgccc
tgatcaagcg caactccacc 1501 atccccacca agcagacgca gatcttcacc
acctactccg acaaccaacc cggggtgctg 1561 atccaggtgt acgagggcga
gagggccatg acgaaagaca acaatctgtt ggggcgcttc 1621 gagctgagcg
gcatccctcc ggcccccagg ggcgtgcccc agatcgaggt gaccttcgac 1681
atcgatgcca acggcatcct gaacgtcacg gccacggaca agagcaccgg caaggccaac
1741 aagatcacca tcaccaacga caagggccgc ctgagcaagg aggagatcga
gcgcatggtg 1801 caggaggcgg agaagtacaa agcggaggac gaggtgcagc
gcgagagggt gtcagccaag 1861 aacgccctgg agtcctacgc cttcaacatg
aagagcgccg tggaggatga ggggctcaag 1921 ggcaagatca gcgaggcgga
caagaagaag gtgctggaca agtgtcaaga ggtcatctcg 1981 tggctggacg
ccaacacctt ggccgagaag gacgagtttg agcacaagag gaaggagctg 2041
gagcaggtgt gtaaccccat catcagcgga ctgtaccagg gtgccggtgg tcccgggcct
2101 gggggcttcg gggctcaggg tcccaaggga gggtctgggt caggccccac
cattgaggag 2161 gtagattagg ggcctttcca agattgctgt ttttgttttg
gagcttcaag actttgcatt 2221 tcctagtatt tctgtttgtc agttctcaat
ttcctgtgtt tgcaatgttg aaattttttg 2281 gtgaagtact gaacttgctt
tttttccggt ttctacatgc agagatgaat ttatactgcc 2341 atcttacgac
tatttcttct ttttaataca cttaactcag gccatttttt aagttggtta 2401
cttcaaagta aataaacttt aaaattcaaa aaaaaaaaaa aaaaa
[0255] The protein sequence for Homo sapiens heat shock 70 kDa
protein 1B (HSPA1B) is (SEQ ID NO:3) (Accession no: NM_005346):
TABLE-US-00004 MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
IGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDK
PKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYF
NDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL
GGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHK
KDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL
QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLS
LGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT
KDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANK
ITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
[0256] The nucleic acid (DNA) sequence for Homo sapiens heat shock
70 kDa protein 1B (HSPA1B) is (SEQ ID NO:4) (Accession no:
NM_005346):
TABLE-US-00005 1 ggaaaacggc cagcctgagg agctgctgcg agggtccgct
tcgtctttcg agagtgactc 61 ccgcggtccc aaggctttcc agagcgaacc
tgtgcggctg caggcaccgg cgtgttgagt 121 ttccggcgtt ccgaaggact
gagctcttgt cgcggatccc gtccgccgtt tccagccccc 181 agtctcagag
cggagcccac agagcagggc accggcatgg ccaaagccgc ggcgatcggc 241
atcgacctgg gcaccaccta ctcctgcgta ggggtgttcc aacacggcaa ggtggagatc
301 atcgccaacg accagggcaa ccgcaccacc cccagctacg tggccttcac
ggacaccgag 361 cggctcatcg gggatgcggc caagaaccag gtggcgctga
acccgcagaa caccgtgttt 421 gacgcgaagc ggctgatcgg ccgcaagttc
ggcgacccgg tggtgcagtc ggacatgaag 481 cactggcctt tccaggtgat
caacgacgga gacaagccca aggtgcaggt gagctacaag 541 ggggagacca
aggcattcta ccccgaggag atctcgtcca tggtgctgac caagatgaag 601
gagatcgccg aggcgtacct gggctacccg gtgaccaacg cggtgatcac cgtgccggcc
661 tacttcaacg actcgcagcg ccaggccacc aaggatgcgg gtgtgatcgc
ggggctcaac 721 gtgctgcgga tcatcaacga gcccacggcc gccgccatcg
cctacggcct ggacagaacg 781 ggcaaggggg agcgcaacgt gctcatcttt
gacctgggcg ggggcacctt cgacgtgtcc 841 atcctgacga tcgacgacgg
catcttcgag gtgaaggcca cggccgggga cacccacctg 901 ggtggggagg
actttgacaa caggctggtg aaccacttcg tggaggagtt caagagaaaa 961
cacaagaagg acatcagcca gaacaagcga gccgtgaggc ggctgcgcac cgcctgcgag
1021 agggccaaga ggaccctgtc gtccagcacc caggccagcc tggagatcga
ctccctgttt 1081 gagggcatcg acttctacac gtccatcacc agggcgaggt
tcgaggagct gtgctccgac 1141 ctgttccgaa gcaccctgga gcccgtggag
aaggctctgc gcgacgccaa gctggacaag 1201 gcccagattc acgacctggt
cctggtcggg ggctccaccc gcatccccaa ggtgcagaag 1261 ctgctgcagg
acttcttcaa cgggcgcgac ctgaacaaga gcatcaaccc cgacgaggct 1321
gtggcctacg gggcggcggt gcaggcggcc atcctgatgg gggacaagtc cgagaacgtg
1381 caggacctgc tgctgctgga cgtggctccc ctgtcgctgg ggctggagac
ggccggaggc 1441 gtgatgactg ccctgatcaa gcgcaactcc accatcccca
ccaagcagac gcagatcttc 1501 accacctact ccgacaacca acccggggtg
ctgatccagg tgtacgaggg cgagagggcc 1561 atgacgaaag acaacaatct
gttggggcgc ttcgagctga gcggcatccc tccggccccc 1621 aggggcgtgc
cccagatcga ggtgaccttc gacatcgatg ccaacggcat cctgaacgtc 1681
acggccacgg acaagagcac cggcaaggcc aacaagatca ccatcaccaa cgacaagggc
1741 cgcctgagca aggaggagat cgagcgcatg gtgcaggagg cggagaagta
caaagcggag 1801 gacgaggtgc agcgcgagag ggtgtcagcc aagaacgccc
tggagtccta cgccttcaac 1861 atgaagagcg ccgtggagga tgaggggctc
aagggcaaga tcagcgaggc ggacaagaag 1921 aaggttctgg acaagtgtca
agaggtcatc tcgtggctgg acgccaacac cttggccgag 1981 aaggacgagt
ttgagcacaa gaggaaggag ctggagcagg tgtgtaaccc catcatcagc 2041
ggactgtacc agggtgccgg tggtcccggg cctggcggct tcggggctca gggtcccaag
2101 ggagggtctg ggtcaggccc taccattgag gaggtggatt aggggccttt
gttctttagt 2161 atgtttgtct ttgaggtgga ctgttgggac tcaaggactt
tgctgctgtt ttcctatgtc 2221 atttctgctt cagctctttg ctgcttcact
tctttgtaaa gttgtaacct gatggtaatt 2281 agctggcttc attatttttg
tagtacaacc gatatgttca ttagaattct ttgcatttaa 2341 tgttgatact
gtaagggtgt ttcgttccct ttaaatgaat caacactgcc accttctgta 2401
cgagtttgtt tgtttttttt tttttttttt ttttttgctt ggcgaaaaca ctacaaaggc
2461 tgggaatgta tgtttttata atttgtttat ttaaatatga aaaataaaat
gttaaacttt 2521 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a
HspA1L and HspA2
[0257] Two Hsp70 family members have been termed "chauvinist genes"
because male germ cells favor their expression with strong
prejudice. The hspAIL gene is a constitutively expressed
intron-less Hsp70 family member located 4 kb telomeric to the
HSPA1A locus in the same MHC-class III complex on chromosome 6. It
is expressed in low amounts both before and after heat shock but
with the expression pattern favoring the testes in mouse, rat and
humans with the 641 amino acids (aa) protein being 90% identical to
HspA1A. The hspA2 gene was first isolated from a mouse genomic
library and has later been shown to be constitutively expressed
albeit in low levels in various tissues in the human body including
skeletal muscle, ovary, small intestine, colon, brain, placenta and
the kidneys, but highly expressed in testis. Its expression, or
rather lack thereof, has been connected with abnormal human
spermatogenesis and male hspA2.sup.(-/-) mice are sterile. The gene
is located on chromosome 14, giving rise to a 639 aa protein with
84% identity to HspA1A, although the exact location is subject to
discussion as two papers have presented different loci
positions--14q24.1 vs. 14q22.
HspA6 and HspA 7
[0258] The hspA6 and hspA7 genes are heat inducible members of the
Hsp70 family with no apparent counterparts in mice. They contain
HSEs in their promoter-sites and the genes are intron-less. They
are co-localized on chromosome 1 and are 94% identical to each
other in the nucleotide sequence. However, only HspA6 is functional
as the hspA7 gene harbors a single nucleotide insertion generating
a premature stop codon at +1324. The HspA6 protein is 643 aa long
and displays 77% identity to HspA1A and HspA1B.
HspA5 and HspA9
[0259] The hspA5 and hspA9 genes are the two compartment-specific
members of the Hsp70 family. The 655 aa HspA5 protein is located in
the endoplasmic reticulum (ER) and facilitates folding and
transport of newly synthesized proteins in this compartment. The
protein is 64% identical to HspA1A, the gene being located at 9q34.
The 679 aa HspA9 protein is located in the mitochondria where it
assists in folding of proteins after their transport across the
mitochondrial membrane. HspA9 is located at 5q31.1, the protein
being 52% identical to HspA1A.
HspA8
[0260] The cognate Hsp70 member known as Hsc70 is encoded by a gene
named hspA8 at 11q24, giving rise to a 646 aa protein with 86%
identity to HspA1A, and is constitutively expressed in all tissues
and cell lines. The protein is analogous to Hsp70 in its cellular
functions, providing the required chaperoning under normal
circumstances, but has also been ascribed a role in the un-coating
of clathrin-coated vesicles as well as in chaperone-mediated
autophagy.
HspA3 and HspA4
[0261] These will not be discussed here, as there is doubt as to
whether HSPA3 exists at all and since HSPA4 is most likely a member
of the Hsp110 family and nothing is known about it so far, except
for its chromosomal location at 5q31.1-2.
TABLE-US-00006 TABLE II List of the Human Hsp70 Gene Family.
Sequence Name Used identity herein, (%)to Locus Gene/Protein
Position HSPA1A Alternative Names HSPA1A hspA1A/HspA1A 6p23.1 100
Hsp70; Hsp72; (Hsp70) Hsp70-1 HSPA1B hspA1B/HspA1B 6p23.1 99 Hsp70;
Hsp72; (Hsp70) Hsp70-2 HSPA1L hspA1L/HspA1L 6p23.1 90 Hsp70-Hom;
Hsp70t HSPA2 hspA2/HspA2 14q24.1 84 Hsp70-3 HSPA4 hspA4/HspA4
5q31.1 31 Hsp70RY; APG-2 HSPA5 hspA5/HspA5 9q34 64 BiP; GRP78 HSPA6
hspA6/HspA6 1q 84 Hsp70-6; Hsp70B' HSPA7 hspA7/HspA7 1q -- Hsp70-7;
Hsp70B HSPA8 hspA8/HspA8 11q24 86 Hsc70; Hsp73 (Hsc70) HSPA9
hspA9/HspA9 5q31.1 52 GRP75; PBP74; mtHsp75; mortalin; mot-2
[0262] The genes are listed according to locus name, names used
herein, chromosomal location (position), amino acid sequence
identity to HspAl A as well as alternative names often seen in the
literature.
Transcriptional Regulation of Hsp70
[0263] Genomic foot printing of the human Hsp70 promoter has
revealed that heat shock/stress induces a rapid binding of heat
shock transcription factors (HSF) to a region encompassing nGAAn
sequences named heat shock elements (HSEs). Under normal conditions
Hsp70 is bound to HSFs, which reside in the cytosol, but during
stress the HSFs are separated from Hsp70 and adapt a homotrimeric
conformation upon phosphorylation by PKC or other serine/threonine
kinases. The HSF trimers enter the nucleus, where they bind HSEs
located in the promoter region of Hsp70 genes and become further
phosphorylated by HSF kinases.
[0264] Three HSFs have so far been characterized in humans (HSF1,
HSF2 and HSF4). HSF1 is the major transcription factor activated
under most stress conditions and responds to a wide range of
stimuli, which can be categorized into physiological (e.g. cell
division, hormonal stimulation), pathological (e.g. infections,
fever, inflammation, malignancy) and environmental conditions (e.g.
heat shock, heavy metals, ethanol). HSF2 responds only to heroin,
whereas HSF4 is preferentially expressed in the human heart,
pancreas, brain and skeletal muscle, lacks the c-terminal
hydrophobic repeat that is shared among all vertebrate HSFs and
appears to repress expression of HSPs. The Hsp70 gene regulation
responsible for synthesis of the constitutively expressed Hsp70
(Hsc70) is not clearly understood, but HSFs do not seem to be
involved.
[0265] Although the HSFs are the most prominent of the factors
regulating HSP expression, other transcription factors have been
shown to possess the same capability. Specific CCAAT-box binding
factors (CBF) have been shown to induce Hsp70 transcription, the
tumor-suppressor p53 can repress transcription by binding to the
promoter-region of Hsp70 and by neutralizing CBF, and HSFs can be
antagonized by the heat shock factor binding protein 1 (HSBP1),
which in this way attenuates Hsp70 transcription.
Structural and Functional Properties of Hsp70
[0266] The structure and function of the Hsp70 system are best
understood for the eubacterial Hsp70, DnaK, its Hsp40 co-chaperone
DnaJ and the nucleotide exchange factor GrpE. However, the
mechanism is generally considered to be analogous in eukaryotes,
although evidence suggests an uncoupling of GrpE. This section will
focus on the eukaryotic Hsp70 system, but will also include
comments on the eubacterial system, where this is considered
appropriate.
[0267] Hsp70 is comprised of two functional entities--an N-terminal
ATPase domain and a smaller C-terminal peptide-binding domain. The
ATPase domain is comprised of two subdomains separated by a cleft
containing the nucleotide-binding site, which determines the
peptide-binding properties of the C-terminal domain. When ATP is
bound, peptide substrates bind and dissociate rapidly, albeit with
low affinity, whereas in a state where either no nucleotide or ADP
is bound to the N-terminal domain, the rates of peptide binding and
dissociation decrease and the affinity increases. ATP hydrolysis
thus serves as a molecular switch between two states of Hsp70, the
cycling of which is regulated by the J-domain family protein Hsp40
in eukaryotes and DnaJ and GrpE in eubacteria. The N-terminal
J-domain of Hsp40 binds to Hsp70 accelerating ATP-hydrolysis,
hereby facilitating peptide capture, whereas the C-terminal part of
Hsp40 functions as a chaperone by recognizing hydrophobic peptides,
whereby Hsp70 is recruited to nascent polypeptide chains. It is
important to note that the molecular chaperones do not provide
specific steric information for the folding of the bound protein,
but rather inhibit unproductive interactions, thus allowing the
protein to fold more efficiently into its native structure.
[0268] In eubacteria, GrpE induces the release of ADP from DnaK
(bacterial Hsp70), whereas for eukaryotic Hsp70 proteins such a
factor appears to be dispensable because the rate-limiting step in
this ATPase cycle is not the dissociation of bound ADP but rather
the ATP-hydrolysis itself. However, additional proteins serve to
regulate Hsp70 function in eukaryotes; the homo-oligomeric protein
Hip (Hsp70 interacting protein) serving as a positive regulator by
stabilizing the ADP-bound state of Hsp70, whereas the proteins
Carboxy-terminus of Hsp70-binding protein (CHIP) and
Bcl-2-associated athanogene-1 (Bag-1) both have inhibitory
effects--CHIP by inhibiting the ATPase activity of Hsp70 and Bag-1
by antagonizing the refolding activity of Hsp70. Further
interactions are provided by the two human Hsp40 proteins Hdj1 and
Hdj2, which, besides their Hsp40 functions (described above), have
been shown to facilitate the coupling of Hsp70 and Hsp90 through
Hop (Hsp-organizing protein), an adaptor protein which physically
links the chaperones through its two tetratricopeptide repeat (TPR)
domains that bind the extended C-terminal sequences of Hsp70 and
Hsp90, respectively. It has recently been shown that some of the
above mentioned proteins are regulatory in the transfer of
non-native or irreversible misfolded proteins from the chaperones
to the ubiquitin-proteasome machinery. The protein CHIP is, apart
from its negative regulatory role on Hsp70, able to associate with
Hsp90 through an N-terminal TPR domain and targets Hsp90 substrates
for degradation through a C-terminal ubiquitin ligase domain, but
is also capable of cooperating functionally with BAG-1, which binds
to Hsp70 (as well as the proteasome. These findings provide a
possible link between the mechanisms that integrate
chaperone-assisted folding and proteolytic degradation, the two
main components of protein quality control in the cytosol.
Cytoprotection via Hsp70
[0269] Apart from its anti-apoptotic abilities as a consequence of
being a molecular chaperone, i.e. facilitating protein folding
under otherwise denaturing conditions, Hsp70 is also able to affect
the survival of cells in various other ways, including protection
of mitochondrial function after ischemia-reperfusion injury,
blocking activation of the stress kinase c-jun N-terminal kinase
(JNK) upon stimulation of primary fibroblasts with TNF, and a
Hsp70/Bag-1 complex has been proposed to regulate cell growth and
mitogenesis during conditions of cellular stress. The ability of
Hsp70 to protect cells from cell death induced by an array of
stimuli such as TNF, TRAIL, oxidative stress, UV-radiation and the
anti-cancer drugs doxorubicin, etoposide and taxol further
emphasize its anti-apoptotic features. Finally, reports have also
provided evidence of more direct interactions between Hsp70 and the
apoptotic machinery as Hsp70 has been shown to antagonize
apoptosis-inducing factor (AIF), as well as exert an anti-apoptotic
function downstream of caspase-3.
[0270] Recent evidence also suggests that parts of the potent
cytoprotective effect of Hsp70 are due to stabilization of
lysosomal membranes. In evidence of this, the depletion of Hsp70
triggers an early permeabilization of lysosomal membranes and
cathepsin-mediated cell death in cancer cells, and exogenous Hsp70
effectively inhibits lysosomal destabilization induced by various
stresses. Furthermore, mice deficient for Hsp70 suffer from
pancreatitis caused by the leakage of lysosomal proteases into the
cytosol. All of these events stress the role of Hsp70 as an
important regulator of PCD and hence survival factor for cells.
Extracellular Hsp70
[0271] As evident from the former paragraphs, the intracellular
functions of Hsp70 are essential for proper cell homeostasis, not
least so in the face of noxious challenges. However, interesting
roles are also emerging for extracellular Hsp70 (eHsp70) especially
when it comes to immune and inflammatory responses, which might
have important roles for the clearance of cancer cells.
Furthermore, involvement in a general physiological adaptation to
stress and protection versus cellular damage are also emerging
themes for eHsp70.
Extracellular Hsp70 and Neuroprotection
[0272] The first evidence for the presence of eHsp70 came from
studies in the squid giant axon, in which it was shown that
elevation of temperature induced a set of heat shock proteins in
the glial sheath surrounding the axon which where transferred into
the axon. These findings where soon reproduced in cultured rat
embryo cells, and importantly, already at this point, evidence was
presented for a non-classical pathway of exocytosis being
responsible for the release of Hsp70 as neither monensin nor
colchicine, both inhibitors of the classical secretory pathway,
could block the secretion of Hsp70. Since these publications, other
reports have provided examples of release of Hsps by glia and the
uptake by neurons in various animal model systems such as frogs,
crayfish and rats. Support of a role for glia cells as sources of
eHsp70 in humans was provided by a study of cultured human
glioblastoma cells. This study showed that under control conditions
the cells released .about.10 pg of Hsp70 per million cells to the
medium in a time period of 24 h. This release was increased
2.5-5-fold when a 20 min heat shock was applied in the beginning of
the time period. Importantly, this study also showed that the
release of eHsp70 was greater than what could be accounted for by
cell death. These data all support the originally suggested
hypothesis set forth by Tytell et al., that glial release of Hsps
may be a way to support neuron function during metabolic
stress.
[0273] In vivo evidence for eHsp70 having a neuroprotective role
during acute stress comes from a variety of studies. A study by
Tidwell et al. found that eHsp70 is capable of reducing the amount
of post-axotomy motor neuron cell death, when eHsp70 was applied
via a gel-sponge after axotomy. In the same study, increased
survival of dorsal root ganglion sensory neuron cells where also
observed upon Hsp70 administration, albeit this depended on
slightly higher doses of Hsp70 than the motor neurons. In addition,
eHsp70 has been shown to protect motor neurons otherwise destined
to die during chick embryonic development, and also protect motor
neurons isolated from chick spinal cords upon trophic factor
deprivation. An in vivo protective role for eHsp70 has also been
described when it comes to light damage of the retina. In this
study, Yu et al., intravitreally injected a solution of recombinant
Hsp70 and Hsc70 after exposure to damage-inducing light at a dose
which had previously been described to cause extensive
photoreceptor degeneration. Interestingly, the presence of the
eHsp70 mixture in the vitreous chamber of the right eye resulted in
significantly more photoreceptors surviving in the retina.
Furthermore, evaluation of uptake of fluorescein-labelled Hsc/Hsp70
demonstrated that it was present in the retina 6 h after
administration. Extracellular Hsp70 administered via intranasal
treatment has also been shown to prevent the consequences of
unavoidable stress in rats and it was recently described that
intraperitoneally injected recombinant human Hsp70 was effective in
increasing the lifespan, delaying symptom onset, preserving motor
function and prolonging motor neuron survival in a mouse model of
amyotrophic lateral sclerosis. Additional in vitro work using Hsp70
or the Hsc/Hsp70 mixture in neuronal systems has furthermore shown
that eHsp70 can enhance neuronal cell stress tolerance and reduce
polyglutamine toxicity and aggregation.
Extracellular Hsp70 and Immunity
[0274] Beside roles in cytoprotection, both plasma
membrane-associated as well as free systemic eHsp70 have been
documented to serve roles in immunity. Considering that one of the
major functions of Hsp70 is to chaperone intracellular proteins, it
is perhaps not surprising that it can be involved in binding of
immunogenic peptides and assist in the presentation of these by
major histocompatibility complex (MHC) class 1 molecules.
Furthermore, tumor-derived eHsp70 has been shown to chaperone
immunogenic peptides and selectively bind to antigen presenting
cells (APC). Following receptor-mediated endocytosis these
Hsp70-peptide complexes are then presented on MHC class 1 molecules
leading to a cytotoxic t-cell response. In addition to the
chaperoning of self-antigens, Hsp70 is also capable of binding
microbial peptides and unmethylated CpG motifs in bacterial
DNA.
[0275] In addition to its role as an antigen-presenting chaperone,
eHsp70 has also been implicated in the stimulation of innate
immunity. Whilst a number of cell types have been shown to release
Hsp70, eHsp70 has also been shown to bind to a number of receptors
on different leucocyte sub-populations including natural killer
(NK) cells, macrophages, monocytes and dendritic cells. The
receptors involved in eHsp70 recognition mainly include pattern
recognition receptors (PRR's) and consist of a variety of receptors
from different receptor families such as the toll like receptors
(TLR), scavenger receptors and c-type lectins. Upon receptor
binding, eHsp70 is capable of eliciting a wide cytokine-response
including release of pro-inflammatory cytokines such as TNF-a,
IL-1b, IL-12, IL-6 and GM-CSF, a process triggered by translocation
of NF-kB to the nucleus, suggesting a cytokine action of eHsp70,
which has also led to the suggestion of coining the term
chaperokine to eHsp70 in order to better describe the unique
functions of eHsp70 as both a chaperone and cytokine.
[0276] Much of the in vivo work on a role of eHsp70 in immunity has
been conducted in rodent models. For example, increases in eHsp70
concentration in response to tail-shock were associated with
reduced inflammation and quicker recovery times following a
sub-cutaneous E. Coli-injection. In addition, in vivo delivery of
Hsp70 into mice accelerated wound closure, a feature which was
likely due to enhanced macrophage phagocytosis of wound debris.
[0277] Evidence for the immunomodulatory roles of Hsp70 in humans
is lacking, but studies have demonstrated relationships between
increased eHsp70 and improved prognosis/outcome for brain trauma,
although the contrary has also been shown. However, it is also
known that concentrations of eHsp70 decline with advancing age,
which may be indicative of an age-related reduced ability to mount
a full stress-response, which again could account for the increased
morbidity and mortality seen with ageing, although this remains
purely speculative.
[0278] Release of Hsp70
[0279] Aside for the data demonstrating transfer of eHsp70 between
neighboring cells such as in the glia/axon model, several reports
have documented the presence of free eHsp70 in the circulation. For
Hsp70 to be present in this compartment, it necessarily has to be
released from an organ/cell. Two major ways of achieving this are
usually considered. One is a passive way in which the observation
of eHsp70 in the peripheral circulation is the consequence of
release from an intracellular pool of Hsp70 due to cell lysis or
death. Alternatively, or perhaps additionally, Hsp70 is actively
released via a non-classical exocytotic pathway.
[0280] It has been suggested that Hsp70 along with other heat shock
proteins are only released under pathological circumstances
resulting in necrotic death and not during programmed cell death.
No doubt, severe trauma and pathological conditions resulting in
necrosis can lead to the release of Hsp70 to the bloodstream. This
has been well documented and would also logically be expected.
Recent studies however, have shown that Hsp70 can be released from
intact cells by active mechanisms and that the degree of stimulus
determines the mode of release. Strong evidence for the
non-necrotic release of Hsp70 also comes from studies on
exercise-induced release of eHsp70 to the peripheral bloodstream.
Dependent on the mode of exercise (the higher the physical strain,
the more release) major increases of eHsp70 can be detected in the
peripheral bloodstream, and importantly, no known studies have
reported a direct correlation between eHsp70 and markers of muscle
damage. That eHsp70 can be released regardless of cellular or
tissue damage has furthermore been elegantly demonstrated by
Fleshner and co-workers who have shown that psychological stress
such as predatory fear and electric shock can evoke a stress
induced eHsp70 release, a process which was suggested to be
dependent on cathecholamine signaling.
[0281] The way by which hsp70 leaves the cell is still unclear
though, not least so because Hsp70 does not contain any classical
peptide leader sequence, which could target it for secretion. In
addition, as classical secretion was already questioned early, this
suggests that alternate mechanisms for eHsp70 release must exist.
It has been demonstrated that eHsp70 can be released in vesicles
characterized as exosomes, but evidence has also been presented
that eHsp70 can be released as free eHsp70, both in cellular
systems as well as in vivo. It has been suggested that lipid rafts
are needed for eHsp70 release although this has also been disputed.
Moreover, it has been shown that a functional lysosomal compartment
is necessary for release of eHsp70 and that this release is
accompanied by the presence of lysosomal marker proteins on the
surface of the cells, suggesting a secretion dependent on plasma-
and lysosomal membrane fusion. Regardless of whether the release is
via exosomes or via direct release from lysosomes, it is
interesting to note that some sort of secretory MTB/late
endosomalllysosomal compartment is apparently involved in all modes
of release.
[0282] As catecholamines via the .quadrature..sub.1-adrenergic
receptor can lead to intracellular calcium-fluxes, and since the
same calcium-fluxes has been suggested to cause exocytosis of
exosomes, multivesicular bodies and lysosomes, a current hypothesis
is that under times of stress, increases in noradrenaline acting
upon .quadrature..sub.1-adrenergic receptors results in a calcium
flux within the cell and a subsequent release of Hsp70 within
exosomes.
Bioactive Agent According to the Present Invention
[0283] The present invention relates in one embodiment to the use
of a bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70.
[0284] Increasing the intracellular concentration and/or activity
of Hsp70 according to the present invention can be obtained by
providing one of the following classes of compounds and therapies:
[0285] Hsp70, or a functional fragment or variant thereof [0286]
Hsp70 inducers and co-inducers [0287] Small-molecule drugs such as
Bimoclomol and Arimoclomol [0288] Membrane fluidizers such as
benzyl alcohol [0289] Sub-lethal heat-therapy (.ltoreq.42.degree.
C.) or hypertheimia [0290] Certain drugs from the group of
anti-inflammatory and anti-neoplastic drugs [0291] Cellular stress
[0292] Reactive oxygen species (ROS), Adrenalin, noradrenalin, UV
light, Radiation therapy
[0293] A bioactive agent according to the present invention is thus
any agent, chemical or compound that increases the intracellular
concentration and/or activity of Hsp70; and includes HSP70 itself,
or a functional fragment or variant thereof, and any Hsp70 inducer
or co-inducer known to the skilled person.
[0294] It follows that a bioactive agent may increase the
intracellular concentration and/or activity of Hsp70 either
directly or indirectly.
[0295] In one embodiment, the bioactive agent according to the
present invention is Hsp70, or a functional fragment or variant
thereof.
[0296] In another embodiment, the bioactive agent according to the
present invention is an Hsp70 inducer or co-inducer.
[0297] In one embodiment, the bioactive agent according to the
present invention comprises a combination of Hsp70, or a functional
fragment or variant thereof, and an Hsp70 inducer or
co-inducer.
[0298] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70, for use as a
medicament.
[0299] It is a further aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70, for use in the treatment of
a disease selected from the group consisting of glycogen storage
diseases, gangliosidoses, neuronal ceroid lipofuscinoses,
cerebrotendinous cholesterosis, Wolman's disease, cholesteryl ester
storage disease, disorders of glycosaminoglycan metabolism,
mucopolysaccharidoses, disorders of glycoprotein metabolism,
mucolipidoses, aspartylglucosaminuria, fucosidosis, mannosidoses,
and sialidosis type II.
[0300] It is a further aspect of the present invention to provide
the use of a bioactive agent capable of increasing the
intracellular concentration and/or activity of Hsp70, for the
manufacture of a medicament for treating a disease selected from
the group consisting of glycogen storage diseases, gangliosidoses,
neuronal ceroid lipofuscinoses, cerebrotendinous cholesterosis,
Wolman's disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, and sialidosis type II.
[0301] It is a still further aspect of the present invention to
provide a bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in the treatment of
a lysosomal storage disease, wherein said lysosomal storage disease
arise from a defect in an enzyme whose activity is not directly
associated with the presence of lysosomal BMP as a co-factor.
[0302] In one embodiment, said lysosomal storage disease is not
selected from the group of Niemann-Pick disease, Farber disease,
Krabbe disease, Sialidosis type I, Metachromatic leukodystrophy,
Gaucher disease, Fabry disease and saposin-deficiency.
[0303] In one embodiment, said lysosomal storage disease is
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
[0304] In one embodiment, said treatment may be prophylactic,
curative or ameliorating. In one particular embodiment, said
treatment is prophylactic. In another embodiment, said treatment is
curative. In a further embodiment, said treatment is
ameliorating.
Bioactive Agent--Hsp70, or a Functional Fragment or Variant
Thereof
[0305] It is an aspect of the present invention to provide Hsp70,
or a functional fragment or variant thereof, for use as a
medicament.
[0306] It is a further aspect of the present invention to provide
Hsp70, or a functional fragment or variant thereof, for use in the
treatment of a disease selected from the group consisting of
glycogen storage diseases, gangliosidoses, neuronal ceroid
lipofuscinoses, cerebrotendinous cholesterosis, Wolman's disease,
cholesteryl ester storage disease, disorders of glycosaminoglycan
metabolism, mucopolysaccharidoses, disorders of glycoprotein
metabolism, mucolipidoses, aspartylglucosaminuria, fucosidosis,
mannosidoses, and sialidosis type II.
[0307] It is a further aspect of the present invention to provide
the use of Hsp70, or a functional fragment or variant thereof, for
the manufacture of a medicament for treating a disease selected
from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
[0308] It is a still further aspect of the present invention to
provide Hsp70, or a functional fragment or variant thereof, for use
in the treatment of a lysosomal storage disease, wherein said
lysosomal storage disease arise from a defect in an enzyme whose
activity is not directly associated with the presence of lysosomal
BMP as a co-factor.
[0309] In one embodiment, said lysosomal storage disease is not
selected from the group of Niemann-Pick disease, Farber disease,
Krabbe disease, Sialidosis type I, Metachromatic leukodystrophy,
Gaucher disease, Fabry disease and saposin-deficiency.
[0310] In one embodiment, said lysosomal storage disease is
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidosies, and sialidosis
type II.
[0311] It is understood that Hsp70, or a functional fragment or
variant thereof, according to the present invention may be any
natural or synthetic product, and may be produced by any
conventional technique known to the person skilled in the art.
[0312] In one embodiment, Hsp70, or a functional fragment or
variant thereof, is purified from a natural source. Said natural
source may be any plant, animal or bacteria which expresses, or may
be induced to express, Hsp70 in a form suitable for administering
to an individual in need thereof.
[0313] In a preferred embodiment however, Hsp70, or a functional
fragment or variant thereof, is made synthetically. It follows that
Hsp70, or a functional fragment or variant thereof, may in one
preferred embodiment be a recombinant protein made by conventional
techniques therefore and as such is denoted rHsp70.
[0314] The Hsp70 according to the present invention, synthetic or
natural, may have a sequence which is derived from any suitable
species of plant, animal or bacteria. In one embodiment, said
rHsp70 is derived from a mammal. Said mammal may be selected form
the group consisting of human (homo sapiens), mouse (mus musculus),
cow, dog, rat, ferret, pig, sheep, and monkey. In another
embodiment, said rHsp70 is derived from bacteria.
[0315] Hsp70 is characterized in part by having a very high degree
of interspecies sequence conservation, thus possibly allowing for
Hsp70 derived from one species to be used in another species
without eliciting a harmful immune response.
[0316] In one particular embodiment, said rHsp70 has a sequence
derived from human Hsp70.
[0317] In one particular embodiment, said rHsp70 has a sequence
derived from more than one species. Said Hsp70, or a functional
fragment or variant htereof, may thus in one embodiment be a
chimera.
[0318] A recombinant protein is a protein that is derived from
recombinant DNA. Recombinant DNA is a form of DNA that does not
exist naturally, which is created by combining DNA sequences that
would not normally occur together. In terms of genetic
modification, recombinant DNA is introduced through the addition of
relevant DNA into an existing organismal DNA, such as the plasmids
of bacteria, to code for different traits for a specific purpose.
It differs from genetic recombination, in that it does not occur
through processes within the cell, but is engineered by man.
[0319] In one embodiment, the Hsp70 according to the present
invention has 100% identity to the wild-type Hsp70 protein. In
another embodiment, the Hsp70 according to the present invention
has less than 100% identity to the wild-type Hsp70 protein, such as
between 99.9 to 95% identity, for example 95 to 90% identity, such
as 90 to 85% identity, for example 85 to 80% identity, such as 80
to 75% identity, for example 75 to 60% identity to the wild-type
protein. Regardless of the degree of identity, any variant of Hsp70
that retains all or most of its biological functions is encompassed
by the present invention.
[0320] In one embodiment, the bioactive agent is Hsp70. In one
embodiment, said Hsp70 is full length Hsp70.
[0321] It is also an embodiment to provide a functional fragment or
variant of Hsp70. As defined herein, a functional fragment or
variant is any fragment of Hsp70 having the desired function, which
in terms of the present invention is a capability to reverse the
pathology of a lysosomal storage disease and/or increase the
cellular uptake of other molecules.
[0322] In one embodiment, the bioactive agent is a functional
fragment or variant of Hsp70.
[0323] In one embodiment, the bioactive agent is a functional
fragment or variant of Hsp70, in which Hsp70 is modified by
deletion(s), addition(s) or substitution(s) of the wild type
Hsp70.
[0324] The wild type Hsp70 protein has a total length of 641 amino
acids. A fragment of Hsp70 is in one embodiment meant to comprise
any fragment with a total length of less than the wild type protein
of 641 amino acids, such as less than 625 amino acids, for example
less than 600 amino aids, such as less than 575 amino acids, for
example less than 550 amino acids, such as less than 525 amino
acids, for example less than 500 amino acids, such as less than 475
amino acids, for example less than 450 amino acids, such as less
than 425 amino acids, for example less than 400 amino acids, such
as less than 375 amino acids, for example less than 350 amino
acids, such as less than 325 amino acids, for example less than 300
amino acids, such as less than 275 amino acids, for example less
than 250 amino acids, such as less than 225 amino acids, for
example less than 200 amino acids, such as less than 175 amino
acids, for example less than 150 amino acids, such as less than 125
amino acids, for example less than 100 amino acids, such as less
than 75 amino acids, for example less than 50 amino acds, such as
less than 25 amino acids.
[0325] The wild type Hsp70 protein has a total length of 641 amino
acids. A fragment of Hsp70 is in one embodiment meant to comprise
any fragment with a total length of more than 10 amino acids, such
as more than 25 amino acids, for example more than 50 amino acids,
such as more than 75 amino acids, for example more than 100 amino
acids, such as more than 125 amino acids, for example more than 150
amino acids, such as more than 175 amino acids, for example more
than 200 amino acids, such as more than 225 amino acids, for
example more than 250 amino acids, such as more than 275 amino
acids, for example more than 300 amino acids, such as more than 325
amino acids, for example more than 350 amino acids, such as more
than 375 amino acids, for example more than 400 amino acids, such
as more than 425 amino acids, for example more than 450 amino
acids, such as more than 475 amino acids, for example more than 500
amino acids, such as more than 525 amino acids, for example more
than 550 amino acids, such as more than 575 amino acids, for
example more than 600 amino acids, such as more than 625 amino
acids.
[0326] It follows that the total length of the fragment of Hsp70
according to the present invention may in one embodiment be within
the range of 5 to 25 amino acids, such as 25 to 50 amino acids, for
example 50 to 75 amino acids, such as 75 to 100 amino acids, for
example 100 to 125 amino acids, such as 125 to 150 amino acids, for
example 150 to 175 amino acids, such as 175 to 200 amino acids, for
example 200 to 225 amino acids, such as 225 to 250 amino acids, for
example 250 to 275 amino acids, such as 275 to 300 amino acids, for
example 300 to 325 amino acids, such as 325 to 350 amino acids, for
example 350 to 375 amino acids, such as 375 to 400 amino acids, for
example 400 to 425 amino acids, such as 425 to 450 amino acids, for
example 450 to 475 amino acids, such as 475 to 500 amino acids, for
example 500 to 525 amino acids, such as 525 to 550 amino acids, for
example 550 to 575 amino acids, such as 575 to 600 amino acids, for
example 600 to 625 amino acids, such as 625 to 640 amino acids.
[0327] In one embodiment, the fragment or variant of Hsp70
comprises all or part of the ATPase domain of Hsp70. It follows
that the fragment or variant of Hsp70 according to the present
invention in one embodiment comprises all or part of amino acids
number 30 to 382. In another embodiment, the fragment or variant of
Hsp70 comprises tryptophan at amino acid position 90 of the Hsp70
ATPase domain.
[0328] A fragment of Hsp70 may be a truncated version of the wild
type protein, meaning that it is a shorter version. A fragment may
be truncated by shortening of the protein from either the
amino-terminal or the carboxy-terminal ends of the protein, or it
may be truncated by deletion of one or more internal regions of any
size of the protein.
[0329] A fragment or variant of Hsp70 may in one embodiment have
100% identity to the wild-type protein. In another embodiment, the
fragment or variant of Hsp70 may also be a variant of Hsp70 which
has less than 100% identity to the wild-type protein, such as
between 99.9 to 95% identity, for example 95 to 90% identity, such
as 90 to 85% identity, for example 85 to 80% identity, such as 80
to 75% identity, for example 75 to 60% identity to the wild-type
protein.
[0330] A fragment or variant of Hsp70 may in one embodiment have
100% identity to the wild-type protein. In another embodiment, the
fragment or variant of Hsp70 may also be a variant of Hsp70 which
has less than 100% identity to the wild-type protein, such as
between 99.9 to 95% identity, for example 95 to 90% identity, such
as 90 to 85% identity, for example 85 to 80% identity, such as 80
to 75% identity, for example 75 to 60% identity to the wild-type
protein.
[0331] It is appreciated that the exact quantitative effect of the
functional fragment or variant may be different from the effect of
the full-length molecule. In some instances, the functional
fragment or variant may indeed be more effective than the
ft..sup.-Ell-length molecule. Furthermore, the use of fragments
instead of full-length molecules may be advantageous in view of the
smaller size of the fragments.
[0332] In one embodiment, a functional fragment or variant of Hsp70
may be a variant of Hsp70 in which one or more amino acids has been
substituted. Said substitutions) may be an equivalent or
conservative substitution(s), or a non-equivalent or
non-conservative substitution(s).
[0333] In one embodiment, between 0.1 to 1% of the amino acid
residues of wild type Hsp70 has been substituted, such as between 1
to 2% amino acid residues, for example between 2 to 3% amino acid
residues, such as between 3 to 4% amino acid residues. for example
between 4 to 5% amino acid residues, such as between 5 to 10% amino
acid residues, for example between 10 to 15% amino acid residues,
such as between 15 to 20% amino acid residues, for example between
20 to 30% amino acid residues, such as between 30 to 40% amino acid
residues, for example between 40 to 50% amino acid residues, such
as between 50 to 60% amino acid residues, for example between 60 to
70% amino acid residues, such as between 70 to 80% amino acid
residues, for example between 80 to 90% amino acid residues, such
as between 90 to 100% amino acid residues.
[0334] In one embodiment, between 1 to 5 of the amino acid residues
of wild type Hsp70 has been substituted, such as between 5 to 10
amino acid residues, for example between 10 to 15 amino acid
residues, such as between 15 to 20 amino acid residues, for example
between 20 to 30 amino acid residues, such as between 30 to 40
amino acid residues, for example between 40 to 50 amino acid
residues, such as between 50 to 75 amino acid residues, for example
between 75 to 100 amino acid residues, such as between 100 to 150
amino acid residues, for example between 150 to 200 amino acid
residues, such as between 200 to 300 amino acid residues, for
example between 300 to 400 amino acid residues, such as between 400
to 500 amino acid residues.
[0335] In one embodiment, the functional fragment or variant of
Hsp70 is a fusion protein. In one embodiment, said functional
fragment or variant of Hsp70 is fused to a tag.
Advantages of using Hsp 70, or a Functional Fragment or Variant
Thereof
[0336] As discussed herein above, there are no cures for the
lysosomal storage diseases and treatment is mostly symptomatic,
with the exception of the development of enzyme replacement
therapies (ERT) for Gaucher disease and Fabry disease. As
mentioned, ERT is a very expensive form of therapy that is
effective for one specific disease only.
[0337] To the knowledge of the inventors, to date no succesful
attempt has been made to provide ERT for the remaining lysosomal
storage diseases associated with lipid accumulation, thus a major
unmet need for an effective and specific treatment of these LSDs
remains today.
[0338] Administration of Hsp70, or a functional fragment or variant
thereof, to an individual in need thereof has a number of
advantages compared to conventional treatment modalities for the
lysosomal storage disorders.
[0339] First, producing a recombinant protein, such as rHsp70 or a
functional fragment or variant thereof, is with modern technology a
simple and straight-forward way of producing sufficient amounts of
rHsp70, or a functional fragment or variant thereof. Conventional
techniques for producing recombinant enzymes are well known to the
skilled person.
[0340] Further, producing a recombinant protein, such as rHsp70 a
functional fragment or variant thereof, is a cheap method for
producing sufficient amounts of rHsp70, or a functional fragment or
variant thereof. Compared to the production of enzymes for ERT, the
cost is drastically reduced.
[0341] Also, the use of Hsp70, or a functional fragment or variant
thereof can be used for treatment of more than one specific
lysosomal storage disorder. This applies also to the Hsp70 inducers
and co-inducers of the present invention. Indeed, the bioactive
agent capable of increasing the intracellular concentration and/or
activity of Hsp70 may be used for treatment of any lysosomal
storage disease which may be reverted by modulating the enzymatic
activity of the involved defective enzyme, wherein said enzyme
interacts with BMP.
[0342] Finally, as Hsp70 is an endogenously occurring molecule,
i.e. a molecule that originate from within an organism, tissue, or
cell, it is to be expected that no or a very limited immune
response is triggered by administering Hsp70, or a functional
fragment or variant thereof. This is a major advantage as it
facilitates treatment and reduces potential side effects when
administered to an individual.
Ectopic Expression of Hsp70
[0343] In one embodiment, Hsp70, or a functional fragment or
variant thereof, may be expressed from a vector. The invention thus
in one embodiment relates to a vector encoding Hsp70, or a
functional fragment or variant thereof.
[0344] In one embodiment of the present invention, Hsp70, or a
functional fragment or variant thereof, may be administered to an
individual in need thereof in the form of a vector.
[0345] The vector used for expressing Hsp70, or a functional
fragment or variant thereof, may be selected from the group
consisting of: viral vectors (retroviral and adenoviral) or
non-viral vectors (plasmid, cosmid, bacteriophage).
[0346] In one embodiment, said vector comprises one or more of a
origin of replication, a marker for selection and one or more
recognition sites for a restriction endonuclease. In another
embodiment, said vector is operably linked to regulatory sequences
controlling the transcription of said Hsp70, or a functional
fragment or variant thereof, in a suitable host cell.
[0347] The present invention in one embodiment relates to a method
for producing Hsp70, or a functional fragment or variant thereof,
as described herein; said method comprising the steps of providing
a vector encoding said Hsp70, or a functional fragment or variant
thereof, and expressing said vector either in vitro, or in vivo in
a suitable host organism, thereby producing said Hsp70, or a
functional fragment or variant thereof.
[0348] The invention further relates to an isolated recombinant or
transgenic host cell comprising a vector encoding Hsp70, or a
functional fragment or variant thereof, according to the present
invention.
[0349] The invention also relates to a method for generating a
recombinant or transgenic host cell, said method comprising the
steps of providing a vector encoding Hsp70, or a functional
fragment or variant thereof, introducing said vector into said
recombinant or transgenic host cell and optionally also expressing
said vector in said recombinant or transgenic host cell, thereby
generating a recombinant or transgenic host cell producing said
Hsp70, or a functional fragment or variant thereof.
[0350] In another embodiment the present invention relates to a
transgenic, mammalian organism comprising the host cell described
above.
[0351] In a further embodiment, the transgenic, mammalian organism
comprising the recombinant or transgenic host cell according to the
present invention is non-human.
[0352] The transgenic host cell may be selected from the group
consisting of a mammalian, plant, bacterial, yeast or fungal host
cell.
[0353] To improve the delivery of the DNA into the cell, the DNA
must be protected from damage and its entry into the cell must be
facilitated. Lipoplexes and polyplexes, have been created that have
the ability to protect the DNA from undesirable degradation during
the transfection process. Plasmid DNA can be covered with lipids in
an organized structure like a micelle or a liposome. When the
organized structure is complexed with DNA it is called a lipoplex.
There are three types of lipids that may be employed for forming
liposomes; anionic (negatively charged), neutral, or cationic
(positively charged). Complexes of polymers with DNA are called
polyplexes. Most polyplexes consist of cationic polymers and their
production is regulated by ionic interactions.
[0354] In another embodiment, Hsp70, or a functional fragment or
variant thereof, may be administered as naked DNA. This is the
simplest form of non-viral transfection. Delivery of naked DNA may
be performed by use of electroporation, sonoporation, or the use of
a "gene gun", which shoots DNA coated gold particles into a cell
using high pressure gas.
Bioactive Agent--Hsp70 Inducers and Co-Inducers
[0355] In one embodiment, the bioactive agent according to the
present invention is an Hsp70 inducer or co-inducer.
[0356] An Hsp70 inducer is a compound that can by itself amplify
Hsp70 gene expression and protein expression without a concomitant
stress.
[0357] An Hsp70 co-inducer is a compound that cannot amplify Hsp70
gene expression and protein expression without a concomitant (mild)
stress, but the stress-induced increase in Hsp70 levels is further
elevated or enhanced by their presence.
[0358] It is an aspect of the present invention to provide an Hsp70
inducer or co-inducer for use as a medicament.
[0359] It is a further aspect of the present invention to provide
an Hsp70 inducer or co-inducer for use in the treatment of a
disease selected from the group consisting of glycogen storage
diseases, gangliosidoses, neuronal ceroid lipofuscinoses,
cerebrotendinous cholesterosis, Wolman's disease, cholesteryl ester
storage disease, disorders of glycosaminoglycan metabolism,
mucopolysaccharidoses, disorders of glycoprotein metabolism,
mucolipidoses, aspartylglucosaminuria, fucosidosis, mannosidoses,
and sialidosis type II.
[0360] It is a further aspect of the present invention to provide
the use of an Hsp70 inducer or co-inducer, for the manufacture of a
medicament for the treatment of a disease selected from the aroup
consisting of glycogen storage diseases, gangliosidoses, neuronal
ceroid lipofuscinoses, cerebrotendinous cholesterosis, Wolman's
disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, and sialidosis type II.
[0361] It is a still further aspect of the present invention to
provide an Hsp70 inducer or co-inducer for use in treating a
lysosomal storage disease, wherein said lysosomal storage disease
arise from a defect in an enzyme whose activity is not directly
associated with the presence of lysosomal BMP as a co-factor.
[0362] In one embodiment, said lysosomal storage disease is not
selected from the group of Niemann-Pick disease, Farber disease,
Krabbe disease, Sialidosis type I, Metachromatic leukodystrophy,
Gaucher disease, Fabry disease and saposin-deficiency.
[0363] In one embodiment, said lysosomal storage disease is
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
[0364] In one embodiment, the bioactive aaent according to the
present invention is an Hsp70 inducer or co-inducer. In a
particular embodiment, the bioactive agent according to the present
invention is an Hsp70 inducer. In another particular embodiment,
the bioactive agent according to the present invention is an Hsp70
co-inducer.
Small-Molecule Drugs--Hydroxylamine Derivatives
[0365] In one embodiment, the bioactive agent according to the
present invention is an Hsp70 co-inducer. In a further embodiment,
said Hsp70 co-inducer is a small-molecule drug.
[0366] In a particular embodiment, the Hsp70 co-inducer according
to the present invention is a hydroxylamine derivative. Said
hydroxylamine derivative may in a further embodiment selected from
the group of Bimoclomol (BRLP-42), Arimoclomol (BRX-220), BRX-345
and BGP-15.
[0367] In a particular embodiment, said hydroxylamine derivative is
Arimoclomol (BRX-220).
[0368] Bimoclomol ([2-hydroxy-3-(1-piperidinyl)
propoxy]-3-pyridine-carboximidoyl-chloride maleate) is a non-toxic
compound that was originally developed for treatment of diabetic
complications such as neuropathies. Bimoclomol has been shown to
improve cell survival under experimental stress conditions partly
by increasing intracellular heat shock proteins (HSPs), including
Hsp70, via an activation of HSF-1. It has been shown that
bimoclomol possess the capability of Hsp70 co-induction in the
absence of unfolded proteins, and that bimoclomol interacts with
and increases the fluidity of negatively charged membrane lipids.
BRX-345 is a structural analog of bimoclomol with a somewhat lesser
ability to induce HSPs.
[0369] Arimoclomol (BRX-220) is an analog of bimoclomol, which also
interacts with and amplifies the heat shock response. Arimoclomol
is currently in clinical trials for the treatment of ALS
(amyotrophic lateral sclerosis); a progressive neurodegenerative
disorder. Arimoclomol is owned by CytRx Corporation.
[0370] In some embodiments, the bioactive agent according to the
present invention is Iroxanadine
(5-(piperidin-1-ylmethyl)-3-pyridin-3-yl-5,6-dihydro-2H-1,2,4-oxadiazine)-
.
[0371] It is thus an aspect of the present invention to provide a
hydroxylamine derivative Hsp70 co-inducer for use in the treatment
of a disease selected from the group consisting of glycogen storage
diseases, gangliosidoses, neuronal ceroid lipofuscinoses,
cerebrotendinous cholesterosis, Wolman's disease, cholesteryl ester
storage disease, disorders of glycosaminoglycan metabolism,
mucopolysaccharidoses, disorders of glycoprotein metabolism,
mucolipidoses, aspartylglucosaminuria, fucosidosis, mannosidoses,
and sialidosis type II.
[0372] It is a further aspect of the present invention to provide
the use of a hydroxylamine derivative Hsp70 co-inducer for the
manufacture of a medicament for treating a disease selected from
the group consisting of glycogen storage diseases, gangliosidoses,
neuronal ceroid lipofuscinoses, cerebrotendinous cholesterosis,
Wolman's disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, and sialidosis type II.
[0373] It is a still further aspect of the present invention to
provide a hydroxylamine derivative Hsp70 co-inducer for use in
treating a lysosomal storage disease, wherein said lysosomal
storage disease arise from a defect in an enzyme whose activity is
not directly associated with the presence of lysosomal BMP as a
co-factor.
[0374] In one embodiment, said lysosomal storage disease is not
selected from the group of Niemann-Pick disease, Farber disease,
Krabbe disease, Sialidosis type I, Metachromatic leukodystrophy,
Gaucher disease, Fabry disease and saposin-deficiency.
[0375] In one embodiment, said lysosomal storage disease is
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
Membrane Fluidizers
[0376] In one embodiment, the bioactive agent according to the
present invention is an Hsp70 inducer. In a further embodiment,
said Hsp70 inducer is a membrane fluidizer.
[0377] Treatment with a membrane fluidizer may also be termed lipid
therapy.
[0378] In a particular embodiment, the Hsp70 inducer according to
the present invention is a membrane fluidizer selected from the
group of benzyl alcohol, heptanol, AL721, Docosahexaenoic acid,
aliphatic alcohols, oleyl alcohol, dimethylaminoethanol, A.sub.2C,
farnesol and anaesthetics such as lidocaine, ropivacaine,
bupivacaine and mepivacaine, as well as others known to the skilled
person.
[0379] Besides the denaturation of a proportion of cellular
proteins during heat (proteotoxicity), a change in the fluidity of
membranes is also proposed as being a cellular thermosensor that
initiates the heat shock response and induces HSPs. Indeed,
chemically induced membrane perturbations--analogous with heat
induced plasma membrane fluidization--are capable of activating
HSP, without causing protein denaturation.
[0380] Membrane fluidity refers to the viscosity of the lipid
bilayer of a cell membrane. The membrane phospholipids incorporate
fatty acids of varying length and saturation.
[0381] The membrane fluidizers act by intercalating between
membrane lipids thus inducing a disordering effect by weakening of
van der Vaals interactions between the lipid acyl chains.
[0382] It is thus an aspect of the present invention to provide a
membrane fluidizer selected from the group of benzyl alcohol,
heptanol, AL721, Docosahexaenoic acid, aliphatic alcohols, oleyl
alcohol, dimethylaminoethanol, A.sub.2C, farnesol and anaesthetics
such as lidocaine, ropivacaine, bupivacaine and mepivacaine, as
well as others known to the skilled person, for use in the
treatment of a disease selected from the group consisting of
glycogen storage diseases, gangliosidoses, neuronal ceroid
lipofuscinoses, cerebrotendinous cholesterosis, Wolman's disease,
cholesteryl ester storage disease, disorders of glycosaminoglycan
metabolism, mucopolysaccharidoses, disorders of glycoprotein
metabolism, mucolipidoses, aspartylglucosaminuria, fucosidosis,
mannosidoses, and sialidosis type II.
[0383] It is a further aspect of the present invention to provide
the use of a membrane fluidizer selected from the group of benzyl
alcohol, heptanol, AL721, Docosahexaenoic acid, aliphatic alcohols,
oleyl alcohol, dimethylaminoethanol, A.sub.2C, farnesol and
anaesthetics such as lidocaine, ropivacaine, bupivacaine and
mepivacaine, as well as others known to the skilled person, for the
manufacture of a medicament for treating a disease selected from
the group consisting of glycogen storage diseases, gangliosidoses,
neuronal ceroid lipofuscinoses, cerebrotendinous cholesterosis,
Wolman's disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, and sialidosis type II.
[0384] It is a still further aspect of the present invention to
provide a membrane fluidizer selected from the group of benzyl
alcohol, heptanol, AL721, Docosahexaenoic acid, aliphatic alcohols,
oleyl alcohol, dimethylaminoethanol, A.sub.2C, farnesol and
anaesthetics such as lidocaine, ropivacaine, bupivacaine and
mepivacaine, as well as others known to the skilled person, for use
in treating a lysosomal storage disease, wherein said lysosomal
storage disease arise from a defect in an enzyme whose activity is
not associated with the presence of lysosomal BMP as a
co-factor.
[0385] In one embodiment, said lysosomal storage disease is not
selected from the group of Niemann-Pick disease, Farber disease,
Krabbe disease, Sialidosis type I, Metachromatic leukodystrophy,
Gaucher disease, Fabry disease and saposin-deficiency.
[0386] In one embodiment, said lysosomal storage disease is
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
Other Means for Inducing Hsp70
[0387] Any means for inducing Hsp70 expression is envisioned to be
encompassed by the present invention, some of which are outlined
herein below.
[0388] Increasing the temperature of an individual is a potent
inducer of HSPs inclusing Hsp70, and as such sub-lethal heat
therapy is an aspect of the present invention. In one embodiment,
sub-lethal heat therapy comprises increasing the temperature of an
individual to a core temperature of about 38.degree. C., such as
about 39.degree. C., for example about 40.degree. C., such as about
41.degree. C., for example about 42.degree. C., such as about
43.degree. C.
[0389] It is thus an aspect of the present invention to provide
sub-lethal heat therapy for use in treating a disease selected from
the group consisting of glycogen storage diseases, gangliosidoses,
neuronal ceroid lipofuscinoses, cerebrotendinous cholesterosis,
Wolman's disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, and sialidosis type II.
[0390] It is also an aspect of the present invention to provide
sub-lethal heat therapy for use in treating a lysosomal storage
disease, wherein said lysosomal storage disease arise from a defect
in an enzyme whose activity is not directly associated with the
presence of lysosomal BMP as a co-factor.
[0391] Psychological stress such as predatory fear and electric
shock can evoke a stress induced eHsp70 release, a process which is
suggested to be dependent on cathecholamine signaling. Further,
adrenaline and noradrenalin can evoke Hsp70 release.
[0392] The following compounds have been shown to induce (or
co-induce) HSPs, including Hsp70: the membrane-interactive compound
alkyllysophospholipid Edelfosine (ET-18-OCH3 or
1-octadecyl-2-methyl-rac-glycero-3 -phosphocholine);
anti-inflammatory drugs including cyclooxygenase 1/2 inhibitors
such as celecoxib and rofecoxib, as well as NSAIDs such as
acetyl-salicylic acid, sodium salicylate and indomethacin;
prodstaglandins PGA1, PGj2 and 2-cyclopentene-1-one; peroxidase
proliferator-activated receptor-gamma agonists; tubulin-interacting
anticancer agents including vincristine and paclitaxel; the insulin
sensitizer pioglitazone; anti-neoplastic agents such as
carboplatin, doxorubicin, fludarabine, ifosfamide and cytarabine;
the Hsp90 inhibitors geldanamycin, 17-AAG, 17-DMAG, radicicol,
herbimycin-A and arachidonic acid; proteasome inhibitors MG132 and
lactacystin; serine protease inhibitors DCIC, TLCK and TPCK; the
anti-ulcer drugs geranylgeranylacetone (GGA), rebamipide,
carbenoxolone and polaprezinc (zinc L-carnosine); heavy metals
(zinc and tin); the anti-inflammatory drug dexamethasone; cocaine;
nicotine; alcohol; alpha-adrenergic agonists; cyclopentenone
prostanoids; as well as herbal medicines paeoniflorin,
glycyrrhizin, celastrol, dihydrocelastrol, dihydrocelastrol
diacetate and curcumin.
[0393] It is thus an aspect of the present invention to provide a
compound selected from the group of Edelfosine (ET-18-OCH3 or
1-octadecyl-2-methyl-rac-glycero-3-phosphocholine), celecoxib,
rofecoxib, acetyl-salicylic acid, sodium salicylate, indomethacin,
PGA1, PGj2 2-cyclopentene-1-one, peroxidase proliferator-activated
receptor-gamma agonists, vincristine, paclitaxel, pioglitazone,
carboplatin, doxorubicin, fludarabine, ifosfamide cytarabine,
geldanamycin, 17-AAG, 17-DMAG, radicicol, herbimycin-A, arachidonic
acid, MG132, lactacystin, DCIC, TLCK, TPCK, geranylgeranylacetone
(GGA), rebamipide, carbenoxolone, polaprezinc (zinc L-carnosine),
dexamethasone, cocaine, nicotine, alcohol, alpha-adrenergic
agonists, cyclopentenone prostanoids, paeoniflorin, glycyrrhizin,
celastrol, dihydrocelastrol, dihydrocelastrol diacetate and
curcumin, as well as other HSP inducers known to the skilled
person, for use in treating a disease selected from the group
consisting of glycogen storage diseases, gangliosidoses, neuronal
ceroid lipofuscinoses, cerebrotendinous cholesterosis, Wolman's
disease, cholesteryl ester storage disease, disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidases, and sialidosis type II.
[0394] It is also an aspect of the present invention to provide a
compound selected from the group of Edelfosine (ET-18-OCH3 or
1-octadecyl-2-methyl-rac-glycero-3-phosphocholine), celecoxib,
rofecoxib, acetyl-salicylic acid, sodium salicylate, indomethacin,
PGA1, PGj2 2-cyclopentene-1-one, peroxidase proliferator-activated
receptor-gamma agonists, vincristine, paclitaxel, pioglitazone,
carboplatin, doxorubicin, fludarabine, ifosfamide cytarabine,
geldanamycin, 17-AAG, 17-DMAG, radicicol, herbimycin-A, arachidonic
acid, MG132, lactacystin, DCIC, TLCK, TPCK, geranylgeranylacetone
(GGA), rebamipide, carbenoxolone, polaprezinc (zinc L-carnosine),
dexamethasone, cocaine, nicotine, alcohol, alpha-adrenergic
agonists, cyclopentenone prostanoids, paeoniflorin, glycyrrhizin,
celastrol, dihydrocelastrol, dihydrocelastrol diacetate and
curcumin, as well as other HSP inducers known to the skilled
person, for use in treating a lysosomal storage disease, wherein
said lysosomal storage disease arise from a defect in an enzyme
whose activity is not directly associated with the presence of
lysosomal BMP as a co-factor.
Pharmaceutical Composition According to the Present Invention
[0395] The present invention relates to the use of a bioactive
agent capable of increasing the concentration and/or activity of
Hsp70, thereby benefiting patients suffering from a disease
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II.
[0396] Whilst it is possible for the bioactive agents of the
present invention to be administered as the raw chemical, it is
preferred to present them in the form of a pharmaceutical
formulation. Accordingly, the present invention further provides a
pharmaceutical composition, for medicinal application, which
comprises a bioactive agent of the present invention or
pharmaceutically acceptable salts thereof, as herein defined, and a
pharmaceutically acceptable carrier therefore.
[0397] It is an aspect of the present invention to provide a
composition, such as a pharmaceutical composition, comprising a
bioactive agent identified herein that may be administered to an
individual in need thereof. A pharmaceutical composition is a
composition that is safe to administer to an individual; and may
thus be a pharmaceutically safe composition.
[0398] In one embodiment, the invention relates to a composition
comprising a bioactive agent according to the present invention.
The composition as disclosed herein may in one embodiment be
formulated in combination with a physiologically acceptable
carrier. The composition as disclosed herein may in one embodiment
be formulated in combination with a pharmaceutically acceptable
carrier.
[0399] Pharmaceutical compositions containing a bioactive agent of
the present invention may be prepared by conventional techniques,
e.g. as described in Remington: The Science and Practice of
Pharmacy 1995, edited by E. W. Martin, Mack Publishing Company,
19th edition, Easton, Pa.
[0400] The bioactive agents of the present invention may be
formulated for parenteral administration and may be presented in
unit dose form in ampoules, pre-filled syringes, small volume
infusion or in multi-dose containers with an added preservative.
The compositions may take such forms as suspensions, solutions, or
emulsions in oily or aqueous vehicles, carriers, diluents, or
solvents including aqueous solutions of mineral salts or other
water-soluble molecules, propylene glycol, polyethylene glycol,
vegetable oils, animal oils, synthetic oils, injectable organic
esters, and may contain formulatory agents such as preserving,
wetting, emulsifying or suspending, stabilizing and/or dispersing
agents, colorants, buffers, thickeners, solubilizing agents and the
like. Alternatively, the active ingredient may be in powder form,
obtained by aseptic isolation of sterile solid or by lyophilization
from solution for constitution before use with a suitable vehicle,
e.g., sterile, pyrogen-free water.
[0401] Pharmaceutically acceptable salts of the bioactive agents,
where they can be prepared, are also intended to be covered by this
invention, as are specific hydrate forms of a salt. These salts
will be ones which are acceptable in their application to a
pharmaceutical use. By that it is meant that the salt will retain
the biological activity of the parent compound and the salt will
not have untoward or deleterious effects in its application and use
in treating diseases.
[0402] Pharmaceutically acceptable salts are prepared in a standard
manner. If the parent compound is a base it is treated with an
excess of an organic or inorganic acid in a suitable solvent. If
the parent compound is an acid, it is treated with an inorganic or
organic base in a suitable solvent.
[0403] Any suitable formulation of the bioactive agent according to
the present invention may be employed, known to the skilled
person.
[0404] In one embodiment, the Hsp70, or a functional fragment or
variant thereof, is formulated in a biodegradable microsphere, such
as a liposome.
Administration
[0405] Any suitable route of administration may be employed for
providing a mammal, preferably a human, with an effective amount of
a bioactive agent according to the present invention, wherein said
bioactive agent in one embodiment may be Hsp70, or a functional
fragment or variant thereof.
[0406] Administering bioactive agents or pharmaceutical
compositions to an individual in need thereof may occur via three
major routes of delivery: 1) Topical (applied to body surfaces such
as skin or mucous membranes), 2) Enteral (via the gastrointestinal
or digestive tract) and 3) Parenteral (routes other than the
gastrointestinal or digestive tract).
[0407] Topical administration includes epicutaneous (application
onto the skin), inhalational, enema, eye drops (onto the
conjunctiva), ear drops, intranasal route, and vaginal
administration.
[0408] Enteral administration is any form of administration that
involves any part of the aastrointestinal tract and includes oral
administration (by mouth e.g. tablets, capsules or drops),
intrarectal (e.g. suppository or enema) administration besides by
gastric or duodenal feeding tube.
[0409] Parenteral delivery, such as by injection or infusion, are
effective to deliver the bioactive agent to a target site or to
introduce the drug into the bloodstream, and includes intravenous
(into a vein), intra-arterial (into an artery). intramuscular (into
a muscle), intracardiac (into the heart), subcutaneous (under the
skin), intraosseous (into the bone marrow), intradermal, (into the
skin itself), intrathecal or intraspinal (into the spinal canal),
intraperitoneal, (into the peritoneum), transdermal (diffusion
through the intact skin), transmucosal (diffusion through a mucous
membrane, e.g. insufflation (snorting), sublingual, buccal and
vaginal suppositories), inhalational, epidural (into the epidural
space) and intravitreal (into the eye). Sublingual administration
(under the tongue) is also a form of parenteral administration,
whereby bioactive agents diffuse into the bloodstream through the
mucosal tissue under the tongue. The bioactive agent of the present
invention may be administered by any parenteral route of delivery
and preferably any of the above.
[0410] Parenteral delivery has the advantage of avoiding
degradation in the gastrointestinal tract, as associated with
enteral delivery.
[0411] Parenteral delivery has the further advantage of of
abolishing first pass metabolism, as associated with enteral
delivery, because it allows compounds to be absorbed directly into
the systemic circulation.
[0412] First-pass metabolism is a phenomenon of drug metabolism
whereby the concentration of a drug is greatly reduced before it
reaches the systemic circulation. It is the fraction of lost drug
during the process of absorption which is generally related to the
liver and gut wall.
[0413] After a drug is swallowed, it is absorbed by the digestive
system and enters the hepatic portal system. It is carried through
the portal vein into the liver before it reaches the rest of the
body. The liver metabolizes many drugs, sometimes to such an extent
that only a small amount of active drug emerges from the liver to
the rest of the circulatory system. This first pass through the
liver thus greatly reduces the bioavailability of the drug.
[0414] The four primary systems that affect the first pass effect
of a drug are the enzymes of the gastrointestinal lumen, gut wall
enzymes, bacterial enzymes, and hepatic enzymes.
[0415] Appropriate dosage forms for such administration may be
prepared by conventional techniques. Appropriate dosage forms for
administration by inhalation, such as an aerosol formulation or a
metered dose inhaler, may be prepared by conventional
techniques.
[0416] In one embodiment, a particular mode of administration of a
bioactive agent according to the present invention is by parenteral
administration.
[0417] In one embodiment, a particular mode of parenteral
administration of a bioactive agent of the present invention is by
intravenous, subcutaneous, intramuscular, intraarterial,
subcutaneous or intraperitoneal injection.
[0418] In one embodiment, a particular mode of parenteral
administration of a bioactive agent of the present invention is by
inhalation.
[0419] In one embodiment, a particular mode of parenteral
administration of a bioactive agent of the present invention is by
intravenous infusion.
[0420] Intravenous infusion according to the present invention may
in one embodiment occur over a time period of from 10 minutes to 20
minutes, such as 20 to 30 minutes, for example 30 to 40 minutes,
such as 40 to 50 minutes, for example 50 to 60 minutes, such as 60
to 90 minutes, for example 90 to 120 minutes, such as 2 hours to 3
hours, for example 3 to 4 hours, such as 4 to 5 hours, for example
5 to 6 hours, such as 6 to 7 hours, for example 7 to 8 hours.
[0421] In a particular embodiment, the mode of parenteral
administration of a bioactive agent of the present invention is by
transmucosal delivery. Said transmucosal delivery is in one
embodiment sublingual delivery, in another embodiment said
transmucosal delivery is buccal delivery, and in yet another
embodiment said transmucosal delivery is insufflation or intranasal
delivery.
[0422] Dosage forms include tablets, troches, dispersions,
suspensions, solutions, capsules, creams, ointments, emulsions,
gels, lotions, pastes, aerosols, or other forms known in the
art.
[0423] The effective dosage of active ingredient employed may vary
depending on the particular composition employed, the mode of
administration, the condition being treated and the severity of the
condition being treated. Such dosage may be ascertained readily by
a person skilled in the art.
[0424] In one embodiment, the bioactive agent of the present
invention is administered at a daily dosage of from about 1
microgram to about 100 milligram per kilogram of animal body
weight, given as a single daily dose or in divided doses, or in
sustained release form. The dosage regimen may be adjusted within
this range or even outside of this range to provide the optimal
therapeutic response.
[0425] In one embodiment, the bioactive agent of the present
invention is administered at a dosage of from about 1 .mu.g to
about 10 .mu.g per kg body weight, such as from about 10 .mu.g to
about 50 .mu.g per kg body weight, for example from about 50 .mu.g
to about 100 .mu.g per kg body weight, such as from about 100 .mu.g
to about 250 .mu.g per kg body weight, for example from about 250
.mu.g to about 500 .mu.g per kg body weight, such as from about 500
.mu.g to about 750 .mu.g per kg body weight, for example from about
750 .mu.g to about 1000 .mu.g per kg body weight, such as from
about 1 mg to about 10 mg per kg body weight, for example from
about 10 mg to about 50 mg per kg body weight, such as from about
50 mg to about 100 mg per kg body weight.
[0426] Said dosage may be administered in certain time intervals,
and may be expressed as mg per kg body weight per time unit. Said
time unit may in one embodiment be per minute, such as per hour,
for example per day, such as per week.
Combination Treatment
[0427] It is an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in treatment of a
disease selected from the group consisting of glycogen storage
diseases, gangliosidoses, neuronal ceroid lipofuscinoses,
cerebrotendinous cholesterosis, Wolman's disease, cholesteryl ester
storage disease, disorders of glycosaminoglycan metabolism,
mucopolysaccharidoses, disorders of glycoprotein metabolism,
mucolipidoses, aspartylglucosaminuria, fucosidosis, mannosidoses,
and sialidosis type II in combination with other treatment
modalities.
[0428] It is also an aspect of the present invention to provide a
bioactive agent capable of increasing the intracellular
concentration and/or activity of Hsp70 for use in treatment of a
lysosomal storage disease, wherein said lysosomal storage disease
arise from a defect in an enzyme whose activity is not directly
associated with the presence of lysosomal BMP as a co-factor, in
combination with other treatment modalities.
[0429] The present invention in one aspect relates to a method of
treatment of a disease selected from the group consisting of
glycogen storage diseases, gangliosidoses, neuronal ceroid
lipofuscinoses, cerebrotendinous cholesterosis, Wolman's disease,
cholesteryl ester storage disease, disorders of glycosaminoglycan
metabolism, mucopolysaccharidoses, disorders of glycoprotein
metabolism, mucolipidoses, aspartylglucosaminuria, fucosidosis,
mannosidoses, and sialidosis type II comprising administration of
the bioactive agent according to any the present invention in
combination with at least one other treatment modality.
[0430] Thus, in one embodiment, the bioactive agent according to
the present invention is administered to an individual in need
thereof in combination with at least one other treatment modality,
such as conventional or known treatment modalities for the disease
in question.
[0431] It is understood, that the bioactive agent according to the
present invention may be Hsp70 or a functional fragment or variant
thereof, or an Hsp70 inducer or co-inducer.
[0432] Administering more than one treatment modality in
combination may occur either simultaneously, or sequentially.
Simultaneous administration may be two compounds comprised in the
same composition or comprised in separate compositions, or may be
one composition and one other treatment modality performed
essentially at the same time. Sequential administration means that
the more than one treatment modalities are administered at
different time points, such as administering one treatment modality
first, and administering the second treatment modality
subsequently. The time frame for administering more than one
treatment modality sequentially may be determined by a skilled
person in the art for achieving the optimal effect, and may in one
embodiment be between 30 minutes to 72 hours.
[0433] The treatment modalities in the form of chemical compounds
may be administered together or separately, each at its most
effective dosage. Administering more than one compound may have a
synergistic effect, thus effectively reducing the required dosage
of each drug.
[0434] In one embodiment, the bioactive agent according to the
present invention is administered to an individual in need thereof
in combination with one or more of enzyme replacement therapy
(ERT), pain relievers, corticosteroids, a transplantation such as
bone marrow transplantation, cord blood transplantation or stem
cell transplantation, substrate reduction therapy and/or
symptomatic and supportive therapy such as physical therapy.
Hsp70 Increases the Uptake of Compounds
[0435] The present inventors have further shown that Hsp70
increases the endocytic uptake of other molecules (FIG. 4). This
increased uptake may occur independently on Hsp70 due to a passive
mechanism which allows a compound to be more readily taken up by
the cell in the presence of Hsp70, or it may be occur dependently
on Hsp70 due to a direct association with Hsp70.
[0436] The ability of Hsp70 to increase the cellular uptake of
compounds is an advantage in that it allows for Hsp70, or a
functional fragment or variant thereof, administered to cells to be
readily taken up by the cell.
[0437] Further, the ability of Hsp70 to increase the cellular
uptake of compounds is an advantage in combination treatment
regimens, as the presence of Hsp70 may incresase the uptake of both
Hsp70 and the compound given in combination with Hsp70.
[0438] In respect to combination therapy wherein one compound is an
enzyme for ERT, and the other is Hsp70, or a functional fragment or
variant thereof, this may help effectively reduce the amount of
enzyme for ERT needed to achieve an effective intracellular dosis.
This is relevant as ERT is very expensive.
[0439] In the situation in which the bioactive agent according to
the present invention comprises a combination of Hsp70, or a
functional fragment or variant thereof, and an Hsp70 inducer or
co-inducer, the presence of Hsp70 may therefore increase the uptake
of said Hsp70 inducer or co-inducer.
Method of Treatment
[0440] The present invention relates in one aspect to a method for
treating an individual in need thereof.
[0441] It is thus an aspect of the present invention to provide a
method for treatment of a disease selected from the group
consisting of glycogen storage diseases, gangliosidoses, neuronal
ceroid lipofuscinoses, cerebrotendinous cholesterosis, Wolman's
disease, cholesteryl ester storage disease disorders of
glycosaminoglycan metabolism, mucopolysaccharidoses, disorders of
glycoprotein metabolism, mucolipidoses, aspartylglucosaminuria,
fucosidosis, mannosidoses, and sialidosis type II, comprising
administration of the bioactive agent according to the present
invention to an individual in need thereof.
[0442] It is also an aspect of the present invention to provide a
method for treatment of a lysosomal storage disease, wherein said
lysosomal storage disease arise from a defect in an enzyme whose
activity is not directly associated with the presence of lysosomal
BMP as a co-factor, comprising administration of the bioactive
agent according to the present invention to an individual in need
thereof.
[0443] It follows, that in one embodiment said treatment may be
prophylactic, curative or ameliorating. In one particular
embodiment, said treatment is prophylactic. In another embodiment,
said treatment is curative. In a further embodiment, said treatment
is ameliorating.
[0444] The bioactive agent used according to the present invention
may in one embodiment be formulated as a pharmaceutical
composition.
[0445] In one embodiment, said treatment reduces the intracellular
accumulation of substances in an individual in need thereof. Said
substance may be a substance which is normally degraded in the
lysosomes. In one embodiment, said substance is a shingolipid.
[0446] In one embodiment, the treatment according to the present
invention reduces the intracellular accumulation of a lysosomally
degradable substance to less than 100% of the accumulated amount,
such than less than 90% of the accumulated amount, for example less
than 80% of the accumulated amount, such than less than 70% of the
accumulated amount, for example less than 60% of the accumulated
amount, such than less than 50% of the accumulated amount, for
example less than 40% of the accumulated amount, such than less
than 30% of the accumulated amount, for example less than 20% of
the accumulated amount, such than less than 10% of the accumulated
amount, for example less than 5% of the accumulated amount.
[0447] In one embodiment, the treatment according to the present
invention reduces the intracellular accumulation of a lysosomally
degradable substance by at least 5%, such as at least 10%, for
example at least 15%, such as at least 20%, for example at least
25%, such as at least 30%, for example at least 35%, such as at
least 40%, for example at least 45%, such as at least 50%, for
example at least 55%, such as at least 60%, for example at least
65%, such as at least 70%, for example at least 75%, such as at
least 80%, for example at least 85%, such as at least 90%, for
example at least 95%, such as at least 100%.
[0448] The rate of reducing the intracellular concentration of a
lysosomaly degradable substance may depend on factors such as
administration form, dosage regimens and the like.
[0449] In one embodiment, said treatment prolongs the life
expectancy of said individual in need thereof.
[0450] It follows, that the life expectancy may in one embodiment
be increased by between 6 months to 1 year, such as from 1 year to
2 years, for example from 2 to 3 years, such as from 3 to 4 years,
for example from 4 to 5 years, such as from 5 to 6 years, for
example from 6 to 7 years, such as from 7 to 8 years, for example
from 8 to 9 years, such as from 9 to 10 years, for example from 10
to 12 years, such as from 12 to 14 years, for example from 14 to 16
years, such as from 16 to 18 years, for example from 18 to 20
years, such as from 20 to 25 years, for example from 25 to 30
years, such as from 30 to 40 years, for example from 40 to 50
years, such as from 50 to 60 years, for example from 60 to 70
years, such as from 70 to 80 years, for example from 80 to 90
years, such as from 90 to 100 years.
[0451] In one embodiment life expectancy is increased by at least 6
months, such as at least 1 year, such as at least 2 years, for
example 3 years, such as at least 4 years, for example 5 years,
such as at least 6 years, for example 7 years, such as at least 8
years, for example 9 years, such as at least 10 years, for example
12 years, such as at least 14 years, for example 16 years, such as
at least 18 years, for example 20 years, such as at least 25 years,
for example 30 years, such as at least 40 years, for example 50
years, such as at least 60 years, for example 70 years, such as at
least 80 years, for example 90 years, such as at least 100
years.
[0452] It is an aspect of the present invention to provide a method
for prolonging life expectancy in a patient with a lysosomal
storage disease, wherein said lysosomal storage disease arise from
a defect in an enzyme whose activity is not directly associated
with the presence of lysosomal BMP as a co-factor, wherein said
method comprises administration of the bioactive agent according to
the present invention to an individual in need thereof.
[0453] It is also an aspect of the present invention to provide a
method for prolonging life expectancy in a patient with a disease
selected from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II, wherein said method comprises administration of the
bioactive agent according to the present invention to an individual
in need thereof.
[0454] In one embodiment, the present invention relates to a method
for prolonging life expectancy in a patient with a disease selected
from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II, wherein said method comprises administration of the
bioactive agent according to the present invention to an individual
in need thereof, wherein said life expectancy is increased by
between 6 months to 1 year, such as from 1 year to 2 years, for
example from 2 to 3 years, such as from 3 to 4 years, for example
from 4 to 5 years, such as from 5 to 6 years, for example from 6 to
7 years, such as from 7 to 8 years, for example from 8 to 9 years,
such as from 9 to 10 years, for example from 10 to 12 years, such
as from 12 to 14 years, for example from 14 to 16 years, such as
from 16 to 18 years, for example from 18 to 20 years, such as from
20 to 25 years, for example from 25 to 30 years, such as from 30 to
40 years, for example from 40 to 50 years, such as from 50 to 60
years, for example from 60 to 70 years, such as from 70 to 80
years, for example from 80 to 90 years, such as from 90 to 100
years.
[0455] In one embodiment, the present invention relates to a method
for prolonging life expectancy in a patient with a disease selected
from the group consisting of glycogen storage diseases,
gangliosidoses, neuronal ceroid lipofuscinoses, cerebrotendinous
cholesterosis, Wolman's disease, cholesteryl ester storage disease,
disorders of glycosaminoglycan metabolism, mucopolysaccharidoses,
disorders of glycoprotein metabolism, mucolipidoses,
aspartylglucosaminuria, fucosidosis, mannosidoses, and sialidosis
type II, wherein said method comprises administration of the
bioactive agent according to the present invention to an individual
in need thereof, wherein said life expectancy is increased by at
least 6 months, such as at least 1 year, such as at least 2 years,
for example 3 years, such as at least 4 years, for example 5 years,
such as at least 6 years, for example 7 years, such as at least 8
years, for example 9 years, such as at least 10 years, for example
12 years, such as at least 14 years, for example 16 years, such as
at least 18 years, for example 20 years, such as at least 25 years,
for example 30 years, such as at least 40 years, for example 50
years, such as at least 60 years, for example 70 years, such as at
least 80 years, for example 90 years, such as at least 100
years.
EXAMPLES
Example 1
Interaction between Hsp70 and Bis(nonoacylglycero)phosphate
Activates Acid Sphingomyelinase, Stabilizes Lysosomal Membranes and
Promotes Cell Survival
[0456] Heat shock protein 70 (Hsp70) is an evolutionarily highly
conserved molecular chaperone that promotes the survival of
stressed cells by inhibiting lysosomal membrane permeabilization, a
hallmark of stress-induced cell death. Clues to its molecular
mechanism of action may lay in the recently reported stress- and
cancer-associated translocation of a small portion of Hsp70 to the
lysosomal compartment. Here, we show that Hsp70 stabilizes
lysosomes by enhancing the activity of acid sphingomyelinase (ASM),
a lysosomal lipase that hydrolyzes sphingomyelin to ceramide and
phosphorylcholine. In acidic environment Hsp70 binds with high
affinity and specificity to an endo-lysosomal anionic phospholipid
bis(monoacylglycero)phosphate (BMP), an essential co-factor for
ASM, thereby facilitating the binding of ASM to BMP and stimulating
ASM activity. The inhibition of the Hsp70-BMP interaction by BMP
antibodies or a point mutation (W90A) in Hsp70 as well as the
inhibition of ASM activity by desipramine effectively revert the
Hsp70-mediated stabilization of lysosomes. Notably, the reduced ASM
activity in cells from patients with Niemann-Pick disease A (NPDA),
a severe lysosomal storage disorder caused by mutations in the ASM
gene, is also associated with a dramatic decrease in lysosomal
stability, and this phenotype can be effectively corrected by
restoring the lysosomal ASM activity by treatment with recombinant
Hsp70 or ASM. Taken together, these data open exciting
possibilities for the treatment of lysosomal storage disorders and
cancer with non cell permeable compounds that enter the lysosomal
lumen via the endocytic delivery pathway.
[0457] Lysosomal proteases, cathepsins, are important effectors in
evolutionarily conserved cell death programs induced by a wide
variety of stresses. Cathepsin-dependent cell death is
characterized by an early lysosomal membrane permeabilization and
subsequent translocation of cathepsins into the cytosol, where they
can initiate caspase-dependent and -independent cell death
pathways. In order to test whether the lysosomal localization is
crucial for the reported ability of Hsp70 to stabilize lysosomal
membranes and protect cells against stress-induced cell death, we
took advantage of the endocytic machinery of cells to target
recombinant Hsp70 (rHsp70) into the lysosomes. Immunocytochemical
and biochemical analysis of U-2-OS osteosarcoma cells incubated
with fluorochrome-labeled rHsp70 revealed effective uptake of
rHsp70, its specific co-localization with late endosomal and
lysosomal markers and binding to lysosomal membranes (FIG. 2a,b and
FIG. 3). Using a real time imaging to monitor lysosomal membrane
integrity (FIG. 3c), we showed that the endocytosed rHsp70
protected lysosomes against photo-oxidation (FIG. 3d). Furthermore,
a short interfering RNA (siRNA) specific for Hsp70 sensitized the
lysosomes to photo-oxidation, and this effect was fully reverted by
endocytosed rHsp70 aptly demonstrating that the protective effect
of endogenous Hsp70 is mediated by the small fraction of the
protein in the lysosomal lumen (FIG. 3e). In spite of similar
uptake (data not shown), no lysosomal stabilization was observed
with recombinant Hsc70 and Hsp70-2, which are 86% and 84% identical
to the amino acid sequence of with Hsp70, respectively (FIG.
3d).
[0458] The presence of Hsp70 in the lysosomal membranes and its
ability to survive the hydrolytic lysosomal environment suggest
that it binds to the lysosomal membrane lipids. Thus, we
investigated the interaction of Hsp70 with
palmitoyl-oleoyl-phosphatidylcholine (POPC) large unilamellar
vesicles (LUVs) containing various membrane-associated anionic
lipids, i.e. palmitoyl-oleoyl-phosphatidylserine (POPS; primarily
in plasma membrane), cardiolipin (primarily mitochondrial) and BMP
(primarily in late endosomes/lysosomes). Taking into account the
increasingly acidic milieu of the endo-lysosomal compartment upon
maturation to lysosomes, we compared the protein-lipid interactions
in neutral (pH 7.4) and acidic (pH 6.0) conditions. At pH 7.4,
rHsp70 caused a little relative change in the 90.degree. light
scattering in POPC liposomes indicating a very weak binding. As
reported earlier for POPS, all negatively charged lipids enhanced
the binding of rHsp70 to the liposomes at neutral pH approximately
4-fold irrespective of the charge density on the liposome surface
(ranging from -1 to -2). Remarkably, the binding to BMP was almost
20 times stronger at the acidic pH as compared to the neutral pH,
whereas the binding to POPS was only slightly increased upon
acidification. The high affinity binding of Hsp70 to BMP in acidic
pH was confirmed in an independent set of BIAcore experiments.
Importantly, BMP antibodies delivered to the endo-lysosomal
compartment by endocytosis effectively inhibited the ability of
rHsp70 to stabilize the lysosomes in living cells, and sensitized
the cells to cisplatin, an anti-cancer drug that induces lysosomal
leakage.
[0459] In order to investigate which part of the Hsp70 protein is
responsible for the BMP binding, we measured the fluorescence shift
of the tryptophans upon docking of rHsp70 and its mutants into
BMP-containing liposomes. The loss of signal in relative peak
fluorescence intensity for the Hsp70 mutant lacking amino acids
119-426 in the amino-terminal ATPase domain
(rHsp70-.quadrature.ATP), but not for that lacking amino acids
437-617 in the carboxy-terminal peptide-binding domain (rHsp70-
.quadrature.PBD), indicated that the ATPase domain was required for
the high affinity binding of Hsp70 to BMP (FIG. 6d). Next, we
substituted the two tryptophans in Hsp70 with phenylalanines (W90F
and W580F) and studied which tryptophan is responsible for the
fluorescence shift induced by lipid binding. The reduction of the
signal only with rHsp70-W90F indicated that the NH.sub.2-terminus
of the protein docked into the lipid layer. A more quantitative
BIAcore analysis of the BMP- rHsp70 interaction confirmed that
Hsp70 interacted with BMP mainly through its ATPase domain.
Surprisingly, the W90F mutation specifically abolished the
interaction between rHsp70 and BMP whilst retaining the structural
(folding as analyzed by far- and near-UV circular dichroism) and
functional (luciferase folding and ATP hydrolysis) aspects of the
Hsp70 chaperone. Thus, the rHsp70-W90F mutant provided us with an
invaluable tool to further test whether the direct interaction
between Hsp70 and BMP endows Hsp70 with its lysosome protective
attributes. Indeed, the rHsp70-W90F mutant had completely lost its
ability to protect the lysosomal membranes against photo-oxidation
and cells against cisplatin-induced lysosomal cell death, whereas
the rHsp70-W580F mutant showed the same protective effect as the
wild-type protein. Importantly, mutant Hsp70 proteins were
endocytosed essentially as effectively as the wild type Hsp70.
[0460] Because the concentration of BMP increases in endocytic
vesicles as the endosomes matures to form lysosomes, the
pH-regulation might be the way by which Hsp70 is targeted to
lysosomes. Calculations (PROTPARAM, EXPaSy proteomics server, Swiss
Institute of Bioinformatics) revealed that the ATPase domain of
Hsp70 has 1.72 units higher theoretical pI than the peptide-binding
domain (6.62 vs. 4.9). This characteristic suggests that at acidic
pH, the ATPase domain is preferentially positively charged, which
could facilitate its interaction with anionic lipids. Our data
demonstrating the dependence of Hsp70-BMP interaction on acidic pH
and the ATPase domain support this theory. Furthermore, molecular
modeling of the electrostatic surface of the ATPase domain of Hsp70
revealed that it forms an almost wedge-like structure with a
predominantly positive charge at the bottom of the wedge containing
W90 possibly explaining the profound impact of W90F mutation on the
ability of Hsp70 to interact with BMP and stabilize lysosomes.
[0461] BMP binds ASM with high affinity and stimulates its ability
to hydrolyze sphingomyelin to ceramide and phosphorylcholine. The
BlAcore analysis revealed that pretreatment of the BMP-containing
LUVs with rHsp70 at sub-equimolar concentrations facilitated the
subsequent binding of ASM, whereas higher rHsp70 concentrations
showed an inhibitory effect. Remarkably, Hsp70 transgenic murine
embryonic fibroblasts (Hsp70-MEFs), which are protected against
stress-induced lysosomal damage, displayed significantly higher ASM
activity than wild type MEFs (WT-MEFs), and the treatment of
WT-MEFs with rHsp70 at a cytoprotective concentration (300 nM)
increased the ASM activity to the level comparable to that in
Hsp70-MEFs. In order to test whether ASM is responsible for the
lysosome stabilizing effect we treated the cells with desipramine,
a well characterized pharmacological ASM inhibitor. Desipramine
reduced the viability of MEFs in a dose-dependent manner and the
cell death was associated with a massive permeabilization of
lysosomes as demonstrated by the leakage of lysosomal cathepsins
into the cytosol. Notably, desipramine-induced cell death and
lysosomal leakage were significantly reduced in Hsp70-MEFs as
compared to WT-MEFs. Furthermore, inhibition of ASM with subtoxic
concentration of desipramine reverted the lysosomal stress
resistance of Hsp70-MEFs to the level of WT-MEFs as evidenced by
accelerated loss of lysosomal membrane integrity upon
photo-oxidation (FIG. 7e). The lysosome protective role of ASM was
further supported by data showing that lysosomes in fibroblasts
from patients with NPDA, a fatal lysosomal storage disorder caused
by mutations in the ASM gene, displayed extreme sensitivity to
photo-oxidation-induced damage. Remarkably, rHsp70 was also capable
of enhancing the enzymatic activity of the endogenous mutated ASM
as well as the simultaneously loaded rASM in the patient cells. The
increased ASM activity obtained by loading the lysosomes with
rHsp70, rASM or the combination of the two correlated with their
ability to stabilize the lysosomes and to normalize the volume of
the dramatically enlarged lysosomal compartment in NPDA cells (FIG.
8b-d). It should be noted that akin to rHsp70, also rASM localized
to the lysosomes.
[0462] Taken together our data indicate that in Niemann-Pick
Disease, a Hsp70-BMP interaction stabilizes lysosomes via a
mechanism involving the regulation of sphingomyelin metabolism
rather than direct physical stabilization of the membrane. Such an
indirect effect is supported by the fact that BMP is localized
exclusively in the inner membranes of the endo-lysosomal
compartment, where its major function is to support the
disintegration and lipid extraction from lipid vesicles by ASM and
sphingolipid activator proteins. Interestingly, ASM-mediated
increase in lysosomal ceramide concentration modifies the steric
conformation of lysosomal membranes and thereby facilitates their
fusion with other intracellular vesicles and plasma membrane. Thus,
the changes in the lysosomal membrane composition and volume as a
result of the ceramide-induced enhanced fusion capacity may
contribute to the Hsp70-mediated increase in lysosomal stability.
On the other hand, various apoptotic stimuli induce the
translocation of ASM to the outer leaflet of plasma membrane, where
ceramide can form lipid microdomains that function as sites for
activation of membrane-associated signaling molecules involved in
apoptotic signaling. Thus, ceramide may have opposing effects on
cell survival depending on whether it is produced inside the
lysosome or on the plasma membrane.
[0463] The above-described molecular mechanism underlying the
cytoprotective effect of Hsp70 opens new exiting possibilities for
sensitization of cancer cells to agents that induce lysosomal cell
death pathways via specific inhibition of the lysosome stabilizing
function of Hsp70. Vice versa, the ability of exogenously
administered rHsp70 alone or in combination with rASM can be
directly challenged as a novel treatment for NPD patients, whose
therapeutic options are currently limited to aene and stem cell
therapies.
Methods Summary
[0464] WT- and Hsp70-MEFs were generated, immortalized and
maintained as described in the art. Human NPDA fibroblasts (83/24)
originate from a skin biopsy of a 5 month old patient with
hepatosplenomegaly. Recombinant proteins were generated using the
pET-16b vector system and Ni.sup.2+-affinity-purification
(Novagen), and labeled with Alexa Fluor 488 according to
manufacturers protocol (Molecular Probes). To analyze the lysosomal
integrity, we developed a real time imaging method of cells stained
with acridine orange, a metachromatic weak base that accumulates in
the acidic compartment of the cells staining them red and
sensitizing them to photo-oxidation. The photo-oxidation-induced
loss of the lysosomal pH-gradient and leakage of acridine orange to
the cytosol from individual lysosomes was quantified visually as
"loss of red dots" in U2-O-S cells and as a decrease in red and an
increase in green fluorescence by Zeiss LSM DUO Software in
fibroblasts. The total and cytoplasmic (digitonin-extracted)
cathepsin activities were measured in digitonin-treated samples
using zFR-AFC (Enzyme System Products) probe as described in the
art. The tryptophan fluorescence spectra and liposome 90.degree.
light scattering were analyzed in a HEPES buffer (20 mM HEPES, 0.1
mM EDTA, pH as indicated) essentially as described in the art.
Surface plasmon resonance measurements were performed with
immobilized LUN's using a BIAcore 2000 system as described in the
art. Hsp70 siRNA (5'-GCCAUGACGAAAGACAACAAUCUGU-3') and a control
Hsp70 siRNA were transfected with Oligofectamine (Invitrogen).
Immunodetection was performed with standard protocols.
Apoptosis-like cell death and lysosomal membrane permeabilization
were analyzed essentially as described in the art. ASM activity was
analyzed by Amplex Red Sphingomyelinase Assay Kit (A12220) from
Molecular Probes with modifications described in the art.
Statistical analysis was performed using a two-tailed, paired
Student's T-test and all groups of data were tested for the
comparability of their variances using an F-test.
Methods
[0465] Cell Culture and reagents. Human U-2-OS osteosarcoma cells
were cultivated in RPMI 1640 (Invitrogen) supplemented with 6%
heat-inactivated calf serum and penicillin-streptomycin. Hsp70
transgenic and appropriate control MEFs were generated and
maintained as described in the art. Human primary NPDA fibroblasts
where grown in MEF media further supplemented with 1% Na-Pyruvate,
1% HEPES, 1% L-Glutamine. All cells were grown at 37.degree. C. in
a humidified air atmosphere with 5% CO.sub.2 and repeatedly tested
and found negative for mycoplasma. Unless otherwise stated, all
chemicals were purchased from Sigma-Aldrich (Sigma-Aldrich Denmark
A/S).
[0466] Assays for lysosomal integrity. Sub-confluent cells
incubated with 2 .mu.g/ml acridine orange for 15 min at 37.degree.
C. were washed, irradiated and analyzed in Hanks balanced salt
solution complemented with 3% fetal calf serum. Cells for single
cell imaging were selected from 8 pre-defined areas of each well in
transmitted light-mode after which the same cells were immediately
visualized and exposed to blue light from USH102 100W mercury arc
burner (Ushio electric) installed in a U-ULS100HG housing (Olympus)
for 20 sec. Fluorescence microscopy was performed on Olympus IX-70
inverted microscope with a LCPlanF 1 .times.20 objective with
NA=0.40. Loss of lysosomal pH gradient was quantified by counting
the loss of intense red staining. A more elaborate method for
assaying lysosomal integrity was developed to handle the larger
lysosomal compartment of the various fibroblasts used in this
study. Cells for single cell imagine were selected from 8
pre-defined areas of each well in transmitted light-mode after
which the same cells were immediately and continuously exposed to
489 nm light from a 100 mW diode laser while laser scanning
micrographs where captured every 330 ms on a Zeiss LSM LIVE DUO
confocal system in two channels defined by bandpass filters for
495-555 nm (green) and LP650 nm (Red) light. The resulting
timelapse movies where subsequently analysed by the integrated
Zeiss LSM DUO software.
[0467] The total and cytoplasmic (digitonin-extracted) cathepsin
activities were measured in digitonin-treated samples using zFR-AFC
(Enzyme System Products) probe as described in the art.
[0468] Assays for cell viability. Cell density was assessed by the
3-(4,5-dimethylthiazole-2-y)-2,5-diphenyltetrasodiumbromide (MTT,
SIGMA-Aldrich) reduction assay essentially as described in the art.
Apoptosis-like cell death was assessed by staining the cells with
0.05 .infin.g/ml Hoechst 33342 (Molecular Probes) and counting
cells with condensed nuclei in an inverted Olympus IX-70
fluorescent Microscope (Filter U-MWU 330-385 nm). For each
experiment a minimum of eight randomly chosen areas were
counted.
[0469] Immunodetection and microscopy. Primary antibodies used
included mouse monoclonal antibodies against Hsp70 (2H9; kindly
provided by Boris Margulis, Russian Academy of Sciences, St.
Petersburg, Russia), glyceraldehyde-3-phosphate dehydrogenase
(GAPDH; Biogenesis), BMP (6C4), lysosomal integral membrane
protein-1 (H5C6; developed by J. Thomas August and James E. K.
Hildreth and obtained from the Developmental Studies Hybridoma Bank
developed under the auspices of the NICHD and maintained by The
University of Iowa, Department of Biological Sciences, Iowa City,
USA). Proteins separated by 10% SDS-PAGE and transferred to a
nitrocellulose membrane were detected by using indicated primary
antibodies, appropriate peroxidase-conjugated secondary antibodies
from Dako, ECL Western blotting reagents (Amersham), and
Luminescent Image Reader (LAS-1000Plus, Fujifilm). For
immunocytochemistry Alexa Fluor.RTM.-576- or Alexa
Fluor.RTM.-488-conjugated secondary antibodies were used.
Lysotracker Red.RTM. was used for live visualization of the
lysosomal comp& ment. Fluorescence images were taken using a
Zeiss Axiovert 100M laser scanning microscope. Lysotracker
quantification and timelapse movies for lysosomal integrity were
done on a Zeiss LSM LIVE DUO system.
[0470] Toptophan fluorescence spectra and Liposome 90.degree. light
scattering. The tryptophan fluorescence spectra (RFI) and liposome
90.degree. light scattering (RSI) were analyzed in a HEPES buffer
(20 mM HEPES, 0.1 mM EDTA, pH 7.4 or 6.0 as indicated) employing
LUVs consisting of indicated lipids essentially as described in the
art. For the RFI, LUVs were added in 10 .mu.M aliquots and spectra
recorded after a 20 mM stabilization period. For the RSI,
recombinant proteins were added in 0.12 nmol aliquots.
[0471] Surface Plasmon Resonance (BIAcore). For preparation of LUVs
a lipid mixture consisting of 10 mol % sphingomyelin, 50 mol %
phosphatidylcholine, 20 mol % cholesterol and 20 mol % BMP
dissolved in organic solvents, was dried under a stream of argon
and rehydrated in Tris/HCl buffer (pH 7.4). The mixture was
freeze-thawed nine times in liquid nitrogen and then in an
incubator at 37.degree. C. After ultrasound bath for 15 min the
mixture was passed 21 times through a polycarbonate membrane with a
pore diameter of 100 mn. Surface plasmon resonance measurements
were performed using a BIAcore 2000 system at 25.degree. C. LUVs
(total lipid concentration 0.1 mM) were immobilized on the surface
of a L1 sensor chip (BIAcore) in PBS (loading buffer). The running
buffer used was sodium acetate buffer (50 mM, pH 4.5). As a
control, acid sphingomyelinase (0.2 .mu.M, 60 .mu.l in running
buffer) was injected directly on the liposome surface. Response
units between 4100 RU-5250RU were obtained. The protein of interest
was injected in running buffer at a flow rate of 20 .mu.l/min at
the concentrations indicated. After injection a dissociation phase
of 10 min was appended. In the case where rASM followed rHsp70,
rASM was added for 180 sec after the 10 min rHsp70-dissociation
phase followed by yet a 10 min dissociation phase.
[0472] Molecular modeling. Primary structure analysis as well as
molecular modeling were done with software available from the
Expert Protein Analysis System (EXPaSy) proteomics server of the
Swiss Institute of Bioinformatics (http://expasy.org/). Molecular
modeling was done on basis of the crystal structure of the human
Hsp70-ATPase domain (pdb code: 1S3X) and the human Hsc70 substrate
binding domain (pdb code: 7HSC) with DeepView-Swiss PDB Viewer.
Surface models were based on coulomb interaction at pH 7.0 using a
solvent dielectric constant of 80 (H.sub.2O).
[0473] Statistical analysis. Statistical analysis was performed
using a two-tailed, paired Student's T-test in order to evaluate
the null-hypothesis. The cut-off level for statistical significance
was set to 5% and all groups of data tested for the comparability
of their variances using an F-test. All statistics were done on a
minimum of n=3 independent experiments.
Example 2
NPC1 In Vivo Pilot Study
Aims
[0474] Determine in vivo effects of HSP70 treatment on the
following measures of NPC pathology [0475] Physical outcomes (body
weight, organ weight & survival) [0476] Behavioural changes in
tremor, gait & rearing [0477] Biochemical changes in storage
lipids (cholesterol, GSLs and sphingosine) [0478]
Immunohistochemical analysis of cerebellar pathology (extent of
Purkinje cell loss)
Experiments
Treatment Regime
[0479] Eight treated (rHSP70) NPC.sup.-/- versus eight control (PBS
only) NPC controls. Mice were treated IP three times per week with
either 10 mg/kg of rHSP70 or vehicle alone (PBS) from 3 weeks of
age. Three control and three treated mice were sacrificed at 7 or 9
weeks old (i.e. after 4 or 6 weeks of treatment, respectively).
Organs were perfused (PBS), weighed and frozen for biochemical and
immunohistochemical analysis.
Behavioural Analysis
[0480] Behavioural experiments were performed from 3 weeks of age,
as described previously. Briefly, tremor analysis was performed
using an automated tremor monitor (San Diego instruments) Gait
analysis was performed by painting front and hind paws with
non-toxic paint and allowing the mice to walk over Whatman 3M
paper. Paw placement was measured to determine how closely their
hind paws superimposed their front paws, the length of the stride
and the width of their gait.
[0481] Rearing analysis was performed only at 9 and 10 weeks of
age. Briefly, animals are allowed to acclimatise in an open field
box. After 5', counts are made of the activity of the mice
including the number of times the animal rears in the centre of the
box without support, or at the edges of the box using the walls for
support.
Biochemical Analysis
[0482] Organs were homogenised without any added buffer and frozen
as 10 ul aliquots. Fresh aliquots were reconstituted to 100 ul with
PBS prior to biochemical analysis. Protein determination for each
aliquot was perfolined by BCA protein assay. Cholesterol assays
were perfolined using the Amplex Red Cholesterol Assay from
Invitrogen.sup.i. Sphingosine was isolated by sphingoid base
extraction and analysed by HPLC.sup.i. GSLs were extracted and
analysed by fluorescent HPLC.sup.i. All results were standardised
for protein content.
Immunohistochemistry
[0483] Perfused brains were embedded in OCT and snap frozen in
isopentane on dry-ice. Brains were sectioned onto gelatine coated
slides and stored at -80 C prior to antibody staining.
Results
[0484] Growth Curves (refer to FIG. 12)
[0485] Control animals (upper panel) appear to have shallower
growth curves than the treated animals, which rise more steadily
and reach higher weights.
Organ Weights
[0486] No differences in organ weights were recorded.
Survival
[0487] Due to the small number of animals remaining after the 7 and
9 week time points we were unable to draw any conclusions regarding
increased survival. Video recording of the mice at 9 and 10 weeks
showed the HSP70 treated animals were larger, with better coat
condition. Additionally they were more active and had increased
tremor, which appeared to get worse upon voluntary movement.
[0488] At the point of culling, the treated mice appeared to have
deteriorated quite badly within the space of a few days.
[0489] The cause may be inadvertently due to the rapid weight loss,
as the drug doses made up a few days prior were effectively
becoming overdoses as the mice got smaller, potentially amplifying
any toxic effects.
Behavioural Results (refer to FIG. 13)
[0490] HSP70 treated mice showed increased tremor from 3 weeks of
treatment and remained increased until endstage. This tremor was
particularly pronounced in the lowest frequency range and was
clearly visible to the naked eye.
[0491] Gait analysis showed no difference in any of the three
variables measured (front:hind paw placement, stride length or gait
width)
[0492] Rearing analysis showed no difference after 6 treatment
weeks. On the basis of observing the mice, at 9 weeks we took the
decision to count separately rearing events that were completed
successfully, and those that failed to complete. This showed a
distinct difference between the two groups, as only control mice
failed to complete rearings. This suggests treated mice have better
coordination, though the sample size at this point was low (n=5
treated, n=4 control).
Biochemistry--Cholesterol(refer to FIG. 14)
[0493] At 7 week time point (FIG. 14A) HSP70 treated mice show
significant decreases in peripheral tissue compared to control (n=3
mice in each group, done in duplicates, *=p<0.05, **=p<0.01,
***=p<0.001).
[0494] Brain cholesterol shows decrease, although the decrease only
occurred in one repeat of the experiment, other two showed treated
animals had exactly the same levels as control (n=3 mice in each
group, done in triplicate)
[0495] At 9 week time point (FIG. 14B) there is no difference
between the two groups (n=3 mice in each group, done in
triplicate)
[0496] It should be noted that whilst we have tried to control for
differences within kits by analysing control and treated for each
tissue samples side by side, the total cholesterol levels between
time points might not be directly comparable.
Biochemistry--GSL (refer to FIG. 15)
[0497] At 7 weeks, liver shows a significant reduction of GSLs in
mice treated with HSP70 (p<0.05, *)(FIG. 15A). There are also
reductions in spleen and brain, but are not statistically
significant (probably due to the low n-number).
[0498] By 9 weeks (FIG. 15B), there are no significant differences
between tissues of treated and untreated animals.
[0499] At 9 weeks, the total GSL levels in the brain fall
significantly (p<0.05) in both treated and untreated mice. This
phenomenon is consistent with GSL measurements of NPC1 brain from
previous studies, and is possibly a result of neuronal cell death.
Interestingly, it appears that while control mice undergo a
five-fold reduction of total GSLs, the reduction exhibited by the
treated mice seems less severe.
Biochemistry--Sphingosine (refer to FIG. 16)
[0500] Sphingosine analysis not yet completed for all organs. Data
from 7 and 9 week brains shows that there is no significant
difference between 7 week treated and control animals. Whilst the 9
week time point shows an overall decrease in both groups, the
treated animals retain slight, yet significant (p<0.005, ***)
increased levels of sphingosine in the brain.
Conclusions
Growth Curves
[0501] Indicate a general increase in the health of the mice,
especially at the initial stages.
Behavioural Data
[0502] The increase in tremor is an interesting indicator of an
effect which may originate in CNS (Miglustat shows a similar,
though less extreme effect at high doses in patients).
Biochemistry
[0503] HSP70 treatment results in a reduction of peripheral storage
of cholesterol compared to control mice at 7 weeks, though the
brain is still under contention, as only one of the three repeats
showed a reduction. However, by 9 weeks, cholesterol levels are
equal in the treated and control groups. This may be due to any one
of several factors. Firstly, the mice may be developing antibodies
against the protein, inhibiting its effects and causing the initial
effect of the drug to wear off. Secondly, the high dose may be
causing chronic toxic effects, impacting on cholesterol metabolism
and the overall health of the mice.
[0504] The decrease in cholesterol in the 7 week treated animals is
supported by a concurrent decrease in GSL storage. Peripheral GSLs
in the 9 week treated animals have not changed significantly. GSLs
were reduced in the brain of HSP70 treated 7 week old mice, but the
result was not statistically significant. A larger number of
animals will help clarify this point. At the 9 week time point, the
levels of total GSLs have fallen significantly in both groups. This
fits with historical data which shows marked and significant drop
at the end stage of NPC1 pathology, possibly due to cell death. It
was noted that the drop in GSL's seemed less severe in the treated
brain, but whether this is significant remains unclear.
[0505] This is supported by the sphingosine data, which again
follows historical trends of reduction from 7 to 9 weeks of age
(likely due to cell death), the small yet significant increase in
the treated group may reflect improved cell survival. This issue
will be clearer to interpret once cerebellar Purkinje cell numbers
are measured by immunocytochemistry to give an idea of the rate of
neuronal atrophy/loss in treated animals.
Sequence CWU 1
1
41641PRTHomo sapiens 1Met Ala Lys Ala Ala Ala Ile Gly Ile Asp Leu
Gly Thr Thr Tyr Ser1 5 10 15Cys Val Gly Val Phe Gln His Gly Lys Val
Glu Ile Ile Ala Asn Asp 20 25 30Gln Gly Asn Arg Thr Thr Pro Ser Tyr
Val Ala Phe Thr Asp Thr Glu 35 40 45Arg Leu Ile Gly Asp Ala Ala Lys
Asn Gln Val Ala Leu Asn Pro Gln 50 55 60Asn Thr Val Phe Asp Ala Lys
Arg Leu Ile Gly Arg Lys Phe Gly Asp65 70 75 80Pro Val Val Gln Ser
Asp Met Lys His Trp Pro Phe Gln Val Ile Asn 85 90 95Asp Gly Asp Lys
Pro Lys Val Gln Val Ser Tyr Lys Gly Glu Thr Lys 100 105 110Ala Phe
Tyr Pro Glu Glu Ile Ser Ser Met Val Leu Thr Lys Met Lys 115 120
125Glu Ile Ala Glu Ala Tyr Leu Gly Tyr Pro Val Thr Asn Ala Val Ile
130 135 140Thr Val Pro Ala Tyr Phe Asn Asp Ser Gln Arg Gln Ala Thr
Lys Asp145 150 155 160Ala Gly Val Ile Ala Gly Leu Asn Val Leu Arg
Ile Ile Asn Glu Pro 165 170 175Thr Ala Ala Ala Ile Ala Tyr Gly Leu
Asp Arg Thr Gly Lys Gly Glu 180 185 190Arg Asn Val Leu Ile Phe Asp
Leu Gly Gly Gly Thr Phe Asp Val Ser 195 200 205Ile Leu Thr Ile Asp
Asp Gly Ile Phe Glu Val Lys Ala Thr Ala Gly 210 215 220Asp Thr His
Leu Gly Gly Glu Asp Phe Asp Asn Arg Leu Val Asn His225 230 235
240Phe Val Glu Glu Phe Lys Arg Lys His Lys Lys Asp Ile Ser Gln Asn
245 250 255Lys Arg Ala Val Arg Arg Leu Arg Thr Ala Cys Glu Arg Ala
Lys Arg 260 265 270Thr Leu Ser Ser Ser Thr Gln Ala Ser Leu Glu Ile
Asp Ser Leu Phe 275 280 285Glu Gly Ile Asp Phe Tyr Thr Ser Ile Thr
Arg Ala Arg Phe Glu Glu 290 295 300Leu Cys Ser Asp Leu Phe Arg Ser
Thr Leu Glu Pro Val Glu Lys Ala305 310 315 320Leu Arg Asp Ala Lys
Leu Asp Lys Ala Gln Ile His Asp Leu Val Leu 325 330 335Val Gly Gly
Ser Thr Arg Ile Pro Lys Val Gln Lys Leu Leu Gln Asp 340 345 350Phe
Phe Asn Gly Arg Asp Leu Asn Lys Ser Ile Asn Pro Asp Glu Ala 355 360
365Val Ala Tyr Gly Ala Ala Val Gln Ala Ala Ile Leu Met Gly Asp Lys
370 375 380Ser Glu Asn Val Gln Asp Leu Leu Leu Leu Asp Val Ala Pro
Leu Ser385 390 395 400Leu Gly Leu Glu Thr Ala Gly Gly Val Met Thr
Ala Leu Ile Lys Arg 405 410 415Asn Ser Thr Ile Pro Thr Lys Gln Thr
Gln Ile Phe Thr Thr Tyr Ser 420 425 430Asp Asn Gln Pro Gly Val Leu
Ile Gln Val Tyr Glu Gly Glu Arg Ala 435 440 445Met Thr Lys Asp Asn
Asn Leu Leu Gly Arg Phe Glu Leu Ser Gly Ile 450 455 460Pro Pro Ala
Pro Arg Gly Val Pro Gln Ile Glu Val Thr Phe Asp Ile465 470 475
480Asp Ala Asn Gly Ile Leu Asn Val Thr Ala Thr Asp Lys Ser Thr Gly
485 490 495Lys Ala Asn Lys Ile Thr Ile Thr Asn Asp Lys Gly Arg Leu
Ser Lys 500 505 510Glu Glu Ile Glu Arg Met Val Gln Glu Ala Glu Lys
Tyr Lys Ala Glu 515 520 525Asp Glu Val Gln Arg Glu Arg Val Ser Ala
Lys Asn Ala Leu Glu Ser 530 535 540Tyr Ala Phe Asn Met Lys Ser Ala
Val Glu Asp Glu Gly Leu Lys Gly545 550 555 560Lys Ile Ser Glu Ala
Asp Lys Lys Lys Val Leu Asp Lys Cys Gln Glu 565 570 575Val Ile Ser
Trp Leu Asp Ala Asn Thr Leu Ala Glu Lys Asp Glu Phe 580 585 590Glu
His Lys Arg Lys Glu Leu Glu Gln Val Cys Asn Pro Ile Ile Ser 595 600
605Gly Leu Tyr Gln Gly Ala Gly Gly Pro Gly Pro Gly Gly Phe Gly Ala
610 615 620Gln Gly Pro Lys Gly Gly Ser Gly Ser Gly Pro Thr Ile Glu
Glu Val625 630 635 640Asp22445DNAHomo sapiens 2ataaaagccc
aggggcaagc ggtccggata acggctagcc tgaggagctg ctgcgacagt 60ccactacctt
tttcgagagt gactcccgtt gtcccaaggc ttcccagagc gaacctgtgc
120ggctgcaggc accggcgcgt cgagtttccg gcgtccggaa ggaccgagct
cttctcgcgg 180atccagtgtt ccgtttccag cccccaatct cagagcggag
ccgacagaga gcagggaacc 240ggcatggcca aagccgcggc gatcggcatc
gacctgggca ccacctactc ctgcgtgggg 300gtgttccaac acggcaaggt
ggagatcatc gccaacgacc agggcaaccg caccaccccc 360agctacgtgg
ccttcacgga caccgagcgg ctcatcgggg atgcggccaa gaaccaggtg
420gcgctgaacc cgcagaacac cgtgtttgac gcgaagcggc tgattggccg
caagttcggc 480gacccggtgg tgcagtcgga catgaagcac tggcctttcc
aggtgatcaa cgacggagac 540aagcccaagg tgcaggtgag ctacaagggg
gagaccaagg cattctaccc cgaggagatc 600tcgtccatgg tgctgaccaa
gatgaaggag atcgccgagg cgtacctggg ctacccggtg 660accaacgcgg
tgatcaccgt gccggcctac ttcaacgact cgcagcgcca ggccaccaag
720gatgcgggtg tgatcgcggg gctcaacgtg ctgcggatca tcaacgagcc
cacggccgcc 780gccatcgcct acggcctgga cagaacgggc aagggggagc
gcaacgtgct catctttgac 840ctgggcgggg gcaccttcga cgtgtccatc
ctgacgatcg acgacggcat cttcgaggtg 900aaggccacgg ccggggacac
ccacctgggt ggggaggact ttgacaacag gctggtgaac 960cacttcgtgg
aggagttcaa gagaaaacac aagaaggaca tcagccagaa caagcgagcc
1020gtgaggcggc tgcgcaccgc ctgcgagagg gccaagagga ccctgtcgtc
cagcacccag 1080gccagcctgg agatcgactc cctgtttgag ggcatcgact
tctacacgtc catcaccagg 1140gcgaggttcg aggagctgtg ctccgacctg
ttccgaagca ccctggagcc cgtggagaag 1200gctctgcgcg acgccaagct
ggacaaggcc cagattcacg acctggtcct ggtcgggggc 1260tccacccgca
tccccaaggt gcagaagctg ctgcaggact tcttcaacgg gcgcgacctg
1320aacaagagca tcaaccccga cgaggctgtg gcctacgggg cggcggtgca
ggcggccatc 1380ctgatggggg acaagtccga gaacgtgcag gacctgctgc
tgctggacgt ggctcccctg 1440tcgctggggc tggagacggc cggaggcgtg
atgactgccc tgatcaagcg caactccacc 1500atccccacca agcagacgca
gatcttcacc acctactccg acaaccaacc cggggtgctg 1560atccaggtgt
acgagggcga gagggccatg acgaaagaca acaatctgtt ggggcgcttc
1620gagctgagcg gcatccctcc ggcccccagg ggcgtgcccc agatcgaggt
gaccttcgac 1680atcgatgcca acggcatcct gaacgtcacg gccacggaca
agagcaccgg caaggccaac 1740aagatcacca tcaccaacga caagggccgc
ctgagcaagg aggagatcga gcgcatggtg 1800caggaggcgg agaagtacaa
agcggaggac gaggtgcagc gcgagagggt gtcagccaag 1860aacgccctgg
agtcctacgc cttcaacatg aagagcgccg tggaggatga ggggctcaag
1920ggcaagatca gcgaggcgga caagaagaag gtgctggaca agtgtcaaga
ggtcatctcg 1980tggctggacg ccaacacctt ggccgagaag gacgagtttg
agcacaagag gaaggagctg 2040gagcaggtgt gtaaccccat catcagcgga
ctgtaccagg gtgccggtgg tcccgggcct 2100gggggcttcg gggctcaggg
tcccaaggga gggtctgggt caggccccac cattgaggag 2160gtagattagg
ggcctttcca agattgctgt ttttgttttg gagcttcaag actttgcatt
2220tcctagtatt tctgtttgtc agttctcaat ttcctgtgtt tgcaatgttg
aaattttttg 2280gtgaagtact gaacttgctt tttttccggt ttctacatgc
agagatgaat ttatactgcc 2340atcttacgac tatttcttct ttttaataca
cttaactcag gccatttttt aagttggtta 2400cttcaaagta aataaacttt
aaaattcaaa aaaaaaaaaa aaaaa 24453641PRTHomo sapiens 3Met Ala Lys
Ala Ala Ala Ile Gly Ile Asp Leu Gly Thr Thr Tyr Ser1 5 10 15Cys Val
Gly Val Phe Gln His Gly Lys Val Glu Ile Ile Ala Asn Asp 20 25 30Gln
Gly Asn Arg Thr Thr Pro Ser Tyr Val Ala Phe Thr Asp Thr Glu 35 40
45Arg Leu Ile Gly Asp Ala Ala Lys Asn Gln Val Ala Leu Asn Pro Gln
50 55 60Asn Thr Val Phe Asp Ala Lys Arg Leu Ile Gly Arg Lys Phe Gly
Asp65 70 75 80Pro Val Val Gln Ser Asp Met Lys His Trp Pro Phe Gln
Val Ile Asn 85 90 95Asp Gly Asp Lys Pro Lys Val Gln Val Ser Tyr Lys
Gly Glu Thr Lys 100 105 110Ala Phe Tyr Pro Glu Glu Ile Ser Ser Met
Val Leu Thr Lys Met Lys 115 120 125Glu Ile Ala Glu Ala Tyr Leu Gly
Tyr Pro Val Thr Asn Ala Val Ile 130 135 140Thr Val Pro Ala Tyr Phe
Asn Asp Ser Gln Arg Gln Ala Thr Lys Asp145 150 155 160Ala Gly Val
Ile Ala Gly Leu Asn Val Leu Arg Ile Ile Asn Glu Pro 165 170 175Thr
Ala Ala Ala Ile Ala Tyr Gly Leu Asp Arg Thr Gly Lys Gly Glu 180 185
190Arg Asn Val Leu Ile Phe Asp Leu Gly Gly Gly Thr Phe Asp Val Ser
195 200 205Ile Leu Thr Ile Asp Asp Gly Ile Phe Glu Val Lys Ala Thr
Ala Gly 210 215 220Asp Thr His Leu Gly Gly Glu Asp Phe Asp Asn Arg
Leu Val Asn His225 230 235 240Phe Val Glu Glu Phe Lys Arg Lys His
Lys Lys Asp Ile Ser Gln Asn 245 250 255Lys Arg Ala Val Arg Arg Leu
Arg Thr Ala Cys Glu Arg Ala Lys Arg 260 265 270Thr Leu Ser Ser Ser
Thr Gln Ala Ser Leu Glu Ile Asp Ser Leu Phe 275 280 285Glu Gly Ile
Asp Phe Tyr Thr Ser Ile Thr Arg Ala Arg Phe Glu Glu 290 295 300Leu
Cys Ser Asp Leu Phe Arg Ser Thr Leu Glu Pro Val Glu Lys Ala305 310
315 320Leu Arg Asp Ala Lys Leu Asp Lys Ala Gln Ile His Asp Leu Val
Leu 325 330 335Val Gly Gly Ser Thr Arg Ile Pro Lys Val Gln Lys Leu
Leu Gln Asp 340 345 350Phe Phe Asn Gly Arg Asp Leu Asn Lys Ser Ile
Asn Pro Asp Glu Ala 355 360 365Val Ala Tyr Gly Ala Ala Val Gln Ala
Ala Ile Leu Met Gly Asp Lys 370 375 380Ser Glu Asn Val Gln Asp Leu
Leu Leu Leu Asp Val Ala Pro Leu Ser385 390 395 400Leu Gly Leu Glu
Thr Ala Gly Gly Val Met Thr Ala Leu Ile Lys Arg 405 410 415Asn Ser
Thr Ile Pro Thr Lys Gln Thr Gln Ile Phe Thr Thr Tyr Ser 420 425
430Asp Asn Gln Pro Gly Val Leu Ile Gln Val Tyr Glu Gly Glu Arg Ala
435 440 445Met Thr Lys Asp Asn Asn Leu Leu Gly Arg Phe Glu Leu Ser
Gly Ile 450 455 460Pro Pro Ala Pro Arg Gly Val Pro Gln Ile Glu Val
Thr Phe Asp Ile465 470 475 480Asp Ala Asn Gly Ile Leu Asn Val Thr
Ala Thr Asp Lys Ser Thr Gly 485 490 495Lys Ala Asn Lys Ile Thr Ile
Thr Asn Asp Lys Gly Arg Leu Ser Lys 500 505 510Glu Glu Ile Glu Arg
Met Val Gln Glu Ala Glu Lys Tyr Lys Ala Glu 515 520 525Asp Glu Val
Gln Arg Glu Arg Val Ser Ala Lys Asn Ala Leu Glu Ser 530 535 540Tyr
Ala Phe Asn Met Lys Ser Ala Val Glu Asp Glu Gly Leu Lys Gly545 550
555 560Lys Ile Ser Glu Ala Asp Lys Lys Lys Val Leu Asp Lys Cys Gln
Glu 565 570 575Val Ile Ser Trp Leu Asp Ala Asn Thr Leu Ala Glu Lys
Asp Glu Phe 580 585 590Glu His Lys Arg Lys Glu Leu Glu Gln Val Cys
Asn Pro Ile Ile Ser 595 600 605Gly Leu Tyr Gln Gly Ala Gly Gly Pro
Gly Pro Gly Gly Phe Gly Ala 610 615 620Gln Gly Pro Lys Gly Gly Ser
Gly Ser Gly Pro Thr Ile Glu Glu Val625 630 635 640Asp42551DNAHomo
sapiens 4ggaaaacggc cagcctgagg agctgctgcg agggtccgct tcgtctttcg
agagtgactc 60ccgcggtccc aaggctttcc agagcgaacc tgtgcggctg caggcaccgg
cgtgttgagt 120ttccggcgtt ccgaaggact gagctcttgt cgcggatccc
gtccgccgtt tccagccccc 180agtctcagag cggagcccac agagcagggc
accggcatgg ccaaagccgc ggcgatcggc 240atcgacctgg gcaccaccta
ctcctgcgtg ggggtgttcc aacacggcaa ggtggagatc 300atcgccaacg
accagggcaa ccgcaccacc cccagctacg tggccttcac ggacaccgag
360cggctcatcg gggatgcggc caagaaccag gtggcgctga acccgcagaa
caccgtgttt 420gacgcgaagc ggctgatcgg ccgcaagttc ggcgacccgg
tggtgcagtc ggacatgaag 480cactggcctt tccaggtgat caacgacgga
gacaagccca aggtgcaggt gagctacaag 540ggggagacca aggcattcta
ccccgaggag atctcgtcca tggtgctgac caagatgaag 600gagatcgccg
aggcgtacct gggctacccg gtgaccaacg cggtgatcac cgtgccggcc
660tacttcaacg actcgcagcg ccaggccacc aaggatgcgg gtgtgatcgc
ggggctcaac 720gtgctgcgga tcatcaacga gcccacggcc gccgccatcg
cctacggcct ggacagaacg 780ggcaaggggg agcgcaacgt gctcatcttt
gacctgggcg ggggcacctt cgacgtgtcc 840atcctgacga tcgacgacgg
catcttcgag gtgaaggcca cggccgggga cacccacctg 900ggtggggagg
actttgacaa caggctggtg aaccacttcg tggaggagtt caagagaaaa
960cacaagaagg acatcagcca gaacaagcga gccgtgaggc ggctgcgcac
cgcctgcgag 1020agggccaaga ggaccctgtc gtccagcacc caggccagcc
tggagatcga ctccctgttt 1080gagggcatcg acttctacac gtccatcacc
agggcgaggt tcgaggagct gtgctccgac 1140ctgttccgaa gcaccctgga
gcccgtggag aaggctctgc gcgacgccaa gctggacaag 1200gcccagattc
acgacctggt cctggtcggg ggctccaccc gcatccccaa ggtgcagaag
1260ctgctgcagg acttcttcaa cgggcgcgac ctgaacaaga gcatcaaccc
cgacgaggct 1320gtggcctacg gggcggcggt gcaggcggcc atcctgatgg
gggacaagtc cgagaacgtg 1380caggacctgc tgctgctgga cgtggctccc
ctgtcgctgg ggctggagac ggccggaggc 1440gtgatgactg ccctgatcaa
gcgcaactcc accatcccca ccaagcagac gcagatcttc 1500accacctact
ccgacaacca acccggggtg ctgatccagg tgtacgaggg cgagagggcc
1560atgacgaaag acaacaatct gttggggcgc ttcgagctga gcggcatccc
tccggccccc 1620aggggcgtgc cccagatcga ggtgaccttc gacatcgatg
ccaacggcat cctgaacgtc 1680acggccacgg acaagagcac cggcaaggcc
aacaagatca ccatcaccaa cgacaagggc 1740cgcctgagca aggaggagat
cgagcgcatg gtgcaggagg cggagaagta caaagcggag 1800gacgaggtgc
agcgcgagag ggtgtcagcc aagaacgccc tggagtccta cgccttcaac
1860atgaagagcg ccgtggagga tgaggggctc aagggcaaga tcagcgaggc
ggacaagaag 1920aaggttctgg acaagtgtca agaggtcatc tcgtggctgg
acgccaacac cttggccgag 1980aaggacgagt ttgagcacaa gaggaaggag
ctggagcagg tgtgtaaccc catcatcagc 2040ggactgtacc agggtgccgg
tggtcccggg cctggcggct tcggggctca gggtcccaag 2100ggagggtctg
ggtcaggccc taccattgag gaggtggatt aggggccttt gttctttagt
2160atgtttgtct ttgaggtgga ctgttgggac tcaaggactt tgctgctgtt
ttcctatgtc 2220atttctgctt cagctctttg ctgcttcact tctttgtaaa
gttgtaacct gatggtaatt 2280agctggcttc attatttttg tagtacaacc
gatatgttca ttagaattct ttgcatttaa 2340tgttgatact gtaagggtgt
ttcgttccct ttaaatgaat caacactgcc accttctgta 2400cgagtttgtt
tgtttttttt tttttttttt ttttttgctt ggcgaaaaca ctacaaaggc
2460tgggaatgta tgtttttata atttgtttat ttaaatatga aaaataaaat
gttaaacttt 2520aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a 2551
* * * * *
References