U.S. patent application number 15/772186 was filed with the patent office on 2020-06-04 for virus like particle with efficient epitope display.
The applicant listed for this patent is University of Copenhagen. Invention is credited to Mette Orskov Agerbaek, Adam Frederik Sander Bertelsen, Christoph Mikkel Janitzek, Morten Agertoug Nielsen, Ali Salanti, Thor Theander, Susan Thrane.
Application Number | 20200171138 15/772186 |
Document ID | / |
Family ID | 57421596 |
Filed Date | 2020-06-04 |
View All Diagrams
United States Patent
Application |
20200171138 |
Kind Code |
A9 |
Bertelsen; Adam Frederik Sander ;
et al. |
June 4, 2020 |
VIRUS LIKE PARTICLE WITH EFFICIENT EPITOPE DISPLAY
Abstract
The invention relates to a virus like particle (VLP) based
vaccine. The virus-like particle constitutes a non-naturally
occurring, ordered and repetitive antigen array display scaffold
which can obtain a strong and long-lasting immune response in a
subject. The VLP based vaccine may be used for the prophylaxis
and/or treatment of a disease including, but is not limited to,
cancer, cardiovascular, infectious, asthma, and/or allergy
diseases/disorders.
Inventors: |
Bertelsen; Adam Frederik
Sander; (Dragor, DK) ; Salanti; Ali; (Farum,
DK) ; Theander; Thor; (Greve, DK) ; Thrane;
Susan; (Kobenhavn N, DK) ; Janitzek; Christoph
Mikkel; (Kobenhavn S, DK) ; Agerbaek; Mette
Orskov; (Valby, DK) ; Nielsen; Morten Agertoug;
(Birkerod, DK) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
University of Copenhagen |
Copenhagen |
|
DK |
|
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20190022206 A1 |
January 24, 2019 |
|
|
Family ID: |
57421596 |
Appl. No.: |
15/772186 |
Filed: |
October 28, 2016 |
PCT Filed: |
October 28, 2016 |
PCT NO: |
PCT/DK2016/050342 PCKC 00 |
371 Date: |
April 30, 2018 |
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12N 2710/20023
20130101; C12N 2710/20022 20130101; A61K 39/0208 20130101; A61K
39/0011 20130101; A61K 39/015 20130101; A61K 2039/55505 20130101;
A61K 39/0012 20130101; A61K 2039/6075 20130101; A61K 39/0005
20130101; A61K 39/00115 20180801; C12N 7/00 20130101; A61K 2039/625
20130101; A61K 2039/5258 20130101; A61K 39/001106 20180801 |
International
Class: |
A61K 39/02 20060101
A61K039/02; A61K 39/015 20060101 A61K039/015; A61K 39/00 20060101
A61K039/00 |
Foreign Application Data
Date |
Code |
Application Number |
Oct 30, 2015 |
DK |
PA 2015 70699 |
Claims
1. A vaccine comprising: i. a papilloma virus (PV) L1 protein
containing a biotin acceptor site, and ii. a biotin molecule
enzymatically conjugated to said biotin acceptor site, and iii. an
antigen fused to a monovalent streptavidin, wherein the antigen and
PV L1 protein are linked via the interaction between the monovalent
streptavidin and the biotin molecule enzymatically conjugated to
the biotin acceptor site of the PV L1 protein, and wherein i-iii
form a virus like particle displaying said antigen.
2.-7. (canceled)
8. The vaccine according to claim 1, wherein the PV L1 protein is
from a virus infecting mammals.
9. The vaccine according to claim 1, wherein the PV L1 protein is
from the human PV genotype 16 and/or 118.
10. The vaccine according to claim 1, wherein the biotin acceptor
site comprises amino acid sequence SEQ ID NO: 36.
11. The vaccine according to claim 1, wherein the biotin acceptor
site is fused into a loop of the PV L1 protein, the loop selected
from the group consisting of: a DE-loop and an HI-loop of the PV L1
protein.
12. The vaccine according to claim 1, wherein the PV L1 protein
containing the biotin acceptor site is a PV L1 protein derived from
the human PV genotype 16, the PV 1 protein containing the biotin
acceptor site having a PV L1 amino acid sequence wherein residues
134-137 (YAAN) are deleted compared to a wild-type PV L1 amino acid
sequence, and wherein the PV L1 protein contains the biotin
acceptor site in a DE-loop at position 133/138 in the amino acid
sequence of said PV L1 protein.
13. The vaccine according to claim 1, wherein the PV L1 protein
containing the biotin acceptor site is a PV L1 protein derived from
the human PV genotype 16 and contains the biotin acceptor site in
an HI-loop at position 351/352 in the amino acid sequence of said
PV L1 protein.
14. The vaccine according to claim 1, wherein the PV L1 protein
containing the biotin acceptor site is a PV L1 protein derived from
the human PV genotype 118, wherein residues 361-364 (AGKI) are
deleted, and contains the biotin acceptor site in an HI-loop at
position 360/365 of said PV L1 protein.
15. The vaccine according to claim 1, wherein several PV L1
proteins containing the biotin acceptor site are able to form a
virus like particle.
16. The vaccine according to claim 1, wherein the PV L1 protein
containing the biotin acceptor site comprises i. a polypeptide
having an amino acid sequence selected from the group comprising
SEQ ID NO: 3 [DE-loop, HPV genotype 16], SEQ ID NO: 2 [HI-loop, HPV
genotype 16], and SEQ ID NO: 6 [HI-loop, HPV118], or ii. a
biologically active sequence variant of said polypeptide, wherein
the biologically active sequence variant has at least 95% sequence
identity to the sequences comprising SEQ ID NO: 3 [DE-loop, HPV
genotype 16], SEQ ID NO: 2 [HI-loop, HPV genotype 16], SEQ ID NO: 6
[HI-loop, HPV118], wherein the biological activity is an ability to
form a virus like particle.
17. The vaccine according to claim 1, wherein the biotin molecule
is enzymatically conjugated to the biotin acceptor site by a biotin
ligase.
18.-19. (canceled)
20. The vaccine according to claim 1, wherein said antigen is a
protein, peptide and/or an antigenic fragment from the group
comprising cancer-specific polypeptides, polypeptides associated
with cardiovascular diseases, polypeptides associated with asthma,
polypeptides associated with nasal polyposis, polypeptides
associated with atopic dermatitis, polypeptides associated with
eosinophilic esophagitis, polypeptides associated with
hypereosinophilic syndrome, polypeptides associated with
Churg-Strauss syndrome and/or polypeptides associated with
pathogenic organisms.
21.-28. (canceled)
29. The vaccine according to claim 1, wherein the ratio of PV L1
proteins, biotin molecules, and antigens is 1:1:1.
30. The vaccine according to claim 1, wherein the antigen fused to
the monovalent streptavidin further comprises a polyhistidine
tag.
31. The vaccine according to claim 1, wherein the monovalent
streptavidin comprises amino acid sequence SEQ ID NO 37.
32. The vaccine according to claim 1, wherein the monovalent
streptavidin is fused to the antigen in a position selected from
the group comprising an N-terminal end of the antigen, a C-terminal
end of the antigen and/or inserted in-frame into a coding sequence
of the antigen.
33. The vaccine according to claim 1, wherein the monovalent
streptavidin fused to the antigen comprises: i. a polypeptide
having a sequence selected from the group consisting of SEQ ID NO:
18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ
ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:
27, and SEQ ID NO: 28, or ii. a sequence variant of said
polypeptide sequence, wherein the sequence variant has at least 95%
sequence identity to the sequences comprising SEQ ID NO: 18, SEQ ID
NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23,
SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ
ID NO: 28.
34.-42. (canceled)
43. A method of manufacturing a pharmaceutical composition
comprising a vaccine according to claim 1, wherein the method
comprises the steps of: i. obtaining a first polypeptide; a PV L1
protein containing a biotin acceptor site according to any one of
the preceding claims, and ii. obtaining a second polypeptide; a
biotin ligase, according to any one of the preceding claims,
capable of biotinylating the biotin acceptor site, and iii.
obtaining a third polypeptide; an antigen fused to a monovalent
streptavidin according to any one of the preceding claims, and iv.
subjecting the first polypeptide to conditions which enable
formation of virus like particles, and v. enabling enzymatic
biotinylation of the biotin acceptor site of said virus like
particles using said second polypeptide, and vi. obtaining a
vaccine by linkage of the third polypeptide and said virus like
particles via the interaction between the monovalent streptavidin
and the biotin molecule enzymatically conjugated to the biotin
acceptor site of said virus like particles, and vii. generating a
composition comprising said vaccine according to any one of the
preceding claims, thereby obtaining a pharmaceutical
composition.
44. A method for treating and/or preventing a clinical condition in
a subject in need thereof comprising the steps of: i. obtaining at
least one vaccine according to claim 1, and ii. administering said
vaccine to a subject at least once for prophylaxis and/or treatment
of a disease.
45.-52. (canceled)
53. The method of claim 44, wherein the disease is cancer, a
cardiovascular disease, asthma or allergy disease, or an infectious
disease.
Description
FIELD OF INVENTION
[0001] The present invention relates to a technology and method for
making a virus like particle based vaccine with efficient epitope
display and capable of inducing a strong and long-term protective
immune response. The present invention solves the key challenge of
obtaining a virus like particle which presents a larger antigen on
the particle surface at high density, while being regularly spaced,
and with consistent orientation; three critical factors for
obtaining optimal activation of the immune system.
BACKGROUND OF INVENTION
[0002] Vaccines have played, and still play, a major role in
reducing the impact of infectious diseases on global health. The
first generation of vaccines was based on attenuated or inactivated
pathogens. These full-pathogen-based vaccines have proven extremely
effective and, in some cases, have (e.g. small pox) led to the
complete eradication of the target pathogen. There are however
serious concerns associated with using full-pathogens for
immunization as these have been seen to induce severe side effects
at some frequency in populations, underscoring the need to develop
safer vaccines (Plotkin S A et. al 2005). Along with the recent
advances in recombinant DNA technology and genetic engineering,
modern vaccine research has put effort into identifying critical
antigenic targets of neutralizing antibodies with the aim of
developing so called `subunit vaccines` composed solely of
well-defined, purified antigen components (Murray K. et al. 1988).
The immunogenicity of subunit vaccines based on soluble protein is,
unfortunately, low compared to that of full pathogen-based
vaccines. To induce a high-titer antibody response it is thus often
necessary to use high antigen doses, booster administrations, and
co-administration of adjuvants and even so these subunit vaccines
are generally not capable of inducing long-term protective
immunity. This is indeed exemplified by the many vaccine failures
observed with soluble proteins during the past several years and
point to an important fact: that the size and the spatial assembly
of the vaccine antigen component is critical for proper activation
of the immune system, demonstrating the importance of qualitative
immune responses beyond quantitative ones.
[0003] Virus-like particles (VLPs), which are both highly
immunogenic and safe, represent a major advancement in the
development of subunit vaccines, combining many of the advantages
of full pathogen-based vaccines and recombinant subunit vaccines.
VLPs are composed of one or several recombinantly expressed viral
proteins which spontaneously assemble into macromolecular
particulate structures mimicking the morphology of the native virus
coat--but lacking infectious genetic material. The particulate
nature and size of VLPs (22-150 nm) appears to be optimal for
efficient uptake by professional antigen presenting cells,
particularly dendritic cells (DCs) as well as for entry into lymph
vessels (Bachmann, M F, Jennings, G T. 2010). Furthermore, surface
structures presenting an antigen at high density, while being
regularly spaced, and with consistent orientation are
characteristic of microbial surface antigens for which the
mammalian immune system has evolved to respond vigorously to. At
the molecular level, the presentation of an epitope at high
density, while being regularly spaced, and with consistent
orientation enables efficient cross-linking of B-cell receptors
(Bachmann, M F and Zinkernagel, R M. 1997) leading to strong B-cell
responses, even in the absence of T-cell help (Bachmann, M F et
al., 1993; Chackerian et al., 1999; Kouskoff, V. et al., 2000) and
cumulative data from several studies indicate that B-cells, in
fact, discriminate antigen patterns via the degree of surface
Ig-cross-linking and use antigen repetitiveness as a self/nonself
discriminator.
[0004] It has long been an attractive goal to exploit the VLPs as
an immunogenicity-boosting platform for inducing immune responses
against heterologous antigens by using them as molecular scaffolds
for antigen presentation. Traditionally this has been achieved
either by incorporation of antigenic epitopes into VLPs by genetic
fusion (chimeric VLPs) or by conjugating antigens to preassembled
VLPs. The chimeric VLP approach is to date the most common method
for displaying heterologous epitopes on VLPs (Pumpens, P and Grens,
E. 2001; Bachmann, M F and Jennings, G T, 2004a; Chackerian, 2007;
Grgacic, E V L. and Anderson, D A. 2006). However, this strategy is
severely limited by both the size and nature of epitopes that can
be inserted into VLPs, especially in their immunodominant regions,
and it has in general not been possible to insert peptides longer
than 20 amino acids without disrupting the fragile self-assembly
process of the VLPs. In addition, this approach requires that
critical epitopes have already been identified in the target
antigen and that these can be presented in an immunodominant region
on the VLP surface while maintaining its native conformation.
Therefore, despite a still growing understanding of the VLP
structure/assembly process, generating chimeric VLPs is still a
trial-and-error process and it remains impossible to predict
whether individual peptides will be compatible with VLP assembly or
whether insertions will be immunogenic. Finally, due to the small
size of inserted peptide sequences the induced antibody response
will essentially be monoclonal, which in some cases will set a
limit to the potency of protection.
[0005] On the other hand chemical conjugation e.g. through chemical
biotinylation of exposed lysine residues allows the attachment of
diverse kinds of target antigens (incl. non-protein targets) to
VLPs and this approach is generally not restricted by the size of
the antigen (Raja K S. Et al. 2003 and others). However with this
approach it is very challenging, if not impossible, to control the
orientation and the total amount/stoichiometry of the coupled
antigen, affecting both the density and regularity of displayed
epitopes, and thus potentially limiting the immune response. In
addition to this, chemical coupling procedures are rarely
compatible with large scale vaccine production. As a result the
current technologies are not sufficient to ensure VLP display of
antigens at high density, while being regularly spaced, and with
consistent orientation, which are three critical factors for
obtaining strong and long lasting activation of the immune
system.
[0006] In brief: [0007] Induction of a strong and long lasting
immune response to pathogens as well as disease associated antigens
is very difficult to obtain with subunit vaccines. [0008] Virus
like particle (VLP) presentation of antigens has proven to be very
efficient in inducing the highly functional long-term immune
responses. [0009] Coupling of an antigen onto the surface of a VLP,
to ensure a high density display of regularly spaced epitopes, pose
a major biotechnological challenge. [0010] Specifically, the main
challenge of current VLP delivery platforms is to present an
antigen on the surface of the VLP, at high density, and with a
consistent orientation to enable a regular, high density, spacing
of displayed epitopes, which is important for inducing long-term
protective immunity.
SUMMARY OF INVENTION
[0011] The present invention solves the challenges of obtaining a
VLP which presents densely and regularly spaced surface antigens
with consistent orientation, capable of efficiently displaying
epitopes and to induce long-term protective immunity in a subject.
The general concept of the present invention is illustrated in FIG.
1. The present inventors have identified regions of the Papilloma
Virus (PV) VLP where the inventors can insert a biotin acceptor
site, without compromising the self-assembly of the particle. In
addition, the inventors have managed to setup a system to produce
antigens fused to a monovalent streptavidin, which ensures control
of the orientation of the coupled antigen. Enzymatical
biotinylation of the human papilloma virus (HPV) VLPs facilitate
linkage to the monovalent streptavidin/antigen and ensure control
of the overall amount/stoichiometry as well as display of antigens
in a densely and repetitive ordered manner with consistent
orientation which is important for yielding efficient epitope
display and consequently a potent immune response. The described
antigen display scaffold is unique as it for the first time enables
coupling of virtually any antigen at high density on a VLP surface,
thereby presenting ordered arrays of the particular antigens which
are all held in the same orientation, thereby solving three key
issues of mounting an efficient immune response. The system can
both be used to target self-antigens (i.e. break tolerance) as well
as to efficiently target infectious organisms.
[0012] The problems described above are solved by the aspects and
embodiments of the present invention characterized in the claims.
As illustrated in FIG. 1, a main aspect of the present invention
concerns a vaccine for use in the prophylaxis and/or treatment of a
disease wherein the vaccine comprises: [0013] i. a papilloma virus
(PV) L1 protein containing a biotin acceptor site, and [0014] ii. a
biotin molecule enzymatically conjugated to said biotin acceptor
site, and [0015] iii. an antigen fused to a monovalent
streptavidin, wherein the antigen and PV L1 protein are linked via
the interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
the PV L1 protein, and wherein i-iii form a virus like particle
displaying said antigen.
[0016] In another aspect the present invention concerns a vector
comprising at least one polynucleotide encoding [0017] i. a PV L1
protein containing a biotin acceptor site, and [0018] ii. a biotin
ligase capable of biotinylating the biotin acceptor site, and
[0019] iii. an antigen fused to a monovalent streptavidin as
illustrated on FIG. 1.
[0020] In another aspect the present invention concerns a host cell
expressing at least one polypeptide encoded by said
polynucleotide.
[0021] In another aspect the present invention concerns a
composition comprising said vaccine.
[0022] A further aspect of the present invention concerns a method
of manufacturing a pharmaceutical composition comprising said
vaccine, wherein the method comprises the steps of [0023] i.
obtaining a first polypeptide; a PV L1 protein containing a biotin
acceptor site, and [0024] ii. obtaining a second polypeptide; a
biotin ligase, capable of biotinylating the biotin acceptor site,
and [0025] iii. obtaining a third polypeptide; an antigen fused to
a monovalent streptavidin, and [0026] iv. subjecting the first
polypeptide to conditions which enable formation of virus like
particles, and [0027] v. enable enzymatic biotinylating of the
biotin acceptor site of said virus like particles using said second
polypeptide, and [0028] vi. obtaining a vaccine by linkage of the
third polypeptide and said virus like particles via the interaction
between the monovalent streptavidin and the biotin molecule
enzymatically conjugated to the biotin acceptor site of said virus
like particles, and [0029] vii. generating a composition comprising
said vaccine, thereby obtaining a pharmaceutical composition.
[0030] Yet an aspect of the present invention concerns a method of
administering said vaccine to treat and/or prevent a clinical
condition in a subject in need thereof comprising the steps of:
[0031] i. obtaining a composition comprising at least one vaccine,
and/or [0032] ii. administering said composition to a subject at
least once for prophylaxis and/or treatment of a disease.
[0033] In another aspect the present invention concerns a kit of
parts comprising [0034] i. a composition comprising a vaccine, and
[0035] ii. a medical instrument or other means for administering
the vaccine, and [0036] iii. instructions on how to use the kit of
parts.
[0037] An aspect of the invention relates to a method for inducing
an immune response in a subject, the method comprising the steps of
[0038] i. obtaining a composition comprising at least one vaccine,
and [0039] ii. administering said composition to a subject at least
once for prophylaxis and/or treatment of a disease.
DESCRIPTION OF DRAWINGS
[0040] FIG. 1. Schematic representation of the VAR2CSA VLP-vaccine
components and the assembly system.
[0041] a. Structure of HPV16 L1 major capsid protein. The biotin
acceptor sequence (AviTag.TM.) was successfully inserted into the
protruding DE and HI loops and the H4-.beta.J coil (blue boxes) of
the HPV16 L1. Gray boxes represent regions (loops and coils) of the
L1 protein where the AviTag.TM. could not be inserted (FG loop) or
has not been investigated. The VAR2CSA antigen encompasses the
extracellular ID1-ID2a (ID1--Interdomain 1, DBL2X--Duffy binding
like 2X and ID2a--Interdomain 2a) domains of the full-length
VAR2CSA fused at the N-terminus to a previously described
monovalent streptavidin (mSA) (Lim et al., 2011). b. Production
process of HPV16 Avi-L1 VLPs displaying consistently oriented
mSA-VAR2 antigens in a high-density repetitive manner. The HPV16
Avi-L1 and the mSA-vaccine antigen are separately expressed. The
HPV16 Avi-VLPs are subsequently in vitro biotinylated (the triangle
represents BirA ligase) and finally mixed with the soluble
mSA-vaccine antigen. The HPV16 Avi-L1 VLP is theoretically expected
to bind one mSA-VAR2CSA antigen per Avi-L1.
[0042] FIG. 2: Transmission electron microscopy of HPV AviTag-L1
virus-like particles. The TEM pictures shows non-aggregated VLPs
(size range: 28-60 nm) assembled from biotinylated HPV16 L1-Avi
(SEQ ID NO. 1-3) constructs, respectively. Scale bar=200 nm.
[0043] FIG. 3: VLP/mSA-antigen coupling efficiency. The figure
shows SDS-PAGE gels (reduced conditions) with relative amounts of
coupled mSA-antigens (mSA-ID1ID2a-HIS SEQ ID NO. 21;
mSA-IL-5(C63T/C105T) SEQ ID NO. 19; HIS-GMZ2T:ggsmSA SEQ ID NO. 25;
mSA-Her2-ECD|23-686 SEQ ID NO. 18) and AviTag-L1 protein (SEQ ID
NO. 2). There is an estimated 0.8-1.0 mSA-antigen per AviTag-L1
protein in the VLP containing fractions.
[0044] FIG. 4: Transmission electron microscopy of HPV AviTag-L1
virus-like particles coupled with different mSA-antigens
(mSA-ID1ID2a-HIS SEQ ID NO. 21; mSA-IL-5(C63T/C105T) SEQ ID NO. 19;
HIS-GMZ2T:ggsmSA SEQ ID NO. 25; mSA-Her2-ECD|23-686 SEQ ID NO. 18)
and AviTag-L1 protein (SEQ ID NO. 2). The TEM pictures shows
non-aggregated VLPs assembled from biotinylated HPV16 L1-Avi (SEQ
ID NO. 2) constructs, respectively. The apparent average size of
the mSA-antigen coupled VLPs seems (.about.5-10 nm) larger than
corresponding non-coupled VLPs. Scale bar=200 nm.
[0045] FIG. 5. Verification of self-assembly and subsequent in
vitro biotinylation of HPV16 Avi-L1 VLPs
[0046] a. Purification of HPV16 Avi-L1 VLPs (HI) VLPs was performed
by ultracentrifugation (UC) on an iodixanol (Optiprep.TM.)
density-gradient (27%/33%/39%). Subsequent reduced SDS-PAGE
analyses showed the presence of a 56 kDa protein band (theoretical
size of Avi-L1) in the high-density UC fractions [4-6] containing
particulate material. b. Transmission-electron microscopy (TEM)
analysis of material representing UC fraction 4 post UC
purification. To verify the integrity of the chimeric HPV16 Avi-L1
(HI) VLPs, an aliquot of diluted particles was placed on
carbon-coated grids, negatively stained with 2% phosphotungstic
acid (pH=7.0) and examined by transmission electron microscopy
(TEM) using a CM 100 BioTWIN at magnification .times.36,000
(.ANG.), scale bar 80 nm. c. Western blot analysis of fraction 4
post UC purification. The blot demonstrates the presence of HPV16
Avi-L1 (56 kDa) detected by Camvir-1 (lane one) and successful
biotinylation of HPV16 Avi-L1 using Strep-HRP to detect biotin
(lane two).
[0047] FIG. 6. HPV16 Avi-L1 VLP coupled to mSA-ID1-ID2a analyzed by
ultracentrifugation followed by SDS-PAGE, Western blot and TEM
analysis a After coupling of the mSA-ID1-ID2a antigen to the HPV16
Avi-L1 VLPs, excess antigen was removed by UC over an Optiprep.TM.
gradient (27%/33%/39%). Reducing SDS-PAGE analysis showed the
presence of two protein bands corresponding to the size of HPV16
Avi-L1 (56 kDa) and mSA-VAR2CSA (85 kDa), respectively, in the
high-density fractions [4-6] post UC purification. Excess unbound
mSA-VAR2CSA was present in the higher UC fractions [12-14]
containing soluble proteins. b Transmission electron microscopy
(TEM) analysis of material from UC fraction 4 containing HPV16
Avi-L1 VLPs coupled with mSA-VAR2CSA. An aliquot of diluted
particles was placed on carbon-coated grids, negatively stained
with 2% phosphotungstic acid (pH=7.0) and examined by transmission
electron microscopy (TEM) using a CM 100 BioTWIN at
magnification.times.36,000 (.ANG.). Black scale bar 200 nm,
enhanced section white scale bar 40 nm. c Western blot analysis of
fraction 4 post UC purification of mixed HPV16 Avi-L1 and
mSA-VAR2CSA. The blot confirms the presence of HPV16 Avi-L1 and
mSA-VAR2CSA detected by Camvir-1 and .alpha.-PENTA HIS-tag,
respectively.
[0048] FIG. 7. Other PV VLPs with AviTag.TM. inserted in
DE-loop.
[0049] The HPV16 L1 VLP was used as VLP platform for proof of
concept in this study. However, the AviTag.TM. can also be inserted
into the DE loop of the major capsid protein from other papilloma
viruses while retaining the ability to self-assemble into VLPs, as
demonstrated in this figure. a Multiple sequence alignment of the
HPV16 L1, HPV118 L1 and major capsid protein from European Elk
(Alces alces) papilloma virus (PAPVE). b Purification of HPV118
Avi-L1 and PAPVE Avi-L1 VLPs were performed by UC over an
Optiprep.TM. density gradient (27%/33%/39). Subsequent reduced
SDS-PAGE analysis of high-density UC fractions [3-5] show the
presence of a protein band of 56 kDa corresponding to the
full-length Avi-L1 protein. These fractions also contain an intense
protein band of approximately 43 kDa, which may represent a
truncated Avi-L1 product.
[0050] FIG. 8. Reactivity of sera from vaccinated mice by
ELISA.
[0051] C57BL/6 mice were immunized three times with three-week
intervals. Serum samples were collected two weeks after each
immunization. Total VAR2CSA-specific immunoglobulin was measured in
a serial dilution of mouse anti-sera by ELISA using recombinant
VAR2CSA as the solid phase capturing antigen. HRP conjugated
anti-mouse Ig antibodies were used for detection by measuring
absorbance at OD 490 nm. Serum reactivity from individual mice
vaccinated with mSA-VAR2CSA coupled HPV16 Avi-L1 (HI) VLPs (blue)
or uncoupled mSA-VAR2CSA (red) are shown after first (a), second
(b) and third (c) immunization where each line shows the reactivity
of one animal. Green curves represent sera from mice vaccinated
with soluble naked VAR2CSA and is a pool of sera obtained after
2.sup.nd and 3.sup.rd bleed.
[0052] FIG. 9. Display of VAR2CSA on HPV16 L1-AviTag VLPs assessed
by parasite inhibition assay.
[0053] The functional antibody response was assessed by measuring
the capacity of mouse anti-sera to inhibit binding between native
VAR2CSA expressed on parasitized erythrocytes and CSA in a static
binding-assay. P. falciparum (FCR3 genotype)-infected red blood
cells, expressing the native VAR2CSA, were first incubated with
mouse anti-serum (4 fold dilution series, starting from 1:50) and
then allowed to incubate on decorin coated plates for 90 min.
Unbound IE were washed away and the remaining IEs were quantified.
Normalized parasite binding after incubation with pooled anti-sera
from mice (n=5) vaccinated with mSA-VAR2CSA-coupled HPV16 Avi-L1
VLPs (blue) or soluble mSA-VAR2CSA (red) are shown after first (a),
second (b) and third (c) immunization. The green piles in FIG. 6c
represent anti-sera from mice vaccinated with soluble naked VAR2CSA
and is a pool of sera from 2.sup.nd and 3.sup.rd bleed.
[0054] FIG. 10. Control experiment where unbiotinylated VLPs were
mixed with mSA-VAR2CSA. SDS PAGE shows that ultracentrifugation
efficiently separated soluble mSA-VAR2CSA from unbiotinylated
VLPs.
[0055] FIG. 11. Immuno-tolerance to a cancer-associated
self-antigen "Survivin". a. All the survivin-VLP (mSA-Survivin
coupled to HPV Avi-L1 (HI-LOOP)) immunized mice (n=3) induced
high-titre antibody responses against the mSA-survivin
self-antigen, whereas the negative control vaccine was not able to
break immune-tolerance in the immunized mice (no sero-conversion).
b. The same anti-sera in ELISA using the mSA-survivin as the solid
phase capturing antigen, showing that the negative control mice did
produce antibodies against the `foreign` mSA part.
DETAILED DESCRIPTION OF THE INVENTION
[0056] The present invention solves the challenge of conjugating
larger proteins (e.g. full length antigens) at high density and in
a consistent orientation onto the surface of a VLP, thereby
obtaining VLPs presenting densely and repetitive arrays of
heterologous epitopes. The solution of the present invention
represents a novel approach for making a versatile VLP-based
vaccine delivery platform capable of efficiently displaying antigen
epitopes and of inducing long-term protective immunity.
[0057] A general aspect of the present invention is illustrated in
FIG. 1b.
Definitions
[0058] The term "PV" refers to papillomavirus.
[0059] The term "L1 protein" refers to the major capsid L1 protein
from papillomavirus, which has the ability to spontaneously
self-assemble into virus-like particles (VLPs). The L1 proteins of
the present invention are displaying antigens.
[0060] The term "virus like particle" or "VLP" refers to one or
several recombinantly expressed viral proteins which spontaneously
assemble into macromolecular particulate structures mimicking the
morphology of a virus coat, but lacking infectious genetic
material.
[0061] The term "self-assembly" refers to a process in which a
system of pre-existing components, under specific conditions,
adopts a more organised structure through interactions between the
components themselves. In the present context, self-assembly refers
to the intrinsic capacity of L1, the major capsid protein of
papillomavirus to self-assemble into virus-like particles in the
absence of L2 or other papillomavirus proteins, when subjected to
specific conditions. The self-assembly process may be sensitive and
fragile and may be influenced by factors such as, but not limited
to, choice of expression host, choice of expression conditions, and
conditions for maturing the virus-like particles.
[0062] The term "consistent orientation", as used herein, refers to
the orientation of the monomeric streptavidin/antigen constructs of
the present invention and their spatial orientation to the major
capsid protein of papillomavirus (PV L1) of the present invention.
When linking an antigen fused to a monomeric streptavidin to a PV
L1 protein VLP comprising a biotin acceptor site with a biotin
molecule enzymatically conjugated to the biotin acceptor site, the
monomeric streptavidin can only be linked to a single PV L1
protein, thus creating a uniform and/or consistent presentation of
said antigen with a consistent orientation. In contrast a
streptavidin homo-tetramer may crosslink several PV L1 proteins on
the surface of a VLP, thus creating an irregular and non-consistent
orientation of said antigen. Besides, it is highly challenging to
use a homo-tetramer streptavidin as a bridging molecule e.g. for
conjugating biotinylated antigens onto biotinylated VLPs, since the
multiple biotin binding sites will allow cross-linking and
aggregation of the biotinylated VLPs.
[0063] The term "regularly spaced" as used herein, refers to
antigens of the present invention which forms a pattern on the
surface of a VLP. Such pattern may be symmetric, circle-like,
and/or bouquet like pattern of antigens.
[0064] The term "treatment" refers to the remediation of a health
problem. Treatment may also be preventive and/or prophylactic or
reduce the risk of the occurrence of a disease and/or infection.
Treatment may also be curative or ameliorate a disease and/or
infection.
[0065] The term "prophylaxis" refers to the reduction of risk of
the occurrence of a disease and/or infection. Prophylaxis may also
refer to the prevention of the occurrence of a disease and/or
infection.
[0066] The term "loop" refers to a secondary structure of a
polypeptide where the polypeptide chain reverses its overall
direction and may also be referred to as a turn.
[0067] The term "vaccine cocktail" refers to a mixture of antigens
administered together. A vaccine cocktail may be administered as a
single dose or as several doses administered over a period of time.
Time intervals may be, but not limited to administration within the
same year, month, week, day, hour and/or minute. Co-vaccination and
vaccine cocktail may be used interchangeably.
[0068] The term "self-antigens" refers to endogenous antigens that
have been generated within previously normal cells as a result of
normal cell metabolism, or because of viral or intracellular
bacterial infection.
[0069] The term "biotin acceptor site" refers to a peptide sequence
capable of binding a biotin molecule. Biotin acceptor site and
AviTag are interchangeably used herein.
[0070] The term "sequence variant" refers to a polypeptide and/or
polynucleotide sequence with at least 70%, such as 75%, such as
80%, such as 85%, such as 90%, such as 95%, such as 96%, such as,
97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence
identity to said polypeptide and/or polynucleotide sequence.
[0071] VLP Based Vaccine
[0072] The expression of viral structural proteins, such as
Envelope or Capsid proteins, can result in the self-assembly of
virus-like particles (VLPs). VLPs resemble viruses, but are
non-infectious as they do not contain any viral genetic material.
For the purpose of active immunization VLPs have proven highly
immunogenic and provide a safer alternative to attenuated viruses
since they lack genetic material. Besides, VLPs are a useful tool
for the development of vaccines and can be used as molecular
scaffolds for efficient antigen epitope display. This has been
achieved by either genetic insertion or by chemical conjugation
approaches. However, it has generally not been possible to
incorporate peptides longer than 20 amino acids without disrupting
the self-assembly process of the chimeric VLP. At the same time the
current technologies using chemical conjugation are not sufficient
to enable VLP-presentation of larger proteins at high density and
with a consistent orientation to ensure an orderly, high density,
display of repetitive antigen epitopes, which are critical factors
for obtaining strong and long-lasting immune responses.
[0073] The present inventors have solved these problems by a novel
approach to linking antigens to a PV L1 VLP using a biotin acceptor
site, a biotin molecule and a monovalent streptavidin tag without
disrupting the self-assembly of the VLP. Thus in a main aspect, as
illustrated in FIG. 1b, the present invention concerns a vaccine
for use in the prophylaxis and/or treatment of a disease wherein
the vaccine comprises: [0074] i. a papilloma virus (PV) L1 protein
containing a biotin acceptor site, and [0075] ii. a biotin molecule
enzymatically conjugated to said biotin acceptor site, and [0076]
iii. an antigen fused to a monovalent streptavidin, wherein the
antigen and PV L1 protein are linked via the interaction between
the monovalent streptavidin and the biotin molecule enzymatically
conjugated to the biotin acceptor site of the PV L1 protein, and
wherein i-iii form a virus like particle displaying said
antigen.
[0077] In an embodiment the PV L1 protein containing a biotin
acceptor site is able to form a virus like particle.
[0078] The inventors of the present invention have demonstrated
formation of VLP's using insect cells, such as High Five of Sf9
cells incubated at 28.degree. C. In vitro maturation may occur for
18-24 hours at 30.degree. C.-37.degree. C. Other conditions and
expression hosts (such as Pichia Pastoris) may work as well.
[0079] In an embodiment the antigen is capable of eliciting an
immune reaction in an animal, such as a mammal, such as a cow, pig,
horse, sheep, goat, llama, mouse, rat, monkey, most preferably such
as a human being; or bird such as a chicken, or fish such as a
Salmon.
[0080] It has long been an attractive goal to exploit the VLPs as
an immunogenicity-boosting platform for inducing immune responses
against heterologous antigens by using them as molecular scaffolds
for antigen display. Thus another aspect of the present invention
relates to an antigen display scaffold, comprising an assembled
virus-like particle comprising: [0081] i. a papilloma virus (PV) L1
protein containing a biotin acceptor site, and [0082] ii. a biotin
molecule enzymatically conjugated to said biotin acceptor site, and
[0083] iii. an antigen fused to a monovalent streptavidin, wherein
the antigen and PV L1 protein are linked via the interaction
between the monovalent streptavidin and the biotin molecule
enzymatically conjugated to the biotin acceptor site of the PV L1
protein, and wherein i-iii form an antigen display scaffold.
[0084] Another aspect of the present invention relates to a method
of producing a non-naturally occurring, ordered and repetitive
antigen array comprising [0085] i. a papilloma virus (PV) L1
protein containing a biotin acceptor site, and [0086] ii. a biotin
molecule enzymatically conjugated to said biotin acceptor site, and
[0087] iii. an antigen fused to a monovalent streptavidin, wherein
the antigen and PV L1 protein are linked via the interaction
between the monovalent streptavidin and the biotin molecule
enzymatically conjugated to the biotin acceptor site of the PV L1
protein, and wherein i-iii form a non-naturally occurring, ordered
and repetitive antigen array.
[0088] Diseases and Medical Indications
[0089] The present invention is a novel, generic, and
easy-to-use-approach to conjugate various antigens to a VLP.
Depending on the antigen the VLP-based vaccines of the present
invention can be used for prophylaxis and/or treatment of a wide
range of diseases. The diseases which the present invention may be
used for prophylaxis and/or treatment of include but are not
limited to cancers, cardiovascular diseases, allergic diseases,
and/or infectious diseases.
[0090] In an embodiment an antigen which is associated with at
least one cancer disease is linked to the PV L1 protein via the
interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
the PV L1 protein. In a further embodiment the present VLP vaccine
may be used for prophylaxis and/or treatment of the cancer and/or
cancers which the antigen is associated with.
[0091] In an embodiment an antigen which is associated with at
least one cardiovascular disease is linked to the PV L1 protein via
the interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
the PV L1 protein. In a further embodiment the present VLP vaccine
can be used for prophylaxis and/or treatment of the cardiovascular
disease and/or cardiovascular diseases which the antigen is
associated with.
[0092] In an embodiment an antigen which is associated with at
least one allergic disease is linked to the PV L1 protein via the
interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
the PV L1 protein. In a further embodiment the present VLP vaccine
can be used for prophylaxis and/or treatment of the allergic
disease and/or allergic diseases which the antigen is associated
with.
[0093] In an embodiment an antigen which is associated with at
least one infectious disease is linked to the PV L1 protein via the
interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
the PV L1 protein. In a further embodiment the present VLP vaccine
can be used for prophylaxis and/or treatment of the infectious
disease and/or infectious diseases which the antigen is associated
with.
[0094] A non-exhaustive list of antigens which may be used by the
present invention is outlined in table 1 and table 2. In addition
table 1 show examples of specific diseases the antigens are
associated with as well as examples of patient groups which may be
in need of prophylaxis and/or treatment using the antigen-VLP
vaccines of the present invention.
TABLE-US-00001 TABLE 1 Non-exhaustive list of antigens or parts
hereof that could be used in treatment of specific diseases/medical
indications in various patient groups. Examples of Examples of a
specific antigens (non- disease (non- Examples of patient group
(non- exhaustive) exhaustive) exhaustive) Her2/Neu Breast cancer
Females overexpressing Her2 (ERBB2) Her2/Neu Gastric cancer Males
and Females overexpressing (ERBB2) Her2 Her2/Neu Ovarian cancer
Females overexpressing Her2 (ERBB2) Her2/Neu Uterine serous
Postmenopausal Females (ERBB2) carcinoma overexpressing Her2
Survivin Cancer types Males and non-pregnant Females overexpressing
Survivin overexpressing Survivin PCSK9 cardiovascular disease Males
and Females with dyslipidemia PCSK9 cardiovascular disease Males
and Females with atherosclerosis PCSK9 cardiovascular disease Males
and Females with hypercholesterolemia Interleukin-5 Asthma Males
and Females with eosinophilia Interleukin-5 nasal polyposis Males
and Females with eosinophilia Interleukin-5 atopic dermatitis Males
and Females with eosinophilia Interleukin-5 eosinophilic
esophagitis Males and Females with eosinophilia Interleukin-5
Hypereosinophilic Males and Females with eosinophilia syndrome
Interleukin-5 Churg-Strauss Males and Females with eosinophilia
syndrome Ag85A Tuberculosis Males and Females with tuberculosis
PfRH5 Malaria Males and Females with malaria VAR2CSA Malaria
Females with malaria PfEMP1, CIDR1a Malaria Males and Females with
malaria GLURP Malaria Males and Females with malaria MSP3 Malaria
Males and Females with malaria Pfs25 Malaria Males and Females with
malaria CSP Malaria Males and Females with malaria PfSEA-1 Malaria
Males and Females with malaria
[0095] The disclosed antigens may as well be relevant for the use
in other patient groups and/or against other specific or related
diseases. In an embodiment at least two such as three, four, and/or
five antigens may be combined.
TABLE-US-00002 TABLE 2 Non-exhaustive list of diseases/medical
indications and target antigen/organisms of the present VLP
vaccine. Disease: Target antigen/Organism: Cancer: Her2/Neu
(ERBB2)/Homo Sapiens Survivin (Baculoviral IAP repeat-containing
protein 5)/ Homo Sapiens Cardio- PCSK9 (Proprotein convertase
subtilisin/kexin type 9)/ vascular Homo Sapiens disease: Asthma/
IL-5 (Interleukin-5)/Homo Sapiens Allergies: Tuber- Ag85A
(Diacylglycerol cyltransferase/mycolyltransferase)/ culosis:
Mycobacterium tuberculosis Malaria: Reticulocyte-binding protein
homologue 5 (PfRH5)/ Plasmodium falciparum VAR2CSA (domain,
ID1-ID2a)/Plasmodium falciparum CIDR1a domain of PfEMP1, Plasmodium
falciparum Glutamate rich protein (GLURP)/Plasmodium falciparum
Merozoite surface protein 3 (MSP3)/Plasmodium falciparum 25 kDa
ookinete surface antigen (Pfs25)/Plasmodium falciparum
Circumsporozoite protein (CSP)/Plasmodium falciparum Schizont
egress antigen-1 (PfSEA-1)/Plasmodium falciparum
[0096] The vaccine of the present invention may as well be used
against other diseases and/or use other antigens.
[0097] In an embodiment of the present invention the medical
indication is selected from the group consisting of a cancer, a
cardiovascular disease, an allergy, and/or an infectious disease.
In a particular embodiment the medical indication is an allergy. In
another particular embodiment the medical indication is a
cardiovascular disease. In a most preferred embodiment the medical
indication is a cancer.
[0098] In another embodiment the antigen is a polypeptide, peptide
and/or an antigenic fragment of a polypeptide associated with an
abnormal physiological response such as a cardiovascular disease
and/or an allergic reaction/disease. In a particular embodiment the
abnormal physiological response is a cancer.
[0099] In a further embodiment the antigen is a protein, peptide
and/or an antigenic fragment associated with a medical indication
disclosed in the present invention.
[0100] Cancer and Associated Antigens
[0101] In 2012 more than 14 million adults were diagnosed with
cancer and there were more than 8 million deaths from cancer,
globally. Consequently, there is a need for efficient cancer
therapeutics.
[0102] One characteristic of cancer cells is abnormal expression
levels of genes and proteins. One example of a cancer associated
gene is HER2, which is overexpressed in 20% of all breast cancers
and is associated with increased metastatic potential and poor
patient survival. Although cancer cells express cancer associated
antigens in a way that immunologically distinguishes them from
normal cells, most cancer associated antigens are only weakly
immunogenic because most cancer associated antigens are "self"
proteins which are generally tolerated by the host. The present
invention has solved this problem by an effective antigen-VLP based
vaccine which is capable of activating the immune system to react
against for example cancer associated antigens and overcome the
immunological tolerance to such antigens. Different cancers are
characterized by having different cancer associated antigens.
Survivin is regarded to be overexpressed in most cancer cells and
could also be used in the present invention. Therefore the present
invention may be used in treatment/prophylaxis of most types of
cancers that overexpress a tumor associated antigen.
[0103] The antigen is linked to the PV L1 protein of the present
invention via the interaction between the monovalent streptavidin
and the biotin molecule enzymatically conjugated to the biotin
acceptor site of the PV L1 protein (see FIG. 1b for the general
concept of the present invention). Thereby the present invention
provides effective antigen-VLP based vaccine which is capable of
activating the immune system to react against for example cancer
associated antigens and overcome immunological tolerance to such
antigens. In an embodiment the VLP vaccine of the present invention
can be used for prophylaxis and/or treatment of the cancer which
the antigen is associated with.
[0104] An embodiment of the present invention comprises a cancer
associated antigen linked to the PV L1 protein via the interaction
between the monovalent streptavidin and the biotin molecule
enzymatically conjugated to the biotin acceptor site of the PV L1
protein. In a further embodiment the present VLP vaccine can be
used for prophylaxis and/or treatment of the cancer which the
antigen is associated with.
[0105] In another embodiment the present invention is used in
treatment/prophylaxis of any type of cancer which overexpresses an
antigen. The type of cancer which the invention may be used against
is determined by the choice of antigen.
[0106] It is known that oncovirus can cause cancer. Therefore in an
embodiment the vaccine of the present invention comprises an
oncovirus associated antigen linked to the PV L1 protein via the
interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
the PV L1 protein.
[0107] In a further embodiment the present vaccine can be used for
prophylaxis and/or treatment of the cancer which the antigen is
associated with.
[0108] In an embodiment the antigen is a protein or peptide or an
antigenic fragment of a polypeptide associated with a cancer
selected from the group comprising of Adrenal Cancer, Anal Cancer,
Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain/CNS Tumors in
adults, Brain/CNS Tumors In Children, Breast Cancer, Breast Cancer
In Men, Cancer in Adolescents, Cancer in Children, Cancer in Young
Adults, Cancer of Unknown Primary, Castleman Disease, Cervical
Cancer, Colon/Rectum Cancer, Endometrial Cancer, Esophagus Cancer,
Ewing Family Of Tumors, Eye Cancer, Gallbladder Cancer,
Gastrointestinal Carcinoid Tumors, Gastrointestinal Stromal Tumor,
Gestational Trophoblastic Disease, Hodgkin Disease, Kaposi Sarcoma,
Kidney Cancer, Laryngeal and Hypopharyngeal Cancer, Leukemia, Acute
Lymphocytic in Adults, Leukemia, Acute Myeloid Leukemia, Chronic
Lymphocytic Leukemia, Chronic Myeloid Leukemia, Chronic
Myelomonocytic Leukemia, Leukemia in Children, Liver Cancer, Lung
Cancer, Non-Small Cell Lung Cancer, Small Cell Lung Cancer, Lung
Carcinoid Tumor, Lymphoma, Lymphoma of the Skin, Malignant
Mesothelioma, Multiple Myeloma, Myelodysplastic Syndrome, Nasal
Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer,
Neuroblastoma, Non-Hodgkin Lymphoma, Non-Hodgkin Lymphoma In
Children, Oral Cavity and Oropharyngeal Cancer, Osteosarcoma,
Ovarian Cancer, Pancreatic Cancer, Penile Cancer, Pituitary Tumors,
Prostate Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland
Cancer, Adult Soft Tissue Cancer Sarcoma, Skin Cancer, Basal and
Squamous Cell Skin Cancer, Melanoma Skin Cancer, Merkel Cell Skin
cancer, Small Intestine Cancer, Stomach Cancer, Testicular Cancer,
Thymus Cancer, Thyroid Cancer, Uterine Sarcoma, Vaginal Cancer,
Vulvar Cancer, Waldenstrom Macroglobulinemia, and Wilms Tumor.
[0109] In a preferred embodiment the cancer is selected from the
group consisting of breast cancer, gastric cancer, ovarian cancer,
and uterine serous carcinoma.
[0110] Linking the Her2/Neu (ERBB2) and/or Survivin or an antigenic
fragment hereof to the VLP forms a VLP based vaccine which is
capable of activating the immune system to react against for
example cells with high Her2/Neu (ERBB2) and/or Survivin expression
and overcome immunological tolerance. In an embodiment the Her2/Neu
(ERBB2) and/or Survivin VLP vaccine of the present invention can be
used for prophylaxis and/or treatment of the herein disclosed
cancer disease and/or other cancer diseases. Using a similar
reasoning other cancer disease associated antigen-VLP based
vaccines may be used against any cancer disease.
[0111] In an embodiment the antigen of the present invention is
Her2/Neu (ERBB2) and/or Survivin or an antigenic fragment hereof,
wherein the antigen is associated with and directed against at
least one of the herein disclosed types of cancers.
[0112] In a most preferred embodiment the present invention
concerns a vaccine for use in the prophylaxis and/or treatment of
one of the herein disclosed cancers wherein the vaccine comprises:
[0113] i. a papilloma virus (PV) L1 protein containing a biotin
acceptor site, and [0114] ii. a biotin molecule enzymatically
conjugated to said biotin acceptor site, and [0115] iii. a cancer
associated antigen such as Her2/Neu (ERBB2) and/or Survivin or an
antigenic fragment of Her2/Neu (ERBB2) and/or Survivin fused to a
monovalent streptavidin, wherein the antigen and the PV L1 protein
are linked via the interaction between the monovalent streptavidin
and the biotin molecule enzymatically conjugated to the biotin
acceptor site of the PV L1 protein, and wherein i-iii form a virus
like particle displaying said antigen.
[0116] In an embodiment the antigen fused to a monovalent
streptavidin is selected from the group comprising SEQ ID NO: 18,
SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID
NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, and/or SEQ ID NO: 47 and/or a
sequence variant hereof.
[0117] Cardiovascular Diseases and Associated Antigens
[0118] An estimated 17.3 million people died from cardiovascular
diseases in 2008, representing 30% of all global deaths. Addressing
risk factors such as tobacco use, unhealthy diet and obesity,
physical inactivity, high blood pressure, diabetes and raised
lipids are important for prevention of cardiovascular diseases.
However, the need for preventive pharmaceutical measures is
increasingly important. The present invention may be used in
treatment/prophylaxis of most types of cardiovascular diseases. The
type of cardiovascular disease which the invention may be used
against is decided by the choice of antigen.
[0119] In an embodiment of the invention the antigen is a protein
or peptide or an antigenic fragment of a polypeptide associated
with a disease selected from the group comprising a lipid disorder
such as hyperlipidemia, type I, type II, type III, type IV, or type
V hyperlipidemia, secondary hypertriglyceridemia,
hypercholesterolemia, familial hypercholesterolemia, xanthomatosis,
cholesterol acetyltransferase deficiency, an ateriosclerotic
condition (e.g., atherosclerosis), a coronary artery disease, a
cardiovascular disease, and Alzheimer's disease.
[0120] In an embodiment of the invention the antigen is a protein
or peptide or an antigenic fragment of a polypeptide associated
with a cardiovascular disease. In a further embodiment the
cardiovascular disease is selected from the group consisting of
dyslipidemia, atherosclerosis, and hypercholesterolemia.
[0121] One example of a polypeptide associated with a
cardiovascular disease is PCSK9 which acts in cholesterol
homeostasis. Blockage of PCSK9 has medical significance and can
lower the plasma and/or serum low-density lipoprotein cholesterol
(LDL-C) levels. Reducing LDL-C reduces the risk of for example
heart attacks.
[0122] Linking the PCSK9 antigen to the VLP forms a PCSK9-VLP based
vaccine which is capable of activating the immune system to react
against for example cells with high PCSK9 expression and overcome
immunological PCSK9 tolerance, thereby lowering the LDL-C levels
and the risk of heart attacks. In an embodiment the PCSK9-VLP
vaccine of the present invention can be used for prophylaxis and/or
treatment of the herein disclosed cardiovascular disease and/or
other cardiovascular diseases. Using a similar reasoning other
cardiovascular disease associated antigen-VLP based vaccines may be
used against any cardiovascular disease.
[0123] In a preferred embodiment the antigen comprises PCSK9 or an
antigenic fragment hereof, wherein the antigen is associated with
and directed against at least one of the herein disclosed
cardiovascular disease and/or other cardiovascular diseases.
[0124] In a most preferred embodiment the present invention
concerns a vaccine for use in the prophylaxis and/or treatment of
at least one of the herein disclosed cardiovascular diseases
wherein the vaccine comprises: [0125] i. a papilloma virus (PV) L1
protein containing a biotin acceptor site, and [0126] ii. a biotin
molecule enzymatically conjugated to said biotin acceptor site, and
[0127] iii. a cardiovascular disease associated antigen such as
PCSK9 or an antigenic fragment hereof fused to a monovalent
streptavidin, wherein the antigen and the PV L1 protein are linked
via the interaction between the monovalent streptavidin and the
biotin molecule enzymatically conjugated to the biotin acceptor
site of the PV L1 protein, and wherein i-iii form a virus like
particle displaying said antigen.
[0128] In an embodiment the antigen fused to a monovalent
streptavidin comprise SEQ ID NO: 20 and/or a sequence variant
hereof.
[0129] Asthma or Allergy Diseases and Associated Antigens
[0130] The prevalence of allergic diseases worldwide is rising
dramatically in both developed and developing countries. According
to World Health Organization statistics, hundreds of millions of
subjects in the world suffer from allergic rhinitis and it is
estimated that 300 million have asthma markedly affecting the
quality of life of these individuals and negatively impacting the
socio-economic welfare of society.
[0131] Interleukin 5 (IL-5) has been shown to play an instrumental
role in eosinophilic inflammation in various types of allergies,
including severe eosinophilic asthma. Eosinophils are regulated in
terms of their recruitment, activation, growth, differentiation and
survival by IL-5 which, consequently, has identified this cytokine
as a primary target for therapeutic interventions. Linking an IL-5
antigen or a fragment hereof to the VLP of the present invention
forms an IL-5-VLP based vaccine which is capable of activating the
immune system to react against IL-5. Consequently an IL-5-VLP based
vaccine described in the present invention may be used in the
treatment/prophylaxis of eosinophilic asthma or allergy. Other
allergy-associated antigens (e.g. IgE) may be used by the present
invention using a similar reasoning. The type of asthma or allergy
disease which the invention may be used against is decided by the
choice of antigen. In an embodiment the antigen is a protein or
peptide or an antigenic fragment of a polypeptide associated with
one or more asthma or allergy diseases disclosed herein. In a
preferred embodiment the asthma or allergy is selected from the
group consisting of eosinophilic asthma, allergy, nasal polyposis,
atopic dermatitis, eosinophilic esophagitis, hypereosinophilic
syndrome, and Churg-Strauss syndrome.
[0132] In a preferred embodiment the antigen comprises IL-5 or an
antigenic fragment hereof, wherein the antigen is associated with
and directed against at least one of the herein disclosed asthma or
allergy diseases and/or other asthma or allergy diseases.
[0133] In a most preferred embodiment the present invention
concerns a vaccine for use in the prophylaxis and/or treatment of
one of the herein disclosed asthma or allergy diseases wherein the
vaccine comprises: [0134] i. a papilloma virus (PV) L1 protein
containing a biotin acceptor site, and [0135] ii. a biotin molecule
enzymatically conjugated to said biotin acceptor site, and [0136]
iii. an allergy associated antigen such as IL-5 or an antigenic
fragment hereof fused to a monovalent streptavidin, wherein the
antigen and the PV L1 protein are linked via the interaction
between the monovalent streptavidin and the biotin molecule
enzymatically conjugated to the biotin acceptor site of the PV L1
protein, and wherein i-iii form a virus like particle displaying
said antigen.
[0137] In an embodiment the antigen fused to a monovalent
streptavidin comprises SEQ ID NO: 19 and/or a sequence variant
hereof.
[0138] Infectious Diseases and Associated Antigens
[0139] Tuberculosis and malaria are two major infectious diseases.
In 2012, an estimated 207 million cases of malaria occurred which
resulted in more than 500.000 deaths. Also in 2012, an estimated
8.6 million people developed tuberculosis and 1.3 million died from
the disease. The current methods of treatment are insufficient and
some have resulted in drug resistance. Consequently there is a need
for new and efficient drugs for treatment/prophylaxis of
tuberculosis and malaria. Linking a malaria or tuberculosis
associated-antigen or a fragment hereof to the VLP of the present
invention forms a VLP based vaccine which is capable of activating
the immune system to react against for example malaria or
tuberculosis. Using a similar line of reasoning the present
invention may be used in treatment/prophylaxis of most infectious
disease. The type of infectious disease which the invention may be
used against is decided by the choice of antigen.
[0140] In an embodiment the antigen fused to the monovalent
streptavidin of the present invention is a protein or peptide or an
antigenic fragment of a polypeptide associated with an infectious
disease such as tuberculosis and/or malaria.
[0141] In a further embodiment an antigen from Plasmodium
falciparum is fused to the monovalent streptavidin of the present
invention for use in treatment/prophylaxis of malaria.
[0142] In a further embodiment an antigen from Mycobacterium
tuberculosis is fused to the monovalent streptavidin of the present
invention for use in treatment/prophylaxis of tuberculosis.
[0143] In a further embodiment the antigen is selected from the
group consisting of Ag85A from Mycobacterium tuberculosis, PfRH5
from Plasmodium falciparum, VAR2CSA (domain, ID1-ID2a) from
Plasmodium falciparum, CIDR1a domain, of PfEMP1 from Plasmodium
falciparum, GLURP from Plasmodium falciparum, MSP3 from Plasmodium
falciparum, Pfs25 from Plasmodium falciparum, CSP from Plasmodium
falciparum, and PfSEA-1 from Plasmodium falciparum or an antigenic
fragment of the disclosed antigens. In another embodiment the
antigen comprises a fusion construct between MSP3 and GLURP (GMZ2)
from Plasmodium falciparum.
[0144] In another embodiment the antigen of the present invention
comprises a protein, or an antigenic fragment hereof, from the
pathogenic organism which causes the infectious disease.
[0145] In a most preferred embodiment the present invention
concerns a vaccine for use in the prophylaxis and/or treatment of
one of the herein disclosed infectious diseases wherein the vaccine
comprises: [0146] i. a papilloma virus (PV) L1 protein containing a
biotin acceptor site, and [0147] ii. a biotin molecule
enzymatically conjugated to said biotin acceptor site, and [0148]
iii. an antigen associated with an infectious disease such as Ag85A
from Mycobacterium tuberculosis, PfRH5 from Plasmodium falciparum,
VAR2CSA (domain, ID1-ID2a) from Plasmodium falciparum, CIDR1a
domain, of PfEMP1 from Plasmodium falciparum, GLURP from Plasmodium
falciparum, MSP3 from Plasmodium falciparum, Pfs25 from Plasmodium
falciparum, CSP from Plasmodium falciparum, and/or PfSEA-1 from
Plasmodium falciparum or an antigenic fragment hereof fused to a
monovalent streptavidin, wherein the antigen and the PV L1 protein
are linked via the interaction between the monovalent streptavidin
and the biotin molecule enzymatically conjugated to the biotin
acceptor site of the PV L1 protein, and wherein i-iii form a virus
like particle displaying said antigen.
[0149] In a preferred embodiment, the antigen is VAR2CSA and the
vaccine is for use in the prophylaxis and/or treatment of placental
malaria.
[0150] In another preferred embodiment, the antigen is surviving
and the vaccine is for use in the prophylaxis and/or treatment of
cancer.
[0151] In an embodiment the antigen fused to a monovalent
streptavidin comprises SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23,
SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, or SEQ
ID NO: 28 and/or a sequence variant hereof. In a preferred
embodiment the antigen fused to a monovalent streptavidin comprises
SEQ ID NO: 21. In a more preferred embodiment the antigen fused to
a monovalent streptavidin comprises SEQ ID NO: 24. In a most
preferred embodiment the antigen fused to a monovalent streptavidin
comprises SEQ ID NO: 28.
[0152] Induction of an Immune Response in a Subject
[0153] Active vaccination (immunization), by delivering small doses
of an antigen into a subject, is a way to activate a subject's
immune system to develop adaptive immunity to the antigen. This
allows a subjects body to react quickly and efficiently to future
exposures.
[0154] An aspect of the invention relates to a method for inducing
an immune response in a subject, the method comprising the steps of
[0155] i. obtaining a composition comprising at least one vaccine
of the present invention and/or [0156] ii. administering said
composition to a subject at least once for prophylaxis and/or
treatment of a disease, thereby inducing an immune response in the
subject.
[0157] Another aspect of the present invention relates to a method
of immunizing a subject in need thereof, said method comprises the
steps of: [0158] i. obtaining a composition comprising at least one
vaccine of the present invention, and/or [0159] ii. administering
said composition to a subject at least once for prophylaxis and/or
treatment of a disease. thereby immunizing the subject in need
thereof.
[0160] Another aspect of the present invention relates to a method
for obtaining a strong and long-lasting immune response in a
subject in need thereof, said method comprising the steps of:
[0161] i. obtaining composition comprising a vaccine of the present
invention, and/or [0162] ii. administering the vaccine to treat
and/or prevent a clinical condition in an subject in need thereof,
wherein the vaccine obtain a strong and long-lasting immune
response in the subject.
[0163] In an embodiment the method of inducing an immune response
in a subject, immunizing a subject in need thereof, and/or
obtaining a strong and long-lasting immune response further
comprising at least one booster vaccine and/or a second active
ingredient.
[0164] Origin of the PV L1 Protein
[0165] An important element of the present VLP based vaccine is the
major capsid L1 protein from papillomavirus (PV), which has the
ability to spontaneously self-assemble into virus-like particles
(VLPs). The use of papillomavirus L1 proteins in the present
invention is illustrated in FIG. 1b. Several hundred species of
papillomaviruses, traditionally referred to as "types", are known
to infect most mammals, as well as birds, snakes, and turtles. In
principle the major capsid protein L1 from most papillomavirus,
capable of forming a VLP, may be used to carry out the present
invention.
[0166] In an embodiment the PV L1 protein of the present invention
is from a mammal such as but not limited to: Alces genus, Homo
sapiens, cow, pig, horse, sheep, goat, llama, mouse, rat, monkey,
and chicken.
[0167] In a most preferred embodiment the PV L1 protein of the
present invention is from the human PV genotype 16 and/or 118. In
yet a particular embodiment the PV L1 protein is from the Alces
alces.
[0168] Biotin acceptor site and its position in the PV L1 protein
The biotin acceptor site of the present invention comprises a
sequence of 15 amino acids encoded by a polynucleotide sequence. It
is extremely difficult, if not impossible, to predict the
consequence of modifications to VLP forming proteins, such as PV L1
proteins. Such modifications often lead to disruption of the
delicate and sensitive self-assembly process of the VLPs.
Successful modification of the VLP forming process is at least
dependent on three factors 1) the amino acid sequence of the biotin
acceptor site, 2) the insertion site, and 3) deletion/removal of
amino acid residues to make room for the biotin acceptor site. The
inventors have demonstrated several successful modifications to PV
L1 loops without disrupting the delicate self-assembly process.
[0169] In an embodiment the biotin acceptor site is fused into a
loop of the PV L1 protein.
[0170] In an embodiment the present invention concerns a vaccine
for use in the prophylaxis and/or treatment of a disease wherein
the vaccine comprises: [0171] i. a papilloma virus (PV) L1 protein
containing a biotin acceptor site in a loop of the PV L1 protein,
and [0172] ii. a biotin molecule enzymatically conjugated to said
biotin acceptor site, and [0173] iii. an antigen fused to a
monovalent streptavidin, wherein the antigen and PV L1 protein are
linked via the interaction between the monovalent streptavidin and
the biotin molecule enzymatically conjugated to the biotin acceptor
site of the PV L1 protein, and wherein i-iii form a virus like
particle displaying said antigen.
[0174] In another embodiment the loop is selected from the group
consisting of the DE-loop, and the HI-loop of the PV L1 protein.
The PV L1 protein starts with a methionine residue which is cleaved
off after translation. There are thus two ways of numbering the
amino acid residues of the PV L1 protein: either the methionine
residue is the first, or the methionine residue is not counted and
the following serine residue is the first. The positions given in
the present disclosure are numbered using the first numbering, i.e.
where the methionine is counted.
[0175] In an embodiment the biotin acceptor site is inserted into
the HI-loop of the L1 protein from the human PV genotype 16 at
position 351/352 (SEQ ID NO: 2). In another embodiment the biotin
acceptor site, is inserted into the H4-loop of the L1 protein from
the human PV genotype 16 at position 431/432 (SEQ ID NO: 1). In an
embodiment the biotin acceptor site is inserted into the HI-loop of
the L1 protein from the human PV genotype 118 at position 360/365
where the residues 361-364 (AGKI) are deleted (SEQ ID NO: 6). In a
most preferred embodiment the biotin acceptor site is inserted into
the DE-loop of the L1 protein from the human PV genotype 16 at
position 134/139 where the residues 135-137 (YAAN) are deleted (SEQ
ID NO: 3).
[0176] In an embodiment the PV L1 protein containing the biotin
acceptor site comprises the amino acid sequences selected from the
group consisting of SEQ ID NO: 3, SEQ ID NO: 2, and SEQ ID NO: 6 or
a biologically active sequence variant that has at least 95%, such
as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such
as 100% sequence identity to any of the herein disclosed PV L1
proteins containing the biotin acceptor site sequences. By
"biological active" is meant the ability to form a virus like
particle.
[0177] In an embodiment the biotin acceptor site of the present
invention comprises the amino acid sequence GLNDIFEAQKIEWHE (SEQ ID
NO 36).
[0178] Enzymatic Biotinylation
[0179] In general, two approaches for biotinylation of proteins
exists; chemical biotinylation and enzymatic biotinylation.
Chemical biotinylation such as biotinylation of exposed lysine
residues allows the attachment to VLPs of diverse kinds of target
antigens (incl. non-protein targets) and this approach is generally
not restricted by the size of the antigen (Raja K S. et al., 2003).
However, with this strategy it is very challenging to control the
overall amount/stoichiometry as well as the orientation of the
coupled antigen. Finally, chemical coupling procedures are rarely
compatible with large scale vaccine production. The main challenge
of current VLP platforms is to present the antigen on the surface
of the VLP, at high density, in a regularly spaced order with a
consistent orientation for an efficient epitope display which are
capable of inducing long-term protective immunity.
[0180] In order to solve these challenges the VLPs of the present
invention are made by enzymatic biotinylation. Enzymatic
biotinylation ensures that only a single biotin molecule is
conjugated to each L1 in the VLP thus controlling the overall
ratio/stoichiometry and placement of VLP proteins and biotin
molecules. This control will enable display of an antigen at high
density i.e. in theory one antigen per L1 protein, while being
regularly spaced, and with consistent orientation on the surface of
the VLPs of the present invention.
[0181] Thus, in an embodiment the biotin molecule is enzymatically
conjugated to the biotin acceptor site. In another embodiment the
biotin molecule is enzymatically conjugated to the biotin acceptor
site by a biotin ligase from a prokaryote, such as from a bacteria,
such as from E. coli. The biotin ligase is in a preferred
embodiment BirA from E. coli.
[0182] Antigen Fused to a Monovalent Streptavidin
[0183] Streptavidin from Streptomyces avidinii forms streptavidin
homo-tetramers and binds up to four biotin molecules. The
monovalent streptavidin of the present invention forms monomers and
binds a single biotin molecule. Thus when linking the antigen fused
to a monovalent streptavidin to the VLP of the present invention,
the monovalent streptavidin ensures a uniform presentation of said
antigens. Using monovalent streptavidin further ensures control of
the overall amount/stoichiometry as well as the orientation of the
coupled antigen. This control will enable display of an antigen at
high density, while being regularly spaced, and with consistent
orientation on the surface of a VLP, thus solving three major
critical factors for obtaining prober activation of the immune
system. In contrast a streptavidin homo-tetramer may crosslink
several PV L1 proteins on the surface of a VLP, thus creating an
irregular presentation of said antigen, which may hamper the immune
response of an antigen. It is thus an aspect of the present
invention to use monovalent streptavidin fused to the antigen for
linking the antigen to the PV L1 protein via the interaction
between the monovalent streptavidin and the biotin molecule
enzymatically conjugated to the biotin acceptor site of the PV L1
protein.
[0184] In an embodiment the monovalent streptavidin used by the
present invention comprises or consists of the amino acid sequence
of SEQ ID NO: 37.
[0185] In another embodiment each antigen is presented in immediate
continuation of each PV L1 protein in a consistent orientation.
[0186] In another embodiment the ratio of PV L1 protein:biotin
molecule:antigen is 1:1:1.
[0187] Changing the position where the monomeric streptavidin tag
is fused to the antigen will allow changing the orientation of the
antigen. This may be performed to enable the best possible display
of the most immunogenic epitopes of the antigen. The best possible
orientation may be different from antigen to antigen.
[0188] In another embodiment the antigen fused to a monovalent
streptavidin further comprises a tag. Such tags may be used for
purification techniques known to the skilled person. The tag may be
selected from the group comprising polyhistidine tag,
Calmodulin-tag, polyglutamate tag, E-tag, FLAG-tag, HA-tag,
Myc-tag, S-tag, SBP-tag, Softag 1, Softag 3, Strep-tag, Strep-tag
II, TC tag, V5 tag, VSV-tag, and Xpress tag. Other peptide or
non-peptide tags may be used instead or in combination with the
above mentioned peptide tags. In a particular embodiment the tag is
a polyhistidine tag, such as a 4.times.His, 5.times.His,
6.times.His, 7.times.His, 8.times.His, 9.times.His, or 10.times.His
tag.
[0189] In an embodiment the monovalent streptavidin is fused to the
antigen in any position. In another embodiment the monovalent
streptavidin is fused to the antigen in the N-terminal, C-terminal,
and/or is fused to the antigen into the coding sequence of the
antigen. A person of skill will know how to fuse the antigen and
the monovalent streptavidin, without introducing stop-codons or
causing frame shift or any other mutations.
[0190] In another embodiment the monovalent streptavidin fused to
the antigen comprises [0191] i. a polypeptide sequence selected
from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID
NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24,
SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28, or
[0192] ii. a sequence variant of said polypeptide sequence, wherein
the sequence variant has at least 70%, such as 75%, such as 80%,
such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%,
such as 98%, such as 99%, such as 99.5%, such as 100% sequence
identity to the sequences of the group comprising SEQ ID NO: 18,
SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID
NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27,
and SEQ ID NO: 28.
[0193] In a preferred embodiment the monovalent streptavidin fused
to the antigen comprises [0194] i. a polypeptide sequence
comprising SEQ ID NO: 19, and/or [0195] ii. a sequence variant of
said polypeptide sequence, wherein the sequence variant has at
least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such
as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such
as 99.5%, such as 100% sequence identity to SEQ ID NO: 19.
[0196] In a most preferred embodiment the monovalent streptavidin
fused to the antigen comprises [0197] i. a polypeptide sequence
comprising SEQ ID NO: 18, and/or [0198] ii. a sequence variant of
said polypeptide sequence, wherein the sequence variant has at
least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such
as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such
as 99.5%, such as 100% sequence identity to SEQ ID NO: 18.
[0199] Vector and Polynucleotide/Polypeptide Sequences
[0200] In molecular cloning, a vector is a DNA molecule used as a
vehicle to artificially carry foreign genetic material into a cell,
where it can be replicated and/or expressed. The four major types
of vectors are plasmids, viral vectors, cosmids, and artificial
chromosomes. The vector itself is generally a DNA sequence that
consists of an insert (transgene) and a larger sequence that serves
as the "backbone" of the vector. The purpose of a vector which
transfers genetic information to another cell is typically to
isolate, multiply, or express the insert in the target cell.
Expression vectors (expression constructs) specifically are for the
expression of transgenes in target cells, and generally have a
promoter sequence that drives expression of the transgene.
[0201] The heterologous expression/production of the vaccine of the
present invention comprises 3 peptide components 1) a PV L1 protein
containing a biotin acceptor site 2) a biotin ligase capable of
biotinylating the biotin acceptor site, and 3) an antigen fused to
a monovalent streptavidin. Thus in an embodiment of the present
invention each of the peptide components are encoded by a
polynucleotide sequence and each of the polynucleotide sequences
may be expressed on one, two, or three different plasmids.
[0202] To enable heterologous expression/production of the vaccine
one aspect of the present invention is a vector comprising at least
one polynucleotide encoding [0203] i. a PV L1 protein containing a
biotin acceptor site, and/or [0204] ii. a biotin ligase capable of
biotinylating the biotin acceptor site, and/or [0205] iii. an
antigen fused to a monovalent streptavidin.
[0206] In another embodiment the vector comprises at least two,
such as at least three polynucleotides of the following
polypeptides: [0207] i. a PV L1 protein containing a biotin
acceptor site, and/or [0208] ii. a biotin ligase capable of
biotinylating the biotin acceptor site, and/or [0209] iii. an
antigen fused to a monovalent streptavidin.
[0210] In a further embodiment the PV L1 protein containing the
biotin acceptor site is encoded by a polynucleotide sequence
comprising: [0211] i. a polynucleotide sequence selected from the
group comprising SEQ ID 11, SEQ ID 12, SEQ ID 13, SEQ ID 14, SEQ ID
15, SEQ ID 16, SEQ ID 17, and/or [0212] ii. a sequence variant of
said polynucleotide sequence, wherein the sequence variant has at
least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such
as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such
as 99.5%, such as 100% sequence identity to said SEQ ID 11, SEQ ID
12, SEQ ID 13, SEQ ID 14, SEQ ID 15, SEQ ID 16, SEQ ID 17, and/or
[0213] iii. a sequence variant of said polynucleotide, wherein the
codon usage is altered.
[0214] In a preferred embodiment the PV L1 protein containing the
biotin acceptor site is encoded by a polynucleotide sequence
comprising: [0215] i. a polynucleotide sequence selected from the
group comprising, SEQ ID 12, and/or SEQ ID 13, and/or [0216] ii. a
sequence variant of said polynucleotide sequence, wherein the
sequence variant has at least 70%, such as 75%, such as 80%, such
as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such
as 98%, such as 99%, such as 99.5%, such as 100% sequence identity
to said, SEQ ID 12, and/or SEQ ID 13, and/or [0217] iii. a sequence
variant of said polynucleotide, wherein the codon usage is
altered.
[0218] In a further embodiment the antigen fused to the monovalent
streptavidin has a polynucleotide sequence comprising: [0219] i. a
polynucleotide sequence selected from the group consisting of SEQ
ID 29, SEQ ID 30, SEQ ID 31, SEQ ID 32, SEQ ID 33, SEQ ID 34, SEQ
ID 35, and/or [0220] ii. a sequence variant of said polynucleotide
sequence, wherein the sequence variant has at least 70%, such as
75%, such as 80%, such as 85%, such as 90%, such as 95%, such as
96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as
100% sequence identity to said SEQ ID 11, SEQ ID 12, SEQ ID 13, SEQ
ID 14, SEQ ID 15, SEQ ID 16, SEQ ID 17, and/or [0221] iii. a
sequence variant of said polynucleotide, wherein the codon usage is
altered.
[0222] In an embodiment the biotin acceptor site, comprises the
nucleotide sequence SEQ ID NO: 39.
[0223] Another aspect of the present invention relates to
polynucleotide sequences encoding [0224] i. a PV L1 protein
containing a biotin acceptor site, and/or [0225] ii. a biotin
ligase capable of biotinylating the biotin acceptor site, and/or
[0226] iii. an antigen fused to a monovalent streptavidin.
[0227] In a preferred embodiment the present invention relates to
polynucleotide sequences encoding [0228] i. a PV L1 protein
containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
[0229] ii. a biotin ligase capable of biotinylating the biotin
acceptor site comprising SEQ ID 38, and/or [0230] iii. an antigen
fused to a monovalent streptavidin comprising SEQ ID NO: 19.
[0231] In a more preferred embodiment the present invention relates
to polynucleotide sequences encoding [0232] i. a PV L1 protein
containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
[0233] ii. a biotin ligase capable of biotinylating the biotin
acceptor site comprising SEQ ID 38, and/or [0234] iii. an antigen
fused to a monovalent streptavidin comprising SEQ ID NO: 20.
[0235] In a most preferred embodiment the present invention relates
to polynucleotide sequences encoding [0236] i. a PV L1 protein
containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
[0237] ii. a biotin ligase capable of biotinylating the biotin
acceptor site comprising SEQ ID 38, and/or [0238] iii. an antigen
fused to a monovalent streptavidin comprising SEQ ID NO: 18.
[0239] Host Cell
[0240] The invention further relates to a host cell comprising a
polynucleotide and/or a vector. The polynucleotide may have a
sequence that is codon-optimised. Codon optimisation methods are
known in the art and allow optimised expression in a heterologous
host organism or cell. In an embodiment the host cell may be
selected from the group comprising bacteria, yeast, fungi, plant,
mammalian and/or insect cells. Methods for expressing a first
polypeptide: a PV L1 protein containing a biotin acceptor site,
and/or a second polypeptide; a biotin ligase, capable of
biotinylating the biotin acceptor site, and/or a third polypeptide:
an antigen fused to a monovalent streptavidin in a host cell are
known in the art. The first, second or third polypeptide may be
heterologously expressed from corresponding polynucleotide
sequences cloned into the genome of the host cell or they may be
comprised within a vector. For example, a first and/or second
and/or third polynucleotide coding for the first and/or second
and/or third polypeptide is cloned into the genome, and a first
and/or second and/or third polynucleotide coding for the first
and/or second and/or third polypeptide is comprised within a vector
transformed or transfected into the host cell. Alternatively, the
first and/or second and/or third polynucleotide is comprised within
a first vector and the first and/or second and/or third
polynucleotide is comprised within a second vector and the first
and/or second and/or third is comprised within a third vector.
[0241] Expression of the first, second, and third polypeptides in
the host cell may occur in a transient manner. When the
polynucleotide encoding one of the polypeptides is cloned into the
genome, an inducible promoter may be cloned as well to control
expression of the polypeptides. Such inducible promoters are known
in the art. Alternatively, genes coding for suppressors of gene
silencing may also be cloned into the genome or into a vector
transfected within the host cell.
[0242] In a particular embodiment the host cell may be selected
from the group comprising Escherichia coli, Spodoptera frugiperda
(sf9), Trichoplusia ni (BTI-TN-5B1-4), Pichia Pastoris,
Saccharomyces cerevisiae, Hansenula polymorpha, Drosophila
Schneider 2 (S2), Lactococcus lactis, Chinese hamster ovary (CHO),
Human Embryonic Kidney 293, Nicotiana tabacum cv. Samsun NN and
Solanum tuberosum cv. Solara. Thus in an embodiment, the host cell
is Escherichia coli. In another embodiment, the host cell is
Spodoptera frugiperda. In another embodiment, the host cell is
Pichia Pastoris. In another embodiment, the host cell is
Saccharomyces cerevisiae. In another embodiment, the host cell is
Hansenula polymorpha. In another embodiment, the host cell is
Drosophila Schneider 2. In another embodiment, the host cell is
Lactococcus lactis. In another embodiment, the host cell is Chinese
hamster ovary (CHO). In another embodiment, the host cell is Human
Embryonic Kidney 293. In another embodiment, the host cell is
Trichoplusia ni (BTI-TN-5B1-4). In another embodiment, the host
cell is Nicotiana tabacum cv. Samsun NN. In another embodiment, the
host cell is Solanum tuberosum cv. Solara.
[0243] In another aspect the present invention relates to a host
cell expressing at least one polypeptide encoded by any of the
polynucleotides disclosed by the present invention.
[0244] In an embodiment the host cell expresses: [0245] i. a first
polypeptide; a PV L1 protein containing a biotin acceptor site,
and/or [0246] ii. a second polypeptide; a biotin ligase, capable of
biotinylating the biotin acceptor site, and/or [0247] iii. a third
polypeptide; an antigen fused to a monovalent streptavidin, wherein
the cell is selected from the group comprising bacteria, yeast,
fungi, plant, mammalian and/or insect cells.
[0248] In a further embodiment the host cell, expresses [0249] i. a
first polypeptide having a sequence at least 70%, such as 75%, such
as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such
as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100%
identical to SEQ ID NO: 3 [DE-loop, HPV genotype 16], SEQ ID NO: 2
[HI-loop, HPV genotype 16], SEQ ID NO: 6 [HI-loop, HPV118]; and/or
[0250] ii. a second polypeptide having a sequence at least 70%,
such as 75%, such as 80%, such as 85%, such as 90%, such as 95%,
such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%,
such as 100% identical to SEQ ID NO: 38, and/or [0251] iii. a third
polypeptide having a sequence at least 70%, such as 75%, such as
80%, such as 85%, such as 90%, such as 95%, such as 96%, such as,
97%, such as 98%, such as 99%, such as 99.5%, such as 100%
identical to SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID
NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25,
SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28, wherein the cell
is selected from the group comprising bacteria, yeast, fungi,
plant, mammalian and/or insect cells.
[0252] In a preferred embodiment the host cell expresses: [0253] i.
a first polypeptide; a PV L1 protein containing a biotin acceptor
site comprising SEQ ID NO: 2, and/or [0254] ii. a second
polypeptide; a biotin ligase, capable of biotinylating the biotin
acceptor site comprising SEQ ID NO: 38, and/or [0255] iii. a third
polypeptide; an antigen fused to a monovalent streptavidin
comprising SEQ ID NO:18, wherein the cell is selected from the
group comprising bacteria, yeast, fungi, plant, mammalian and/or
insect cells.
[0256] The inventors of the present invention have demonstrated
formation of VLP's using insect cells, such as High Five
(Trichoplusia ni) of Sf9 cells incubated at 28.degree. C. Other
conditions and expression hosts may work as well.
[0257] In a particular embodiment Trichoplusia ni cells are used as
host cell for expression of any of the disclosed polynucleotides
and/or polypeptides. In another embodiment Trichoplusia ni cells
are used to express a polypeptide having a sequence at least 70%,
such as 75%, such as 80%, such as 85%, such as 90%, such as 95%,
such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%,
such as 100% identical any of the polypeptides disclosed
herein.
[0258] Composition Comprising the Vaccine
[0259] The vaccine of the present invention is to be used in the
prophylaxis and/or treatment of a disease. Thus, one aspect of the
present invention relates to a composition comprising the vaccine
of the present invention. Such compositions may further comprise
for example an adjuvant, a buffer, and/or salts or a combination
hereof.
[0260] An adjuvant is a pharmacological and/or immunological agent
that modifies the effect of other agents. Adjuvants may be added to
a vaccine to modify the immune response by boosting it such as to
give a higher amount of antibodies and/or a longer lasting
protection, thus minimizing the amount of injected foreign
material. Adjuvants may also be used to enhance the efficacy of a
vaccine by helping to subvert the immune response to particular
cell types of the immune system, for example by activating the T
cells instead of antibody-secreting B cells dependent on the type
of the vaccine. Thus in an embodiment the composition comprises at
least one adjuvant. In an embodiment the adjuvant is aluminium
based. Alluminumum adjuvants may be aluminum phosphate, aluminum
hydroxide, amorphous aluminum hydroxyphosphate sulfate and/or a
combination hereof. Other adjuvants may be included as well.
[0261] In another embodiment the composition described above
comprises at least one buffer. In an embodiment the buffer is PBS
and/or histidine based. In another embodiment the buffer has a pH
between pH 6-pH 7.5. In an embodiment the buffer, is isotonic such
as has 0.6%-1.8% NaCl.
[0262] An emulsifier (also known as an "emulgent") is a substance
that stabilizes an emulsion by increasing its kinetic stability.
One class of emulsifiers is known as "surface active agents", or
surfactants. Polysorbates are a class of emulsifiers used in some
pharmaceuticals and food preparation. Common brand names for
polysorbates include Alkest, Canarcel, and Tween. Some examples of
polysorbates are Polysorbate 20, Polysorbate 40, Polysorbate 60,
Polysorbate 80. In an embodiment the composition of the present
invention comprises an emulsifier such as one of the above
described polysorbates. In a particular embodiment the composition
comprises 0.001-0.02% polysorbate 80. Other polysorbates or
emulsifiers may be used in the present invention as well.
[0263] A Pharmaceutical Composition Comprising the Vaccine
[0264] The vaccine of the present invention is intended to be used
in the prophylaxis and/or treatment of a disease. Accordingly, the
present invention further provides a pharmaceutical formulation,
which comprises the vaccine of the present invention and a
pharmaceutically acceptable carrier therefor. The pharmaceutical
formulations may be prepared by conventional techniques, e.g. as
described in Remington: The Science and Practice of Pharmacy 2005,
Lippincott, Williams & Wilkins.
[0265] The pharmaceutically acceptable carriers can be either solid
or liquid. Solid form preparations include powders, tablets, pills,
capsules, cachets, suppositories, and dispersible granules. A solid
carrier can be one or more excipients which may also act as
diluents, flavoring agents, solubilizers, lubricants, suspending
agents, binders, preservatives, wetting agents, tablet
disintegrating agents, or an encapsulating material.
[0266] Also included are solid form preparations which are intended
to be converted, shortly before use, to liquid form preparations
for oral administration. Such liquid forms include solutions,
suspensions, and emulsions. These preparations may contain, in
addition to the active component, colorants, flavors, stabilizers,
buffers, artificial and natural sweeteners, dispersants,
thickeners, solubilizing agents, and the like. 3
[0267] The compounds of the present invention may be formulated for
parenteral administration and may be presented in unit dose form in
ampoules, pre-filled syringes, small volume infusion or in
multi-dose containers, optionally with an added preservative. The
compositions may take such forms as suspensions, solutions, or
emulsions in oily or aqueous vehicles, for example solutions in
aqueous polyethylene glycol. Examples of oily or non-aqueous
carriers, diluents, solvents or vehicles include propylene glycol,
polyethylene glycol, vegetable oils, and injectable organic esters,
and may contain agents such as preserving, wetting, emulsifying or
suspending, stabilizing and/or dispersing agents. Preferably, the
formulation will comprise about 0.5% to 75% by weight of the active
ingredient(s) with the remainder consisting of suitable
pharmaceutical excipients as described herein.
[0268] The vaccine of the invention may be administered
concurrently, simultaneously, or together with a pharmaceutically
acceptable carrier or diluent, especially and preferably in the
form of a pharmaceutical composition thereof, whether by oral,
rectal, or parenteral (including subcutaneous) route, in an
effective amount.
[0269] Thus, one aspect of the present invention relates to a
pharmaceutical composition comprising a vaccine. Such
pharmaceutical composition may comprise an adjuvant, a buffer,
and/or salts or a combination hereof.
[0270] In an embodiment the pharmaceutical composition, further
comprises a composition comprising a vaccine as described by the
present invention.
[0271] A Method of Manufacture a Pharmaceutical Composition
Comprising a Vaccine
[0272] The present invention further relates to a method of
manufacturing a pharmaceutical composition comprising a vaccine. In
one aspect the VLP based vaccine of the present invention, may at
least be manufactured by the following steps: [0273] i. obtaining a
first polypeptide comprising: a PV L1 protein containing a biotin
acceptor site, and/or [0274] ii. obtaining a second polypeptide: a
biotin ligase capable of biotinylating the biotin acceptor site,
and/or [0275] iii. obtaining a third polypeptide: an antigen fused
to a monovalent streptavidin, and [0276] iv. subjecting the first
polypeptide to conditions which enable formation of virus like
particles, and/or [0277] v. enabling enzymatic biotinylation of the
biotin acceptor site of said virus like particles using said second
polypeptide, and/or [0278] vi. obtaining a vaccine by linkage of
the third polypeptide and said virus like particles via the
interaction between the monovalent streptavidin and the biotin
molecule enzymatically conjugated to the biotin acceptor site of
said virus like particles, and/or [0279] vii. generating a
composition comprising said vaccine. thereby obtaining a
pharmaceutical composition.
[0280] In the manufacture of the pharmaceutical composition other
steps may be included for example a) isolation/purification of the
VLP to yield a high purity/quality product. This will be
accomplished using different techniques for protein purification.
For this purpose several separation steps will be carried out using
the differences in for instance protein size, physico-chemical
properties, binding affinity or biological activity b) formulation
by adding stabilizers to prolong the storage life or preservatives
to allow multi-dose vials to be used safely as needed c) all
components that constitute the final vaccine are combined and mixed
uniformly e.g. in a single vial or syringe d) the vaccine is put in
recipient vessel (e.g. a vial or a syringe) and sealed with sterile
stoppers.
[0281] All the processes described above will have to comply with
the standards defined for Good Manufacturing Practices (GMP) that
will involve several quality controls and an adequate
infrastructure and separation of activities to avoid
cross-contamination. Finally, the vaccine may be labeled and
distributed worldwide.
[0282] Method of Administering a Vaccine
[0283] Routes of Administration
[0284] Systemic treatment. The main routes of administration are
oral and parenteral in order to introduce the agent into the blood
stream to ultimately target the sites of desired action.
Appropriate dosage forms for such administration may be prepared by
conventional techniques.
[0285] Oral administration. Oral administration is normally for
enteral drug delivery, wherein the agent is delivered through the
enteral mucosa.
[0286] Parenteral administration. Parenteral administration is any
administration route not being the oral/enteral route whereby the
medicament avoids first-pass degradation in the liver. Accordingly,
parenteral administration includes any injections and infusions,
for example bolus injection or continuous infusion, such as
intravenous administration, intramuscular administration,
subcutaneous administration. Furthermore, parenteral administration
includes inhalations and topical administration.
[0287] Accordingly, the agent may be administered topically to
cross any mucosal membrane of an animal to which the biologically
active substance is to be given, e.g. in the nose, vagina, eye,
mouth, genital tract, lungs, gastrointestinal tract, or rectum,
preferably the mucosa of the nose, or mouth, and accordingly,
parenteral administration may also include buccal, sublingual,
nasal, rectal, vaginal and intraperitoneal administration as well
as pulmonal and bronchial administration by inhalation or
installation. Also, the agent may be administered topically to
cross the skin.
[0288] The subcutaneous and intramuscular forms of parenteral
administration are generally preferred.
[0289] Local treatment. The agent according to the invention may be
used as a local treatment, ie. be introduced directly to the
site(s) of action as will be described below.
[0290] Thus one agent may be applied to the skin or mucosa
directly, or the agent may be injected into the diseased tissue or
to an end artery leading directly to the diseased tissue.
[0291] Thus another aspect of the present invention relates to a
method of administering a vaccine to treat and/or prevent a
clinical condition in a subject in need thereof, comprising the
steps of [0292] i. obtaining a composition comprising at least one
vaccine according to the present invention, and/or [0293] ii.
administering said composition to a subject at least once for
prophylaxis and/or treatment of a disease.
[0294] A preferred embodiment relates to a method of administering
a vaccine to treat and/or prevent cancer, as disclosed herein, in a
subject in need thereof, comprising the steps of [0295] i.
obtaining a composition comprising at least one vaccine as [0296]
ii. administering said composition to a subject intramuscular
and/or intravenous at least once for prophylaxis and/or treatment
of a cancer.
[0297] A preferred embodiment relates to a method of administering
a vaccine to treat and/or prevent a cardiovascular disease, as
disclosed herein, in a subject in need thereof, comprising the
steps of [0298] i. obtaining a composition comprising at least one
vaccine as disclosed herein, and/or [0299] ii. administering said
composition to a subject intramuscular and/or intravenous at least
once for prophylaxis and/or treatment of a cardiovascular
disease.
[0300] In another embodiment the vaccine of the present invention
is administered by any type of injections or infusions selected
from the group of bolus injection, continuous infusion, intravenous
administration, intramuscular administration, subcutaneous
administration, inhalation or topical administration or a
combination hereof. In a particular embodiment the vaccine is
administered by intramuscular administration and/or intravenous
administration.
[0301] In medicine, a booster dose is an extra administration of a
vaccine after an earlier dose. After initial immunization, a
booster injection or booster dose is a re-exposure to the
immunizing antigen cell. It is intended to increase immunity
against that antigen back to protective levels after it has been
shown to have decreased or after a specified period. In an
embodiment the vaccine of the present invention is administered any
number of times from one, two, three, four times or more.
[0302] In a further embodiment the vaccine is boosted by
administration in a form and/or body part different from the
previous administration. In another embodiment the vaccine is
administered to the area most likely to be the receptacle of a
given disease or infection which the vaccine is intended to
prevent/reduce the risk of.
[0303] In another embodiment the recipient of the vaccine (the
subject) of the present invention is an animal, for example a
mammal, such as a Homo sapiens, cow, pig, horse, sheep, goat,
llama, mouse, rat, monkey, and/or chicken. In a particular
embodiment the subject is a Homo sapiens.
[0304] Administration of more than one vaccine is known in the art
and refers to this concept as co-vaccination or to give a vaccine
cocktail. Thus, in an embodiment of the vaccine, is co-administered
with any other vaccine. In another embodiment the vaccine forms a
part of a vaccine cocktail.
[0305] A Kit of Parts
[0306] In another aspect of the present invention relates to a kit
of parts comprising [0307] i. a composition comprising a vaccine of
the present invention, and/or [0308] ii. a medical instrument or
other means for administering the vaccine, and/or [0309] iii.
instructions on how to use the kit of parts.
[0310] In an embodiment the kit of parts comprises a second active
ingredient or vaccine component for therapeutic use in the
treatment or prevention of one or more of the diseased disclosed in
the present invention.
[0311] In an embodiment the vaccine of the invention is
administered separate, sequential, or simultaneously with at least
one other pharmaceutical active ingredient and/or vaccine
component.
[0312] Dosages and Dosing Regimes
[0313] The dosage requirements will vary with the particular drug
composition employed, the route of administration and the
particular subject being treated. It will also be recognized by one
of skill in the art that the optimal quantity and spacing of
individual dosages of a compound will be determined by the nature
and extent of the condition being treated, the form, route and site
of administration, and the particular patient being treated, and
that such optimums can be determined by conventional techniques. It
will also be appreciated by one of skill in the art that the
optimal course of treatment, i.e., the number of doses of a
compound given per day for a defined number of days, can be
ascertained using conventional course of treatment determination
tests.
[0314] The daily oral dosage regimen will preferably be from about
0.01 to about 80 mg/kg of total body weight. The daily parenteral
dosage regimen about 0.001 to about 80 mg/kg of total body weight.
The daily topical dosage regimen will preferably be from 0.1 mg to
150 mg, administered one to four, preferably two or three times
daily. The daily inhalation dosage regimen will preferably be from
about 0.01 mg/kg to about 1 mg/kg per day.
[0315] The term "unit dosage form" refers to physically discrete
units suitable as unitary dosages for human and animal subjects,
each unit containing a predetermined quantity of a compound, alone
or in combination with other agents, calculated in an amount
sufficient to produce the desired effect in association with a
pharmaceutically acceptable diluent, carrier, or vehicle. The
specifications for the unit dosage forms of the present invention
depend on the particular compound or compounds employed and the
effect to be achieved, as well as the pharmacodynamics associated
with each compound in the host. The dose administered should be an
"effective amount" or an amount necessary to achieve an "effective
level" in the individual patient.
[0316] When the "effective level" is used as the preferred endpoint
for dosing, the actual dose and schedule can vary, depending on
inter-individual differences in pharmacokinetics, drug
distribution, age, gender, size, health and metabolism. The
"effective level" can be defined, for example, as the blood or
tissue level desired in the patient that corresponds to a
concentration of one or more compounds according to the
invention.
EXAMPLES
[0317] Modification of VLPs without disrupting the delicate and
sensitive self-assembly process is challenging. The inventors have
below shown several examples of successful introduction of a biotin
acceptor site into various VLP loops without disrupting the
self-assembly process. In addition the inventors have shown
enzymatic biotinylation of the biotin acceptor site as well as
coupled several antigen/monovalent streptavidin fusion proteins to
the VLPs. Immunological testing of the VLP vaccines have been
initiated. The examples below are non-limiting to the scope of the
invention.
Example 1--Design of Chimeric HPV16 Avi-L1 Coat Proteins
[0318] The chimeric HPV16 Avi-L1 gene sequences were constructed by
insertion of the biotin acceptor sequence (AviTag.TM.),
GLNDIFEAQKIEWHE, into the DE- (aa positions 134-139), FG- (aa
positions 279-286), HI- (aa positions 351-352) or H4-.beta.J coil
(aa positions 431-432) after having deleted any intervening amino
acids (HPV16 L1 accession number DQ155283.1). Gene sequences were
further modified to contain an EcoRV restriction site followed by a
polyhedrin promotor sequence at the N-terminus and a stop-codon
followed by a NotI restriction site at the C-terminus. The
synthetic gene sequences were finally codon-optimized for
recombinant expression in Trichoplusia ni cells and synthesized by
Geneart (Life Technologies).
Example 2--Expression and Purification of Chimeric HPV16
Avi-L1-VLPs
[0319] The HPV16 Avi-L1 gene fragments were cloned into the
EcoRV/NotI sites of the pAcGP67A vector (BD Biosciences) deleting
the gp67 secretion signal sequence. To generate recombinant virus
particles, linearized BakPak viral DNA (BD Biosciences) was
co-transfected with pAcGP67A/Avi-L1 into Sf9 insect cells using
Lipofectamine 2000 10 Reagent (Invitrogen, 11668-019) and incubated
at 28.degree. C. for 3-5 days. Recombinant Baculovirus was
harvested from the supernatant and used to generate a high-titer
virus stock, which was used for infection of High-Five insect
cells. Infected High-Five cells were incubated for 48 hours at
28.degree. C. with shaking. In vitro maturation and purification of
HPV16 Avi-L1 VLPs were performed as previously described (Buck et
al., 2005, Buck et al., 2007). In brief, cell lysates were
harvested and VLPs were allowed to mature in maturation-buffer
(0.5% Triton-X-100, 0.1% Benzonase.RTM. Nuclease (Sigma-Aldrich),
25 mM (NH.sub.4).sub.2SO.sub.4 and 4 mM MgCl.sub.2) for 18 h at
37.degree. C. Matured VLPs were subsequently purified by
ultracentrifugation through an Optiprep.TM. step gradient
(27%/33%/39%) as previously described (22). VLPs were dialyzed in
PBS (0.02% PS80) and incubated for 30 min at 30.degree. C. with
biotin and Biotin ligase (BirA) according to instructions from
Avidity (Aurora, Colo.). Excess biotin was removed by dialysis in
PBS (0.32 M NaCl, 0.02% PS80) and protein concentration was
determined using BCA analysis. Collected ultracentrifugation
fractions were analyzed with NuPAGE.RTM. Bis-Tris Protein gels
(Life Technologies) or blotted onto a nitrocellulose membrane
(GE-Healthcare, RPN203E) for detection of L1 or biotin with
CamVir-1 (AbD Serotec, Bio-Rad, 7135-2804) or Streptavidin-HRP
(Life Technologies, 43-4323), respectively. Densitometric analysis
of SDS-PAGE gels was done using ImageJ.
Example 3--Gene Design and Recombinant Expression of Biotin-Binding
Vaccine Antigens
[0320] Heterologous vaccine antigens were genetically fused with a
GGS linker at either their C- or N-terminus to a previously
described (refs)/patented (U.S. Pat. No. 8,586,708 B2) engineered
monovalent streptavidin (mSA) (SEQ ID NO: 37), thereby introducing
biotin binding capability to the expressed mSA-antigen fusion
proteins. mSA-antigen fusion genes expressed in E. coli were
designed with a 6.times.Histidine tag and NcoI/BamHI restriction
sites for subcloning into pET-15b vector. mSA-antigen fusion genes
expressed in either S2 cells, Human Embryonic Kidney 293 (HEK293)
cells or in Baculovirus infected insect cells were designed with
flanking EcoRI/BamHI (N-terminal) and NotI (C-terminal) sites and a
6.times.Histidine tag and were subcloned into the pHP34s,
pcDNA.TM.4/HisMax or pAcGP67A (BD Biosciences) vector,
respectively.
Example 4--Characterisation of Particles
[0321] Electron Microscopy--Negative Staining
[0322] An aliquot of diluted VLPs was adsorbed to 200-mesh mica
carbon-coated grids and negatively stained with 2% phosphotungstic
acid (pH=7.0). The sample was examined with a CM 100 BioTWIN
electron microscope (Phillips, Amsterdam) at an accelerating
voltage of 80 kV. Photographic records were performed on an Olympus
Veleta camera. Particle sizes were estimated using ImageJ.
Representative pictures are shown in FIG. 2.
Example 5--Particle Size Measurement by Dynamic Light Scattering
(DLS)
[0323] The hydrodynamic diameter (referred to as size) of the VLP
was measured using a particle analyzer, DynaPro NanoStar (WYATT
Technology), equipped with a 658 nm laser. VLP samples were diluted
to 0.2 mg/mL with PBS (0.32 M NaCl, 0.02% PS80) and 70 .mu.l of
each VLP sample was loaded into a disposable low volume cuvette and
mounted into the DLS chamber. After 1 min equilibration, the size
distribution was obtained by DLS measurement at 25.degree. C. Each
sample was measured 2 times with 20 runs in each measurement. The
most predominant average sizes of particles in the population were
calculated from the measurements and recorded together with the %
polydispersity (% Pd).
Example 6--Determination of the Extent of Biotinylation of
AviTag-VLPs
[0324] The degree of biotinylation of the AviTag-VLPs is estimated
by comparison with known quantities of fully biotinylated
C-terminal AviTag Maltose Binding Protein (MBP-AviTag protein)
using a typical ELISA setup. Briefly, the standard MBP-AviTag
protein and AviTag-VLPs are adsorbed to the wells of a 96-well
maxisorb plate (Nunc 456537) at known protein quantities (1-45 ng,
5 ng increments). Extraneous biotin is removed by washing with TBST
buffer (10 mM Tris, pH 7.5, 150 mM NaCl, 0.05% Tween 20) and the
plate is blocked by adding 300 .mu.l blocking solution (PBS plus 40
.mu.g/ml BSA) to each well. The streptavidin-horseradish peroxidase
solution is then added into each well and incubated with gentle
shaking for 1 hour at room temperature. Finally, the biotin
associated with the biotin acceptor site is detected by its
interaction with streptavidin-conjugated horseradish peroxidase by
monitoring the absorption at 490 nm after adding the developing
solution (3 OPD tablets dissolved in 12 ml d-water with 10 .mu.l
H2O2).
Example 7--Verification of the mSA-Antigen Coupling onto (Biotin
Acceptor Site)--VLPs
[0325] The overall amounts of antigen coupled onto the VLPs was
estimated by comparing the relative amounts of antigen/HPV L1
protein on a reduced SDS-PAGE gel (FIG. 3). The material for this
analysis was made by firstly mixing biotinylated VLPs with an
excess amount of the mSA-antigen and then separating the
mSA-antigen/VLP complexes from the excess mSA-antigen by density
gradient ultracentrifugation. The VLPs were also examined by
transmission electron microscopy to assess their integrity after
coupling of different mSA-antigens (FIG. 4). Specifically, an
aliquot of diluted particles (post mSA-coupling and removal of
excess mSA-antigen) was placed on 200-mesh mica carbon-coated
grids, negatively stained with 2% phosphotungstic acid (pH=7.0) and
examined by transmission electron microscopy (TEM) using a CM 100
BioTWIN.
Example 8--Coupling of Antigens to VLPs
[0326] The inventors have partially tested the coupling of 7
different VLPs with 12 different antigen/monovalent streptavidin
fusion proteins. The results have been obtained as described above
and are summarized in table 3.
TABLE-US-00003 TABLE 3 Coupling of VLP1-7 and antigen/mSA A1-A11.
Sequences of the constructs are found in table 5. VLP1 VLP2 VLP3
VLP4 VLP5 VLP6 VLP7 A1 No Yes Yes No N/A No No coupling VLPs VLPs
VLPs A2 No Yes Yes No N/A No No coupling VLPs VLPs VLPs A3 No N/A
N/A No N/A No No coupling VLPs VLPs VLPs A4 No Yes Yes No N/A No No
coupling VLPs VLPs VLPs A5 No Yes Yes No N/A No No coupling VLPs
VLPs VLPs A6 No Yes Yes No N/A No No coupling VLPs VLPs VLPs A7 No
Yes Yes No N/A No No coupling VLPs VLPs VLPs A8 No Yes Yes No N/A
No No coupling VLPs VLPs VLPs A9 No Yes Yes No N/A No No coupling
VLPs VLPs VLPs A10 No Yes Yes No N/A No No coupling VLPs VLPs VLPs
A11 No Yes Yes No N/A No No coupling VLPs VLPs VLPs A12 No Yes N/A
No N/A No No coupling VLPs VLPs VLPs
Example 9--Expression and Purification of VAR2CSA and
mSA-VAR2CSA
[0327] The chimeric mSA-VAR2CSA gene sequence was designed with a
small Gly-Gly-Ser linker separating the monomeric Streptavidin
(mSA) [GenBank: 4JNJ_A] from the ID1-ID2a domains of VAR2CSA [FCR3
strain, GenBank: GU249598] (amino terminus). Both the VAR2CSA and
mSA-VAR2CSA gene fragments were further modified to contain a
C-terminal 6.times. histidine tag and flanking BamHI and NotI
restriction sites used for sub-cloning into the Baculovirus vector,
pAcGP67A (BD Biosciences). Linearized Bakpak6 Baculovirus DNA (BD
Biosciences) was co-transfected with pAcGP67A-VAR2CSA or
pAcGP67A-mSA-VAR2CSA into Sf9 insect cells for generation of
recombinant virus particles. Histidine-tagged recombinant protein
was purified on Ni.sup.2+ sepharose columns from the supernatant of
Baculovirus infected High-Five insect cells using an AKTAxpress
purification system (GE-Healthcare).
Example 10--Conjugation and Purification of mSA-VAR2CSA to L1-Avi
VLPs
[0328] For production of the VLP-VAR2CSA vaccine, biotinylated
HPV16 Avi-L1 VLPs were mixed with 3.times. molar excess of
mSA-VAR2CSA and the sample was incubated at 4.degree. C. for 18-24
hours with gentle shaking. Unbound mSA-VAR2CSA was removed by
ultracentrifugation over an Optiprep.TM. step gradient (27%, 33%,
39%) as previously described (Buck et al., 2004).
[0329] The VLP-VAR2CSA vaccine was dialyzed in PBS (0.32 M NaCl,
0.02% PS80) and the relative concentration of VLP-bound mSA-VAR2CSA
was estimated by SDS-PAGE using a BSA standard dilution range. Post
ultracentrifugation fractions were analyzed by SDS-PAGE or blotted
onto a nitrocellulose membrane (GE-Healthcare RPN203E) for
detection of L1 or mSA-VAR2CSA (via a 6.times. histidine tag) with
CamVir-1 (AbD Serotec, Bio-Rad, 7135-2804) or Penta.quadrature.His
HRP (QIAGEN, 34460) respectively.
Example 11--Anti-VAR2CSA Antibody Response Measured by ELISA
[0330] Recombinant VAR2CSA (1 .mu.g/ml in PBS) was coated on Nunc
MaxiSorp plates overnight at 4.degree. C. Plates were incubated
with blocking buffer for 1 hour at room temperature (RT) to inhibit
non-specific binding to the plate. Plates were washed three times
in between different steps. Serum samples were diluted in blocking
buffer (1:100), added to the wells in three fold dilutions, and
incubated for 1 hour at RT. Horseradish peroxidase (HRP)-conjugated
polyclonal rabbit anti-mouse Ig (P260 DAKO, Denmark) was diluted
1:3000 in blocking buffer and incubated for 1 hour. Finally, color
reactions were developed for 7 min by adding o-phenylenediamine
substrate. The HRP enzymatic reaction was stopped by adding 2.5 M
H.sub.2SO.sub.4 and the optical density was measured at 490 nm
using an ELISA plate reader (VersaMax Molecular Devices).
Example 12--Parasite Culture
[0331] Parasites were maintained in culture as described (23).
Briefly, parasites were cultured in 5% hematocrit of human blood
(group 0+) in RPMI 1640 (Sigma) supplemented with 0.125 .mu.g/ml
Albumax II (Invitrogen) and 2% normal human serum. Atmospheric air
was exchanged with a mixture of 1% oxygen and 5% carbon dioxide in
nitrogen, whereafter incubation was done at 37.degree. C. under
static conditions with ad hoc change of culture medium. The FCR3
isolate was selected for binding to CSA by panning on BeWo cells as
described (Haase et al., 2006). Parasite isolates tested negative
for mycoplasma (Lonza) and were regularly genotyped using nested
GLURP and MSP-2 primers in a single PCR step, as described (Snounou
et al., 1999).
Example 13--Inhibition of Binding Assays
[0332] Parasite DNA was labeled with Tritium by overnight
incorporation of titrated hypoxanthine. A 96 well plate (Falcon)
was coated with 2 .mu.g/ml of Decorin (Sigma-Aldrich) overnight and
blocked with 2% bovine serum albumin (Sigma) as described (Nielsen
et al., 2009). Tritium labeled late-stage IEs were MACS purified
and added to the 96 well plate in a concentration of 200,000 cells
per well. Titrations of serum were added in a total volume of 100
.mu.l in triplicate wells. After incubation for 90 min at
37.degree. C., unbound IEs were washed away by a pipetting robot
(Beckman-Coulter). The remaining IEs were harvested onto a filter
plate (Perkin-Elmer). After addition of scintillation fluid
(Perkin-Elmer) the counts per minute (CPM) recording the number of
non-inhibited IE was determined by liquid scintillation counting on
a Topcount NXT (Perkin-Elmer). Data were adjusted to percentage of
binding by dividing test result with the mean value of wells with
IE incubated without serum.
Example 14--Generation of Biotinylated HPV Avi-L1 VLPs
[0333] The biotin acceptor site (AviTag.TM.) sequence was
genetically inserted as described above at four different positions
in the HPV16 L1 sequence, which based on the crystal structure of
HPV16 L1 capsid protein, correspond to surface exposed loops in the
assembled VLP structure. The chimeric Avi-L1 constructs were
expressed in High-Five cells and allowed to assemble into VLPs
(FIG. 1b). Formation of VLPs was confirmed by performing density
gradient ultracentrifugation followed by SDS-PAGE analysis. This
analysis indicated that three of the recombinant proteins, Avi-L1
(HI), Avi-L1 (DE) and Avi-L1 (H4-.beta.J coil) formed VLPs as the
majority of the expressed protein were present in high
molecular/density fractions 4-6 after ultracentrifugation (FIG.
5a). The Avi-L1 (FG) protein was exclusively found in the low
density fractions containing non-particulate soluble protein,
indicating that the AviTag.TM. insertion, in this case, prevented
VLP assembly.
[0334] The identity of Avi-L1 proteins in the high-density
fractions was confirmed by western blot analysis using a monoclonal
anti-HPV16 L1 antibody (FIG. 5c). VLP assembly of the Avi-L1
constructs was verified by transmission electron microscopy (TEM)
as described above showing a heterogeneous population of VLPs of
different sizes (28-60 nm) (FIG. 5b), representing different
icosahedral assembly symmetries of which roughly 30% had the
size/appearance of native HPV16 L1 VLPs. The particles were
subsequently biotinylated (FIG. 5c) and analyzed by TEM.
Example 15--Construction of the Displayed Antigen VAR2CSA
[0335] The shortest truncated VAR2CSA polypeptide sequence that is
able to bind CSA covers the ID1-ID2a region of the full-length
protein (FIG. 1a). This construct (herein referred to as VAR2CSA)
was genetically fused at the amino terminus to monomeric
streptavidin (mSA) which can bind biotin with high affinity. To
avoid VLP aggregation we used a monomeric form of streptavidin
which is advantageous to native streptavidin as the latter contains
four biotin binding sites. The chimeric construct expressed high
levels of soluble protein and retained a structure capable of
binding CSA (data not shown). Purified mSA-VAR2CSA was subsequently
mixed with the biotinylated VLP (1:3 HPV L1/antigen), and examined
by ultracentrifugation followed by SDS-PAGE and western blot
analysis. High-density ultracentrifugation fractions [4-5]
contained both mSA-VAR2CSA and Avi-L1 protein, which was estimated
by densitometric analysis to be present at a 0.6:1 molar ratio.
Excess mSA-VAR2CSA was present in the low-density fractions [12-14]
(FIG. 6 a&c). The co-localization of Avi-L1 and mSA-VAR2CSA,
indicated that the mSA-VAR2CSA antigen was bound to the surface of
Avi-L1 VLPs at high density and that these large protein complexes
had been separated from the excess soluble mSA-VAR2CSA (FIG. 6a).
To confirm that co-localization of mSA-VAR2CSA and Avi-L1 VLPs was
caused by the specific interaction between mSA and biotin, the
procedure was repeated using unbiotinylated VLPs. This control
experiment showed that ultracentrifugation efficiently separated
soluble mSA-VAR2CSA from unbiotinylated VLPs (FIG. 10).
[0336] Antigen-coupled VLPs were further examined by TEM, showing
particles of a comparably larger size (.about.70 nm) than the
non-coupled VLPs (.about.30-60 nm) (FIG. 6b). This observation was
further examined by dynamic light scattering (DLS) analysis, which
confirmed that mixing of mSA-VAR2CSA with biotinylated Avi-L1 VLPs
resulted in measurably larger particles with an average diameter of
.about.70 nm (12.9% Pd) compared to naked Avi-L1 VLPs (<60 nm,
23.9% Pd). Importantly, this analysis also confirmed that such
large complexes were not formed after mixing unbiotinylated VLPs
with mSA-VAR2CSA, demonstrating that mSA-VAR2CSA is, in fact, bound
to the surface of Avi-L1 VLPs via the specific affinity interaction
between mSA and biotin.
[0337] Together, these results indicate that the produced
mSA-VAR2CSA VLP vaccine consists of non-aggregated HPV16 Avi-L1
VLPs displaying dense, repetitive arrays of the mSA-VAR2CSA antigen
presented in a consistent orientation, as illustrated schematically
in FIG. 1b.
Example 16--Inserting AviTag.TM. into Other Coat Proteins Forming
Papilloma VLP
[0338] The HPV16 L1 genotype, used as VLP platform in this study,
constitutes one of the most prevalent oncogenic HPV types. This
genotype is included in all licensed HPV vaccines, which are being
administered to millions of young women every year. Thus, the
immunogenicity of this VLP platform could be impeded by
pre-existing immunity towards the HPV L1 major capsid protein. We
therefore examined whether insertion of the AviTag.TM. sequence was
compatible with VLP formation in other HPV genotypes as well as in
non-human PV. The AviTag.TM. sequence was inserted in the L1 major
capsid protein of the European elk PV as well as in HPV genotype
118 at a position corresponding to the fusion site in the HPV16
Avi-L1 (DE) (FIG. 7a). The two protein sequences were expressed and
purified as previously described. For both constructs a L1 band of
the expected protein size (56 kDa) was found in the high-density
ultracentrifugation fractions although the majority of protein
present in these fractions was of a lower molecular size, possibly
representing a L1 truncation (FIG. 7b).
[0339] These data indicate that insertion of the AviTag.TM.
sequence into other PV types is a feasible strategy for avoiding
the potential issue of pre-existing immunity.
Example 17--Immunization of Mice
[0340] Female C57BL/6 mice (Taconic, Denmark) were immunized by
intramuscular injection with 5 .mu.g VLP-coupled mSA-VAR2CSA,
soluble mSA-VAR2CSA or soluble naked VAR2CSA on day 0 with no
adjuvant. Two booster injections with 2.5 .mu.g of the respective
antigens were given on days 21 and 42. Immune-serum was collected
on days 14, 35 and 56.
[0341] The immunogenicity of the mSA-VAR2CSA VLP vaccine was then
tested. ELISA was used to measure total immunoglobulin (Ig) levels
against VAR2CSA in sera obtained from mice immunized with
mSA-VAR2CSA VLP, soluble mSA-VAR2CSA or soluble naked VAR2CSA (FIG.
8). After three immunizations the VAR2CSA specific Ig levels were
higher in sera from mice immunized with the mSA-VAR2CSA Avi-L1 VLP
vaccine than in sera from mice immunized with soluble naked VAR2CSA
(FIG. 8c). After 1.sup.st and 2.sup.nd immunization sera from
mSA-VAR2CSA Avi-L1 VLP immunized mice had statistically
significantly higher Ig endpoint titers compared with sera from
mice immunized with the soluble mSA-VAR2CSA vaccine (P=0.014 and
P=0.018, respectively). This difference was, however, not
statistically significant after the 3.sup.rd immunization (P=0.058)
(Table 4) where both vaccines seem to have reached a similar
plateau.
TABLE-US-00004 TABLE 4 Serum endpoint titers (median {25 and 75
percentiles}) obtained with the different immunogens After first
After second After third immunization immunization immunization 1.
Soluble Not done Not done 8,100.sup.a VAR2CSA {8,100:8,100} 2.
Soluble mSA- 24,300.sup.a 218,700.sup.a 218,700.sup.a VAR2CSA
{24,300:24,300} {72,900:218,700} {72,900:218,700} 3. mSA-
72,900.sup.a 656,100.sup.a 218,700.sup.a VAR2CSA Avi-
{72,900:218,700} {656,100:656,100} {218,700:656,100} L1 VLP
P-Value.sup.b 0.014 (2. vs 3.) 0.018 (2. vs 3.) 0.0072 (1. vs 2.)
0.0072 (1. vs 3.) 0.058 (2. vs 3.) .sup.aEndpoint titer, defined as
the reciprocal of the highest serum dilution giving an OD
measurement above the cutoff. The cutoff was set to be three
standard deviations above the mean negative control reading.
.sup.bP values were calculated using Wilcoxon rank sum test.
Example 18--Functionality of the mSA-VAR2CSA VLP Vaccine Induced
Anti-VAR2 Antibodies
[0342] Antisera were examined for their ability to block the
binding between native VAR2CSA expressed on the surface of
parasite-infected erythrocytes and immobilized CSA. After first
immunization, none of the three vaccines (mSA-VAR2CSA VLP, soluble
mSA-VAR2CSA or soluble naked VAR2CSA) had induced efficient levels
of functional binding-inhibitory antibodies, leading to full
binding of parasites (FIG. 9a). However, after the second round of
immunizations 1:50 diluted serum from mSA-VAR2CSA VLP immunized
mice inhibited the binding between IE and CSA by approximately 70%.
In comparison, the soluble mSA-VAR2CSA vaccine only inhibited
approximately 20%, while no inhibition was seen for the soluble
naked VAR2CSA vaccine (FIG. 9b). After three immunizations, 1:200
diluted serum from mice immunized with the mSA-VAR2CSA VLP vaccine
showed roughly 90% binding-inhibition, while the sera from mice
immunized with the soluble mSA-VAR2CSA vaccine inhibited parasite
binding by approximately 60%. By contrast, the soluble naked
VAR2CSA vaccine failed to induce any binding-inhibitory antibodies
(FIG. 9c).
[0343] These data show that the mSA-VAR2CSA VLP vaccine displays
higher ability to inhibit binding between IE and CSA.
Example 19--Measurement of Antibody Avidity
[0344] The avidity values of serum antibodies (Ab) were determined
by measuring the resistance of Ab-target complexes to 8 M urea by
ELISA. Analyzed sera were obtained after the 2.sup.nd immunization.
Antibody titres of individual mouse sera were firstly normalized by
dilution. After the serum incubation, triplicate wells were treated
with either PBS or 8 M urea for 5 minutes. Subsequently, the wells
were washed with PBS, and the ELISA was performed as previously
described. The avidity value was calculated as the ratio of the
mean OD value of urea-treated wells to PBS control wells multiplied
by 100. A non-parametric two-sample Wilcoxon rank-sum
(Mann-Whitney) test showed that sera from mice immunized with the
VAR2CSA AviL1 VLP vaccine had significantly higher avidity values
compared to mice immunized with soluble mSA-VAR2CSA (P value:
0.0275).
[0345] Statistical Analysis:
TABLE-US-00005 Two-sample Wilcoxon rank-sum (Mann-Whitney) test
group obs rank sum expected 1 4 29 20 2 5 16 25 combined 9 45 45
unadjusted variance 16.67 adjustment for ties 0.00 adjusted
variance 16.67 Ho: reducall(group == 1) = reducall(group == 2) z =
2.205 Prob > |z| = 0.0275
Example 20--Survivin
[0346] We wanted to examine if our virus-like particle (VLP)
antigen presentation platform was able to overcome immune-tolerance
to a cancer-associated self-antigen "Survivin". This was tested by
coupling monovalent streptavidin (mSA)-Survivin fusion proteins to
the surface of biotinylated HPV Avi-L1 (HI-loop) VLPs. Three mice
were immunized with this VLP-based survivin vaccine. Negative
control mice (n=2) were immunized with the same amount (5 .mu.g) of
mSA-Survivin, but mixed with unbiotinylated Avi-L1 (HI-loop) VLPs.
Both vaccines were formulated using ALUM adjuvant. Mice were
immunized three times at three week intervals and sera were
obtained two weeks after each immunization.
[0347] The obtained anti-sera were tested in ELISA using naked
survivin (no mSA) as the solid phase capturing antigen. In this way
we could directly test what effect the VLP-display had on the
ability of the mice to induce humoral immunity against the
self-antigen.
[0348] The results clearly show that all the survivin-VLP
(mSA-Survivin coupled to HPV Avi-L1 (HI-LOOP)) immunized mice (n=3)
induced high-titre antibody responses against the mSA-survivin
self-antigen, whereas the negative control vaccine was not able to
break immune-tolerance in the immunized mice (no sero-conversion)
(FIG. 11a). The ability to break immune-tolerance thus relies
solely on the virus-like display and is not a result of e.g. fusing
the self-antigen to mSA.
[0349] By testing the same anti-sera in ELISA using the
mSA-survivin as the solid phase capturing antigen we could see the
negative control mice did produce antibodies against the `foreign`
mSA part (FIG. 11b).
[0350] This experiment shows that after three immunizations mouse
1-3 (immunized with Survivin displayed on VLP) were able to break
self-tolerance, whereas mouse 4 and 5 are unable to generate a
response against soluble survivin.
Example 20--Testing of VLP:Avi Platform to Induce Humoral Immunity
Against Self-Antigens
[0351] To demonstrate the capacity of the VLP:Avi platform to break
immune tolerance to self-antigens, associated with both
cardiovascular disease (PCSK9), allergy (IL-5) and cancer (Her2),
we will genetically fuse the self-antigens to the monovalent mSA
and coupled them onto biotinylated (biotin acceptor site)-VLPs, as
previously described. In some cases (IL-5) we will at first use the
mouse gene homologues for the immunization of mice. Specifically,
our working procedure will be to firstly couple HER2
(mSA:Her2-ECD|23-6861), and PCSK9(PCSK9|31-692|:mSA-HIS) to the
(biotin acceptor site)-VLPs, immunize, and measure seroconversion
of the animals in group a) mice immunized with conjugated VLPs and
b) mice immunized with the non-coupled soluble antigen. The antigen
specific Ig and IgG titer will be estimated in a 2 fold dilution
series of the sera. A positive seroconversion is defined as ELISA
OD measurements above 2.times. standard deviation of a mock
immunized animal. Serum conversion and induction of specific
antibodies to HER2 is further confirmed by western blotting using
the sera and cell lysates from different cancerous cell lines (e.g.
melanoma, prostate, breast and lung cancer).
Example 21--Testing of VLP:Avi Platform to Induce Cancer Inhibitory
Antibodies
[0352] We are establishing animal models to study the effect of
immunizing animals with tumor antigens on the growth of an
established subcutaneous tumor. 100.000 tumor cells expressing HER2
and/or Survivin are injected into the left flank. This is being
done in both vaccinated animals and mock immunized animals, to
study the prophylactic effect of the vaccine. Tumor growth is
monitored by measuring the size of the growing tumor as well as by
scanning of the animal when using luciferase transfected cell
lines. In another setup we are studying the therapeutic effect of
the vaccine by immunizing animals with established tumors and
monitoring tumor regression/progression by size measurements and/or
by fluorescent scannings.
Example 22--Testing of VLP:Avi Platform to Induce Anti-PCSK9
Antibodies Capable of Lowering Plasma/Serum Cholesterol Levels
[0353] The goal of making a VLP-based vaccine based on the PCSK9
antigen is to induce a humoral response capable of lowering blood
cholesterol. Therefore, to test the VLP:avi platform we measure
cholesterol levels in plasma and serum samples obtained from
VLP-PCSK9 immunized mice and compare against the levels measured in
mice immunized with the non-coupled PCSK9 antigen, as previously
described. Cholesterol levels in plasma and serum samples are
measured using a WAKO Cholesterol E Assay kit (Cat#439-17501)
following the manufacturers' instructions. Dilutions of cholesterol
standard or test plasma/serum samples (4 .mu.l volume) are added to
wells of a 96-well plate and 196 .mu.l of prepared cholesterol
reagent added. The plate is incubated for 5 minutes at 37.degree.
C. and the absorbance of the developed color read at 600 nm within
30 minutes.
[0354] Sequences
TABLE-US-00006 TABLE 5 Overview of the sequences disclosed in the
present invention Seq ID NO protein (DNA) (biotin acceptor
site)/AviTag-VLPs: 1 VLP1 >L1avi1 (H4-loop, HPV16) (11) 2 VLP2
>L1avi2 (HI-loop, HPV16) (12) 3 VLP3 >L1avi3 (DE-loop, HPV16)
(13) 4 VLP4 >L1avi4 (FG-loop, HPV16) (14) 5 major capsid L1
protein [Human papillomavirus type 16] Protein 6 VLP5 >L1avi2
(HI-loop, HPV118) (15) 7 VLP6 >L1avi3 (DE-loop, HPV118) (16) 8
L1 [Human papillomavirus type 118] 9 VLP7 >PAPVE-L1avi3 (17) 10
Major capsid protein L1 OS = European elk papillomavirus Antigens:
18 A1 >mSA-Her2-ECD|23-686 19 A2 >mSA-IL-5(C63T/C105T) 20 A3
>PCSK9|31-692|:mSA:HIS (29) 21 A4 >mSA-ID1ID2a-HIS (30) 22 AS
>mSA-RO-HIS (31) 23 A6 >HIS-RO-mSA (32) 24 A7
>HIS-GMZ2ggsmSA (33) 25 A8 >HIS-GMZ2T:ggsmSA (34) 26 A9
>mSA-PfRH5-HIS 35 27 A10 >mSA-Pfs25-HIS 28 A11
>HIS-PfCSP(aa92-397)-mSA 40 A12 >Survivin:mSA (Homo Sapiens)
41 A13 >mSA:Survivin (Homo Sapiens) 42 A14
>Survivin(F101A/L102A):mSA (Homo Sapiens) 43 A15
>mSA:Survivin(F101A/L102A) (Homo Sapiens) 44 (48) A16
>mSA:Survivin(F101A/L102A) (Mus Musculus) 45 (49) A17
>Survivin(F101A/L102A):mSA (Mus Musculus) 46 (50) A18
>mSA:Survivin (Mus Musculus) 47 (51) A19 >Survivin:mSA (Mus
Musculus) 52 (53) A20 >mSA:CIDR1a-HIS Misc. 36 (39) Biotin
acceptor site amino acid sequence 37 monovalent streptavidin 38
BirA Escherichia coli (strain K12) GN = birA PE = 1 SV = 1 >SEQ
ID NO: 1 [H4-loop, HPV genotype 16] L1Avi1 Protein
MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG
SPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICK
YPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGSGSTANLA
SSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMS
LCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWN
FGLQPPPGGTLEDTYRFVTSQAIACQKHGLNDIFEAQKIEWHETPPAPKEDPLKKYTF
WEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRK LELSGR
>SEQ ID NO: 2 [HI-loop, HPV genotype 16] L1Avi2 Protein
MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG
SPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICK
YPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGXXWIYXXQ
XLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRST
NMSLCAAISTSGLNDIFEAQKIEWHEETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTA
DVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKK
YTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRK
KRKLELSGR >SEQ ID NO: 3 [DE-loop, HPV genotype 16] L1avi3
Protein MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
GISGHPLLNKLDDTENASAGLNDIFEAQKIEWHEAGVDNRECISMDYKQTQLCLIGCK
PPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSE
VPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIK
GSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVV
DTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHS
MNSTILEDWNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVN
LKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKLEL >SEQ
ID NO: 4 [FG-loop HPV genotype 16] L1avi4) Protein
MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
GISGHPLLNKLDDTENASAAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCT
NVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICKYPDYI
KMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGLNDIFEAQKIEWH
EASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTN
MSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILED
WNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSAD
LDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKLELSGRF >SEQ ID
NO: 5 gi|9627108|ref|NP_041332.1| major capsid L1 protein [Human
papillomavirus type 16] Protein
MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG
SPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFGAMDFTTLQANKSEVPLDICTSICK
YPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGTVGENVPDDLYIKGSGSTANLA
SSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMS
LCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWN
FGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKEDDPLKKYTFWEVNLKEKFSADLD
QFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKL >SEQ ID NO: 6
L1Avi2 (HIloop, HPV118genotype) Protein
MAVWQAASGKVYLPPSTPVARVQSTDEYVERTNIYYHAFTDRLLTVGHPYFNIFNND
GNKLEVPKVSGNQHRVFRLRLPDPNRFALADMSVYNPDKERLVWAITGLEIGRGQPL
GVGTSGHPLFNKFNDTENGNKYTNTSTDDRQNISFDPKQLQMFIIGCTPCIGEHWDR
APACVEDEQLGRCPPIELVNTFIQDDDMADIGYGNLNFKALQQNRSDVSLDIVDEICKY
PDFLKMQNDVYGDACFFYARREQCYARRFFVRGGKPGDDIPAEQIDAGKLKNEFYIP
AAGGQAQGQLGNSMYFPTVSGSLVSSDAQLFNRPFWLQRAQGHNNGILWGNQLFV
TVLDNTRNTNFSIAVYSEGLNDIFEAQKIEWHEQDIANYDSSKSREYQRHVEEYEVSMI
LQLCKIPLKPEVLAHINAMNPAILEDWQLGFIPTPDNPIHDTYRYIDSLATRCPDKVPAK
EKEDPYGKYVFWNVDLSERLSLDLDQYPLGRKFLFQAGLRQKSVNGSVTRTVSRGA KRKRKSGR
>SEQ ID NO: 7 L1avi3 (DEloop, HPV118genotype) Protein
MAVWQAASGKVYLPPSTPVARVQSTDEYVERTNIYYHAFTDRLLTVGHPYFNIFNND
GNKLEVPKVSGNQHRVFRLRLPDPNRFALADMSVYNPDKERLVWAITGLEIGRGQPL
GVGTSGHPLFNKFNDTENGNGLNDIFEAQKIEWHETSTDDRQNISFDPKQLQMFIIGC
TPCIGEHWDRAPACVEDEQLGRCPPIELVNTFIQDDDMADIGYGNLNFKALQQNRSD
VSLDIVDEICKYPDFLKMQNDVYGDACFFYARREQCYARRFFVRGGKPGDDIPAEQID
AGKLKNEFYIPAAGGQAQGQLGNSMYFPTVSGSLVSSDAQLFNRPFWLQRAQGHNN
GILWGNQLFVTVLDNTRNTNFSIAVYSEQDIANYDSSKSREYQRHVEEYEVSMILQLC
KIPLKPEVLAHINAMNPAILEDWQLGFIPTPDNPIHDTYRYIDSLATRCPDKVPAKEKED
PYGKYVFWNVDLSERLSLDLDQYPLGRKFLFQAGLRQKSVNGSVTRTVSRGAKRKR KSGRF
>SEQ ID NO: 8 gi|256807737|gb|ACV30153.1| L1 [Human
papillomavirus type 118] Protein
MAVWQAASGKVYLPPSTPVARVQSTDEYVERTNIYYHAFTDRLLTVGHPYFNIFNND
GNKLEVPKVSGNQHRVFRLRLPDPNRFALADMSVYNPDKERLVWAITGLEIGRGQPL
GVGTSGHPLFNKFNDTENGNKYTNTSTDDRQNISFDPKQLQMFIIGCTPCIGEHWDR
APACVEDEQLGRCPPIELVNTFIQDDDMADIGYGNLNFKALQQNRSDVSLDIVDEICKY
PDFLKMQNDVYGDACFFYARREQCYARRFFVRGGKPGDDIPAEQIDAGKLKNEFYIP
AAGGQAQGQLGNSMYFPTVSGSLVSSDAQLFNRPFWLQRAQGHNNGILWGNQLFV
TVLDNTRNTNFSIAVYSEAGKIQDIANYDSSKSREYQRHVEEYEVSMILQLCKIPLKPE
VLAHINAMNPAILEDWQLGFIPTPDNPIHDTYRYIDSLATRCPDKVPAKEKEDPYGKYV
FWNVDLSERLSLDLDQYPLGRKFLFQAGLRQKSVNGSVTRTVSRGAKRKRK >SEQ ID NO:
9 Avi3 Europaeisk elg papillomavirus (DEloop) Protein
MAFWQPSQRLYLPPTPVTKVLCSEQYIRRKDVFYHGETERMLTVGHPYYEIKQSGSG
KTIPKVSPNQYRVFRILLPDPNQFALPDKAMYDPSKERLVWAVVGVQVSRGQPLGGS
VSGHSYQNTLIDAENVSGLNDIFEAQKIEWHEQGTDDRKQGGMDVKQQQILLLGCTP
AIGEYWTTARPCVTDRPETGSCPPIELKNKPIEDGDMMDIGFGAANFKELNATKSDLP
LDIAKDICLYPDYLKMTEEAAGNSMFFFARKEQVYVRHIWSRGGTDKEMPPEAYFLKP
KGGDQTQKMPSILFGVPSGSLVSTDGQLFNRPYWLFRAQGMNNGICWLNQLFVTVG
DNTRGTTLTITVPTSGSPLTEYDTSKFNVFQRHVEEYKLAFVFQLCSVTLSPETVSHLQ
GLMPSILEHWDINMQPPTSSILEDTYRYLESPATKCADNVTPMGPEDPYAGLKFWEV
NLKERLSLDLDQFPLGRRFLAQQGLGCSTRKRVAPVPKVTEKRIVRKRRKGN >SEQ ID NO:
10 sp|P11326|VL1_PAPVE Major capsid protein L1 OS = European elk
papillomavirus GN = L1 PE = 3 SV = 1 Protein
MAFWQPSQRLYLPPTPVTKVLCSEQYIRRKDVFYHGETERMLTVGHPYYEIKQSGSG
KTIPKVSPNQYRVFRILLPDPNQFALPDKAMYDPSKERLVWAVVGVQVSRGQPLGGS
VSGHSYQNTLIDAENVSKKVNAQGTDDRKQGGMDVKQQQILLLGCTPAIGEYWTTAR
PCVTDRPETGSCPPIELKNKPIEDGDMMDIGFGAANFKELNATKSDLPLDIAKDICLYP
DYLKMTEEAAGNSMFFFARKEQVYVRHIWSRGGTDKEMPPEAYFLKPKGGDQTQKM
PSILFGVPSGSLVSTDGQLFNRPYWLFRAQGMNNGICWLNQLFVTVGDNTRGTTLTIT
VPTSGSPLTEYDTSKFNVFQRHVEEYKLAFVFQLCSVTLSPETVSHLQGLMPSILEHW
DINMQPPTSSILEDTYRYLESPATKCADNVTPMGPEDPYAGLKFWEVNLKERLSLDLD
QFPLGRRFLAQQGLGCSTRKRVAPVPKVTEKRIVRKRRKGN >SEQ ID NO: 11
[H4-loop HPV genotype 16] L1Avi1] DNA
GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCTA
CGCCGCCAACGCCGGTGTCGACAACAGGGAATGCATCTCTATGGACTACAAGCA
GACCCAGCTGTGCCTGATCGGATGCAAGCCCCCCATCGGAGAACACTGGGGAAA
GGGATCTCCCTGCACCAACGTCGCCGTCAACCCCGGCGACTGCCCCCCTCTGGA
ACTGATCAACACCGTCATCCAGGACGGCGACATGGTCGACACCGGATTCGGAGC
CATGGACTTCACCACCCTGCAGGCCAACAAGTCTGAAGTCCCCCTGGACATCTGC
ACCTCTATCTGCAAGTACCCCGACTACATCAAGATGGTGTCTGAACCCTACGGCG
ACTCTCTGTTCTTCTACCTGAGGCGCGAACAGATGTTCGTCAGGCACCTGTTCAA
CCGCGCCGGTGCCGTCGGAGAAAACGTCCCCGACGACCTGTACATCAAGGGATC
TGGATCTACCGCCAACCTGGCCTCTTCTAACTACTTCCCTACCCCTTCTGGATCTA
TGGTCACCTCTGACGCCCAGATCTTCAACAAGCCCTACTGGCTGCAGAGGGCCC
AGGGACACAACAACGGAATCTGCTGGGGAAACCAGCTGTTCGTCACCGTCGTCG
ACACCACCAGGTCTACCAACATGTCCCTGTGCGCCGCCATCTCTACCTCTGAAAC
CACCTACAAGAACACCAACTTCAAAGAATACCTGCGCCACGGCGAAGAATACGAC
CTGCAGTTCATCTTCCAGCTGTGCAAGATCACCCTGACCGCCGACGTCATGACCT
ACATCCACTCTATGAACTCTACCATCTTGGAGGACTGGAACTTCGGACTGCAGCC
CCCTCCCGGTGGAACCCTCGAGGACACCTACCGCTTCGTCACCAGCCAGGCTAT
CGCCTGCCAGAAGCACGGACTGAACGACATCTTCGAAGCCCAAAAGATCGAATG
GCACGAAACCCCCCCTGCCCCCAAAGAGGACCCCCTGAAGAAGTACACCTTCTG
GGAAGTCAACCTGAAAGAAAAGTTCTCTGCCGACCTGGACCAGTTCCCCCTGGGA
CGCAAGTTCCTGCTGCAAGCCGGACTGAAGGCCAAGCCCAAGTTCACCCTGGGA
AAGAGGAAGGCCACCCCCACCACCTCTTCTACCTCTACCACCGCCAAGAGGAAG
AAGCGCAAGCTGGAACTGTAAAGCGGCCGC >SEQ ID NO: 12 L1avi2 (HI-loop,
HPV16) DNA
GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCTA
CGCCGCCAACGCCGGTGTCGACAACAGGGAATGCATCTCTATGGACTACAAGCA
GACCCAGCTGTGCCTGATCGGATGCAAGCCCCCCATCGGAGAACACTGGGGAAA
GGGATCTCCCTGCACCAACGTCGCCGTCAACCCCGGCGACTGCCCCCCTCTGGA
ACTGATCAACACCGTCATCCAGGACGGCGACATGGTCGACACCGGATTCGGAGC
CATGGACTTCACCACCCTGCAGGCCAACAAGTCTGAAGTCCCCCTGGACATCTGC
ACCTCTATCTGCAAGTACCCCGACTACATCAAGATGGTGTCTGAACCCTACGGCG
ACTCTCTGTTCTTCTACCTGAGGCGCGAACAGATGTTCGTCAGGCACCTCTTCAA
CAGGGCCGGTGCCGTCGGAGAAAACGTCCCCGACGACCTGTACATCAAGGGATC
TGGATCTACCGCCAACCTGGCCTCTTCTAACTACTTCCCTACCCCTTCTGGATCTA
TGGTCACCTCTGACGCCCAGATCTTCAACAAGCCCTACTGGCTGCAGAGGGCCC
AGGGACACAACAACGGAATCTGCTGGGGAAACCAGCTGTTCGTCACCGTCGTCG
ACACCACCAGGTCTACCAACATGTCCCTGTGCGCCGCCATCTCTACCTCTGGACT
GAACGACATCTTCGAGGCCCAAAAGATCGAATGGCACGAGGAAACCACCTACAAG
AACACCAACTTCAAAGAATACCTGCGCCACGGCGAAGAATACGACCTGCAGTTCA
TCTTCCAGCTGTGCAAGATCACCCTGACCGCCGACGTCATGACCTACATCCACTC
TATGAACTCTACCATCTTGGAGGATTGGAACTTCGGACTGCAGCCCCCTCCCGGT
GGAACCCTCGAGGACACCTACCGCTTCGTCACCAGCCAGGCTATCGCCTGCCAG
AAGCACACCCCCCCTGCCCCCAAAGAGGACCCCCTGAAGAAGTACACCTTCTGG
GAAGTCAACCTGAAAGAAAAGTTCTCTGCCGACCTGGACCAGTTCCCCCTGGGAC
GCAAGTTCCTGCTGCAAGCCGGACTGAAGGCCAAGCCCAAGTTCACCCTGGGAA
AGAGGAAGGCCACCCCCACCACCTCTTCTACCTCTACCACCGCCAAGAGGAAGA
AGCGCAAGCTGGAACTGTAAAGCGGCCGC >SEQ ID NO: 13 L1avi3 (DE-loop,
HPV16) GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCGG
ACTGAACGACATCTTCGAGGCCCAAAAGATCGAATGGCACGAGGCCGGTGTCGA
CAACAGGGAATGCATCTCTATGGACTACAAGCAGACCCAGCTGTGCCTGATCGGA
TGCAAGCCCCCCATCGGAGAACACTGGGGAAAGGGATCTCCCTGCACCAACGTC
GCCGTCAACCCCGGCGACTGCCCCCCTCTGGAACTGATCAACACCGTCATCCAG
GACGGCGACATGGTCGACACCGGATTCGGAGCCATGGACTTCACCACCCTGCAG
GCCAACAAGTCTGAAGTCCCCCTGGACATCTGCACCTCTATCTGCAAGTACCCCG
ACTACATCAAGATGGTGTCTGAACCCTACGGCGACTCTCTGTTCTTCTACCTGAG
GCGCGAACAGATGTTCGTCAGGCACCTCTTCAACAGGGCCGGTGCCGTCGGAGA
AAACGTCCCCGACGACCTGTACATCAAGGGATCTGGATCTACCGCCAACCTGGCC
TCTTCTAACTACTTCCCTACCCCTTCTGGATCTATGGTCACCTCTGACGCCCAGAT
CTTCAACAAGCCCTACTGGCTGCAGAGGGCCCAGGGACACAACAACGGAATCTG
CTGGGGAAACCAGCTGTTCGTCACCGTCGTCGACACCACCAGGTCTACCAACATG
TCCCTGTGCGCCGCCATCTCTACCTCTGAAACCACCTACAAGAACACCAACTTCA
AAGAATACCTGCGCCACGGCGAAGAATACGACCTGCAGTTCATCTTCCAGCTGTG
CAAGATCACCCTGACCGCCGACGTCATGACCTACATCCACTCTATGAACTCTACC
ATCTTGGAGGATTGGAACTTCGGACTGCAGCCCCCTCCCGGTGGAACCCTCGAG
GACACCTACCGCTTCGTCACCAGCCAGGCTATCGCCTGCCAGAAGCACACCCCC
CCTGCCCCCAAAGAGGACCCCCTGAAGAAGTACACCTTCTGGGAAGTCAACCTGA
AAGAAAAGTTCTCTGCCGACCTGGACCAGTTCCCCCTGGGACGCAAGTTCCTGCT
GCAAGCCGGACTGAAGGCCAAGCCCAAGTTCACCCTGGGAAAGAGGAAGGCCAC
CCCCACCACCTCTTCTACCTCTACCACCGCCAAGAGGAAGAAGCGCAAGCTGGAA
CTGTAAAGCGGCCGC >SEQ ID NO: 14 L1avi4 (FG-loop, HPV16)
GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCTA
CGCCGCCAACGCCGGTGTCGACAACAGGGAATGCATCTCTATGGACTACAAGCA
GACCCAGCTGTGCCTGATCGGATGCAAGCCCCCCATCGGAGAACACTGGGGAAA
GGGATCTCCCTGCACCAACGTCGCCGTCAACCCCGGCGACTGCCCCCCTCTGGA
ACTGATCAACACCGTCATCCAGGACGGCGACATGGTCGACACCGGATTCGGAGC
CATGGACTTCACCACCCTGCAGGCCAACAAGTCTGAAGTCCCCCTGGACATCTGC
ACCTCTATCTGCAAGTACCCCGACTACATCAAGATGGTGTCTGAACCCTACGGCG
ACTCTCTGTTCTTCTACCTGAGGCGCGAACAGATGTTCGTCAGGCACCTCTTCAA
CAGGGCCGGTGCCGTCGGAGAAAACGTCCCCGACGACCTGTACATCAAGGGACT
GAACGACATCTTCGAGGCCCAAAAGATCGAATGGCACGAGGCCTCTTCTAACTAC
TTCCCTACCCCTTCTGGATCTATGGTCACCTCTGACGCCCAGATCTTCAACAAGCC
CTACTGGCTGCAGAGGGCCCAGGGACACAACAACGGAATCTGCTGGGGAAACCA
GCTGTTCGTCACCGTCGTCGACACCACCAGGTCTACCAACATGTCCCTGTGCGCC
GCCATCTCTACCTCTGAAACCACCTACAAGAACACCAACTTCAAAGAATACCTGCG
CCACGGCGAAGAATACGACCTGCAGTTCATCTTCCAGCTGTGCAAGATCACCCTG
ACCGCCGACGTCATGACCTACATCCACTCTATGAACTCTACCATCTTGGAGGATT
GGAACTTCGGACTGCAGCCCCCTCCCGGTGGAACCCTCGAGGACACCTACCGCT
TCGTCACCAGCCAGGCTATCGCCTGCCAGAAGCACACCCCCCCTGCCCCCAAAG
AGGACCCCCTGAAGAAGTACACCTTCTGGGAAGTCAACCTGAAAGAAAAGTTCTC
TGCCGACCTGGACCAGTTCCCCCTGGGACGCAAGTTCCTGCTGCAAGCCGGACT
GAAGGCCAAGCCCAAGTTCACCCTGGGAAAGAGGAAGGCCACCCCCACCACCTC
TTCTACCTCTACCACCGCCAAGAGGAAGAAGCGCAAGCTGGAACTGTAAAGCGG CCGC >SEQ
ID NO: 15 L1avi2 (HI-loop, HPV118)
GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGGCCGTCTGGCAGGCCGCCTC
TGGAAAGGTCTACCTGCCCCCCTCTACCCCCGTCGCCAGGGTCCAGTCTACCGA
CGAATACGTCGAAAGGACCAACATCTACTACCACGCCTTCACCGACAGGCTGCTG
ACCGTCGGACACCCCTACTTCAACATCTTCAACAACGACGGAAACAAGCTCGAAG
TCCCCAAGGTGTCCGGAAACCAGCACAGGGTGTTCAGGCTGAGGCTGCCCGACC
CCAACCGCTTCGCCCTGGCCGACATGTCTGTCTACAACCCCGACAAAGAAAGGCT
CGTCTGGGCCATCACCGGACTGGAAATCGGAAGGGGACAGCCCCTGGGAGTCG
GAACCTCTGGACACCCCCTGTTCAACAAGTTCAACGACACCGAAAACGGCAACAA
GTACACCAACACCTCCACCGACGACAGGCAGAACATCTCTTTCGACCCCAAGCAG
CTGCAGATGTTCATCATCGGATGCACCCCCTGCATCGGAGAACACTGGGACAGG
GCCCCTGCCTGCGTCGAGGACGAACAGCTGGGAAGGTGCCCCCCCATCGAACTG
GTCAACACCTTCATCCAGGACGACGACATGGCCGACATCGGATACGGAAACCTGA
ACTTCAAGGCCCTGCAGCAGAACCGCTCTGACGTGTCCCTGGACATCGTCGACG
AAATCTGCAAGTACCCCGACTTCCTGAAGATGCAGAACGACGTCTACGGCGACGC
CTGCTTCTTCTACGCTAGGCGCGAACAGTGCTACGCCAGGCGCTTCTTCGTCCGC
GGAGGAAAGCCCGGCGACGACATCCCCGCCGAACAGATCGACGCCGGAAAGCT
GAAGAACGAATTCTACATCCCTGCCGCCGGTGGACAGGCCCAGGGACAGCTCGG
AAACTCTATGTACTTCCCCACCGTCAGCGGATCTCTCGTCAGCTCTGACGCCCAG
CTGTTCAACAGGCCCTTCTGGCTGCAGCGCGCTCAGGGACACAACAACGGAATC
CTGTGGGGAAACCAGTTGTTCGTCACCGTCCTGGACAACACCCGCAACACCAACT
TCTCTATCGCCGTCTACTCTGAGGGACTGAACGACATCTTCGAAGCCCAAAAGAT
CGAATGGCACGAGCAGGACATTGCCAACTACGACTCTTCTAAGTCTAGGGAATAC
CAGCGCCACGTCGAAGAGTACGAAGTCTCTATGATCCTGCAGCTGTGCAAGATCC
CCCTGAAGCCCGAAGTCCTGGCCCACATCAACGCCATGAACCCCGCCATCTTGG
AGGACTGGCAGCTGGGATTCATCCCCACCCCCGACAACCCCATCCACGACACCT
ACCGCTACATCGACTCCCTGGCCACCAGGTGCCCTGACAAGGTCCCCGCCAAAG
AAAAAGAGGACCCCTACGGCAAATACGTGTTCTGGAACGTCGACCTGTCTGAAAG
GCTGTCTCTGGACCTGGACCAGTACCCCCTGGGACGCAAGTTCCTGTTCCAAGC
CGGACTGAGGCAGAAGTCTGTCAACGGATCTGTCACCAGGACCGTCAGCAGGGG
AGCCAAGAGGAAGCGCAAGTAAAGCGGCCGC >SEQ ID NO: 16 L1avi3 (DE-loop,
HPV118) GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGGCCGTCTGGCAGGCCGCCTC
TGGAAAGGTCTACCTGCCCCCCTCTACCCCCGTCGCCAGGGTCCAGTCTACCGA
CGAATACGTCGAAAGGACCAACATCTACTACCACGCCTTCACCGACAGGCTGCTG
ACCGTCGGACACCCCTACTTCAACATCTTCAACAACGACGGAAACAAGCTCGAAG
TCCCCAAGGTGTCCGGAAACCAGCACAGGGTGTTCAGGCTGAGGCTGCCCGACC
CCAACCGCTTCGCCCTGGCCGACATGTCTGTCTACAACCCCGACAAAGAAAGGCT
CGTCTGGGCCATCACCGGACTGGAAATCGGAAGGGGACAGCCCCTGGGAGTCG
GAACCTCTGGACACCCCCTGTTCAACAAGTTCAACGACACCGAAAACGGCAACGG
ACTGAACGACATCTTCGAAGCCCAAAAGATCGAATGGCACGAGACCTCCACCGAC
GACAGGCAGAACATCTCTTTCGACCCCAAGCAGCTGCAGATGTTCATCATCGGAT
GCACCCCCTGCATCGGAGAACACTGGGACAGGGCCCCTGCCTGCGTCGAGGAC
GAACAGCTGGGAAGGTGCCCCCCCATCGAACTGGTCAACACCTTCATCCAGGAC
GACGACATGGCCGACATCGGATACGGAAACCTGAACTTCAAGGCCCTGCAGCAG
AACCGCTCTGACGTGTCCCTGGACATCGTCGACGAAATCTGCAAGTACCCCGACT
TCCTGAAGATGCAGAACGACGTCTACGGCGACGCCTGCTTCTTCTACGCTAGGCG
CGAACAGTGCTACGCCAGGCGCTTCTTCGTCCGCGGAGGAAAGCCCGGCGACGA
CATCCCCGCCGAACAGATCGACGCCGGAAAGCTGAAGAACGAATTCTACATCCCT
GCCGCCGGTGGACAGGCCCAGGGACAGCTCGGAAACTCTATGTACTTCCCCACC
GTCAGCGGATCTCTCGTCAGCTCTGACGCCCAGCTGTTCAACAGGCCCTTCTGGC
TGCAGCGCGCTCAGGGACACAACAACGGAATCCTGTGGGGAAACCAGTTGTTCG
TCACCGTCCTGGACAACACCCGCAACACCAACTTCTCTATCGCCGTCTACTCTGA
GGCCGGAAAGATCCAGGACATTGCCAACTACGACTCTTCTAAGTCTAGGGAATAC
CAGCGCCACGTCGAAGAGTACGAAGTCTCTATGATCCTGCAGCTGTGCAAGATCC
CCCTGAAGCCCGAAGTCCTGGCCCACATCAACGCCATGAACCCCGCCATCTTGG
AGGACTGGCAGCTGGGATTCATCCCCACCCCCGACAACCCCATCCACGACACCT
ACCGCTACATCGACTCCCTGGCCACCAGGTGCCCTGACAAGGTCCCCGCCAAAG
AAAAAGAGGACCCCTACGGCAAATACGTGTTCTGGAACGTCGACCTGTCTGAAAG
GCTGTCTCTGGACCTGGACCAGTACCCCCTGGGACGCAAGTTCCTGTTCCAAGC
CGGACTGAGGCAGAAGTCTGTCAACGGATCTGTCACCAGGACCGTCAGCAGGGG
AGCCAAGAGGAAGCGCAAGTAAAGCGGCCGC >SEQ ID NO: 17 PAPVE-L1 avi3
GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
GTCCCACCATCGGGCGCGGATCTCTACTAGTATGGCCTTCTGGCAGCCCTCTCAG
CGTCTGTACCTGCCCCCCACCCCCGTCACCAAGGTCCTGTGCTCTGAACAGTACA
TCAGGCGCAAGGACGTGTTCTACCACGGCGAAACCGAAAGGATGCTGACCGTCG
GACACCCCTACTACGAAATCAAGCAGTCTGGATCTGGAAAGACCATCCCCAAGGT
GTCCCCCAACCAGTACAGGGTGTTCAGGATCCTGCTGCCCGACCCTAACCAGTTC
GCCCTGCCCGACAAGGCTATGTACGACCCCTCTAAGGAAAGGCTCGTCTGGGCC
GTCGTCGGAGTCCAGGTGTCCCGTGGACAGCCTCTGGGAGGATCTGTCTCTGGA
CACTCTTACCAGAACACCCTGATCGACGCCGAAAACGTGTCCGGACTGAACGACA
TCTTCGAAGCCCAAAAGATCGAATGGCACGAACAGGGAACCGACGACCGCAAGC
AGGGTGGAATGGACGTCAAGCAGCAGCAGATCCTGCTCCTGGGATGCACCCCCG
CCATCGGAGAATACTGGACCACCGCCAGGCCCTGCGTCACCGACAGGCCCGAAA
CCGGATCTTGCCCCCCCATCGAACTGAAGAACAAGCCCATCGAGGACGGCGACA
TGATGGACATCGGATTCGGAGCCGCCAACTTCAAGGAACTGAACGCCACCAAGTC
TGACCTGCCCCTGGACATCGCCAAGGACATCTGCCTGTACCCCGACTACCTGAAG
ATGACCGAAGAAGCCGCCGGAAACTCTATGTTCTTCTTCGCCCGCAAGGAACAGG
TCTACGTCCGCCACATCTGGTCCCGCGGAGGAACCGACAAGGAAATGCCCCCCG
AAGCCTACTTCCTGAAGCCCAAGGGTGGCGACCAGACCCAGAAGATGCCCTCTAT
CCTGTTCGGAGTCCCCTCTGGATCTCTCGTCAGCACCGACGGACAGCTGTTCAAC
AGGCCCTACTGGCTGTTCAGGGCCCAGGGAATGAACAACGGAATCTGCTGGCTG
AACCAGCTGTTCGTCACCGTCGGAGACAACACCAGGGGAACCACCCTGACCATC
ACCGTCCCCACCTCTGGATCCCCCCTGACCGAATACGACACCTCCAAGTTCAACG
TGTTCCAGAGGCACGTCGAAGAGTACAAGCTGGCCTTCGTGTTCCAGCTGTGCTC
TGTCACCCTGTCTCCCGAAACCGTCAGCCACCTCCAGGGACTGATGCCTTCCATC
CTGGAACACTGGGACATCAACATGCAGCCCCCCACCTCTTCTATCCTCGAGGACA
CCTACCGCTACCTGGAATCTCCTGCCACCAAGTGCGCCGACAACGTCACCCCCAT
GGGACCCGAGGACCCCTACGCCGGACTGAAGTTCTGGGAAGTCAACCTGAAGGA
ACGCCTGTCCCTGGACCTGGACCAGTTCCCCCTGGGAAGGCGCTTCCTGGCCCA
GCAGGGACTGGGATGCTCTACCCGCAAGAGGGTCGCCCCCGTCCCTAAGGTCAC
CGAAAAGAGGATCGTCCGCAAGAGGCGCAAGGGAAACTAAAGCGGCCGCTAA >SEQ ID NO:
18 A1 >mSA- Her2-ECD|23-686
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
TKVKGGSTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLS
FLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVT
GASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRS
RACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAG
CTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAV
TSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAW
PDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHL
CFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCV
NCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQC
VACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHSCVDLDDK
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTHHHHHH >SEQ ID NO:
19 A2 >mSA-IL-5(C63T/C105T)
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
TKVKGGSIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLTTEEIFQGIGTL
ESQTVQGGTVERLFKNLSLIKKYIDGQKKKTGEERRRVNQFLDYLQEFLGVMNTEWII ES*SGRK
>SEQ ID NO: 20 A3 >PCSK9|31-692|:mSA:HIS
QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETH
LSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEED
SSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTD
FENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKG
TVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGN
FRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDC
STCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQ
RVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSF
SRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEAS
MGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVV
RSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQGGSAEAGITGTWYNQHGSTFT
VTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRT
EWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTFTKVKHHHHHH >SEQ ID NO: 21
A4 >mSA-ID1ID2a-HIS
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
TKVKGGSNYIKGDPYFAEYATKLSFILNPSDANNPSGETANHNDEACNCNESGISSVG
QAQTSGPSSNKTCITHSSIKTNKKKECKDVKLGVRENDKDLKICVIEDTSLSGVDNCC
CQDLLGILQENCSDNKRGSSSNDSCDNKNQDECQKKLEKVFASLTNGYKCDKCKSG
TSRSKKKWIWKKSSGNEEGLQEEYANTIGLPPRTQSLYLGNLPKLENVCEDVKDINFD
TKEKFLAGCLIVSFHEGKNLKKRYPQNKNSGNKENLCKALEYSFADYGDLIKGTSIWD
NEYTKDLELNLQNNFGKLFGKYIKKNNTAEQDTSYSSLDELRESWWNTNKKYIWTAM
KHGAEMNITTCNADGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVENFCEQRQAKVKDV
ITNCKSCKESGNKCKTECKTKCKDECEKYKKFIEACGTAGGGIGTAGSPWSKRWDQI
YKRYSKHIEDAKRNRKAGTKNCGTSSTTNAAASTDENKCVQSDIDSFFKHLIDIGLTTP
SSYLSNVLDDNICGADKAPWTTYTTYTTTEKCNKERDKSKSQSSDTLVVVNVPSPLG
NTPYRYKYACQCKIPTNEETCDDRKEYMNQWSCGSARTMKRGYKNDNYELCKYNG
VDVKPTTVRSNSSKLDHHHHHH >SEQ ID NO: 22 A5 >mSA-RO-HIS
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
TKVKGGSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQS
EKSLVSENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSD
IISENNKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPL
EPFPTQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLK
LKSFDEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQN
SQIPSLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQS
QHNINVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHE
TFEEETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNEN
EFVESEKSEHEARSKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENI
SKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEEEEEEKEEENDKKKEQ
EKEQSNENNDQKKDMEAQNLISKNQNNNEKNVKEAAESIMKTLAGLIKGNNQIDSTLK
DLVEELSKYFKNHRSHHHHHH >SEQ ID NO: 23 A6 >HIS-RO-mSA
GSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLV
SENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISEN
NKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFP
TQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSF
DEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIP
SLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNI
NVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEE
ETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNENEFVE
SEKSEHEAGGSGAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNS
PYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGG
SGPATEQGQDTFTKVK >SEQ ID NO: 24 A7 >HIS-GMZ2ggsmSA
GSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLV
SENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISEN
NKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFP
TQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSF
DEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIP
SLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNI
NVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEE
ETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNENEFVE
SEKSEHEARSKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENISKEN
DDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEEEEEEKEEENDKKKEQEKEQ
SNENNDQKKDMEAQNLISKNQNNNEKNVKEAAESIMKTLAGLIKGNNQIDSTLKDLVE
ELSKYFKNHGGSGAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQN
SPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEG
GSGPATEQGQDTFTKVK >SEQ ID NO:25 A8 >HIS-GMZ2T:ggsmSA
GSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLV
SENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISEN
NKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFP
TQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSF
DEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIP
SLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNI
NVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEE
ETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNENEFVE
SEKSEHEARSKTKEYAEKAKNAYEKAKNAYQKANQAVLKAKEASSYDYILGWEFGGG
VPEHKKEENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEGGSGAEAGIT
GTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVE
WNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTFTKVK >SEQ ID
NO: 26 A9 >mSA-PfRH5-HIS
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
TKVKGGSLSFENAIKKTKNQENNLTLLPIKSTEEEKDDIKNGKDIKKEIDNDKENIKTNN
AKDHSTYIKSYLNTNVNDGLKYLFIPSHNSFIKKYSVFNQINDGMLLNEKNDVKNNEDY
KNVDYKNVNFLQYHFKELSNYNIANSIDILQEKEGHLDFVIIPHYTFLDYYKHLSYNSIYH
KYSTYGKYIAVDAFIKKINETYDKVKSKCNDIKNDLIATIKKLEHPYDINNKNDDSYRYDI
SEEIDDKSEETDDETEEVEDSIQDTDSNHTPSNKKKNDLMNRTFKKMMDEYNTKKKK
LIKCIKNHENDFNKICMDMKNYGTNLFEQLSCYNNNFCNTNGIRFHYDEYIHKLILSVKS
KNLNKDLSDMTNILQQSELLLTNLNKKMGSYIYIDTIKFIHKEMKHIFNRIEYHTKIINDKT
KIIQDKIKLNIWRTFQKDELLKRILDMSNEYSLFITSDHLRQMLYNTFYSKEKHLNNIFHH
LIYVLQMKFNDVPIKMEYFQTYKKNKPLTQHHHHHH >SEQ ID NO: 27 A10
>mSA-Pfs25-HIS
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
TKVKGGSNKLYSLFLFLFIQLSIKYNNAKVTVDTVCKRGFLIQMSGHLECKCENDLVLV
NEETCEEKVLKCDEKTVNKPCGDFSKCIKIDGNPVSYACKCNLGYDMVNNVCIPNEC
KNVTCGNGKCILDTSNPVKTGVCSCNIGKVPNVQDQNKCSKDGETKCSLKCLKENET
CKAVDGIYKCDCKDGFIIDNESSICTAFSAYNILNLSIMFILFSVCFFIM >SEQ ID NO:
28 A11 >HIS-PfCSP(aa92-397)-mSA
KLKQPADGNPDPNANPNVDPNANPNVDPNANPNVDPNANPNANPNANPNANPNAN
PNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNVDPNA
NPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPN
ANPNANPNANPNANPNKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEP
SDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICK
MEKCSSVFNVVNSSIGLIMVLSFLFLNGGSAEAGITGTVVYNQHGSTFTVTAGADGNLT
GQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGG
AEARINTQWNLTYEGGSGPATEQGQDTFTKVK >SEQ ID NO: 29 A3
>PCSK9|31-692|:mSA:HIS DNA
TTTCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT
GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTAC
GTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGC
GTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAA
TGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACT
CCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAA
GCAGAGCTCTCTGGCTAACTAGAGAACCCACTGCTTACTGGCTTATCGAAATTAAT
ACGACTCACTATAGGGAGACCCAAGCTGGCTAGCGTTTAAACTTAAGCTTAGCGC
AGAGGCTTGGGGCAGCCGAGCGGCAGCCAGGCCCCGGCCCGGGCCTCGGTTCC
AGAAGGGAGAGGAGCCCGCCAAGGCGCGCAAGAGAGCGGGCTGCCTCGCAGTC
CGAGCCGGAGAGGGAGCGCGAGCCGCGCCGGCCCCGGACGGCCTCCGAAACC
ATGCAGGAAGATGAGGACGGCGACTACGAGGAACTGGTGCTGGCCCTGCGGAG
CGAAGAGGATGGACTGGCCGAGGCCCCTGAGCACGGCACCACCGCCACCTTCC
ACAGATGCGCCAAGGACCCTTGGCGGCTGCCCGGCACATACGTGGTGGTGCTGA
AAGAGGAAACCCACCTGAGCCAGAGCGAGCGGACCGCCAGAAGGCTGCAGGCC
CAGGCCGCCAGAAGAGGCTACCTGACCAAGATCCTGCACGTGTTCCACGGCCTG
CTGCCCGGCTTCCTGGTGAAAATGAGCGGCGACCTGCTGGAACTGGCCCTGAAG
CTGCCCCACGTGGACTACATCGAAGAGGACAGCAGCGTGTTCGCCCAGAGCATC
CCCTGGAACCTGGAACGGATCACCCCCCCCAGATACCGGGCCGACGAGTACCAG
CCTCCTGACGGCGGCAGCCTGGTGGAAGTGTACCTGCTGGACACCAGCATCCAG
AGCGACCACCGCGAGATCGAGGGCAGAGTGATGGTGACAGACTTCGAGAACGTG
CCCGAAGAGGACGGCACCCGGTTCCACAGACAGGCCAGCAAGTGCGACAGCCA
CGGCACACATCTGGCCGGCGTGGTGTCTGGCAGAGATGCCGGCGTGGCCAAGG
GCGCCAGCATGAGAAGCCTGCGGGTGCTGAACTGCCAGGGCAAGGGCACCGTG
TCCGGCACCCTGATCGGCCTGGAATTCATCCGGAAGTCCCAGCTGGTGCAGCCC
GTGGGCCCTCTGGTGGTGCTGCTGCCTCTGGCTGGCGGCTACAGCAGAGTGCTG
AACGCCGCCTGCCAGAGACTGGCCAGAGCTGGCGTGGTGCTGGTGACAGCCGC
CGGAAACTTCCGGGACGACGCCTGCCTGTACAGCCCCGCCTCTGCCCCCGAAGT
GATCACCGTGGGCGCCACCAACGCCCAGGACCAGCCTGTGACACTGGGCACCCT
GGGCACAAACTTCGGCAGATGCGTGGACCTGTTCGCCCCTGGCGAGGACATCAT
CGGCGCCAGCAGCGACTGCAGCACCTGTTTCGTGTCCCAGAGCGGCACCAGCCA
GGCCGCTGCCCATGTGGCCGGAATCGCCGCCATGATGCTGAGCGCCGAGCCTG
AGCTGACCCTGGCCGAGCTGCGGCAGCGGCTGATCCACTTCTCCGCCAAGGACG
TGATCAACGAGGCCTGGTTCCCCGAGGACCAGAGAGTGCTGACCCCCAACCTGG
TGGCCGCCCTGCCTCCTTCTACACACGGCGCTGGCTGGCAGCTGTTCTGCAGGA
CAGTGTGGTCCGCCCACAGCGGCCCCACCAGAATGGCCACAGCCGTGGCCAGAT
GCGCCCCTGATGAGGAACTGCTGAGCTGCAGCAGCTTCTCCAGAAGCGGCAAGC
GGAGAGGCGAGCGGATGGAAGCCCAGGGCGGCAAGCTCGTGTGCAGAGCCCAC
AATGCCTTCGGCGGCGAGGGCGTGTACGCCATTGCCAGATGCTGCCTGCTGCCT
CAGGCCAACTGCAGCGTGCACACAGCCCCTCCAGCCGAGGCCAGCATGGGCAC
CAGAGTGCACTGCCACCAGCAGGGCCACGTGCTGACCGGCTGTAGCAGCCACTG
GGAGGTGGAAGATCTGGGCACCCACAAGCCCCCCGTGCTGAGGCCCAGAGGCC
AGCCTAATCAGTGCGTGGGCCACAGAGAGGCCTCCATCCACGCCAGCTGTTGCC
ACGCCCCTGGCCTGGAATGCAAAGTGAAAGAGCACGGCATCCCTGCCCCCCAGG
AACAGGTCACAGTGGCCTGCGAGGAAGGCTGGACCCTGACAGGCTGTTCCGCCC
TGCCAGGCACCTCTCACGTGCTGGGCGCCTACGCCGTGGACAATACCTGCGTCG
TGCGCAGCCGGGACGTGTCCACAACCGGCTCTACAAGCGAGGGCGCCGTGACC
GCCGTGGCCATCTGCTGCAGAAGCAGACACCTGGCCCAGGCCTCCCAGGAACTG
CAGGGCGGATCTGCCGAGGCCGGCATCACCGGCACCTGGTACAATCAGCACGG
CAGCACCTTCACCGTGACCGCTGGCGCCGACGGCAACCTGACCGGCCAGTACGA
GAACAGAGCCCAGGGCACCGGCTGCCAGAACAGCCCTTACACCCTGACCGGCAG
ATACAACGGCACCAAGCTGGAATGGCGGGTGGAATGGAACAACAGCACCGAGAA
CTGCCACAGCCGGACCGAGTGGCGGGGACAGTATCAGGGCGGAGCCGAGGCCC
GGATCAACACCCAGTGGAACCTGACCTACGAGGGCGGCTCTGGCCCTGCCACAG
AGCAGGGACAGGACACCTTCACCAAAGTGAAGCACCACCACCATCACCACTAAGC GGCCGCTTTT
>SEQ ID NO: 30 A4 >mSA-ID1ID2a-HIS DNA
CCATGGGCGGTGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTA
GCACCTTTACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAA
TCGTGCACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTAT
AATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTC
ATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAA
TACCCAGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGG
TCAGGATACCTTTACCAAAGTTAAAGGTGGCAGCAACTATATCAAAGGCGATCCGT
ATTTTGCAGAGTATGCAACCAAACTGAGCTTTATTCTGAATCCGAGTGATGCAAAT
AATCCGAGCGGTGAAACCGCAAATCACAATGATGAAGCCTGTAATTGTAACGAAA
GCGGTATTAGCAGCGTTGGTCAGGCACAGACCAGCGGTCCGAGCAGCAATAAAA
CCTGTATTACCCATAGCAGCATTAAAACCAATAAAAAGAAAGAATGCAAAGATGTG
AAACTGGGCGTGCGCGAAAATGATAAAGATCTGAAAATTTGCGTGATCGAGGATA
CCAGCCTGAGCGGTGTTGATAATTGTTGTTGTCAGGATCTGCTGGGTATTCTGCA
AGAAAATTGCAGCGATAATAAACGTGGTAGCAGCAGCAATGATAGCTGCGATAAC
AAAAATCAGGATGAATGCCAGAAAAAACTGGAAAAAGTTTTTGCCAGCCTGACGAA
TGGTTACAAATGCGATAAATGTAAAAGCGGCACCAGCCGCAGCAAAAAGAAATGG
ATTTGGAAAAAAAGCAGCGGCAATGAAGAAGGTCTGCAAGAGGAATATGCAAATA
CCATTGGTCTGCCTCCGCGTACCCAGAGCCTGTATCTGGGTAATCTGCCGAAACT
GGAAAATGTGTGTGAAGATGTGAAAGATATCAATTTTGATACCAAAGAAAAATTTCT
GGCAGGCTGCCTGATTGTGAGCTTTCATGAAGGTAAAAACCTGAAAAAACGCTAT
CCGCAGAATAAAAACAGCGGTAACAAAGAAAATCTGTGCAAAGCACTGGAATACA
GCTTTGCAGATTATGGCGATCTGATTAAAGGCACCAGCATTTGGGATAACGAGTAT
ACCAAAGATCTGGAACTGAATCTGCAGAACAATTTCGGTAAACTGTTCGGCAAATA
TATCAAAAAAAACAATACCGCAGAGCAGGATACCAGCTATAGCAGCCTGGATGAA
CTGCGTGAAAGTTGGTGGAATACCAACAAAAAATACATTTGGACCGCCATGAAAC
ATGGTGCCGAAATGAATATTACCACCTGTAATGCAGATGGTAGCGTTACCGGTAG
CGGTAGCAGCTGTGATGATATTCCGACCATTGATCTGATTCCGCAGTATCTGCGTT
TTCTGCAAGAATGGGTTGAAAACTTTTGTGAACAGCGTCAGGCGAAAGTGAAAGA
TGTTATTACCAATTGCAAAAGCTGCAAAGAAAGCGGCAATAAATGCAAAACCGAGT
GCAAAACCAAATGCAAAGACGAGTGCGAGAAATACAAAAAATTCATTGAAGCATGT
GGTACAGCCGGTGGTGGTATTGGCACCGCAGGTAGCCCGTGGTCAAAACGTTGG
GATCAGATCTATAAACGCTACAGCAAACACATCGAAGATGCCAAACGTAATCGTAA
AGCAGGCACCAAAAATTGTGGCACCAGCAGCACCACCAATGCAGCAGCAAGCAC
CGATGAAAACAAATGTGTTCAGAGCGATATCGATAGCTTCTTCAAACATCTGATTG
ATATTGGTCTGACCACCCCGAGCAGCTATCTGAGCAATGTTCTGGATGATAACATT
TGCGGTGCAGATAAAGCACCGTGGACCACCTATACCACATATACCACCACAGAAA
AATGCAACAAAGAGCGCGATAAAAGCAAAAGCCAGAGCAGCGATACCCTGGTTGT
TGTTAATGTTCCGAGTCCGCTGGGTAATACCCCGTATCGTTATAAGTATGCCTGCC
AGTGTAAAATCCCGACCAATGAAGAAACCTGTGATGATCGCAAAGAATACATGAAT
CAGTGGTCATGTGGTAGCGCACGTACCATGAAACGTGGCTATAAAAACGATAATT
ATGAACTGTGCAAATATAACGGCGTGGATGTTAAACCGACCACCGTTCGTAGCAA
TAGCAGCAAACTGGATCATCATCATCACCATCATTAAGGATCC >SEQ ID NO: 31 A5
>mSA-RO-HIS DNA
CCATGGGCGGTGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTA
GCACCTTTACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAA
TCGTGCACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTAT
AATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTC
ATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAA
TACCCAGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGG
TCAGGATACCTTTACCAAAGTTAAAGGTGGCAGCACAAGTGAGAATAGAAATAAAC
GAATCGGGGGTCCTAAATTAAGGGGTAATGTTACAAGTAATATAAAGTTCCCATCA
GATAACAAAGGTAAAATTATAAGAGGTTCGAATGATAAACTTAATAAAAACTCTGAA
GATGTTTTAGAACAAAGCGAAAAATCGCTTGTTTCAGAAAATGTTCCTAGTGGATT
AGATATAGATGATATCCCTAAAGAATCTATTTTTATTCAAGAAGATCAAGAAGGTCA
AACTCATTCTGAATTAAATCCTGAAACATCAGAACATAGTAAAGATTTAAATAATAA
TGGTTCAAAAAATGAATCTAGTGATATTATTTCAGAAAATAATAAATCAAATAAAGT
ACAAAATCATTTTGAATCATTATCAGATTTAGAATTACTTGAAAATTCCTCACAAGAT
AATTTAGACAAAGATACAATTTCAACAGAACCTTTTCCTAATCAAAAACATAAAGAC
TTACAACAAGATTTAAATGATGAACCTTTAGAACCCTTTCCTACACAAATACATAAA
GATTATAAAGAAAAAAATTTAATAAATGAAGAAGATTCAGAACCATTTCCCAGACAA
AAGCATAAAAAGGTAGACAATCATAATGAAGAAAAAAACGTATTTCATGAAAATGG
TTCTGCAAATGGTAATCAAGGAAGTTTGAAACTTAAATCATTCGATGAACATTTAAA
AGATGAAAAAATAGAAAATGAACCACTTGTTCATGAAAATTTATCCATACCAAATGA
TCCAATAGAACAAATATTAAATCAACCTGAACAAGAAACAAATATCCAGGAACAATT
GTATAATGAAAAACAAAATGTTGAAGAAAAACAAAATTCTCAAATACCTTCGTTAGA
TTTAAAAGAACCAACAAATGAAGATATTTTACCAAATCATAATCCATTAGAAAATAT
AAAACAAAGTGAATCAGAAATAAATCATGTACAAGATCATGCGCTACCAAAAGAGA
ATATAATAGACAAACTTGATAATCAAAAAGAACACATCGATCAATCACAACATAATA
TAAATGTATTACAAGAAAATAACATAAACAATCACCAATTAGAACCTCAAGAGAAAC
CTAATATTGAATCGTTTGAACCTAAAAATATAGATTCAGAAATTATTCTTCCTGAAA
ATGTTGAAACAGAAGAAATAATAGATGATGTGCCTTCCCCTAAACATTCTAACCAT
GAAACATTTGAAGAAGAAACAAGTGAATCTGAACATGAAGAAGCCGTATCTGAAAA
AAATGCCCACGAAACTGTCGAACATGAAGAAACTGTGTCTCAAGAAAGCAATCCT
GAAAAAGCTGATAATGATGGAAATGTATCTCAAAACAGCAACAACGAATTAAATGA
AAATGAATTCGTTGAATCGGAAAAAAGCGAGCATGAAGCAAGATCCAAAGCAAAA
GAAGCTTCTAGTTATGATTATATTTTAGGTTGGGAATTTGGAGGAGGCGTTCCAGA
ACACAAAAAAGAAGAAAATATGTTATCACATTTATATGTTTCTTCAAAGGATAAGGA
AAATATATCTAAGGAAAATGATGATGTATTAGATGAGAAGGAAGAAGAGGCAGAAG
AAACAGAAGAAGAAGAACTTGAAGAAAAAAATGAAGAAGAAACAGAATCAGAAATA
AGTGAAGATGAAGAAGAAGAAGAAGAAGAAGAAGAAAAGGAAGAAGAAAATGACA
AAAAAAAAGAACAAGAAAAAGAACAAAGTAATGAAAATAATGATCAAAAAAAAGATA
TGGAAGCACAGAATTTAATTTCTAAAAACCAGAATAATAATGAGAAAAACGTAAAA
GAAGCTGCTGAAAGCATCATGAAAACTTTAGCTGGTTTAATCAAGGGAAATAATCA
AATAGATTCTACCTTAAAAGATTTAGTAGAAGAATTATCCAAATATTTTAAAAATCAT
AGATCTCATCACCATCATCACCATTAGggatccttt >SEQ ID NO:32 A6
>HIS-RO-mSA DNA
GGATCCACAAGTGAGAATAGAAATAAACGAATCGGGGGTCCTAAATTAAGGGGTA
ATGTTACAAGTAATATAAAGTTCCCATCAGATAACAAAGGTAAAATTATAAGAGGTT
CGAATGATAAACTTAATAAAAACTCTGAAGATGTTTTAGAACAAAGCGAAAAATCG
CTTGTTTCAGAAAATGTTCCTAGTGGATTAGATATAGATGATATCCCTAAAGAATCT
ATTTTTATTCAAGAAGATCAAGAAGGTCAAACTCATTCTGAATTAAATCCTGAAACA
TCAGAACATAGTAAAGATTTAAATAATAATGGTTCAAAAAATGAATCTAGTGATATT
ATTTCAGAAAATAATAAATCAAATAAAGTACAAAATCATTTTGAATCATTATCAGATT
TAGAATTACTTGAAAATTCCTCACAAGATAATTTAGACAAAGATACAATTTCAACAG
AACCTTTTCCTAATCAAAAACATAAAGACTTACAACAAGATTTAAATGATGAACCTT
TAGAACCCTTTCCTACACAAATACATAAAGATTATAAAGAAAAAAATTTAATAAATG
AAGAAGATTCAGAACCATTTCCCAGACAAAAGCATAAAAAGGTAGACAATCATAAT
GAAGAAAAAAACGTATTTCATGAAAATGGTTCTGCAAATGGTAATCAAGGAAGTTT
GAAACTTAAATCATTCGATGAACATTTAAAAGATGAAAAAATAGAAAATGAACCACT
TGTTCATGAAAATTTATCCATACCAAATGATCCAATAGAACAAATATTAAATCAACC
TGAACAAGAAACAAATATCCAGGAACAATTGTATAATGAAAAACAAAATGTTGAAG
AAAAACAAAATTCTCAAATACCTTCGTTAGATTTAAAAGAACCAACAAATGAAGATA
TTTTACCAAATCATAATCCATTAGAAAATATAAAACAAAGTGAATCAGAAATAAATC
ATGTACAAGATCATGCGCTACCAAAAGAGAATATAATAGACAAACTTGATAATCAA
AAAGAACACATCGATCAATCACAACATAATATAAATGTATTACAAGAAAATAACATA
AACAATCACCAATTAGAACCTCAAGAGAAACCTAATATTGAATCGTTTGAACCTAAA
AATATAGATTCAGAAATTATTCTTCCTGAAAATGTTGAAACAGAAGAAATAATAGAT
GATGTGCCTTCCCCTAAACATTCTAACCATGAAACATTTGAAGAAGAAACAAGTGA
ATCTGAACATGAAGAAGCCGTATCTGAAAAAAATGCCCACGAAACTGTCGAACAT
GAAGAAACTGTGTCTCAAGAAAGCAATCCTGAAAAAGCTGATAATGATGGAAATGT
ATCTCAAAACAGCAACAACGAATTAAATGAAAATGAATTCGTTGAATCGGAAAAAA
GCGAGCATGAAGCAGGTGGTAGCGGTGCAGAAGCAGGTATTACCGGCACCTGGT
ATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGATGGTAATCTGAC
AGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAATAGCCCGTATACC
CTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATA
GCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTG
CAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGTGGTAGTGGTCC
GGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTGAAATAAcatatg >SEQ ID NO: 33
A7 >HIS-GMZ2ggsmSA3
GGATCCACAAGTGAGAATAGAAATAAACGAATCGGGGGTCCTAAATTAAGGGGTA
ATGTTACAAGTAATATAAAGTTCCCATCAGATAACAAAGGTAAAATTATAAGAGGTT
CGAATGATAAACTTAATAAAAACTCTGAAGATGTTTTAGAACAAAGCGAAAAATCG
CTTGTTTCAGAAAATGTTCCTAGTGGATTAGATATAGATGATATCCCTAAAGAATCT
ATTTTTATTCAAGAAGATCAAGAAGGTCAAACTCATTCTGAATTAAATCCTGAAACA
TCAGAACATAGTAAAGATTTAAATAATAATGGTTCAAAAAATGAATCTAGTGATATT
ATTTCAGAAAATAATAAATCAAATAAAGTACAAAATCATTTTGAATCATTATCAGATT
TAGAATTACTTGAAAATTCCTCACAAGATAATTTAGACAAAGATACAATTTCAACAG
AACCTTTTCCTAATCAAAAACATAAAGACTTACAACAAGATTTAAATGATGAACCTT
TAGAACCCTTTCCTACACAAATACATAAAGATTATAAAGAAAAAAATTTAATAAATG
AAGAAGATTCAGAACCATTTCCCAGACAAAAGCATAAAAAGGTAGACAATCATAAT
GAAGAAAAAAACGTATTTCATGAAAATGGTTCTGCAAATGGTAATCAAGGAAGTTT
GAAACTTAAATCATTCGATGAACATTTAAAAGATGAAAAAATAGAAAATGAACCACT
TGTTCATGAAAATTTATCCATACCAAATGATCCAATAGAACAAATATTAAATCAACC
TGAACAAGAAACAAATATCCAGGAACAATTGTATAATGAAAAACAAAATGTTGAAG
AAAAACAAAATTCTCAAATACCTTCGTTAGATTTAAAAGAACCAACAAATGAAGATA
TTTTACCAAATCATAATCCATTAGAAAATATAAAACAAAGTGAATCAGAAATAAATC
ATGTACAAGATCATGCGCTACCAAAAGAGAATATAATAGACAAACTTGATAATCAA
AAAGAACACATCGATCAATCACAACATAATATAAATGTATTACAAGAAAATAACATA
AACAATCACCAATTAGAACCTCAAGAGAAACCTAATATTGAATCGTTTGAACCTAAA
AATATAGATTCAGAAATTATTCTTCCTGAAAATGTTGAAACAGAAGAAATAATAGAT
GATGTGCCTTCCCCTAAACATTCTAACCATGAAACATTTGAAGAAGAAACAAGTGA
ATCTGAACATGAAGAAGCCGTATCTGAAAAAAATGCCCACGAAACTGTCGAACAT
GAAGAAACTGTGTCTCAAGAAAGCAATCCTGAAAAAGCTGATAATGATGGAAATGT
ATCTCAAAACAGCAACAACGAATTAAATGAAAATGAATTCGTTGAATCGGAAAAAA
GCGAGCATGAAGCAAGATCCAAAGCAAAAGAAGCTTCTAGTTATGATTATATTTTA
GGTTGGGAATTTGGAGGAGGCGTTCCAGAACACAAAAAAGAAGAAAATATGTTAT
CACATTTATATGTTTCTTCAAAGGATAAGGAAAATATATCTAAGGAAAATGATGATG
TATTAGATGAGAAGGAAGAAGAGGCAGAAGAAACAGAAGAAGAAGAACTTGAAGA
AAAAAATGAAGAAGAAACAGAATCAGAAATAAGTGAAGATGAAGAAGAAGAAGAA
GAAGAAGAAGAAAAGGAAGAAGAAAATGACAAAAAAAAAGAACAAGAAAAAGAAC
AAAGTAATGAAAATAATGATCAAAAAAAAGATATGGAAGCACAGAATTTAATTTCTA
AAAACCAGAATAATAATGAGAAAAACGTAAAAGAAGCTGCTGAAAGCATCATGAAA
ACTTTAGCTGGTTTAATCAAGGGAAATAATCAAATAGATTCTACCTTAAAAGATTTA
GTAGAAGAATTATCCAAATATTTTAAAAATCATGGTGGTAGCGGTGCAGAAGCAGG
TATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGC
GCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTC
AGAATAGCCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCG
TGTTGAATGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGT
CAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATG
AAGGTGGTAGTGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTGAA ATAAcatatg
>SEQ ID NO: 34 A8 >HIS-GMZ2T:ggsmSA DNA
GGATCCACAAGTGAGAATAGAAATAAACGAATCGGGGGTCCTAAATTAAGGGGTA
ATGTTACAAGTAATATAAAGTTCCCATCAGATAACAAAGGTAAAATTATAAGAGGTT
CGAATGATAAACTTAATAAAAACTCTGAAGATGTTTTAGAACAAAGCGAAAAATCG
CTTGTTTCAGAAAATGTTCCTAGTGGATTAGATATAGATGATATCCCTAAAGAATCT
ATTTTTATTCAAGAAGATCAAGAAGGTCAAACTCATTCTGAATTAAATCCTGAAACA
TCAGAACATAGTAAAGATTTAAATAATAATGGTTCAAAAAATGAATCTAGTGATATT
ATTTCAGAAAATAATAAATCAAATAAAGTACAAAATCATTTTGAATCATTATCAGATT
TAGAATTACTTGAAAATTCCTCACAAGATAATTTAGACAAAGATACAATTTCAACAG
AACCTTTTCCTAATCAAAAACATAAAGACTTACAACAAGATTTAAATGATGAACCTT
TAGAACCCTTTCCTACACAAATACATAAAGATTATAAAGAAAAAAATTTAATAAATG
AAGAAGATTCAGAACCATTTCCCAGACAAAAGCATAAAAAGGTAGACAATCATAAT
GAAGAAAAAAACGTATTTCATGAAAATGGTTCTGCAAATGGTAATCAAGGAAGTTT
GAAACTTAAATCATTCGATGAACATTTAAAAGATGAAAAAATAGAAAATGAACCACT
TGTTCATGAAAATTTATCCATACCAAATGATCCAATAGAACAAATATTAAATCAACC
TGAACAAGAAACAAATATCCAGGAACAATTGTATAATGAAAAACAAAATGTTGAAG
AAAAACAAAATTCTCAAATACCTTCGTTAGATTTAAAAGAACCAACAAATGAAGATA
TTTTACCAAATCATAATCCATTAGAAAATATAAAACAAAGTGAATCAGAAATAAATC
ATGTACAAGATCATGCGCTACCAAAAGAGAATATAATAGACAAACTTGATAATCAA
AAAGAACACATCGATCAATCACAACATAATATAAATGTATTACAAGAAAATAACATA
AACAATCACCAATTAGAACCTCAAGAGAAACCTAATATTGAATCGTTTGAACCTAAA
AATATAGATTCAGAAATTATTCTTCCTGAAAATGTTGAAACAGAAGAAATAATAGAT
GATGTGCCTTCCCCTAAACATTCTAACCATGAAACATTTGAAGAAGAAACAAGTGA
ATCTGAACATGAAGAAGCCGTATCTGAAAAAAATGCCCACGAAACTGTCGAACAT
GAAGAAACTGTGTCTCAAGAAAGCAATCCTGAAAAAGCTGATAATGATGGAAATGT
ATCTCAAAACAGCAACAACGAATTAAATGAAAATGAATTCGTTGAATCGGAAAAAA
GCGAGCATGAAGCAAGATCCAAAACAAAAGAATATGCTGAAAAAGCAAAAAATGC
TTATGAAAAGGCAAAAAATGCTTATCAAAAAGCAAACCAAGCTGTTTTAAAAGCAA
AAGAAGCTTCTAGTTATGATTATATTTTAGGTTGGGAATTTGGAGGAGGCGTTCCA
GAACACAAAAAAGAAGAAAATATGTTATCACATTTATATGTTTCTTCAAAGGATAAG
GAAAATATATCTAAGGAAAATGATGATGTATTAGATGAGAAGGAAGAAGAGGCAGA
AGAAACAGAAGAAGAAGAACTTGAAGGTGGTAGCGGTGCAGAAGCAGGTATTACC
GGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGATG
GTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAATAG
CCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTGAA
TGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTATC
AGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGTGG
TAGTGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTGAAATAAcatat g >SEQ
ID NO: 35 A9 >mSA-PfRH5-HIS DNA
gaattcGGTGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACC
TTTACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTG
CACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTATAATGG
CACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTCATAGC
CGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCC
AGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGGTCAGG
ATACCTTTACCAAAGTTAAAGGTGGCAGCCTGTCCTTCGAGAACGCCATCAAGAA
GACCAAGAACCAGGAAAACAACCTGACCCTGCTGCCCATCAAGTCCACCGAGGA
AGAGAAGGACGACATCAAGAACGGCAAGGATATCAAGAAGGAAATCGACAACGA
CAAGGAAAACATCAAGACCAACAACGCCAAGGACCACTCCACCTACATCAAGTCT
TACCTGAACACCAACGTGAACGACGGCCTGAAGTACCTGTTCATCCCATCCCACA
ACAGCTTCATCAAGAAGTACTCCGTTTTCAACCAGATCAACGACGGCATGCTGCT
GAACGAGAAGAACGACGTGAAGAACAACGAGGACTACAAGAACGTCGACTACAA
GAACGTGAACTTCCTGCAGTACCACTTCAAGGAACTGTCCAACTACAACATCGCC
AACTCCATCGACATCCTGCAAGAAAAGGAAGGCCACCTGGACTTCGTGATCATCC
CCCACTACACTTTCTTGGACTACTACAAGCACCTGTCCTACAACAGCATCTACCAC
AAGTACAGCACCTACGGCAAGTACATCGCTGTGGACGCTTTCATCAAGAAGATCA
ACGAGACTTACGACAAAGTGAAGTCCAAGTGTAACGATATCAAGAACGACCTGAT
CGCCACCATCAAGAAGCTCGAGCACCCCTACGACATCAACAACAAGAACGACGAC
AGCTACCGCTACGACATCTCCGAAGAGATCGACGACAAGTCCGAGGAAACCGAC
GACGAGACTGAGGAAGTCGAGGACTCCATCCAGGACACCGACTCCAACCACACC
CCCTCCAACAAGAAGAAGAACGATCTGATGAACCGCACCTTCAAGAAGATGATGG
ACGAGTACAACACTAAGAAGAAGAAGCTGATCAAGTGCATCAAGAACCACGAGAA
CGACTTCAACAAGATCTGCATGGACATGAAGAACTACGGCACCAACCTGTTCGAG
CAGCTGTCCTGCTACAACAACAACTTCTGCAACACTAACGGCATCCGCTTCCACTA
CGATGAGTACATCCACAAGCTGATCCTGTCCGTCAAGAGCAAGAACCTGAACAAG
GACCTGAGCGACATGACCAACATCCTCCAGCAGTCCGAGCTGCTGCTGACCAACT
TGAACAAGAAGATGGGCTCCTACATCTACATCGACACTATCAAGTTCATCCACAAG
GAAATGAAGCACATCTTCAACCGCATCGAGTACCACACCAAGATCATCAACGATAA
GACTAAGATCATCCAAGACAAGATCAAGCTGAACATCTGGCGCACTTTCCAAAAG
GACGAACTGCTGAAGCGTATCCTGGACATGTCTAACGAGTACTCCCTCTTCATCA
CCTCCGACCACCTGAGGCAGATGCTGTACAACACCTTCTACTCCAAGGAAAAGCA
CCTCAACAACATCTTCCACCACCTGATCTACGTGCTGCAGATGAAGTTCAACGAC
GTCCCCATCAAGATGGAATACTTCCAGACCTACAAGAAGAACAAGCCCCTGACCC
AGCATCATCACCACCACCAC >SEQ ID NO: 36 (biotin acceptor site)
GLNDIFEAQKIEWHE >SEQ ID NO: 37 monovalent streptavidin
AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF TKVK >SEQ
ID NO: 38 BirA OS = Escherichia coli (strain K12) GN = birA PE = 1
SV = 1 MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGY
SLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRG
RRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWP
NDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINL
DRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDK
QGALLLEQDGIIKPWMGGEISLRSAEK >SEQ ID NO: 39 DNA sequence of the
biotin binding site GGTCTGAACGACATCTTCGAGGCTCAGAAAATCGAATGGCACGAA
>SEQ ID NO: 40 >Survivin:mSA (Homo Sapiens)
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQC
FFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAK
ETNNKKKEFEETAKKVRRAIEQLAAMDggsGAEAGITGTWYNQHGSTFTVTAGADGNL
TGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQG
GAEARINTQWNLTYEGGSGPATEQGQDTFTKVK >SEQ ID NO: 41
>mSA:Survivin (Homo Sapiens)
MAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGT
KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQD
TFTKVKggsGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTEN
EPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRER
AKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD >SEQ ID NO: 42
>Survivin(F101A/L102A):mSA (Homo Sapiens)
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQC
FFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEAAKLDRERAKNKIAK
ETNNKKKEFEETAKKVRRAIEQLAAMDggsGAEAGITGTWYNQHGSTFTVTAGADGNL
TGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQG
GAEARINTQWNLTYEGGSGPATEQGQDTFTKVK >SEQ ID NO: 43
>mSA:Survivin(F101A/L102A) (Homo Sapiens)
MAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGT
KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQD
TFTKVKggsGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTEN
EPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEAAKLDRE
RAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD >SEQ ID NO:
44>mSA:Survivin(F101A/L102A) (Mus Musculus)
MAEAGITGTVVYNQHGSTFTVTAGADGN LTGQYEN RAQGTGCQNSPYTLTG RYN GT
KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARI NTQWN LTYEGGSGPATEQGQD
TFTKVKGGSGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFI HCPTEN EPD
LAQCFFCFKELEGWEPDD N PI EEH RKHSPGCAFLTVKKQM EELTVSEAAKLDRQ
RAKNKIAKETN NKQKEFEETAKTTRQSI EQLAASGRF >SEQ ID NO: 45
>Survivin (F101A/L102A):mSA (Mus Musculus)
GAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFF
CFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEAAKLDRQRAKNKIAKE
TNNKQKEFEETAKTTRQSIEQLAAggsAEAGITGTWYNQHGSTFTVTAGADGNLTGQY
ENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEA
RINTQWNLTYEGGSGPATEQGQDTFTKVK >SEQ ID NO: 46 >mSA:Survivin
(Mus Musculus)
MAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGT
KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQD
TFTKVKGGSGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTEN
EPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQ
RAKNKIAKETNNKQKEFEETAKTTRQSIEQLAASGRF >SEQ ID NO: 47
>Survivin:mSA (Mus Musculus)
GAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFF
CFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKET
NNKQKEFEETAKTTRQSIEQLAAGGSAEAGITGTWYNQHGSTFTVTAGADGNLTGQY
ENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEA
RINTQWNLTYEGGSGPATEQGQDTFTKVK >SEQ ID NO: 48
>mSA:Survivin(F101A/L102A) (Mus Musculus) DNA
ATGGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTTA
CCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTGCACA
GGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTATAATGGCACC
AAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTCATAGCCGTA
CCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGT
GGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGGTCAGGATA
CCTTTACCAAAGTTAAAGGTGGCAGCGGTGCACCGGCACTGCCGCAGATTTGGC
AGCTGTATCTGAAAAACTATCGTATCGCCACCTTTAAAAACTGGCCGTTTCTGGAA
GATTGTGCATGTACACCGGAACGTATGGCAGAAGCAGGTTTTATTCATTGTCCGA
CCGAAAATGAACCGGATCTGGCACAGTGTTTTTTTTGCTTTAAAGAACTGGAAGGT
TGGGAGCCGGATGATAATCCGATTGAAGAACATCGTAAACATAGTCCGGGTTGTG
CATTTCTGACCGTGAAAAAACAAATGGAAGAACTGACCGTTAGCGAGGCAGCAAA
ACTGGATCGTCAGCGTGCCAAAAACAAAATTGCAAAAGAAACCAATAACAAACAGA
AAGAATTCGAAGAAACCGCCAAAACCACCCGTCAGAGCATTGAACAGCTGGCAGC
Aagcggccgcttt >SEQ ID NO: 49 >Survivin (F101A/L102A):mSA (Mus
Musculus) DNA
GGTGCACCGGCACTGCCGCAGATTTGGCAGCTGTATCTGAAAAACTATCGTATCG
CCACCTTTAAAAACTGGCCGTTTCTGGAAGATTGTGCATGTACACCGGAACGTAT
GGCAGAAGCAGGTTTTATTCATTGTCCGACCGAAAATGAACCGGATCTGGCACAG
TGTTTTTTTTGCTTTAAAGAACTGGAAGGTTGGGAGCCGGATGATAATCCGATTGA
AGAACATCGTAAACATAGTCCGGGTTGTGCATTTCTGACCGTGAAAAAACAAATGG
AAGAACTGACCGTTAGCGAGGCAGCAAAACTGGATCGTCAGCGTGCCAAAAACAA
AATTGCAAAAGAAACCAATAACAAACAGAAAGAATTCGAAGAAACCGCCAAAACCA
CCCGTCAGAGCATTGAACAGCTGGCAGCAGGTGGCAGCGCAGAAGCAGGTATTA
CCGGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGA
TGGTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAAT
AGCCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTG
AATGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTA
TCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGT
GGTAGCGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTTAAA >SEQ ID NO:
50 >mSA:Survivin (Mus Musculus) DNA
ATGGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTTA
CCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTGCACA
GGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTATAATGGCACC
AAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTCATAGCCGTA
CCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGT
GGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGGTCAGGATA
CCTTTACCAAAGTTAAAGGTGGCAGCGGTGCACCGGCACTGCCGCAGATTTGGC
AGCTGTATCTGAAAAACTATCGTATCGCCACCTTTAAAAACTGGCCGTTTCTGGAA
GATTGTGCATGTACACCGGAACGTATGGCAGAAGCAGGTTTTATTCATTGTCCGA
CCGAAAATGAACCGGATCTGGCACAGTGTTTTTTTTGCTTTAAAGAACTGGAAGGT
TGGGAGCCGGATGATAATCCGATTGAAGAACATCGTAAACATAGTCCGGGTTGTG
CATTTCTGACCGTGAAAAAACAAATGGAAGAACTGACCGTTAGCGAGTTTCTGAAA
CTGGATCGTCAGCGTGCCAAAAACAAAATTGCAAAAGAAACCAATAACAAACAGAA
AGAATTCGAAGAAACCGCCAAAACCACCCGTCAGAGCATTGAACAGCTGGCAGCA
agcggccgcttt >SEQ ID NO: 51 >Survivin: mSA (Mus Musculus) DNA
GGTGCACCGGCACTGCCGCAGATTTGGCAGCTGTATCTGAAAAACTATCGTATCG
CCACCTTTAAAAACTGGCCGTTTCTGGAAGATTGTGCATGTACACCGGAACGTAT
GGCAGAAGCAGGTTTTATTCATTGTCCGACCGAAAATGAACCGGATCTGGCACAG
TGTTTTTTTTGCTTTAAAGAACTGGAAGGTTGGGAGCCGGATGATAATCCGATTGA
AGAACATCGTAAACATAGTCCGGGTTGTGCATTTCTGACCGTGAAAAAACAAATGG
AAGAACTGACCGTTAGCGAGTTTCTGAAACTGGATCGTCAGCGTGCCAAAAACAA
AATTGCAAAAGAAACCAATAACAAACAGAAAGAATTCGAAGAAACCGCCAAAACCA
CCCGTCAGAGCATTGAACAGCTGGCAGCAGGTGGCAGCGCAGAAGCAGGTATTA
CCGGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGA
TGGTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAAT
AGCCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTG
AATGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTA
TCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGT
GGTAGCGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTTAAA >SEQ ID NO:
52 >mSA:CIDR1a-HIS
GAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTK
LEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDT
FTKVKGGSKITSFDEFFDFWVRKLLIDTIKWETELTYCINNTDVTDCNKCNKNCVCFDK
WVKQKEDEWTNIMKLFTNKHDIPKKYYLNINDLFDSFFFQVIYKFNEGEAKWNELKEN
LKKQIASSKANNGTKDSEAAIKVLFNHIKEIATICKDNNTN >SEQ ID NO: 53
>mSA:CIDR1a-HIS DNA
GCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTT
ACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGT
GCACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTAT
AATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAAT
TGTCATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCC
CGTATTAATACCCAGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCA
ACCGAACAGGGTCAGGATACCTTTACCAAAGTTAAAGGTGGCAGCAAAATAAC
GTCATTTGATGAATTTTTTGATTTTTGGGTTAGAAAATTATTAATAGACACTATAAAGTGGGAAACCGAA
CTTACGTATTGTATAAATAATACTGATGTCACGGATTGTAATAAATGTAACAAAAATTGCGTATGTTTTG
ACAAATGGGTTAAACAAAAAGAAGACGAATGGACAAATATAATGAAACTATTCACAAACAAACACGAT
ATACCGAAAAAATATTATCTTAATATTAATGATCTTTTTGATAGTTTTTTTTTCCAAGTTATATATAAGTTT
AACGAAGGAGAAGCAAAATGGAATGAACTTAAAGAAAATTTAAAAAAGCAAATTGCGTCTTCCAAAGC
AAATAACGGAACCAAAGATTCAGAAGCTGCAATAAAAGTGTTGTTTAATCACATAAAAGAAATTGCAA
CAATATGCAAAGATAATAATACAAAC
REFERENCES
[0355] Bachmann, M F. and Jennings, Gary T. Vaccine delivery: a
matter of size, geometry, kinetics and molecular patterns. Nat Rev
Immunol 10(11), 787-796. 2010. [0356] Bachmann M F, Zinkernagel, R
M. Neutralizing antiviral B cell responses. Annual review of
immunology 15: 235-270. 1997. [0357] Bachmann, M F. et al. The
influence of antigen organization on B cell responsiveness.
Science. 262(5138), 1448-1451. 1993. [0358] Bachmann, M. F.,
Jennings, G. T., 2004a. Virus-like particles: combining innate and
adaptive immunity for effective vaccination. In: Kaufmann,
P.D.S.H.E. (Ed.), Novel Vaccination Strategies. Wiley-VCH Verlag
GmbH & Co, pp. 415-432. [0359] Buck, Christopher B. and
Thompson, Cynthia D. Production of Papillomavirus-Based Gene
Transfer Vectors. Current Protocols in Cell Biology. 2001. [0360]
Buck C B, Pastrana D V, Lowy D R, Schiller J T. Efficient
intracellular assembly of papillomaviral vectors. J Virol. 2004;
78(2):751-7. [0361] Buck C B, Thompson C D, Pang Y-YS, Lowy D R,
Schiller J T. Maturation of papillomavirus capsids. J Virol. 2005;
79(5):2839-46. [0362] Buck C B, Thompson C D. Production of
papillomavirus-based gene transfer vectors. Curr Protoc Cell Biol.
2007; Chapter 26:Unit 26.1. [0363] Chackerian, B. et al. Induction
of autoantibodies to mouse CCR5 with recombinant papillomavirus
particles. PNAS. (5) 2373-2378. 1999. [0364] Chackerian, B.
Virus-like particles: flexible platforms for vaccine development.
Expert Review of Vaccines. 6(3), 381-390. 2007. [0365] Grgacic,
Elizabeth V. L. and Anderson, David A. Virus-like particles:
Passport to immune recognition. Particle-based Vaccines. Methods
40(1), 60-65. 2006. [0366] Kouskoff, V. et al. T Cell-Independent
Rescue of B Lymphocytes from Peripheral Immune Tolerance. Science
287 (5462). 2501-2503. 2000. [0367] Lim K H, Huang H, Pralle A,
Park S. Engineered streptavidin monomer and dimer with improved
stability and function. Biochemistry. 2011; 50(40):8682-91. [0368]
Murray K. Application of recombinant DNA techniques in the
development of viral vaccines. Vaccine. 6:164-74.1988. [0369]
Nielsen M A, Pinto V V., Resende M, Dahlback M, Ditlev S B,
Theander T G, et al. Induction of adhesion-inhibitory antibodies
against placental Plasmodium falciparum parasites by using single
domains of VAR2CSA. Infect Immun. 2009; 77(6):2482-7. [0370] Haase
R N, Megnekou R, Lundquist M, Ofori M F, Hviid L, Staalsoe T.
Plasmodium falciparum parasites expressing pregnancy-specific
variant surface antigens adhere strongly to the choriocarcinoma
cell line BeWo. Infect Immun. 2006; 74(5):3035-8. [0371] Snounou G,
Zhu X, Siripoon N, Jarra W, Thaithong S, Brown K N, et al. Biased
distribution of msp1 and msp2 allelic variants in Plasmodium
falciparum populations in Thailand. Trans R Soc Trop Med Hyg. 1999;
93(4):369-74. [0372] Plotkin, S A. Vaccines: past, present and
future. Nat Med. 5-4-2005. [0373] Pumpens, P. and Grens, E. HBV
Core Particles as a Carrier for B Cell/T Cell Epitopes.
Intervirology 44(2-3), 98-114. 2001. [0374] Raja, Krishnaswami S.
et al. Icosahedral Virus Particles as Polyvalent Carbohydrate
Display Platforms. ChemBioChem 4(12), 1348-1351. 2003.
Sequence CWU 1
1
531525PRTHuman papillomavirus type 16 1Met Ser Leu Trp Leu Pro Ser
Glu Ala Thr Val Tyr Leu Pro Pro Val 1 5 10 15 Pro Val Ser Lys Val
Val Ser Thr Asp Glu Tyr Val Ala Arg Thr Asn 20 25 30 Ile Tyr Tyr
His Ala Gly Thr Ser Arg Leu Leu Ala Val Gly His Pro 35 40 45 Tyr
Phe Pro Ile Lys Lys Pro Asn Asn Asn Lys Ile Leu Val Pro Lys 50 55
60 Val Ser Gly Leu Gln Tyr Arg Val Phe Arg Ile His Leu Pro Asp Pro
65 70 75 80 Asn Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr Asn Pro Asp
Thr Gln 85 90 95 Arg Leu Val Trp Ala Cys Val Gly Val Glu Val Gly
Arg Gly Gln Pro 100 105 110 Leu Gly Val Gly Ile Ser Gly His Pro Leu
Leu Asn Lys Leu Asp Asp 115 120 125 Thr Glu Asn Ala Ser Ala Tyr Ala
Ala Asn Ala Gly Val Asp Asn Arg 130 135 140 Glu Cys Ile Ser Met Asp
Tyr Lys Gln Thr Gln Leu Cys Leu Ile Gly 145 150 155 160 Cys Lys Pro
Pro Ile Gly Glu His Trp Gly Lys Gly Ser Pro Cys Thr 165 170 175 Asn
Val Ala Val Asn Pro Gly Asp Cys Pro Pro Leu Glu Leu Ile Asn 180 185
190 Thr Val Ile Gln Asp Gly Asp Met Val Asp Thr Gly Phe Gly Ala Met
195 200 205 Asp Phe Thr Thr Leu Gln Ala Asn Lys Ser Glu Val Pro Leu
Asp Ile 210 215 220 Cys Thr Ser Ile Cys Lys Tyr Pro Asp Tyr Ile Lys
Met Val Ser Glu 225 230 235 240 Pro Tyr Gly Asp Ser Leu Phe Phe Tyr
Leu Arg Arg Glu Gln Met Phe 245 250 255 Val Arg His Leu Phe Asn Arg
Ala Gly Ala Val Gly Glu Asn Val Pro 260 265 270 Asp Asp Leu Tyr Ile
Lys Gly Ser Gly Ser Thr Ala Asn Leu Ala Ser 275 280 285 Ser Asn Tyr
Phe Pro Thr Pro Ser Gly Ser Met Val Thr Ser Asp Ala 290 295 300 Gln
Ile Phe Asn Lys Pro Tyr Trp Leu Gln Arg Ala Gln Gly His Asn 305 310
315 320 Asn Gly Ile Cys Trp Gly Asn Gln Leu Phe Val Thr Val Val Asp
Thr 325 330 335 Thr Arg Ser Thr Asn Met Ser Leu Cys Ala Ala Ile Ser
Thr Ser Glu 340 345 350 Thr Thr Tyr Lys Asn Thr Asn Phe Lys Glu Tyr
Leu Arg His Gly Glu 355 360 365 Glu Tyr Asp Leu Gln Phe Ile Phe Gln
Leu Cys Lys Ile Thr Leu Thr 370 375 380 Ala Asp Val Met Thr Tyr Ile
His Ser Met Asn Ser Thr Ile Leu Glu 385 390 395 400 Asp Trp Asn Phe
Gly Leu Gln Pro Pro Pro Gly Gly Thr Leu Glu Asp 405 410 415 Thr Tyr
Arg Phe Val Thr Ser Gln Ala Ile Ala Cys Gln Lys His Gly 420 425 430
Leu Asn Asp Ile Phe Glu Ala Gln Lys Ile Glu Trp His Glu Thr Pro 435
440 445 Pro Ala Pro Lys Glu Asp Pro Leu Lys Lys Tyr Thr Phe Trp Glu
Val 450 455 460 Asn Leu Lys Glu Lys Phe Ser Ala Asp Leu Asp Gln Phe
Pro Leu Gly 465 470 475 480 Arg Lys Phe Leu Leu Gln Ala Gly Leu Lys
Ala Lys Pro Lys Phe Thr 485 490 495 Leu Gly Lys Arg Lys Ala Thr Pro
Thr Thr Ser Ser Thr Ser Thr Thr 500 505 510 Ala Lys Arg Lys Lys Arg
Lys Leu Glu Leu Ser Gly Arg 515 520 525 2528PRTHuman papillomavirus
type 16misc_feature(280)..(281)Xaa can be any naturally occurring
amino acidmisc_feature(285)..(286)Xaa can be any naturally
occurring amino acidmisc_feature(288)..(288)Xaa can be any
naturally occurring amino acid 2Met Ser Leu Trp Leu Pro Ser Glu Ala
Thr Val Tyr Leu Pro Pro Val 1 5 10 15 Pro Val Ser Lys Val Val Ser
Thr Asp Glu Tyr Val Ala Arg Thr Asn 20 25 30 Ile Tyr Tyr His Ala
Gly Thr Ser Arg Leu Leu Ala Val Gly His Pro 35 40 45 Tyr Phe Pro
Ile Lys Lys Pro Asn Asn Asn Lys Ile Leu Val Pro Lys 50 55 60 Val
Ser Gly Leu Gln Tyr Arg Val Phe Arg Ile His Leu Pro Asp Pro 65 70
75 80 Asn Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr Asn Pro Asp Thr
Gln 85 90 95 Arg Leu Val Trp Ala Cys Val Gly Val Glu Val Gly Arg
Gly Gln Pro 100 105 110 Leu Gly Val Gly Ile Ser Gly His Pro Leu Leu
Asn Lys Leu Asp Asp 115 120 125 Thr Glu Asn Ala Ser Ala Tyr Ala Ala
Asn Ala Gly Val Asp Asn Arg 130 135 140 Glu Cys Ile Ser Met Asp Tyr
Lys Gln Thr Gln Leu Cys Leu Ile Gly 145 150 155 160 Cys Lys Pro Pro
Ile Gly Glu His Trp Gly Lys Gly Ser Pro Cys Thr 165 170 175 Asn Val
Ala Val Asn Pro Gly Asp Cys Pro Pro Leu Glu Leu Ile Asn 180 185 190
Thr Val Ile Gln Asp Gly Asp Met Val Asp Thr Gly Phe Gly Ala Met 195
200 205 Asp Phe Thr Thr Leu Gln Ala Asn Lys Ser Glu Val Pro Leu Asp
Ile 210 215 220 Cys Thr Ser Ile Cys Lys Tyr Pro Asp Tyr Ile Lys Met
Val Ser Glu 225 230 235 240 Pro Tyr Gly Asp Ser Leu Phe Phe Tyr Leu
Arg Arg Glu Gln Met Phe 245 250 255 Val Arg His Leu Phe Asn Arg Ala
Gly Ala Val Gly Glu Asn Val Pro 260 265 270 Asp Asp Leu Tyr Ile Lys
Gly Xaa Xaa Trp Ile Tyr Xaa Xaa Gln Xaa 275 280 285 Leu Ala Ser Ser
Asn Tyr Phe Pro Thr Pro Ser Gly Ser Met Val Thr 290 295 300 Ser Asp
Ala Gln Ile Phe Asn Lys Pro Tyr Trp Leu Gln Arg Ala Gln 305 310 315
320 Gly His Asn Asn Gly Ile Cys Trp Gly Asn Gln Leu Phe Val Thr Val
325 330 335 Val Asp Thr Thr Arg Ser Thr Asn Met Ser Leu Cys Ala Ala
Ile Ser 340 345 350 Thr Ser Gly Leu Asn Asp Ile Phe Glu Ala Gln Lys
Ile Glu Trp His 355 360 365 Glu Glu Thr Thr Tyr Lys Asn Thr Asn Phe
Lys Glu Tyr Leu Arg His 370 375 380 Gly Glu Glu Tyr Asp Leu Gln Phe
Ile Phe Gln Leu Cys Lys Ile Thr 385 390 395 400 Leu Thr Ala Asp Val
Met Thr Tyr Ile His Ser Met Asn Ser Thr Ile 405 410 415 Leu Glu Asp
Trp Asn Phe Gly Leu Gln Pro Pro Pro Gly Gly Thr Leu 420 425 430 Glu
Asp Thr Tyr Arg Phe Val Thr Ser Gln Ala Ile Ala Cys Gln Lys 435 440
445 His Thr Pro Pro Ala Pro Lys Glu Asp Pro Leu Lys Lys Tyr Thr Phe
450 455 460 Trp Glu Val Asn Leu Lys Glu Lys Phe Ser Ala Asp Leu Asp
Gln Phe 465 470 475 480 Pro Leu Gly Arg Lys Phe Leu Leu Gln Ala Gly
Leu Lys Ala Lys Pro 485 490 495 Lys Phe Thr Leu Gly Lys Arg Lys Ala
Thr Pro Thr Thr Ser Ser Thr 500 505 510 Ser Thr Thr Ala Lys Arg Lys
Lys Arg Lys Leu Glu Leu Ser Gly Arg 515 520 525 3518PRTHuman
papillomavirus type 16 3Met Ser Leu Trp Leu Pro Ser Glu Ala Thr Val
Tyr Leu Pro Pro Val 1 5 10 15 Pro Val Ser Lys Val Val Ser Thr Asp
Glu Tyr Val Ala Arg Thr Asn 20 25 30 Ile Tyr Tyr His Ala Gly Thr
Ser Arg Leu Leu Ala Val Gly His Pro 35 40 45 Tyr Phe Pro Ile Lys
Lys Pro Asn Asn Asn Lys Ile Leu Val Pro Lys 50 55 60 Val Ser Gly
Leu Gln Tyr Arg Val Phe Arg Ile His Leu Pro Asp Pro 65 70 75 80 Asn
Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr Asn Pro Asp Thr Gln 85 90
95 Arg Leu Val Trp Ala Cys Val Gly Val Glu Val Gly Arg Gly Gln Pro
100 105 110 Leu Gly Val Gly Ile Ser Gly His Pro Leu Leu Asn Lys Leu
Asp Asp 115 120 125 Thr Glu Asn Ala Ser Ala Gly Leu Asn Asp Ile Phe
Glu Ala Gln Lys 130 135 140 Ile Glu Trp His Glu Ala Gly Val Asp Asn
Arg Glu Cys Ile Ser Met 145 150 155 160 Asp Tyr Lys Gln Thr Gln Leu
Cys Leu Ile Gly Cys Lys Pro Pro Ile 165 170 175 Gly Glu His Trp Gly
Lys Gly Ser Pro Cys Thr Asn Val Ala Val Asn 180 185 190 Pro Gly Asp
Cys Pro Pro Leu Glu Leu Ile Asn Thr Val Ile Gln Asp 195 200 205 Gly
Asp Met Val Asp Thr Gly Phe Gly Ala Met Asp Phe Thr Thr Leu 210 215
220 Gln Ala Asn Lys Ser Glu Val Pro Leu Asp Ile Cys Thr Ser Ile Cys
225 230 235 240 Lys Tyr Pro Asp Tyr Ile Lys Met Val Ser Glu Pro Tyr
Gly Asp Ser 245 250 255 Leu Phe Phe Tyr Leu Arg Arg Glu Gln Met Phe
Val Arg His Leu Phe 260 265 270 Asn Arg Ala Gly Ala Val Gly Glu Asn
Val Pro Asp Asp Leu Tyr Ile 275 280 285 Lys Gly Ser Gly Ser Thr Ala
Asn Leu Ala Ser Ser Asn Tyr Phe Pro 290 295 300 Thr Pro Ser Gly Ser
Met Val Thr Ser Asp Ala Gln Ile Phe Asn Lys 305 310 315 320 Pro Tyr
Trp Leu Gln Arg Ala Gln Gly His Asn Asn Gly Ile Cys Trp 325 330 335
Gly Asn Gln Leu Phe Val Thr Val Val Asp Thr Thr Arg Ser Thr Asn 340
345 350 Met Ser Leu Cys Ala Ala Ile Ser Thr Ser Glu Thr Thr Tyr Lys
Asn 355 360 365 Thr Asn Phe Lys Glu Tyr Leu Arg His Gly Glu Glu Tyr
Asp Leu Gln 370 375 380 Phe Ile Phe Gln Leu Cys Lys Ile Thr Leu Thr
Ala Asp Val Met Thr 385 390 395 400 Tyr Ile His Ser Met Asn Ser Thr
Ile Leu Glu Asp Trp Asn Phe Gly 405 410 415 Leu Gln Pro Pro Pro Gly
Gly Thr Leu Glu Asp Thr Tyr Arg Phe Val 420 425 430 Thr Ser Gln Ala
Ile Ala Cys Gln Lys His Thr Pro Pro Ala Pro Lys 435 440 445 Glu Asp
Pro Leu Lys Lys Tyr Thr Phe Trp Glu Val Asn Leu Lys Glu 450 455 460
Lys Phe Ser Ala Asp Leu Asp Gln Phe Pro Leu Gly Arg Lys Phe Leu 465
470 475 480 Leu Gln Ala Gly Leu Lys Ala Lys Pro Lys Phe Thr Leu Gly
Lys Arg 485 490 495 Lys Ala Thr Pro Thr Thr Ser Ser Thr Ser Thr Thr
Ala Lys Arg Lys 500 505 510 Lys Arg Lys Leu Glu Leu 515
4514PRTHuman papillomavirus type 16 4Met Ser Leu Trp Leu Pro Ser
Glu Ala Thr Val Tyr Leu Pro Pro Val 1 5 10 15 Pro Val Ser Lys Val
Val Ser Thr Asp Glu Tyr Val Ala Arg Thr Asn 20 25 30 Ile Tyr Tyr
His Ala Gly Thr Ser Arg Leu Leu Ala Val Gly His Pro 35 40 45 Tyr
Phe Pro Ile Lys Lys Pro Asn Asn Asn Lys Ile Leu Val Pro Lys 50 55
60 Val Ser Gly Leu Gln Tyr Arg Val Phe Arg Ile His Leu Pro Asp Pro
65 70 75 80 Asn Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr Asn Pro Asp
Thr Gln 85 90 95 Arg Leu Val Trp Ala Cys Val Gly Val Glu Val Gly
Arg Gly Gln Pro 100 105 110 Leu Gly Val Gly Ile Ser Gly His Pro Leu
Leu Asn Lys Leu Asp Asp 115 120 125 Thr Glu Asn Ala Ser Ala Ala Gly
Val Asp Asn Arg Glu Cys Ile Ser 130 135 140 Met Asp Tyr Lys Gln Thr
Gln Leu Cys Leu Ile Gly Cys Lys Pro Pro 145 150 155 160 Ile Gly Glu
His Trp Gly Lys Gly Ser Pro Cys Thr Asn Val Ala Val 165 170 175 Asn
Pro Gly Asp Cys Pro Pro Leu Glu Leu Ile Asn Thr Val Ile Gln 180 185
190 Asp Gly Asp Met Val Asp Thr Gly Phe Gly Ala Met Asp Phe Thr Thr
195 200 205 Leu Gln Ala Asn Lys Ser Glu Val Pro Leu Asp Ile Cys Thr
Ser Ile 210 215 220 Cys Lys Tyr Pro Asp Tyr Ile Lys Met Val Ser Glu
Pro Tyr Gly Asp 225 230 235 240 Ser Leu Phe Phe Tyr Leu Arg Arg Glu
Gln Met Phe Val Arg His Leu 245 250 255 Phe Asn Arg Ala Gly Ala Val
Gly Glu Asn Val Pro Asp Asp Leu Tyr 260 265 270 Ile Lys Gly Leu Asn
Asp Ile Phe Glu Ala Gln Lys Ile Glu Trp His 275 280 285 Glu Ala Ser
Ser Asn Tyr Phe Pro Thr Pro Ser Gly Ser Met Val Thr 290 295 300 Ser
Asp Ala Gln Ile Phe Asn Lys Pro Tyr Trp Leu Gln Arg Ala Gln 305 310
315 320 Gly His Asn Asn Gly Ile Cys Trp Gly Asn Gln Leu Phe Val Thr
Val 325 330 335 Val Asp Thr Thr Arg Ser Thr Asn Met Ser Leu Cys Ala
Ala Ile Ser 340 345 350 Thr Ser Glu Thr Thr Tyr Lys Asn Thr Asn Phe
Lys Glu Tyr Leu Arg 355 360 365 His Gly Glu Glu Tyr Asp Leu Gln Phe
Ile Phe Gln Leu Cys Lys Ile 370 375 380 Thr Leu Thr Ala Asp Val Met
Thr Tyr Ile His Ser Met Asn Ser Thr 385 390 395 400 Ile Leu Glu Asp
Trp Asn Phe Gly Leu Gln Pro Pro Pro Gly Gly Thr 405 410 415 Leu Glu
Asp Thr Tyr Arg Phe Val Thr Ser Gln Ala Ile Ala Cys Gln 420 425 430
Lys His Thr Pro Pro Ala Pro Lys Glu Asp Pro Leu Lys Lys Tyr Thr 435
440 445 Phe Trp Glu Val Asn Leu Lys Glu Lys Phe Ser Ala Asp Leu Asp
Gln 450 455 460 Phe Pro Leu Gly Arg Lys Phe Leu Leu Gln Ala Gly Leu
Lys Ala Lys 465 470 475 480 Pro Lys Phe Thr Leu Gly Lys Arg Lys Ala
Thr Pro Thr Thr Ser Ser 485 490 495 Thr Ser Thr Thr Ala Lys Arg Lys
Lys Arg Lys Leu Glu Leu Ser Gly 500 505 510 Arg Phe 5505PRTHuman
papillomavirus type 16 5Met Ser Leu Trp Leu Pro Ser Glu Ala Thr Val
Tyr Leu Pro Pro Val 1 5 10 15 Pro Val Ser Lys Val Val Ser Thr Asp
Glu Tyr Val Ala Arg Thr Asn 20 25 30 Ile Tyr Tyr His Ala Gly Thr
Ser Arg Leu Leu Ala Val Gly His Pro 35 40 45 Tyr Phe Pro Ile Lys
Lys Pro Asn Asn Asn Lys Ile Leu Val Pro Lys 50 55 60 Val Ser Gly
Leu Gln Tyr Arg Val Phe Arg Ile His Leu Pro Asp Pro 65 70 75 80 Asn
Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr Asn Pro Asp Thr Gln 85 90
95 Arg Leu Val Trp Ala Cys Val Gly Val Glu Val Gly Arg Gly Gln Pro
100 105 110 Leu Gly Val Gly Ile Ser Gly His Pro Leu Leu Asn Lys Leu
Asp Asp 115 120 125 Thr Glu Asn Ala Ser Ala Tyr Ala Ala Asn Ala Gly
Val Asp Asn Arg 130 135 140 Glu Cys Ile Ser Met Asp Tyr Lys Gln Thr
Gln Leu Cys Leu Ile Gly 145 150 155 160 Cys Lys Pro Pro Ile Gly Glu
His Trp Gly Lys Gly Ser Pro Cys Thr
165 170 175 Asn Val Ala Val Asn Pro Gly Asp Cys Pro Pro Leu Glu Leu
Ile Asn 180 185 190 Thr Val Ile Gln Asp Gly Asp Met Val His Thr Gly
Phe Gly Ala Met 195 200 205 Asp Phe Thr Thr Leu Gln Ala Asn Lys Ser
Glu Val Pro Leu Asp Ile 210 215 220 Cys Thr Ser Ile Cys Lys Tyr Pro
Asp Tyr Ile Lys Met Val Ser Glu 225 230 235 240 Pro Tyr Gly Asp Ser
Leu Phe Phe Tyr Leu Arg Arg Glu Gln Met Phe 245 250 255 Val Arg His
Leu Phe Asn Arg Ala Gly Thr Val Gly Glu Asn Val Pro 260 265 270 Asp
Asp Leu Tyr Ile Lys Gly Ser Gly Ser Thr Ala Asn Leu Ala Ser 275 280
285 Ser Asn Tyr Phe Pro Thr Pro Ser Gly Ser Met Val Thr Ser Asp Ala
290 295 300 Gln Ile Phe Asn Lys Pro Tyr Trp Leu Gln Arg Ala Gln Gly
His Asn 305 310 315 320 Asn Gly Ile Cys Trp Gly Asn Gln Leu Phe Val
Thr Val Val Asp Thr 325 330 335 Thr Arg Ser Thr Asn Met Ser Leu Cys
Ala Ala Ile Ser Thr Ser Glu 340 345 350 Thr Thr Tyr Lys Asn Thr Asn
Phe Lys Glu Tyr Leu Arg His Gly Glu 355 360 365 Glu Tyr Asp Leu Gln
Phe Ile Phe Gln Leu Cys Lys Ile Thr Leu Thr 370 375 380 Ala Asp Val
Met Thr Tyr Ile His Ser Met Asn Ser Thr Ile Leu Glu 385 390 395 400
Asp Trp Asn Phe Gly Leu Gln Pro Pro Pro Gly Gly Thr Leu Glu Asp 405
410 415 Thr Tyr Arg Phe Val Thr Gln Ala Ile Ala Cys Gln Lys His Thr
Pro 420 425 430 Pro Ala Pro Lys Glu Asp Asp Pro Leu Lys Lys Tyr Thr
Phe Trp Glu 435 440 445 Val Asn Leu Lys Glu Lys Phe Ser Ala Asp Leu
Asp Gln Phe Pro Leu 450 455 460 Gly Arg Lys Phe Leu Leu Gln Ala Gly
Leu Lys Ala Lys Pro Lys Phe 465 470 475 480 Thr Leu Gly Lys Arg Lys
Ala Thr Pro Thr Thr Ser Ser Thr Ser Thr 485 490 495 Thr Ala Lys Arg
Lys Lys Arg Lys Leu 500 505 6525PRTHuman papillomavirus type 118
6Met Ala Val Trp Gln Ala Ala Ser Gly Lys Val Tyr Leu Pro Pro Ser 1
5 10 15 Thr Pro Val Ala Arg Val Gln Ser Thr Asp Glu Tyr Val Glu Arg
Thr 20 25 30 Asn Ile Tyr Tyr His Ala Phe Thr Asp Arg Leu Leu Thr
Val Gly His 35 40 45 Pro Tyr Phe Asn Ile Phe Asn Asn Asp Gly Asn
Lys Leu Glu Val Pro 50 55 60 Lys Val Ser Gly Asn Gln His Arg Val
Phe Arg Leu Arg Leu Pro Asp 65 70 75 80 Pro Asn Arg Phe Ala Leu Ala
Asp Met Ser Val Tyr Asn Pro Asp Lys 85 90 95 Glu Arg Leu Val Trp
Ala Ile Thr Gly Leu Glu Ile Gly Arg Gly Gln 100 105 110 Pro Leu Gly
Val Gly Thr Ser Gly His Pro Leu Phe Asn Lys Phe Asn 115 120 125 Asp
Thr Glu Asn Gly Asn Lys Tyr Thr Asn Thr Ser Thr Asp Asp Arg 130 135
140 Gln Asn Ile Ser Phe Asp Pro Lys Gln Leu Gln Met Phe Ile Ile Gly
145 150 155 160 Cys Thr Pro Cys Ile Gly Glu His Trp Asp Arg Ala Pro
Ala Cys Val 165 170 175 Glu Asp Glu Gln Leu Gly Arg Cys Pro Pro Ile
Glu Leu Val Asn Thr 180 185 190 Phe Ile Gln Asp Asp Asp Met Ala Asp
Ile Gly Tyr Gly Asn Leu Asn 195 200 205 Phe Lys Ala Leu Gln Gln Asn
Arg Ser Asp Val Ser Leu Asp Ile Val 210 215 220 Asp Glu Ile Cys Lys
Tyr Pro Asp Phe Leu Lys Met Gln Asn Asp Val 225 230 235 240 Tyr Gly
Asp Ala Cys Phe Phe Tyr Ala Arg Arg Glu Gln Cys Tyr Ala 245 250 255
Arg Arg Phe Phe Val Arg Gly Gly Lys Pro Gly Asp Asp Ile Pro Ala 260
265 270 Glu Gln Ile Asp Ala Gly Lys Leu Lys Asn Glu Phe Tyr Ile Pro
Ala 275 280 285 Ala Gly Gly Gln Ala Gln Gly Gln Leu Gly Asn Ser Met
Tyr Phe Pro 290 295 300 Thr Val Ser Gly Ser Leu Val Ser Ser Asp Ala
Gln Leu Phe Asn Arg 305 310 315 320 Pro Phe Trp Leu Gln Arg Ala Gln
Gly His Asn Asn Gly Ile Leu Trp 325 330 335 Gly Asn Gln Leu Phe Val
Thr Val Leu Asp Asn Thr Arg Asn Thr Asn 340 345 350 Phe Ser Ile Ala
Val Tyr Ser Glu Gly Leu Asn Asp Ile Phe Glu Ala 355 360 365 Gln Lys
Ile Glu Trp His Glu Gln Asp Ile Ala Asn Tyr Asp Ser Ser 370 375 380
Lys Ser Arg Glu Tyr Gln Arg His Val Glu Glu Tyr Glu Val Ser Met 385
390 395 400 Ile Leu Gln Leu Cys Lys Ile Pro Leu Lys Pro Glu Val Leu
Ala His 405 410 415 Ile Asn Ala Met Asn Pro Ala Ile Leu Glu Asp Trp
Gln Leu Gly Phe 420 425 430 Ile Pro Thr Pro Asp Asn Pro Ile His Asp
Thr Tyr Arg Tyr Ile Asp 435 440 445 Ser Leu Ala Thr Arg Cys Pro Asp
Lys Val Pro Ala Lys Glu Lys Glu 450 455 460 Asp Pro Tyr Gly Lys Tyr
Val Phe Trp Asn Val Asp Leu Ser Glu Arg 465 470 475 480 Leu Ser Leu
Asp Leu Asp Gln Tyr Pro Leu Gly Arg Lys Phe Leu Phe 485 490 495 Gln
Ala Gly Leu Arg Gln Lys Ser Val Asn Gly Ser Val Thr Arg Thr 500 505
510 Val Ser Arg Gly Ala Lys Arg Lys Arg Lys Ser Gly Arg 515 520 525
7522PRTHuman papillomavirus type 118 7Met Ala Val Trp Gln Ala Ala
Ser Gly Lys Val Tyr Leu Pro Pro Ser 1 5 10 15 Thr Pro Val Ala Arg
Val Gln Ser Thr Asp Glu Tyr Val Glu Arg Thr 20 25 30 Asn Ile Tyr
Tyr His Ala Phe Thr Asp Arg Leu Leu Thr Val Gly His 35 40 45 Pro
Tyr Phe Asn Ile Phe Asn Asn Asp Gly Asn Lys Leu Glu Val Pro 50 55
60 Lys Val Ser Gly Asn Gln His Arg Val Phe Arg Leu Arg Leu Pro Asp
65 70 75 80 Pro Asn Arg Phe Ala Leu Ala Asp Met Ser Val Tyr Asn Pro
Asp Lys 85 90 95 Glu Arg Leu Val Trp Ala Ile Thr Gly Leu Glu Ile
Gly Arg Gly Gln 100 105 110 Pro Leu Gly Val Gly Thr Ser Gly His Pro
Leu Phe Asn Lys Phe Asn 115 120 125 Asp Thr Glu Asn Gly Asn Gly Leu
Asn Asp Ile Phe Glu Ala Gln Lys 130 135 140 Ile Glu Trp His Glu Thr
Ser Thr Asp Asp Arg Gln Asn Ile Ser Phe 145 150 155 160 Asp Pro Lys
Gln Leu Gln Met Phe Ile Ile Gly Cys Thr Pro Cys Ile 165 170 175 Gly
Glu His Trp Asp Arg Ala Pro Ala Cys Val Glu Asp Glu Gln Leu 180 185
190 Gly Arg Cys Pro Pro Ile Glu Leu Val Asn Thr Phe Ile Gln Asp Asp
195 200 205 Asp Met Ala Asp Ile Gly Tyr Gly Asn Leu Asn Phe Lys Ala
Leu Gln 210 215 220 Gln Asn Arg Ser Asp Val Ser Leu Asp Ile Val Asp
Glu Ile Cys Lys 225 230 235 240 Tyr Pro Asp Phe Leu Lys Met Gln Asn
Asp Val Tyr Gly Asp Ala Cys 245 250 255 Phe Phe Tyr Ala Arg Arg Glu
Gln Cys Tyr Ala Arg Arg Phe Phe Val 260 265 270 Arg Gly Gly Lys Pro
Gly Asp Asp Ile Pro Ala Glu Gln Ile Asp Ala 275 280 285 Gly Lys Leu
Lys Asn Glu Phe Tyr Ile Pro Ala Ala Gly Gly Gln Ala 290 295 300 Gln
Gly Gln Leu Gly Asn Ser Met Tyr Phe Pro Thr Val Ser Gly Ser 305 310
315 320 Leu Val Ser Ser Asp Ala Gln Leu Phe Asn Arg Pro Phe Trp Leu
Gln 325 330 335 Arg Ala Gln Gly His Asn Asn Gly Ile Leu Trp Gly Asn
Gln Leu Phe 340 345 350 Val Thr Val Leu Asp Asn Thr Arg Asn Thr Asn
Phe Ser Ile Ala Val 355 360 365 Tyr Ser Glu Gln Asp Ile Ala Asn Tyr
Asp Ser Ser Lys Ser Arg Glu 370 375 380 Tyr Gln Arg His Val Glu Glu
Tyr Glu Val Ser Met Ile Leu Gln Leu 385 390 395 400 Cys Lys Ile Pro
Leu Lys Pro Glu Val Leu Ala His Ile Asn Ala Met 405 410 415 Asn Pro
Ala Ile Leu Glu Asp Trp Gln Leu Gly Phe Ile Pro Thr Pro 420 425 430
Asp Asn Pro Ile His Asp Thr Tyr Arg Tyr Ile Asp Ser Leu Ala Thr 435
440 445 Arg Cys Pro Asp Lys Val Pro Ala Lys Glu Lys Glu Asp Pro Tyr
Gly 450 455 460 Lys Tyr Val Phe Trp Asn Val Asp Leu Ser Glu Arg Leu
Ser Leu Asp 465 470 475 480 Leu Asp Gln Tyr Pro Leu Gly Arg Lys Phe
Leu Phe Gln Ala Gly Leu 485 490 495 Arg Gln Lys Ser Val Asn Gly Ser
Val Thr Arg Thr Val Ser Arg Gly 500 505 510 Ala Lys Arg Lys Arg Lys
Ser Gly Arg Phe 515 520 8511PRTHuman papillomavirus type 118 8Met
Ala Val Trp Gln Ala Ala Ser Gly Lys Val Tyr Leu Pro Pro Ser 1 5 10
15 Thr Pro Val Ala Arg Val Gln Ser Thr Asp Glu Tyr Val Glu Arg Thr
20 25 30 Asn Ile Tyr Tyr His Ala Phe Thr Asp Arg Leu Leu Thr Val
Gly His 35 40 45 Pro Tyr Phe Asn Ile Phe Asn Asn Asp Gly Asn Lys
Leu Glu Val Pro 50 55 60 Lys Val Ser Gly Asn Gln His Arg Val Phe
Arg Leu Arg Leu Pro Asp 65 70 75 80 Pro Asn Arg Phe Ala Leu Ala Asp
Met Ser Val Tyr Asn Pro Asp Lys 85 90 95 Glu Arg Leu Val Trp Ala
Ile Thr Gly Leu Glu Ile Gly Arg Gly Gln 100 105 110 Pro Leu Gly Val
Gly Thr Ser Gly His Pro Leu Phe Asn Lys Phe Asn 115 120 125 Asp Thr
Glu Asn Gly Asn Lys Tyr Thr Asn Thr Ser Thr Asp Asp Arg 130 135 140
Gln Asn Ile Ser Phe Asp Pro Lys Gln Leu Gln Met Phe Ile Ile Gly 145
150 155 160 Cys Thr Pro Cys Ile Gly Glu His Trp Asp Arg Ala Pro Ala
Cys Val 165 170 175 Glu Asp Glu Gln Leu Gly Arg Cys Pro Pro Ile Glu
Leu Val Asn Thr 180 185 190 Phe Ile Gln Asp Asp Asp Met Ala Asp Ile
Gly Tyr Gly Asn Leu Asn 195 200 205 Phe Lys Ala Leu Gln Gln Asn Arg
Ser Asp Val Ser Leu Asp Ile Val 210 215 220 Asp Glu Ile Cys Lys Tyr
Pro Asp Phe Leu Lys Met Gln Asn Asp Val 225 230 235 240 Tyr Gly Asp
Ala Cys Phe Phe Tyr Ala Arg Arg Glu Gln Cys Tyr Ala 245 250 255 Arg
Arg Phe Phe Val Arg Gly Gly Lys Pro Gly Asp Asp Ile Pro Ala 260 265
270 Glu Gln Ile Asp Ala Gly Lys Leu Lys Asn Glu Phe Tyr Ile Pro Ala
275 280 285 Ala Gly Gly Gln Ala Gln Gly Gln Leu Gly Asn Ser Met Tyr
Phe Pro 290 295 300 Thr Val Ser Gly Ser Leu Val Ser Ser Asp Ala Gln
Leu Phe Asn Arg 305 310 315 320 Pro Phe Trp Leu Gln Arg Ala Gln Gly
His Asn Asn Gly Ile Leu Trp 325 330 335 Gly Asn Gln Leu Phe Val Thr
Val Leu Asp Asn Thr Arg Asn Thr Asn 340 345 350 Phe Ser Ile Ala Val
Tyr Ser Glu Ala Gly Lys Ile Gln Asp Ile Ala 355 360 365 Asn Tyr Asp
Ser Ser Lys Ser Arg Glu Tyr Gln Arg His Val Glu Glu 370 375 380 Tyr
Glu Val Ser Met Ile Leu Gln Leu Cys Lys Ile Pro Leu Lys Pro 385 390
395 400 Glu Val Leu Ala His Ile Asn Ala Met Asn Pro Ala Ile Leu Glu
Asp 405 410 415 Trp Gln Leu Gly Phe Ile Pro Thr Pro Asp Asn Pro Ile
His Asp Thr 420 425 430 Tyr Arg Tyr Ile Asp Ser Leu Ala Thr Arg Cys
Pro Asp Lys Val Pro 435 440 445 Ala Lys Glu Lys Glu Asp Pro Tyr Gly
Lys Tyr Val Phe Trp Asn Val 450 455 460 Asp Leu Ser Glu Arg Leu Ser
Leu Asp Leu Asp Gln Tyr Pro Leu Gly 465 470 475 480 Arg Lys Phe Leu
Phe Gln Ala Gly Leu Arg Gln Lys Ser Val Asn Gly 485 490 495 Ser Val
Thr Arg Thr Val Ser Arg Gly Ala Lys Arg Lys Arg Lys 500 505 510
9511PRTEuropean elk papillomavirus 9Met Ala Phe Trp Gln Pro Ser Gln
Arg Leu Tyr Leu Pro Pro Thr Pro 1 5 10 15 Val Thr Lys Val Leu Cys
Ser Glu Gln Tyr Ile Arg Arg Lys Asp Val 20 25 30 Phe Tyr His Gly
Glu Thr Glu Arg Met Leu Thr Val Gly His Pro Tyr 35 40 45 Tyr Glu
Ile Lys Gln Ser Gly Ser Gly Lys Thr Ile Pro Lys Val Ser 50 55 60
Pro Asn Gln Tyr Arg Val Phe Arg Ile Leu Leu Pro Asp Pro Asn Gln 65
70 75 80 Phe Ala Leu Pro Asp Lys Ala Met Tyr Asp Pro Ser Lys Glu
Arg Leu 85 90 95 Val Trp Ala Val Val Gly Val Gln Val Ser Arg Gly
Gln Pro Leu Gly 100 105 110 Gly Ser Val Ser Gly His Ser Tyr Gln Asn
Thr Leu Ile Asp Ala Glu 115 120 125 Asn Val Ser Gly Leu Asn Asp Ile
Phe Glu Ala Gln Lys Ile Glu Trp 130 135 140 His Glu Gln Gly Thr Asp
Asp Arg Lys Gln Gly Gly Met Asp Val Lys 145 150 155 160 Gln Gln Gln
Ile Leu Leu Leu Gly Cys Thr Pro Ala Ile Gly Glu Tyr 165 170 175 Trp
Thr Thr Ala Arg Pro Cys Val Thr Asp Arg Pro Glu Thr Gly Ser 180 185
190 Cys Pro Pro Ile Glu Leu Lys Asn Lys Pro Ile Glu Asp Gly Asp Met
195 200 205 Met Asp Ile Gly Phe Gly Ala Ala Asn Phe Lys Glu Leu Asn
Ala Thr 210 215 220 Lys Ser Asp Leu Pro Leu Asp Ile Ala Lys Asp Ile
Cys Leu Tyr Pro 225 230 235 240 Asp Tyr Leu Lys Met Thr Glu Glu Ala
Ala Gly Asn Ser Met Phe Phe 245 250 255 Phe Ala Arg Lys Glu Gln Val
Tyr Val Arg His Ile Trp Ser Arg Gly 260 265 270 Gly Thr Asp Lys Glu
Met Pro Pro Glu Ala Tyr Phe Leu Lys Pro Lys 275 280 285 Gly Gly Asp
Gln Thr Gln Lys Met Pro Ser Ile Leu Phe Gly Val Pro 290 295 300 Ser
Gly Ser Leu Val Ser Thr Asp Gly Gln Leu Phe Asn Arg Pro Tyr 305 310
315 320 Trp Leu Phe Arg Ala Gln Gly Met Asn Asn Gly Ile Cys Trp Leu
Asn 325 330 335 Gln Leu Phe Val Thr Val Gly Asp Asn Thr Arg Gly Thr
Thr Leu Thr 340 345 350 Ile Thr Val Pro Thr Ser Gly Ser Pro Leu Thr
Glu Tyr Asp Thr Ser 355 360 365 Lys Phe Asn Val Phe Gln Arg His Val
Glu Glu Tyr Lys Leu Ala Phe 370 375 380 Val Phe Gln Leu Cys Ser Val
Thr Leu Ser Pro Glu Thr Val Ser His 385 390
395 400 Leu Gln Gly Leu Met Pro Ser Ile Leu Glu His Trp Asp Ile Asn
Met 405 410 415 Gln Pro Pro Thr Ser Ser Ile Leu Glu Asp Thr Tyr Arg
Tyr Leu Glu 420 425 430 Ser Pro Ala Thr Lys Cys Ala Asp Asn Val Thr
Pro Met Gly Pro Glu 435 440 445 Asp Pro Tyr Ala Gly Leu Lys Phe Trp
Glu Val Asn Leu Lys Glu Arg 450 455 460 Leu Ser Leu Asp Leu Asp Gln
Phe Pro Leu Gly Arg Arg Phe Leu Ala 465 470 475 480 Gln Gln Gly Leu
Gly Cys Ser Thr Arg Lys Arg Val Ala Pro Val Pro 485 490 495 Lys Val
Thr Glu Lys Arg Ile Val Arg Lys Arg Arg Lys Gly Asn 500 505 510
10501PRTEuropean elk papillomavirus 10Met Ala Phe Trp Gln Pro Ser
Gln Arg Leu Tyr Leu Pro Pro Thr Pro 1 5 10 15 Val Thr Lys Val Leu
Cys Ser Glu Gln Tyr Ile Arg Arg Lys Asp Val 20 25 30 Phe Tyr His
Gly Glu Thr Glu Arg Met Leu Thr Val Gly His Pro Tyr 35 40 45 Tyr
Glu Ile Lys Gln Ser Gly Ser Gly Lys Thr Ile Pro Lys Val Ser 50 55
60 Pro Asn Gln Tyr Arg Val Phe Arg Ile Leu Leu Pro Asp Pro Asn Gln
65 70 75 80 Phe Ala Leu Pro Asp Lys Ala Met Tyr Asp Pro Ser Lys Glu
Arg Leu 85 90 95 Val Trp Ala Val Val Gly Val Gln Val Ser Arg Gly
Gln Pro Leu Gly 100 105 110 Gly Ser Val Ser Gly His Ser Tyr Gln Asn
Thr Leu Ile Asp Ala Glu 115 120 125 Asn Val Ser Lys Lys Val Asn Ala
Gln Gly Thr Asp Asp Arg Lys Gln 130 135 140 Gly Gly Met Asp Val Lys
Gln Gln Gln Ile Leu Leu Leu Gly Cys Thr 145 150 155 160 Pro Ala Ile
Gly Glu Tyr Trp Thr Thr Ala Arg Pro Cys Val Thr Asp 165 170 175 Arg
Pro Glu Thr Gly Ser Cys Pro Pro Ile Glu Leu Lys Asn Lys Pro 180 185
190 Ile Glu Asp Gly Asp Met Met Asp Ile Gly Phe Gly Ala Ala Asn Phe
195 200 205 Lys Glu Leu Asn Ala Thr Lys Ser Asp Leu Pro Leu Asp Ile
Ala Lys 210 215 220 Asp Ile Cys Leu Tyr Pro Asp Tyr Leu Lys Met Thr
Glu Glu Ala Ala 225 230 235 240 Gly Asn Ser Met Phe Phe Phe Ala Arg
Lys Glu Gln Val Tyr Val Arg 245 250 255 His Ile Trp Ser Arg Gly Gly
Thr Asp Lys Glu Met Pro Pro Glu Ala 260 265 270 Tyr Phe Leu Lys Pro
Lys Gly Gly Asp Gln Thr Gln Lys Met Pro Ser 275 280 285 Ile Leu Phe
Gly Val Pro Ser Gly Ser Leu Val Ser Thr Asp Gly Gln 290 295 300 Leu
Phe Asn Arg Pro Tyr Trp Leu Phe Arg Ala Gln Gly Met Asn Asn 305 310
315 320 Gly Ile Cys Trp Leu Asn Gln Leu Phe Val Thr Val Gly Asp Asn
Thr 325 330 335 Arg Gly Thr Thr Leu Thr Ile Thr Val Pro Thr Ser Gly
Ser Pro Leu 340 345 350 Thr Glu Tyr Asp Thr Ser Lys Phe Asn Val Phe
Gln Arg His Val Glu 355 360 365 Glu Tyr Lys Leu Ala Phe Val Phe Gln
Leu Cys Ser Val Thr Leu Ser 370 375 380 Pro Glu Thr Val Ser His Leu
Gln Gly Leu Met Pro Ser Ile Leu Glu 385 390 395 400 His Trp Asp Ile
Asn Met Gln Pro Pro Thr Ser Ser Ile Leu Glu Asp 405 410 415 Thr Tyr
Arg Tyr Leu Glu Ser Pro Ala Thr Lys Cys Ala Asp Asn Val 420 425 430
Thr Pro Met Gly Pro Glu Asp Pro Tyr Ala Gly Leu Lys Phe Trp Glu 435
440 445 Val Asn Leu Lys Glu Arg Leu Ser Leu Asp Leu Asp Gln Phe Pro
Leu 450 455 460 Gly Arg Arg Phe Leu Ala Gln Gln Gly Leu Gly Cys Ser
Thr Arg Lys 465 470 475 480 Arg Val Ala Pro Val Pro Lys Val Thr Glu
Lys Arg Ile Val Arg Lys 485 490 495 Arg Arg Lys Gly Asn 500
111723DNAHuman papillomavirus type 16 11gatatcatgg agataattaa
aatgataacc atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag ttttgtaata
aaaaaaccta taaatattcc ggattattca taccgtccca 120ccatcgggcg
cggatctcta ctagtatgtc tctgtggctg ccctctgaag ccaccgtcta
180cctgcccccc gtccctgtct ctaaggtcgt cagcaccgac gaatacgtcg
ccaggaccaa 240catctactac cacgccggaa cctctaggct gctggccgtc
ggacacccct acttccccat 300caagaagccc aacaacaaca agatcctggt
ccccaaggtg tccggactgc agtacagggt 360gttcaggatc cacctccccg
accccaacaa gttcggattc cccgacacct ctttctacaa 420ccccgacacc
cagaggctcg tctgggcctg cgtcggagtc gaagtcggaa ggggacagcc
480cctgggagtc ggaatctctg gacaccccct gctgaacaag ctggacgaca
ccgaaaacgc 540ctctgcctac gccgccaacg ccggtgtcga caacagggaa
tgcatctcta tggactacaa 600gcagacccag ctgtgcctga tcggatgcaa
gccccccatc ggagaacact ggggaaaggg 660atctccctgc accaacgtcg
ccgtcaaccc cggcgactgc ccccctctgg aactgatcaa 720caccgtcatc
caggacggcg acatggtcga caccggattc ggagccatgg acttcaccac
780cctgcaggcc aacaagtctg aagtccccct ggacatctgc acctctatct
gcaagtaccc 840cgactacatc aagatggtgt ctgaacccta cggcgactct
ctgttcttct acctgaggcg 900cgaacagatg ttcgtcaggc acctgttcaa
ccgcgccggt gccgtcggag aaaacgtccc 960cgacgacctg tacatcaagg
gatctggatc taccgccaac ctggcctctt ctaactactt 1020ccctacccct
tctggatcta tggtcacctc tgacgcccag atcttcaaca agccctactg
1080gctgcagagg gcccagggac acaacaacgg aatctgctgg ggaaaccagc
tgttcgtcac 1140cgtcgtcgac accaccaggt ctaccaacat gtccctgtgc
gccgccatct ctacctctga 1200aaccacctac aagaacacca acttcaaaga
atacctgcgc cacggcgaag aatacgacct 1260gcagttcatc ttccagctgt
gcaagatcac cctgaccgcc gacgtcatga cctacatcca 1320ctctatgaac
tctaccatct tggaggactg gaacttcgga ctgcagcccc ctcccggtgg
1380aaccctcgag gacacctacc gcttcgtcac cagccaggct atcgcctgcc
agaagcacgg 1440actgaacgac atcttcgaag cccaaaagat cgaatggcac
gaaacccccc ctgcccccaa 1500agaggacccc ctgaagaagt acaccttctg
ggaagtcaac ctgaaagaaa agttctctgc 1560cgacctggac cagttccccc
tgggacgcaa gttcctgctg caagccggac tgaaggccaa 1620gcccaagttc
accctgggaa agaggaaggc cacccccacc acctcttcta cctctaccac
1680cgccaagagg aagaagcgca agctggaact gtaaagcggc cgc
1723121723DNAHuman papillomavirus type 16 12gatatcatgg agataattaa
aatgataacc atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag ttttgtaata
aaaaaaccta taaatattcc ggattattca taccgtccca 120ccatcgggcg
cggatctcta ctagtatgtc tctgtggctg ccctctgaag ccaccgtcta
180cctgcccccc gtccctgtct ctaaggtcgt cagcaccgac gaatacgtcg
ccaggaccaa 240catctactac cacgccggaa cctctaggct gctggccgtc
ggacacccct acttccccat 300caagaagccc aacaacaaca agatcctggt
ccccaaggtg tccggactgc agtacagggt 360gttcaggatc cacctccccg
accccaacaa gttcggattc cccgacacct ctttctacaa 420ccccgacacc
cagaggctcg tctgggcctg cgtcggagtc gaagtcggaa ggggacagcc
480cctgggagtc ggaatctctg gacaccccct gctgaacaag ctggacgaca
ccgaaaacgc 540ctctgcctac gccgccaacg ccggtgtcga caacagggaa
tgcatctcta tggactacaa 600gcagacccag ctgtgcctga tcggatgcaa
gccccccatc ggagaacact ggggaaaggg 660atctccctgc accaacgtcg
ccgtcaaccc cggcgactgc ccccctctgg aactgatcaa 720caccgtcatc
caggacggcg acatggtcga caccggattc ggagccatgg acttcaccac
780cctgcaggcc aacaagtctg aagtccccct ggacatctgc acctctatct
gcaagtaccc 840cgactacatc aagatggtgt ctgaacccta cggcgactct
ctgttcttct acctgaggcg 900cgaacagatg ttcgtcaggc acctcttcaa
cagggccggt gccgtcggag aaaacgtccc 960cgacgacctg tacatcaagg
gatctggatc taccgccaac ctggcctctt ctaactactt 1020ccctacccct
tctggatcta tggtcacctc tgacgcccag atcttcaaca agccctactg
1080gctgcagagg gcccagggac acaacaacgg aatctgctgg ggaaaccagc
tgttcgtcac 1140cgtcgtcgac accaccaggt ctaccaacat gtccctgtgc
gccgccatct ctacctctgg 1200actgaacgac atcttcgagg cccaaaagat
cgaatggcac gaggaaacca cctacaagaa 1260caccaacttc aaagaatacc
tgcgccacgg cgaagaatac gacctgcagt tcatcttcca 1320gctgtgcaag
atcaccctga ccgccgacgt catgacctac atccactcta tgaactctac
1380catcttggag gattggaact tcggactgca gccccctccc ggtggaaccc
tcgaggacac 1440ctaccgcttc gtcaccagcc aggctatcgc ctgccagaag
cacacccccc ctgcccccaa 1500agaggacccc ctgaagaagt acaccttctg
ggaagtcaac ctgaaagaaa agttctctgc 1560cgacctggac cagttccccc
tgggacgcaa gttcctgctg caagccggac tgaaggccaa 1620gcccaagttc
accctgggaa agaggaaggc cacccccacc acctcttcta cctctaccac
1680cgccaagagg aagaagcgca agctggaact gtaaagcggc cgc
1723131711DNAHuman papillomavirus type 16 13gatatcatgg agataattaa
aatgataacc atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag ttttgtaata
aaaaaaccta taaatattcc ggattattca taccgtccca 120ccatcgggcg
cggatctcta ctagtatgtc tctgtggctg ccctctgaag ccaccgtcta
180cctgcccccc gtccctgtct ctaaggtcgt cagcaccgac gaatacgtcg
ccaggaccaa 240catctactac cacgccggaa cctctaggct gctggccgtc
ggacacccct acttccccat 300caagaagccc aacaacaaca agatcctggt
ccccaaggtg tccggactgc agtacagggt 360gttcaggatc cacctccccg
accccaacaa gttcggattc cccgacacct ctttctacaa 420ccccgacacc
cagaggctcg tctgggcctg cgtcggagtc gaagtcggaa ggggacagcc
480cctgggagtc ggaatctctg gacaccccct gctgaacaag ctggacgaca
ccgaaaacgc 540ctctgccgga ctgaacgaca tcttcgaggc ccaaaagatc
gaatggcacg aggccggtgt 600cgacaacagg gaatgcatct ctatggacta
caagcagacc cagctgtgcc tgatcggatg 660caagcccccc atcggagaac
actggggaaa gggatctccc tgcaccaacg tcgccgtcaa 720ccccggcgac
tgcccccctc tggaactgat caacaccgtc atccaggacg gcgacatggt
780cgacaccgga ttcggagcca tggacttcac caccctgcag gccaacaagt
ctgaagtccc 840cctggacatc tgcacctcta tctgcaagta ccccgactac
atcaagatgg tgtctgaacc 900ctacggcgac tctctgttct tctacctgag
gcgcgaacag atgttcgtca ggcacctctt 960caacagggcc ggtgccgtcg
gagaaaacgt ccccgacgac ctgtacatca agggatctgg 1020atctaccgcc
aacctggcct cttctaacta cttccctacc ccttctggat ctatggtcac
1080ctctgacgcc cagatcttca acaagcccta ctggctgcag agggcccagg
gacacaacaa 1140cggaatctgc tggggaaacc agctgttcgt caccgtcgtc
gacaccacca ggtctaccaa 1200catgtccctg tgcgccgcca tctctacctc
tgaaaccacc tacaagaaca ccaacttcaa 1260agaatacctg cgccacggcg
aagaatacga cctgcagttc atcttccagc tgtgcaagat 1320caccctgacc
gccgacgtca tgacctacat ccactctatg aactctacca tcttggagga
1380ttggaacttc ggactgcagc cccctcccgg tggaaccctc gaggacacct
accgcttcgt 1440caccagccag gctatcgcct gccagaagca caccccccct
gcccccaaag aggaccccct 1500gaagaagtac accttctggg aagtcaacct
gaaagaaaag ttctctgccg acctggacca 1560gttccccctg ggacgcaagt
tcctgctgca agccggactg aaggccaagc ccaagttcac 1620cctgggaaag
aggaaggcca cccccaccac ctcttctacc tctaccaccg ccaagaggaa
1680gaagcgcaag ctggaactgt aaagcggccg c 1711141699DNAHuman
papillomavirus type 16 14gatatcatgg agataattaa aatgataacc
atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag ttttgtaata aaaaaaccta
taaatattcc ggattattca taccgtccca 120ccatcgggcg cggatctcta
ctagtatgtc tctgtggctg ccctctgaag ccaccgtcta 180cctgcccccc
gtccctgtct ctaaggtcgt cagcaccgac gaatacgtcg ccaggaccaa
240catctactac cacgccggaa cctctaggct gctggccgtc ggacacccct
acttccccat 300caagaagccc aacaacaaca agatcctggt ccccaaggtg
tccggactgc agtacagggt 360gttcaggatc cacctccccg accccaacaa
gttcggattc cccgacacct ctttctacaa 420ccccgacacc cagaggctcg
tctgggcctg cgtcggagtc gaagtcggaa ggggacagcc 480cctgggagtc
ggaatctctg gacaccccct gctgaacaag ctggacgaca ccgaaaacgc
540ctctgcctac gccgccaacg ccggtgtcga caacagggaa tgcatctcta
tggactacaa 600gcagacccag ctgtgcctga tcggatgcaa gccccccatc
ggagaacact ggggaaaggg 660atctccctgc accaacgtcg ccgtcaaccc
cggcgactgc ccccctctgg aactgatcaa 720caccgtcatc caggacggcg
acatggtcga caccggattc ggagccatgg acttcaccac 780cctgcaggcc
aacaagtctg aagtccccct ggacatctgc acctctatct gcaagtaccc
840cgactacatc aagatggtgt ctgaacccta cggcgactct ctgttcttct
acctgaggcg 900cgaacagatg ttcgtcaggc acctcttcaa cagggccggt
gccgtcggag aaaacgtccc 960cgacgacctg tacatcaagg gactgaacga
catcttcgag gcccaaaaga tcgaatggca 1020cgaggcctct tctaactact
tccctacccc ttctggatct atggtcacct ctgacgccca 1080gatcttcaac
aagccctact ggctgcagag ggcccaggga cacaacaacg gaatctgctg
1140gggaaaccag ctgttcgtca ccgtcgtcga caccaccagg tctaccaaca
tgtccctgtg 1200cgccgccatc tctacctctg aaaccaccta caagaacacc
aacttcaaag aatacctgcg 1260ccacggcgaa gaatacgacc tgcagttcat
cttccagctg tgcaagatca ccctgaccgc 1320cgacgtcatg acctacatcc
actctatgaa ctctaccatc ttggaggatt ggaacttcgg 1380actgcagccc
cctcccggtg gaaccctcga ggacacctac cgcttcgtca ccagccaggc
1440tatcgcctgc cagaagcaca ccccccctgc ccccaaagag gaccccctga
agaagtacac 1500cttctgggaa gtcaacctga aagaaaagtt ctctgccgac
ctggaccagt tccccctggg 1560acgcaagttc ctgctgcaag ccggactgaa
ggccaagccc aagttcaccc tgggaaagag 1620gaaggccacc cccaccacct
cttctacctc taccaccgcc aagaggaaga agcgcaagct 1680ggaactgtaa
agcggccgc 1699151723DNAHuman papillomavirus type 118 15gatatcatgg
agataattaa aatgataacc atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag
ttttgtaata aaaaaaccta taaatattcc ggattattca taccgtccca
120ccatcgggcg cggatctcta ctagtatggc cgtctggcag gccgcctctg
gaaaggtcta 180cctgcccccc tctacccccg tcgccagggt ccagtctacc
gacgaatacg tcgaaaggac 240caacatctac taccacgcct tcaccgacag
gctgctgacc gtcggacacc cctacttcaa 300catcttcaac aacgacggaa
acaagctcga agtccccaag gtgtccggaa accagcacag 360ggtgttcagg
ctgaggctgc ccgaccccaa ccgcttcgcc ctggccgaca tgtctgtcta
420caaccccgac aaagaaaggc tcgtctgggc catcaccgga ctggaaatcg
gaaggggaca 480gcccctggga gtcggaacct ctggacaccc cctgttcaac
aagttcaacg acaccgaaaa 540cggcaacaag tacaccaaca cctccaccga
cgacaggcag aacatctctt tcgaccccaa 600gcagctgcag atgttcatca
tcggatgcac cccctgcatc ggagaacact gggacagggc 660ccctgcctgc
gtcgaggacg aacagctggg aaggtgcccc cccatcgaac tggtcaacac
720cttcatccag gacgacgaca tggccgacat cggatacgga aacctgaact
tcaaggccct 780gcagcagaac cgctctgacg tgtccctgga catcgtcgac
gaaatctgca agtaccccga 840cttcctgaag atgcagaacg acgtctacgg
cgacgcctgc ttcttctacg ctaggcgcga 900acagtgctac gccaggcgct
tcttcgtccg cggaggaaag cccggcgacg acatccccgc 960cgaacagatc
gacgccggaa agctgaagaa cgaattctac atccctgccg ccggtggaca
1020ggcccaggga cagctcggaa actctatgta cttccccacc gtcagcggat
ctctcgtcag 1080ctctgacgcc cagctgttca acaggccctt ctggctgcag
cgcgctcagg gacacaacaa 1140cggaatcctg tggggaaacc agttgttcgt
caccgtcctg gacaacaccc gcaacaccaa 1200cttctctatc gccgtctact
ctgagggact gaacgacatc ttcgaagccc aaaagatcga 1260atggcacgag
caggacattg ccaactacga ctcttctaag tctagggaat accagcgcca
1320cgtcgaagag tacgaagtct ctatgatcct gcagctgtgc aagatccccc
tgaagcccga 1380agtcctggcc cacatcaacg ccatgaaccc cgccatcttg
gaggactggc agctgggatt 1440catccccacc cccgacaacc ccatccacga
cacctaccgc tacatcgact ccctggccac 1500caggtgccct gacaaggtcc
ccgccaaaga aaaagaggac ccctacggca aatacgtgtt 1560ctggaacgtc
gacctgtctg aaaggctgtc tctggacctg gaccagtacc ccctgggacg
1620caagttcctg ttccaagccg gactgaggca gaagtctgtc aacggatctg
tcaccaggac 1680cgtcagcagg ggagccaaga ggaagcgcaa gtaaagcggc cgc
1723161723DNAHuman papillomavirus type 118 16gatatcatgg agataattaa
aatgataacc atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag ttttgtaata
aaaaaaccta taaatattcc ggattattca taccgtccca 120ccatcgggcg
cggatctcta ctagtatggc cgtctggcag gccgcctctg gaaaggtcta
180cctgcccccc tctacccccg tcgccagggt ccagtctacc gacgaatacg
tcgaaaggac 240caacatctac taccacgcct tcaccgacag gctgctgacc
gtcggacacc cctacttcaa 300catcttcaac aacgacggaa acaagctcga
agtccccaag gtgtccggaa accagcacag 360ggtgttcagg ctgaggctgc
ccgaccccaa ccgcttcgcc ctggccgaca tgtctgtcta 420caaccccgac
aaagaaaggc tcgtctgggc catcaccgga ctggaaatcg gaaggggaca
480gcccctggga gtcggaacct ctggacaccc cctgttcaac aagttcaacg
acaccgaaaa 540cggcaacgga ctgaacgaca tcttcgaagc ccaaaagatc
gaatggcacg agacctccac 600cgacgacagg cagaacatct ctttcgaccc
caagcagctg cagatgttca tcatcggatg 660caccccctgc atcggagaac
actgggacag ggcccctgcc tgcgtcgagg acgaacagct 720gggaaggtgc
ccccccatcg aactggtcaa caccttcatc caggacgacg acatggccga
780catcggatac ggaaacctga acttcaaggc cctgcagcag aaccgctctg
acgtgtccct 840ggacatcgtc gacgaaatct gcaagtaccc cgacttcctg
aagatgcaga acgacgtcta 900cggcgacgcc tgcttcttct acgctaggcg
cgaacagtgc tacgccaggc gcttcttcgt 960ccgcggagga aagcccggcg
acgacatccc cgccgaacag atcgacgccg gaaagctgaa 1020gaacgaattc
tacatccctg ccgccggtgg acaggcccag ggacagctcg gaaactctat
1080gtacttcccc accgtcagcg gatctctcgt cagctctgac gcccagctgt
tcaacaggcc 1140cttctggctg cagcgcgctc agggacacaa caacggaatc
ctgtggggaa accagttgtt 1200cgtcaccgtc ctggacaaca cccgcaacac
caacttctct atcgccgtct actctgaggc 1260cggaaagatc caggacattg
ccaactacga ctcttctaag tctagggaat accagcgcca 1320cgtcgaagag
tacgaagtct ctatgatcct gcagctgtgc aagatccccc tgaagcccga
1380agtcctggcc cacatcaacg ccatgaaccc cgccatcttg gaggactggc
agctgggatt 1440catccccacc cccgacaacc ccatccacga cacctaccgc
tacatcgact ccctggccac 1500caggtgccct gacaaggtcc ccgccaaaga
aaaagaggac ccctacggca aatacgtgtt 1560ctggaacgtc gacctgtctg
aaaggctgtc tctggacctg gaccagtacc ccctgggacg 1620caagttcctg
ttccaagccg gactgaggca gaagtctgtc aacggatctg tcaccaggac
1680cgtcagcagg ggagccaaga ggaagcgcaa gtaaagcggc cgc
1723171693DNAEuropean elk papillomavirus 17gatatcatgg agataattaa
aatgataacc atctcgcaaa taaataagta ttttactgtt 60ttcgtaacag ttttgtaata
aaaaaaccta taaatattcc ggattattca taccgtccca 120ccatcgggcg
cggatctcta ctagtatggc cttctggcag ccctctcagc gtctgtacct
180gccccccacc cccgtcacca aggtcctgtg ctctgaacag tacatcaggc
gcaaggacgt 240gttctaccac ggcgaaaccg aaaggatgct gaccgtcgga
cacccctact acgaaatcaa
300gcagtctgga tctggaaaga ccatccccaa ggtgtccccc aaccagtaca
gggtgttcag 360gatcctgctg cccgacccta accagttcgc cctgcccgac
aaggctatgt acgacccctc 420taaggaaagg ctcgtctggg ccgtcgtcgg
agtccaggtg tcccgtggac agcctctggg 480aggatctgtc tctggacact
cttaccagaa caccctgatc gacgccgaaa acgtgtccgg 540actgaacgac
atcttcgaag cccaaaagat cgaatggcac gaacagggaa ccgacgaccg
600caagcagggt ggaatggacg tcaagcagca gcagatcctg ctcctgggat
gcacccccgc 660catcggagaa tactggacca ccgccaggcc ctgcgtcacc
gacaggcccg aaaccggatc 720ttgccccccc atcgaactga agaacaagcc
catcgaggac ggcgacatga tggacatcgg 780attcggagcc gccaacttca
aggaactgaa cgccaccaag tctgacctgc ccctggacat 840cgccaaggac
atctgcctgt accccgacta cctgaagatg accgaagaag ccgccggaaa
900ctctatgttc ttcttcgccc gcaaggaaca ggtctacgtc cgccacatct
ggtcccgcgg 960aggaaccgac aaggaaatgc cccccgaagc ctacttcctg
aagcccaagg gtggcgacca 1020gacccagaag atgccctcta tcctgttcgg
agtcccctct ggatctctcg tcagcaccga 1080cggacagctg ttcaacaggc
cctactggct gttcagggcc cagggaatga acaacggaat 1140ctgctggctg
aaccagctgt tcgtcaccgt cggagacaac accaggggaa ccaccctgac
1200catcaccgtc cccacctctg gatcccccct gaccgaatac gacacctcca
agttcaacgt 1260gttccagagg cacgtcgaag agtacaagct ggccttcgtg
ttccagctgt gctctgtcac 1320cctgtctccc gaaaccgtca gccacctcca
gggactgatg ccttccatcc tggaacactg 1380ggacatcaac atgcagcccc
ccacctcttc tatcctcgag gacacctacc gctacctgga 1440atctcctgcc
accaagtgcg ccgacaacgt cacccccatg ggacccgagg acccctacgc
1500cggactgaag ttctgggaag tcaacctgaa ggaacgcctg tccctggacc
tggaccagtt 1560ccccctggga aggcgcttcc tggcccagca gggactggga
tgctctaccc gcaagagggt 1620cgcccccgtc cctaaggtca ccgaaaagag
gatcgtccgc aagaggcgca agggaaacta 1680aagcggccgc taa
169318787PRTArtificial sequenceConstructsMISC_FEATURE(1)..(787)mSA-
Her2-ECD|23-686 18Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln
His Gly Ser Thr 1 5 10 15 Phe Thr Val Thr Ala Gly Ala Asp Gly Asn
Leu Thr Gly Gln Tyr Glu 20 25 30 Asn Arg Ala Gln Gly Thr Gly Cys
Gln Asn Ser Pro Tyr Thr Leu Thr 35 40 45 Gly Arg Tyr Asn Gly Thr
Lys Leu Glu Trp Arg Val Glu Trp Asn Asn 50 55 60 Ser Thr Glu Asn
Cys His Ser Arg Thr Glu Trp Arg Gly Gln Tyr Gln 65 70 75 80 Gly Gly
Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr Tyr Glu 85 90 95
Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr Lys 100
105 110 Val Lys Gly Gly Ser Thr Gln Val Cys Thr Gly Thr Asp Met Lys
Leu 115 120 125 Arg Leu Pro Ala Ser Pro Glu Thr His Leu Asp Met Leu
Arg His Leu 130 135 140 Tyr Gln Gly Cys Gln Val Val Gln Gly Asn Leu
Glu Leu Thr Tyr Leu 145 150 155 160 Pro Thr Asn Ala Ser Leu Ser Phe
Leu Gln Asp Ile Gln Glu Val Gln 165 170 175 Gly Tyr Val Leu Ile Ala
His Asn Gln Val Arg Gln Val Pro Leu Gln 180 185 190 Arg Leu Arg Ile
Val Arg Gly Thr Gln Leu Phe Glu Asp Asn Tyr Ala 195 200 205 Leu Ala
Val Leu Asp Asn Gly Asp Pro Leu Asn Asn Thr Thr Pro Val 210 215 220
Thr Gly Ala Ser Pro Gly Gly Leu Arg Glu Leu Gln Leu Arg Ser Leu 225
230 235 240 Thr Glu Ile Leu Lys Gly Gly Val Leu Ile Gln Arg Asn Pro
Gln Leu 245 250 255 Cys Tyr Gln Asp Thr Ile Leu Trp Lys Asp Ile Phe
His Lys Asn Asn 260 265 270 Gln Leu Ala Leu Thr Leu Ile Asp Thr Asn
Arg Ser Arg Ala Cys His 275 280 285 Pro Cys Ser Pro Met Cys Lys Gly
Ser Arg Cys Trp Gly Glu Ser Ser 290 295 300 Glu Asp Cys Gln Ser Leu
Thr Arg Thr Val Cys Ala Gly Gly Cys Ala 305 310 315 320 Arg Cys Lys
Gly Pro Leu Pro Thr Asp Cys Cys His Glu Gln Cys Ala 325 330 335 Ala
Gly Cys Thr Gly Pro Lys His Ser Asp Cys Leu Ala Cys Leu His 340 345
350 Phe Asn His Ser Gly Ile Cys Glu Leu His Cys Pro Ala Leu Val Thr
355 360 365 Tyr Asn Thr Asp Thr Phe Glu Ser Met Pro Asn Pro Glu Gly
Arg Tyr 370 375 380 Thr Phe Gly Ala Ser Cys Val Thr Ala Cys Pro Tyr
Asn Tyr Leu Ser 385 390 395 400 Thr Asp Val Gly Ser Cys Thr Leu Val
Cys Pro Leu His Asn Gln Glu 405 410 415 Val Thr Ala Glu Asp Gly Thr
Gln Arg Cys Glu Lys Cys Ser Lys Pro 420 425 430 Cys Ala Arg Val Cys
Tyr Gly Leu Gly Met Glu His Leu Arg Glu Val 435 440 445 Arg Ala Val
Thr Ser Ala Asn Ile Gln Glu Phe Ala Gly Cys Lys Lys 450 455 460 Ile
Phe Gly Ser Leu Ala Phe Leu Pro Glu Ser Phe Asp Gly Asp Pro 465 470
475 480 Ala Ser Asn Thr Ala Pro Leu Gln Pro Glu Gln Leu Gln Val Phe
Glu 485 490 495 Thr Leu Glu Glu Ile Thr Gly Tyr Leu Tyr Ile Ser Ala
Trp Pro Asp 500 505 510 Ser Leu Pro Asp Leu Ser Val Phe Gln Asn Leu
Gln Val Ile Arg Gly 515 520 525 Arg Ile Leu His Asn Gly Ala Tyr Ser
Leu Thr Leu Gln Gly Leu Gly 530 535 540 Ile Ser Trp Leu Gly Leu Arg
Ser Leu Arg Glu Leu Gly Ser Gly Leu 545 550 555 560 Ala Leu Ile His
His Asn Thr His Leu Cys Phe Val His Thr Val Pro 565 570 575 Trp Asp
Gln Leu Phe Arg Asn Pro His Gln Ala Leu Leu His Thr Ala 580 585 590
Asn Arg Pro Glu Asp Glu Cys Val Gly Glu Gly Leu Ala Cys His Gln 595
600 605 Leu Cys Ala Arg Gly His Cys Trp Gly Pro Gly Pro Thr Gln Cys
Val 610 615 620 Asn Cys Ser Gln Phe Leu Arg Gly Gln Glu Cys Val Glu
Glu Cys Arg 625 630 635 640 Val Leu Gln Gly Leu Pro Arg Glu Tyr Val
Asn Ala Arg His Cys Leu 645 650 655 Pro Cys His Pro Glu Cys Gln Pro
Gln Asn Gly Ser Val Thr Cys Phe 660 665 670 Gly Pro Glu Ala Asp Gln
Cys Val Ala Cys Ala His Tyr Lys Asp Pro 675 680 685 Pro Phe Cys Val
Ala Arg Cys Pro Ser Gly Val Lys Pro Asp Leu Ser 690 695 700 Tyr Met
Pro Ile Trp Lys Phe Pro Asp Glu Glu Gly Ala Cys Gln Pro 705 710 715
720 Cys Pro Ile Asn Cys Thr His Ser Cys Val Asp Leu Asp Asp Lys Gly
725 730 735 Cys Pro Ala Glu Gln Arg Ala Ser Pro Leu Thr Ser Ile Ile
Ser Ala 740 745 750 Val Val Gly Ile Leu Leu Val Val Val Leu Gly Val
Val Phe Gly Ile 755 760 765 Leu Ile Lys Arg Arg Gln Gln Lys Ile Arg
Lys Tyr Thr His His His 770 775 780 His His His 785
19236PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(236)mSA-IL-5(C63T/C105T) 19Ala
Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser Thr 1 5 10
15 Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu
20 25 30 Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr
Leu Thr 35 40 45 Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val
Glu Trp Asn Asn 50 55 60 Ser Thr Glu Asn Cys His Ser Arg Thr Glu
Trp Arg Gly Gln Tyr Gln 65 70 75 80 Gly Gly Ala Glu Ala Arg Ile Asn
Thr Gln Trp Asn Leu Thr Tyr Glu 85 90 95 Gly Gly Ser Gly Pro Ala
Thr Glu Gln Gly Gln Asp Thr Phe Thr Lys 100 105 110 Val Lys Gly Gly
Ser Ile Pro Thr Glu Ile Pro Thr Ser Ala Leu Val 115 120 125 Lys Glu
Thr Leu Ala Leu Leu Ser Thr His Arg Thr Leu Leu Ile Ala 130 135 140
Asn Glu Thr Leu Arg Ile Pro Val Pro Val His Lys Asn His Gln Leu 145
150 155 160 Thr Thr Glu Glu Ile Phe Gln Gly Ile Gly Thr Leu Glu Ser
Gln Thr 165 170 175 Val Gln Gly Gly Thr Val Glu Arg Leu Phe Lys Asn
Leu Ser Leu Ile 180 185 190 Lys Lys Tyr Ile Asp Gly Gln Lys Lys Lys
Thr Gly Glu Glu Arg Arg 195 200 205 Arg Val Asn Gln Phe Leu Asp Tyr
Leu Gln Glu Phe Leu Gly Val Met 210 215 220 Asn Thr Glu Trp Ile Ile
Glu Ser Ser Gly Arg Lys 225 230 235 20785PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(785)PCSK9|31-692|mSAHIS 20Gln
Glu Asp Glu Asp Gly Asp Tyr Glu Glu Leu Val Leu Ala Leu Arg 1 5 10
15 Ser Glu Glu Asp Gly Leu Ala Glu Ala Pro Glu His Gly Thr Thr Ala
20 25 30 Thr Phe His Arg Cys Ala Lys Asp Pro Trp Arg Leu Pro Gly
Thr Tyr 35 40 45 Val Val Val Leu Lys Glu Glu Thr His Leu Ser Gln
Ser Glu Arg Thr 50 55 60 Ala Arg Arg Leu Gln Ala Gln Ala Ala Arg
Arg Gly Tyr Leu Thr Lys 65 70 75 80 Ile Leu His Val Phe His Gly Leu
Leu Pro Gly Phe Leu Val Lys Met 85 90 95 Ser Gly Asp Leu Leu Glu
Leu Ala Leu Lys Leu Pro His Val Asp Tyr 100 105 110 Ile Glu Glu Asp
Ser Ser Val Phe Ala Gln Ser Ile Pro Trp Asn Leu 115 120 125 Glu Arg
Ile Thr Pro Pro Arg Tyr Arg Ala Asp Glu Tyr Gln Pro Pro 130 135 140
Asp Gly Gly Ser Leu Val Glu Val Tyr Leu Leu Asp Thr Ser Ile Gln 145
150 155 160 Ser Asp His Arg Glu Ile Glu Gly Arg Val Met Val Thr Asp
Phe Glu 165 170 175 Asn Val Pro Glu Glu Asp Gly Thr Arg Phe His Arg
Gln Ala Ser Lys 180 185 190 Cys Asp Ser His Gly Thr His Leu Ala Gly
Val Val Ser Gly Arg Asp 195 200 205 Ala Gly Val Ala Lys Gly Ala Ser
Met Arg Ser Leu Arg Val Leu Asn 210 215 220 Cys Gln Gly Lys Gly Thr
Val Ser Gly Thr Leu Ile Gly Leu Glu Phe 225 230 235 240 Ile Arg Lys
Ser Gln Leu Val Gln Pro Val Gly Pro Leu Val Val Leu 245 250 255 Leu
Pro Leu Ala Gly Gly Tyr Ser Arg Val Leu Asn Ala Ala Cys Gln 260 265
270 Arg Leu Ala Arg Ala Gly Val Val Leu Val Thr Ala Ala Gly Asn Phe
275 280 285 Arg Asp Asp Ala Cys Leu Tyr Ser Pro Ala Ser Ala Pro Glu
Val Ile 290 295 300 Thr Val Gly Ala Thr Asn Ala Gln Asp Gln Pro Val
Thr Leu Gly Thr 305 310 315 320 Leu Gly Thr Asn Phe Gly Arg Cys Val
Asp Leu Phe Ala Pro Gly Glu 325 330 335 Asp Ile Ile Gly Ala Ser Ser
Asp Cys Ser Thr Cys Phe Val Ser Gln 340 345 350 Ser Gly Thr Ser Gln
Ala Ala Ala His Val Ala Gly Ile Ala Ala Met 355 360 365 Met Leu Ser
Ala Glu Pro Glu Leu Thr Leu Ala Glu Leu Arg Gln Arg 370 375 380 Leu
Ile His Phe Ser Ala Lys Asp Val Ile Asn Glu Ala Trp Phe Pro 385 390
395 400 Glu Asp Gln Arg Val Leu Thr Pro Asn Leu Val Ala Ala Leu Pro
Pro 405 410 415 Ser Thr His Gly Ala Gly Trp Gln Leu Phe Cys Arg Thr
Val Trp Ser 420 425 430 Ala His Ser Gly Pro Thr Arg Met Ala Thr Ala
Val Ala Arg Cys Ala 435 440 445 Pro Asp Glu Glu Leu Leu Ser Cys Ser
Ser Phe Ser Arg Ser Gly Lys 450 455 460 Arg Arg Gly Glu Arg Met Glu
Ala Gln Gly Gly Lys Leu Val Cys Arg 465 470 475 480 Ala His Asn Ala
Phe Gly Gly Glu Gly Val Tyr Ala Ile Ala Arg Cys 485 490 495 Cys Leu
Leu Pro Gln Ala Asn Cys Ser Val His Thr Ala Pro Pro Ala 500 505 510
Glu Ala Ser Met Gly Thr Arg Val His Cys His Gln Gln Gly His Val 515
520 525 Leu Thr Gly Cys Ser Ser His Trp Glu Val Glu Asp Leu Gly Thr
His 530 535 540 Lys Pro Pro Val Leu Arg Pro Arg Gly Gln Pro Asn Gln
Cys Val Gly 545 550 555 560 His Arg Glu Ala Ser Ile His Ala Ser Cys
Cys His Ala Pro Gly Leu 565 570 575 Glu Cys Lys Val Lys Glu His Gly
Ile Pro Ala Pro Gln Glu Gln Val 580 585 590 Thr Val Ala Cys Glu Glu
Gly Trp Thr Leu Thr Gly Cys Ser Ala Leu 595 600 605 Pro Gly Thr Ser
His Val Leu Gly Ala Tyr Ala Val Asp Asn Thr Cys 610 615 620 Val Val
Arg Ser Arg Asp Val Ser Thr Thr Gly Ser Thr Ser Glu Gly 625 630 635
640 Ala Val Thr Ala Val Ala Ile Cys Cys Arg Ser Arg His Leu Ala Gln
645 650 655 Ala Ser Gln Glu Leu Gln Gly Gly Ser Ala Glu Ala Gly Ile
Thr Gly 660 665 670 Thr Trp Tyr Asn Gln His Gly Ser Thr Phe Thr Val
Thr Ala Gly Ala 675 680 685 Asp Gly Asn Leu Thr Gly Gln Tyr Glu Asn
Arg Ala Gln Gly Thr Gly 690 695 700 Cys Gln Asn Ser Pro Tyr Thr Leu
Thr Gly Arg Tyr Asn Gly Thr Lys 705 710 715 720 Leu Glu Trp Arg Val
Glu Trp Asn Asn Ser Thr Glu Asn Cys His Ser 725 730 735 Arg Thr Glu
Trp Arg Gly Gln Tyr Gln Gly Gly Ala Glu Ala Arg Ile 740 745 750 Asn
Thr Gln Trp Asn Leu Thr Tyr Glu Gly Gly Ser Gly Pro Ala Thr 755 760
765 Glu Gln Gly Gln Asp Thr Phe Thr Lys Val Lys His His His His His
770 775 780 His 785 21763PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(763)mSA-ID1ID2a-HIS 21Ala Glu
Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser Thr 1 5 10 15
Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu 20
25 30 Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu
Thr 35 40 45 Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu
Trp Asn Asn 50 55 60 Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp
Arg Gly Gln Tyr Gln 65 70 75 80 Gly Gly Ala Glu Ala Arg Ile Asn Thr
Gln Trp Asn Leu Thr Tyr Glu 85 90 95 Gly Gly Ser Gly Pro Ala Thr
Glu Gln Gly Gln Asp Thr Phe Thr Lys 100 105 110 Val Lys Gly Gly Ser
Asn Tyr Ile Lys Gly Asp Pro Tyr Phe Ala Glu 115 120 125 Tyr Ala Thr
Lys Leu Ser Phe Ile Leu Asn Pro Ser Asp Ala Asn Asn 130 135 140 Pro
Ser Gly Glu Thr Ala Asn His Asn Asp Glu Ala Cys Asn Cys Asn 145 150
155 160 Glu Ser Gly Ile Ser Ser Val Gly Gln Ala Gln Thr Ser Gly Pro
Ser 165 170 175 Ser Asn Lys Thr Cys Ile Thr His Ser Ser Ile Lys Thr
Asn Lys Lys 180 185 190 Lys Glu Cys Lys Asp Val Lys Leu Gly Val Arg
Glu Asn Asp Lys Asp 195 200 205 Leu Lys Ile Cys Val Ile Glu Asp Thr
Ser Leu Ser Gly Val Asp Asn 210 215 220
Cys Cys Cys Gln Asp Leu Leu Gly Ile Leu Gln Glu Asn Cys Ser Asp 225
230 235 240 Asn Lys Arg Gly Ser Ser Ser Asn Asp Ser Cys Asp Asn Lys
Asn Gln 245 250 255 Asp Glu Cys Gln Lys Lys Leu Glu Lys Val Phe Ala
Ser Leu Thr Asn 260 265 270 Gly Tyr Lys Cys Asp Lys Cys Lys Ser Gly
Thr Ser Arg Ser Lys Lys 275 280 285 Lys Trp Ile Trp Lys Lys Ser Ser
Gly Asn Glu Glu Gly Leu Gln Glu 290 295 300 Glu Tyr Ala Asn Thr Ile
Gly Leu Pro Pro Arg Thr Gln Ser Leu Tyr 305 310 315 320 Leu Gly Asn
Leu Pro Lys Leu Glu Asn Val Cys Glu Asp Val Lys Asp 325 330 335 Ile
Asn Phe Asp Thr Lys Glu Lys Phe Leu Ala Gly Cys Leu Ile Val 340 345
350 Ser Phe His Glu Gly Lys Asn Leu Lys Lys Arg Tyr Pro Gln Asn Lys
355 360 365 Asn Ser Gly Asn Lys Glu Asn Leu Cys Lys Ala Leu Glu Tyr
Ser Phe 370 375 380 Ala Asp Tyr Gly Asp Leu Ile Lys Gly Thr Ser Ile
Trp Asp Asn Glu 385 390 395 400 Tyr Thr Lys Asp Leu Glu Leu Asn Leu
Gln Asn Asn Phe Gly Lys Leu 405 410 415 Phe Gly Lys Tyr Ile Lys Lys
Asn Asn Thr Ala Glu Gln Asp Thr Ser 420 425 430 Tyr Ser Ser Leu Asp
Glu Leu Arg Glu Ser Trp Trp Asn Thr Asn Lys 435 440 445 Lys Tyr Ile
Trp Thr Ala Met Lys His Gly Ala Glu Met Asn Ile Thr 450 455 460 Thr
Cys Asn Ala Asp Gly Ser Val Thr Gly Ser Gly Ser Ser Cys Asp 465 470
475 480 Asp Ile Pro Thr Ile Asp Leu Ile Pro Gln Tyr Leu Arg Phe Leu
Gln 485 490 495 Glu Trp Val Glu Asn Phe Cys Glu Gln Arg Gln Ala Lys
Val Lys Asp 500 505 510 Val Ile Thr Asn Cys Lys Ser Cys Lys Glu Ser
Gly Asn Lys Cys Lys 515 520 525 Thr Glu Cys Lys Thr Lys Cys Lys Asp
Glu Cys Glu Lys Tyr Lys Lys 530 535 540 Phe Ile Glu Ala Cys Gly Thr
Ala Gly Gly Gly Ile Gly Thr Ala Gly 545 550 555 560 Ser Pro Trp Ser
Lys Arg Trp Asp Gln Ile Tyr Lys Arg Tyr Ser Lys 565 570 575 His Ile
Glu Asp Ala Lys Arg Asn Arg Lys Ala Gly Thr Lys Asn Cys 580 585 590
Gly Thr Ser Ser Thr Thr Asn Ala Ala Ala Ser Thr Asp Glu Asn Lys 595
600 605 Cys Val Gln Ser Asp Ile Asp Ser Phe Phe Lys His Leu Ile Asp
Ile 610 615 620 Gly Leu Thr Thr Pro Ser Ser Tyr Leu Ser Asn Val Leu
Asp Asp Asn 625 630 635 640 Ile Cys Gly Ala Asp Lys Ala Pro Trp Thr
Thr Tyr Thr Thr Tyr Thr 645 650 655 Thr Thr Glu Lys Cys Asn Lys Glu
Arg Asp Lys Ser Lys Ser Gln Ser 660 665 670 Ser Asp Thr Leu Val Val
Val Asn Val Pro Ser Pro Leu Gly Asn Thr 675 680 685 Pro Tyr Arg Tyr
Lys Tyr Ala Cys Gln Cys Lys Ile Pro Thr Asn Glu 690 695 700 Glu Thr
Cys Asp Asp Arg Lys Glu Tyr Met Asn Gln Trp Ser Cys Gly 705 710 715
720 Ser Ala Arg Thr Met Lys Arg Gly Tyr Lys Asn Asp Asn Tyr Glu Leu
725 730 735 Cys Lys Tyr Asn Gly Val Asp Val Lys Pro Thr Thr Val Arg
Ser Asn 740 745 750 Ser Ser Lys Leu Asp His His His His His His 755
760 22773PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(773)mSA-RO-HIS 22Ala Glu Ala
Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser Thr 1 5 10 15 Phe
Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu 20 25
30 Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu Thr
35 40 45 Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp
Asn Asn 50 55 60 Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp Arg
Gly Gln Tyr Gln 65 70 75 80 Gly Gly Ala Glu Ala Arg Ile Asn Thr Gln
Trp Asn Leu Thr Tyr Glu 85 90 95 Gly Gly Ser Gly Pro Ala Thr Glu
Gln Gly Gln Asp Thr Phe Thr Lys 100 105 110 Val Lys Gly Gly Ser Thr
Ser Glu Asn Arg Asn Lys Arg Ile Gly Gly 115 120 125 Pro Lys Leu Arg
Gly Asn Val Thr Ser Asn Ile Lys Phe Pro Ser Asp 130 135 140 Asn Lys
Gly Lys Ile Ile Arg Gly Ser Asn Asp Lys Leu Asn Lys Asn 145 150 155
160 Ser Glu Asp Val Leu Glu Gln Ser Glu Lys Ser Leu Val Ser Glu Asn
165 170 175 Val Pro Ser Gly Leu Asp Ile Asp Asp Ile Pro Lys Glu Ser
Ile Phe 180 185 190 Ile Gln Glu Asp Gln Glu Gly Gln Thr His Ser Glu
Leu Asn Pro Glu 195 200 205 Thr Ser Glu His Ser Lys Asp Leu Asn Asn
Asn Gly Ser Lys Asn Glu 210 215 220 Ser Ser Asp Ile Ile Ser Glu Asn
Asn Lys Ser Asn Lys Val Gln Asn 225 230 235 240 His Phe Glu Ser Leu
Ser Asp Leu Glu Leu Leu Glu Asn Ser Ser Gln 245 250 255 Asp Asn Leu
Asp Lys Asp Thr Ile Ser Thr Glu Pro Phe Pro Asn Gln 260 265 270 Lys
His Lys Asp Leu Gln Gln Asp Leu Asn Asp Glu Pro Leu Glu Pro 275 280
285 Phe Pro Thr Gln Ile His Lys Asp Tyr Lys Glu Lys Asn Leu Ile Asn
290 295 300 Glu Glu Asp Ser Glu Pro Phe Pro Arg Gln Lys His Lys Lys
Val Asp 305 310 315 320 Asn His Asn Glu Glu Lys Asn Val Phe His Glu
Asn Gly Ser Ala Asn 325 330 335 Gly Asn Gln Gly Ser Leu Lys Leu Lys
Ser Phe Asp Glu His Leu Lys 340 345 350 Asp Glu Lys Ile Glu Asn Glu
Pro Leu Val His Glu Asn Leu Ser Ile 355 360 365 Pro Asn Asp Pro Ile
Glu Gln Ile Leu Asn Gln Pro Glu Gln Glu Thr 370 375 380 Asn Ile Gln
Glu Gln Leu Tyr Asn Glu Lys Gln Asn Val Glu Glu Lys 385 390 395 400
Gln Asn Ser Gln Ile Pro Ser Leu Asp Leu Lys Glu Pro Thr Asn Glu 405
410 415 Asp Ile Leu Pro Asn His Asn Pro Leu Glu Asn Ile Lys Gln Ser
Glu 420 425 430 Ser Glu Ile Asn His Val Gln Asp His Ala Leu Pro Lys
Glu Asn Ile 435 440 445 Ile Asp Lys Leu Asp Asn Gln Lys Glu His Ile
Asp Gln Ser Gln His 450 455 460 Asn Ile Asn Val Leu Gln Glu Asn Asn
Ile Asn Asn His Gln Leu Glu 465 470 475 480 Pro Gln Glu Lys Pro Asn
Ile Glu Ser Phe Glu Pro Lys Asn Ile Asp 485 490 495 Ser Glu Ile Ile
Leu Pro Glu Asn Val Glu Thr Glu Glu Ile Ile Asp 500 505 510 Asp Val
Pro Ser Pro Lys His Ser Asn His Glu Thr Phe Glu Glu Glu 515 520 525
Thr Ser Glu Ser Glu His Glu Glu Ala Val Ser Glu Lys Asn Ala His 530
535 540 Glu Thr Val Glu His Glu Glu Thr Val Ser Gln Glu Ser Asn Pro
Glu 545 550 555 560 Lys Ala Asp Asn Asp Gly Asn Val Ser Gln Asn Ser
Asn Asn Glu Leu 565 570 575 Asn Glu Asn Glu Phe Val Glu Ser Glu Lys
Ser Glu His Glu Ala Arg 580 585 590 Ser Lys Ala Lys Glu Ala Ser Ser
Tyr Asp Tyr Ile Leu Gly Trp Glu 595 600 605 Phe Gly Gly Gly Val Pro
Glu His Lys Lys Glu Glu Asn Met Leu Ser 610 615 620 His Leu Tyr Val
Ser Ser Lys Asp Lys Glu Asn Ile Ser Lys Glu Asn 625 630 635 640 Asp
Asp Val Leu Asp Glu Lys Glu Glu Glu Ala Glu Glu Thr Glu Glu 645 650
655 Glu Glu Leu Glu Glu Lys Asn Glu Glu Glu Thr Glu Ser Glu Ile Ser
660 665 670 Glu Asp Glu Glu Glu Glu Glu Glu Glu Glu Glu Lys Glu Glu
Glu Asn 675 680 685 Asp Lys Lys Lys Glu Gln Glu Lys Glu Gln Ser Asn
Glu Asn Asn Asp 690 695 700 Gln Lys Lys Asp Met Glu Ala Gln Asn Leu
Ile Ser Lys Asn Gln Asn 705 710 715 720 Asn Asn Glu Lys Asn Val Lys
Glu Ala Ala Glu Ser Ile Met Lys Thr 725 730 735 Leu Ala Gly Leu Ile
Lys Gly Asn Asn Gln Ile Asp Ser Thr Leu Lys 740 745 750 Asp Leu Val
Glu Glu Leu Ser Lys Tyr Phe Lys Asn His Arg Ser His 755 760 765 His
His His His His 770 23594PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(594)HIS-RO-mSA 23Gly Ser Thr
Ser Glu Asn Arg Asn Lys Arg Ile Gly Gly Pro Lys Leu 1 5 10 15 Arg
Gly Asn Val Thr Ser Asn Ile Lys Phe Pro Ser Asp Asn Lys Gly 20 25
30 Lys Ile Ile Arg Gly Ser Asn Asp Lys Leu Asn Lys Asn Ser Glu Asp
35 40 45 Val Leu Glu Gln Ser Glu Lys Ser Leu Val Ser Glu Asn Val
Pro Ser 50 55 60 Gly Leu Asp Ile Asp Asp Ile Pro Lys Glu Ser Ile
Phe Ile Gln Glu 65 70 75 80 Asp Gln Glu Gly Gln Thr His Ser Glu Leu
Asn Pro Glu Thr Ser Glu 85 90 95 His Ser Lys Asp Leu Asn Asn Asn
Gly Ser Lys Asn Glu Ser Ser Asp 100 105 110 Ile Ile Ser Glu Asn Asn
Lys Ser Asn Lys Val Gln Asn His Phe Glu 115 120 125 Ser Leu Ser Asp
Leu Glu Leu Leu Glu Asn Ser Ser Gln Asp Asn Leu 130 135 140 Asp Lys
Asp Thr Ile Ser Thr Glu Pro Phe Pro Asn Gln Lys His Lys 145 150 155
160 Asp Leu Gln Gln Asp Leu Asn Asp Glu Pro Leu Glu Pro Phe Pro Thr
165 170 175 Gln Ile His Lys Asp Tyr Lys Glu Lys Asn Leu Ile Asn Glu
Glu Asp 180 185 190 Ser Glu Pro Phe Pro Arg Gln Lys His Lys Lys Val
Asp Asn His Asn 195 200 205 Glu Glu Lys Asn Val Phe His Glu Asn Gly
Ser Ala Asn Gly Asn Gln 210 215 220 Gly Ser Leu Lys Leu Lys Ser Phe
Asp Glu His Leu Lys Asp Glu Lys 225 230 235 240 Ile Glu Asn Glu Pro
Leu Val His Glu Asn Leu Ser Ile Pro Asn Asp 245 250 255 Pro Ile Glu
Gln Ile Leu Asn Gln Pro Glu Gln Glu Thr Asn Ile Gln 260 265 270 Glu
Gln Leu Tyr Asn Glu Lys Gln Asn Val Glu Glu Lys Gln Asn Ser 275 280
285 Gln Ile Pro Ser Leu Asp Leu Lys Glu Pro Thr Asn Glu Asp Ile Leu
290 295 300 Pro Asn His Asn Pro Leu Glu Asn Ile Lys Gln Ser Glu Ser
Glu Ile 305 310 315 320 Asn His Val Gln Asp His Ala Leu Pro Lys Glu
Asn Ile Ile Asp Lys 325 330 335 Leu Asp Asn Gln Lys Glu His Ile Asp
Gln Ser Gln His Asn Ile Asn 340 345 350 Val Leu Gln Glu Asn Asn Ile
Asn Asn His Gln Leu Glu Pro Gln Glu 355 360 365 Lys Pro Asn Ile Glu
Ser Phe Glu Pro Lys Asn Ile Asp Ser Glu Ile 370 375 380 Ile Leu Pro
Glu Asn Val Glu Thr Glu Glu Ile Ile Asp Asp Val Pro 385 390 395 400
Ser Pro Lys His Ser Asn His Glu Thr Phe Glu Glu Glu Thr Ser Glu 405
410 415 Ser Glu His Glu Glu Ala Val Ser Glu Lys Asn Ala His Glu Thr
Val 420 425 430 Glu His Glu Glu Thr Val Ser Gln Glu Ser Asn Pro Glu
Lys Ala Asp 435 440 445 Asn Asp Gly Asn Val Ser Gln Asn Ser Asn Asn
Glu Leu Asn Glu Asn 450 455 460 Glu Phe Val Glu Ser Glu Lys Ser Glu
His Glu Ala Gly Gly Ser Gly 465 470 475 480 Ala Glu Ala Gly Ile Thr
Gly Thr Trp Tyr Asn Gln His Gly Ser Thr 485 490 495 Phe Thr Val Thr
Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu 500 505 510 Asn Arg
Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu Thr 515 520 525
Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp Asn Asn 530
535 540 Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln Tyr
Gln 545 550 555 560 Gly Gly Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn
Leu Thr Tyr Glu 565 570 575 Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly
Gln Asp Thr Phe Thr Lys 580 585 590 Val Lys 24768PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(768)HIS-GMZ2ggsmSA 24Gly Ser
Thr Ser Glu Asn Arg Asn Lys Arg Ile Gly Gly Pro Lys Leu 1 5 10 15
Arg Gly Asn Val Thr Ser Asn Ile Lys Phe Pro Ser Asp Asn Lys Gly 20
25 30 Lys Ile Ile Arg Gly Ser Asn Asp Lys Leu Asn Lys Asn Ser Glu
Asp 35 40 45 Val Leu Glu Gln Ser Glu Lys Ser Leu Val Ser Glu Asn
Val Pro Ser 50 55 60 Gly Leu Asp Ile Asp Asp Ile Pro Lys Glu Ser
Ile Phe Ile Gln Glu 65 70 75 80 Asp Gln Glu Gly Gln Thr His Ser Glu
Leu Asn Pro Glu Thr Ser Glu 85 90 95 His Ser Lys Asp Leu Asn Asn
Asn Gly Ser Lys Asn Glu Ser Ser Asp 100 105 110 Ile Ile Ser Glu Asn
Asn Lys Ser Asn Lys Val Gln Asn His Phe Glu 115 120 125 Ser Leu Ser
Asp Leu Glu Leu Leu Glu Asn Ser Ser Gln Asp Asn Leu 130 135 140 Asp
Lys Asp Thr Ile Ser Thr Glu Pro Phe Pro Asn Gln Lys His Lys 145 150
155 160 Asp Leu Gln Gln Asp Leu Asn Asp Glu Pro Leu Glu Pro Phe Pro
Thr 165 170 175 Gln Ile His Lys Asp Tyr Lys Glu Lys Asn Leu Ile Asn
Glu Glu Asp 180 185 190 Ser Glu Pro Phe Pro Arg Gln Lys His Lys Lys
Val Asp Asn His Asn 195 200 205 Glu Glu Lys Asn Val Phe His Glu Asn
Gly Ser Ala Asn Gly Asn Gln 210 215 220 Gly Ser Leu Lys Leu Lys Ser
Phe Asp Glu His Leu Lys Asp Glu Lys 225 230 235 240 Ile Glu Asn Glu
Pro Leu Val His Glu Asn Leu Ser Ile Pro Asn Asp 245 250 255 Pro Ile
Glu Gln Ile Leu Asn Gln Pro Glu Gln Glu Thr Asn Ile Gln 260 265 270
Glu Gln Leu Tyr Asn Glu Lys Gln Asn Val Glu Glu Lys Gln Asn Ser 275
280 285 Gln Ile Pro Ser Leu Asp Leu Lys Glu Pro Thr Asn Glu Asp Ile
Leu 290 295 300 Pro Asn His Asn Pro Leu Glu Asn Ile Lys Gln Ser Glu
Ser Glu Ile 305 310 315 320 Asn His Val Gln Asp His Ala Leu Pro Lys
Glu Asn Ile Ile Asp Lys 325 330 335 Leu Asp Asn Gln Lys Glu His Ile
Asp Gln Ser Gln His Asn Ile Asn 340 345 350 Val Leu Gln Glu Asn Asn
Ile Asn Asn His Gln Leu Glu Pro Gln Glu
355 360 365 Lys Pro Asn Ile Glu Ser Phe Glu Pro Lys Asn Ile Asp Ser
Glu Ile 370 375 380 Ile Leu Pro Glu Asn Val Glu Thr Glu Glu Ile Ile
Asp Asp Val Pro 385 390 395 400 Ser Pro Lys His Ser Asn His Glu Thr
Phe Glu Glu Glu Thr Ser Glu 405 410 415 Ser Glu His Glu Glu Ala Val
Ser Glu Lys Asn Ala His Glu Thr Val 420 425 430 Glu His Glu Glu Thr
Val Ser Gln Glu Ser Asn Pro Glu Lys Ala Asp 435 440 445 Asn Asp Gly
Asn Val Ser Gln Asn Ser Asn Asn Glu Leu Asn Glu Asn 450 455 460 Glu
Phe Val Glu Ser Glu Lys Ser Glu His Glu Ala Arg Ser Lys Ala 465 470
475 480 Lys Glu Ala Ser Ser Tyr Asp Tyr Ile Leu Gly Trp Glu Phe Gly
Gly 485 490 495 Gly Val Pro Glu His Lys Lys Glu Glu Asn Met Leu Ser
His Leu Tyr 500 505 510 Val Ser Ser Lys Asp Lys Glu Asn Ile Ser Lys
Glu Asn Asp Asp Val 515 520 525 Leu Asp Glu Lys Glu Glu Glu Ala Glu
Glu Thr Glu Glu Glu Glu Leu 530 535 540 Glu Glu Lys Asn Glu Glu Glu
Thr Glu Ser Glu Ile Ser Glu Asp Glu 545 550 555 560 Glu Glu Glu Glu
Glu Glu Glu Glu Lys Glu Glu Glu Asn Asp Lys Lys 565 570 575 Lys Glu
Gln Glu Lys Glu Gln Ser Asn Glu Asn Asn Asp Gln Lys Lys 580 585 590
Asp Met Glu Ala Gln Asn Leu Ile Ser Lys Asn Gln Asn Asn Asn Glu 595
600 605 Lys Asn Val Lys Glu Ala Ala Glu Ser Ile Met Lys Thr Leu Ala
Gly 610 615 620 Leu Ile Lys Gly Asn Asn Gln Ile Asp Ser Thr Leu Lys
Asp Leu Val 625 630 635 640 Glu Glu Leu Ser Lys Tyr Phe Lys Asn His
Gly Gly Ser Gly Ala Glu 645 650 655 Ala Gly Ile Thr Gly Thr Trp Tyr
Asn Gln His Gly Ser Thr Phe Thr 660 665 670 Val Thr Ala Gly Ala Asp
Gly Asn Leu Thr Gly Gln Tyr Glu Asn Arg 675 680 685 Ala Gln Gly Thr
Gly Cys Gln Asn Ser Pro Tyr Thr Leu Thr Gly Arg 690 695 700 Tyr Asn
Gly Thr Lys Leu Glu Trp Arg Val Glu Trp Asn Asn Ser Thr 705 710 715
720 Glu Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln Tyr Gln Gly Gly
725 730 735 Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr Tyr Glu
Gly Gly 740 745 750 Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe
Thr Lys Val Lys 755 760 765 25691PRTArtificial sequenceConstructs
25Gly Ser Thr Ser Glu Asn Arg Asn Lys Arg Ile Gly Gly Pro Lys Leu 1
5 10 15 Arg Gly Asn Val Thr Ser Asn Ile Lys Phe Pro Ser Asp Asn Lys
Gly 20 25 30 Lys Ile Ile Arg Gly Ser Asn Asp Lys Leu Asn Lys Asn
Ser Glu Asp 35 40 45 Val Leu Glu Gln Ser Glu Lys Ser Leu Val Ser
Glu Asn Val Pro Ser 50 55 60 Gly Leu Asp Ile Asp Asp Ile Pro Lys
Glu Ser Ile Phe Ile Gln Glu 65 70 75 80 Asp Gln Glu Gly Gln Thr His
Ser Glu Leu Asn Pro Glu Thr Ser Glu 85 90 95 His Ser Lys Asp Leu
Asn Asn Asn Gly Ser Lys Asn Glu Ser Ser Asp 100 105 110 Ile Ile Ser
Glu Asn Asn Lys Ser Asn Lys Val Gln Asn His Phe Glu 115 120 125 Ser
Leu Ser Asp Leu Glu Leu Leu Glu Asn Ser Ser Gln Asp Asn Leu 130 135
140 Asp Lys Asp Thr Ile Ser Thr Glu Pro Phe Pro Asn Gln Lys His Lys
145 150 155 160 Asp Leu Gln Gln Asp Leu Asn Asp Glu Pro Leu Glu Pro
Phe Pro Thr 165 170 175 Gln Ile His Lys Asp Tyr Lys Glu Lys Asn Leu
Ile Asn Glu Glu Asp 180 185 190 Ser Glu Pro Phe Pro Arg Gln Lys His
Lys Lys Val Asp Asn His Asn 195 200 205 Glu Glu Lys Asn Val Phe His
Glu Asn Gly Ser Ala Asn Gly Asn Gln 210 215 220 Gly Ser Leu Lys Leu
Lys Ser Phe Asp Glu His Leu Lys Asp Glu Lys 225 230 235 240 Ile Glu
Asn Glu Pro Leu Val His Glu Asn Leu Ser Ile Pro Asn Asp 245 250 255
Pro Ile Glu Gln Ile Leu Asn Gln Pro Glu Gln Glu Thr Asn Ile Gln 260
265 270 Glu Gln Leu Tyr Asn Glu Lys Gln Asn Val Glu Glu Lys Gln Asn
Ser 275 280 285 Gln Ile Pro Ser Leu Asp Leu Lys Glu Pro Thr Asn Glu
Asp Ile Leu 290 295 300 Pro Asn His Asn Pro Leu Glu Asn Ile Lys Gln
Ser Glu Ser Glu Ile 305 310 315 320 Asn His Val Gln Asp His Ala Leu
Pro Lys Glu Asn Ile Ile Asp Lys 325 330 335 Leu Asp Asn Gln Lys Glu
His Ile Asp Gln Ser Gln His Asn Ile Asn 340 345 350 Val Leu Gln Glu
Asn Asn Ile Asn Asn His Gln Leu Glu Pro Gln Glu 355 360 365 Lys Pro
Asn Ile Glu Ser Phe Glu Pro Lys Asn Ile Asp Ser Glu Ile 370 375 380
Ile Leu Pro Glu Asn Val Glu Thr Glu Glu Ile Ile Asp Asp Val Pro 385
390 395 400 Ser Pro Lys His Ser Asn His Glu Thr Phe Glu Glu Glu Thr
Ser Glu 405 410 415 Ser Glu His Glu Glu Ala Val Ser Glu Lys Asn Ala
His Glu Thr Val 420 425 430 Glu His Glu Glu Thr Val Ser Gln Glu Ser
Asn Pro Glu Lys Ala Asp 435 440 445 Asn Asp Gly Asn Val Ser Gln Asn
Ser Asn Asn Glu Leu Asn Glu Asn 450 455 460 Glu Phe Val Glu Ser Glu
Lys Ser Glu His Glu Ala Arg Ser Lys Thr 465 470 475 480 Lys Glu Tyr
Ala Glu Lys Ala Lys Asn Ala Tyr Glu Lys Ala Lys Asn 485 490 495 Ala
Tyr Gln Lys Ala Asn Gln Ala Val Leu Lys Ala Lys Glu Ala Ser 500 505
510 Ser Tyr Asp Tyr Ile Leu Gly Trp Glu Phe Gly Gly Gly Val Pro Glu
515 520 525 His Lys Lys Glu Glu Asn Met Leu Ser His Leu Tyr Val Ser
Ser Lys 530 535 540 Asp Lys Glu Asn Ile Ser Lys Glu Asn Asp Asp Val
Leu Asp Glu Lys 545 550 555 560 Glu Glu Glu Ala Glu Glu Thr Glu Glu
Glu Glu Leu Glu Gly Gly Ser 565 570 575 Gly Ala Glu Ala Gly Ile Thr
Gly Thr Trp Tyr Asn Gln His Gly Ser 580 585 590 Thr Phe Thr Val Thr
Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr 595 600 605 Glu Asn Arg
Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu 610 615 620 Thr
Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp Asn 625 630
635 640 Asn Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln
Tyr 645 650 655 Gln Gly Gly Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn
Leu Thr Tyr 660 665 670 Glu Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly
Gln Asp Thr Phe Thr 675 680 685 Lys Val Lys 690 26627PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(627)mSA-PfRH5-HIS 26Ala Glu Ala
Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser Thr 1 5 10 15 Phe
Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu 20 25
30 Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu Thr
35 40 45 Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp
Asn Asn 50 55 60 Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp Arg
Gly Gln Tyr Gln 65 70 75 80 Gly Gly Ala Glu Ala Arg Ile Asn Thr Gln
Trp Asn Leu Thr Tyr Glu 85 90 95 Gly Gly Ser Gly Pro Ala Thr Glu
Gln Gly Gln Asp Thr Phe Thr Lys 100 105 110 Val Lys Gly Gly Ser Leu
Ser Phe Glu Asn Ala Ile Lys Lys Thr Lys 115 120 125 Asn Gln Glu Asn
Asn Leu Thr Leu Leu Pro Ile Lys Ser Thr Glu Glu 130 135 140 Glu Lys
Asp Asp Ile Lys Asn Gly Lys Asp Ile Lys Lys Glu Ile Asp 145 150 155
160 Asn Asp Lys Glu Asn Ile Lys Thr Asn Asn Ala Lys Asp His Ser Thr
165 170 175 Tyr Ile Lys Ser Tyr Leu Asn Thr Asn Val Asn Asp Gly Leu
Lys Tyr 180 185 190 Leu Phe Ile Pro Ser His Asn Ser Phe Ile Lys Lys
Tyr Ser Val Phe 195 200 205 Asn Gln Ile Asn Asp Gly Met Leu Leu Asn
Glu Lys Asn Asp Val Lys 210 215 220 Asn Asn Glu Asp Tyr Lys Asn Val
Asp Tyr Lys Asn Val Asn Phe Leu 225 230 235 240 Gln Tyr His Phe Lys
Glu Leu Ser Asn Tyr Asn Ile Ala Asn Ser Ile 245 250 255 Asp Ile Leu
Gln Glu Lys Glu Gly His Leu Asp Phe Val Ile Ile Pro 260 265 270 His
Tyr Thr Phe Leu Asp Tyr Tyr Lys His Leu Ser Tyr Asn Ser Ile 275 280
285 Tyr His Lys Tyr Ser Thr Tyr Gly Lys Tyr Ile Ala Val Asp Ala Phe
290 295 300 Ile Lys Lys Ile Asn Glu Thr Tyr Asp Lys Val Lys Ser Lys
Cys Asn 305 310 315 320 Asp Ile Lys Asn Asp Leu Ile Ala Thr Ile Lys
Lys Leu Glu His Pro 325 330 335 Tyr Asp Ile Asn Asn Lys Asn Asp Asp
Ser Tyr Arg Tyr Asp Ile Ser 340 345 350 Glu Glu Ile Asp Asp Lys Ser
Glu Glu Thr Asp Asp Glu Thr Glu Glu 355 360 365 Val Glu Asp Ser Ile
Gln Asp Thr Asp Ser Asn His Thr Pro Ser Asn 370 375 380 Lys Lys Lys
Asn Asp Leu Met Asn Arg Thr Phe Lys Lys Met Met Asp 385 390 395 400
Glu Tyr Asn Thr Lys Lys Lys Lys Leu Ile Lys Cys Ile Lys Asn His 405
410 415 Glu Asn Asp Phe Asn Lys Ile Cys Met Asp Met Lys Asn Tyr Gly
Thr 420 425 430 Asn Leu Phe Glu Gln Leu Ser Cys Tyr Asn Asn Asn Phe
Cys Asn Thr 435 440 445 Asn Gly Ile Arg Phe His Tyr Asp Glu Tyr Ile
His Lys Leu Ile Leu 450 455 460 Ser Val Lys Ser Lys Asn Leu Asn Lys
Asp Leu Ser Asp Met Thr Asn 465 470 475 480 Ile Leu Gln Gln Ser Glu
Leu Leu Leu Thr Asn Leu Asn Lys Lys Met 485 490 495 Gly Ser Tyr Ile
Tyr Ile Asp Thr Ile Lys Phe Ile His Lys Glu Met 500 505 510 Lys His
Ile Phe Asn Arg Ile Glu Tyr His Thr Lys Ile Ile Asn Asp 515 520 525
Lys Thr Lys Ile Ile Gln Asp Lys Ile Lys Leu Asn Ile Trp Arg Thr 530
535 540 Phe Gln Lys Asp Glu Leu Leu Lys Arg Ile Leu Asp Met Ser Asn
Glu 545 550 555 560 Tyr Ser Leu Phe Ile Thr Ser Asp His Leu Arg Gln
Met Leu Tyr Asn 565 570 575 Thr Phe Tyr Ser Lys Glu Lys His Leu Asn
Asn Ile Phe His His Leu 580 585 590 Ile Tyr Val Leu Gln Met Lys Phe
Asn Asp Val Pro Ile Lys Met Glu 595 600 605 Tyr Phe Gln Thr Tyr Lys
Lys Asn Lys Pro Leu Thr Gln His His His 610 615 620 His His His 625
27333PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(333)mSA-Pfs25-HIS 27Ala Glu Ala
Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser Thr 1 5 10 15 Phe
Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu 20 25
30 Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu Thr
35 40 45 Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp
Asn Asn 50 55 60 Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp Arg
Gly Gln Tyr Gln 65 70 75 80 Gly Gly Ala Glu Ala Arg Ile Asn Thr Gln
Trp Asn Leu Thr Tyr Glu 85 90 95 Gly Gly Ser Gly Pro Ala Thr Glu
Gln Gly Gln Asp Thr Phe Thr Lys 100 105 110 Val Lys Gly Gly Ser Asn
Lys Leu Tyr Ser Leu Phe Leu Phe Leu Phe 115 120 125 Ile Gln Leu Ser
Ile Lys Tyr Asn Asn Ala Lys Val Thr Val Asp Thr 130 135 140 Val Cys
Lys Arg Gly Phe Leu Ile Gln Met Ser Gly His Leu Glu Cys 145 150 155
160 Lys Cys Glu Asn Asp Leu Val Leu Val Asn Glu Glu Thr Cys Glu Glu
165 170 175 Lys Val Leu Lys Cys Asp Glu Lys Thr Val Asn Lys Pro Cys
Gly Asp 180 185 190 Phe Ser Lys Cys Ile Lys Ile Asp Gly Asn Pro Val
Ser Tyr Ala Cys 195 200 205 Lys Cys Asn Leu Gly Tyr Asp Met Val Asn
Asn Val Cys Ile Pro Asn 210 215 220 Glu Cys Lys Asn Val Thr Cys Gly
Asn Gly Lys Cys Ile Leu Asp Thr 225 230 235 240 Ser Asn Pro Val Lys
Thr Gly Val Cys Ser Cys Asn Ile Gly Lys Val 245 250 255 Pro Asn Val
Gln Asp Gln Asn Lys Cys Ser Lys Asp Gly Glu Thr Lys 260 265 270 Cys
Ser Leu Lys Cys Leu Lys Glu Asn Glu Thr Cys Lys Ala Val Asp 275 280
285 Gly Ile Tyr Lys Cys Asp Cys Lys Asp Gly Phe Ile Ile Asp Asn Glu
290 295 300 Ser Ser Ile Cys Thr Ala Phe Ser Ala Tyr Asn Ile Leu Asn
Leu Ser 305 310 315 320 Ile Met Phe Ile Leu Phe Ser Val Cys Phe Phe
Ile Met 325 330 28422PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(422)HIS-PfCSP(aa92-397)-mSA
28Lys Leu Lys Gln Pro Ala Asp Gly Asn Pro Asp Pro Asn Ala Asn Pro 1
5 10 15 Asn Val Asp Pro Asn Ala Asn Pro Asn Val Asp Pro Asn Ala Asn
Pro 20 25 30 Asn Val Asp Pro Asn Ala Asn Pro Asn Ala Asn Pro Asn
Ala Asn Pro 35 40 45 Asn Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn
Pro Asn Ala Asn Pro 50 55 60 Asn Ala Asn Pro Asn Ala Asn Pro Asn
Ala Asn Pro Asn Ala Asn Pro 65 70 75 80 Asn Ala Asn Pro Asn Ala Asn
Pro Asn Ala Asn Pro Asn Ala Asn Pro 85 90 95 Asn Ala Asn Pro Asn
Ala Asn Pro Asn Val Asp Pro Asn Ala Asn Pro 100 105 110 Asn Ala Asn
Pro Asn Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn Pro 115 120 125 Asn
Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn Pro 130 135
140 Asn Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn Pro
145 150 155 160 Asn Ala Asn Pro Asn Ala Asn Pro Asn Ala Asn Pro Asn
Ala Asn Pro 165 170 175 Asn Ala Asn Pro Asn Lys Asn Asn Gln Gly Asn
Gly Gln Gly His Asn 180 185 190 Met Pro Asn Asp Pro Asn Arg Asn Val
Asp Glu Asn Ala Asn Ala Asn 195
200 205 Ser Ala Val Lys Asn Asn Asn Asn Glu Glu Pro Ser Asp Lys His
Ile 210 215 220 Lys Glu Tyr Leu Asn Lys Ile Gln Asn Ser Leu Ser Thr
Glu Trp Ser 225 230 235 240 Pro Cys Ser Val Thr Cys Gly Asn Gly Ile
Gln Val Arg Ile Lys Pro 245 250 255 Gly Ser Ala Asn Lys Pro Lys Asp
Glu Leu Asp Tyr Ala Asn Asp Ile 260 265 270 Glu Lys Lys Ile Cys Lys
Met Glu Lys Cys Ser Ser Val Phe Asn Val 275 280 285 Val Asn Ser Ser
Ile Gly Leu Ile Met Val Leu Ser Phe Leu Phe Leu 290 295 300 Asn Gly
Gly Ser Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln 305 310 315
320 His Gly Ser Thr Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr
325 330 335 Gly Gln Tyr Glu Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn
Ser Pro 340 345 350 Tyr Thr Leu Thr Gly Arg Tyr Asn Gly Thr Lys Leu
Glu Trp Arg Val 355 360 365 Glu Trp Asn Asn Ser Thr Glu Asn Cys His
Ser Arg Thr Glu Trp Arg 370 375 380 Gly Gln Tyr Gln Gly Gly Ala Glu
Ala Arg Ile Asn Thr Gln Trp Asn 385 390 395 400 Leu Thr Tyr Glu Gly
Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp 405 410 415 Thr Phe Thr
Lys Val Lys 420 292973DNAArtificial
sequenceConstructsmisc_feature(1)..(2973)PCSK9|31-692|mSAHIS DNA
29tttcatatgc caagtacgcc ccctattgac gtcaatgacg gtaaatggcc cgcctggcat
60tatgcccagt acatgacctt atgggacttt cctacttggc agtacatcta cgtattagtc
120atcgctatta ccatggtgat gcggttttgg cagtacatca atgggcgtgg
atagcggttt 180gactcacggg gatttccaag tctccacccc attgacgtca
atgggagttt gttttggcac 240caaaatcaac gggactttcc aaaatgtcgt
aacaactccg ccccattgac gcaaatgggc 300ggtaggcgtg tacggtggga
ggtctatata agcagagctc tctggctaac tagagaaccc 360actgcttact
ggcttatcga aattaatacg actcactata gggagaccca agctggctag
420cgtttaaact taagcttagc gcagaggctt ggggcagccg agcggcagcc
aggccccggc 480ccgggcctcg gttccagaag ggagaggagc ccgccaaggc
gcgcaagaga gcgggctgcc 540tcgcagtccg agccggagag ggagcgcgag
ccgcgccggc cccggacggc ctccgaaacc 600atgcaggaag atgaggacgg
cgactacgag gaactggtgc tggccctgcg gagcgaagag 660gatggactgg
ccgaggcccc tgagcacggc accaccgcca ccttccacag atgcgccaag
720gacccttggc ggctgcccgg cacatacgtg gtggtgctga aagaggaaac
ccacctgagc 780cagagcgagc ggaccgccag aaggctgcag gcccaggccg
ccagaagagg ctacctgacc 840aagatcctgc acgtgttcca cggcctgctg
cccggcttcc tggtgaaaat gagcggcgac 900ctgctggaac tggccctgaa
gctgccccac gtggactaca tcgaagagga cagcagcgtg 960ttcgcccaga
gcatcccctg gaacctggaa cggatcaccc cccccagata ccgggccgac
1020gagtaccagc ctcctgacgg cggcagcctg gtggaagtgt acctgctgga
caccagcatc 1080cagagcgacc accgcgagat cgagggcaga gtgatggtga
cagacttcga gaacgtgccc 1140gaagaggacg gcacccggtt ccacagacag
gccagcaagt gcgacagcca cggcacacat 1200ctggccggcg tggtgtctgg
cagagatgcc ggcgtggcca agggcgccag catgagaagc 1260ctgcgggtgc
tgaactgcca gggcaagggc accgtgtccg gcaccctgat cggcctggaa
1320ttcatccgga agtcccagct ggtgcagccc gtgggccctc tggtggtgct
gctgcctctg 1380gctggcggct acagcagagt gctgaacgcc gcctgccaga
gactggccag agctggcgtg 1440gtgctggtga cagccgccgg aaacttccgg
gacgacgcct gcctgtacag ccccgcctct 1500gcccccgaag tgatcaccgt
gggcgccacc aacgcccagg accagcctgt gacactgggc 1560accctgggca
caaacttcgg cagatgcgtg gacctgttcg cccctggcga ggacatcatc
1620ggcgccagca gcgactgcag cacctgtttc gtgtcccaga gcggcaccag
ccaggccgct 1680gcccatgtgg ccggaatcgc cgccatgatg ctgagcgccg
agcctgagct gaccctggcc 1740gagctgcggc agcggctgat ccacttctcc
gccaaggacg tgatcaacga ggcctggttc 1800cccgaggacc agagagtgct
gacccccaac ctggtggccg ccctgcctcc ttctacacac 1860ggcgctggct
ggcagctgtt ctgcaggaca gtgtggtccg cccacagcgg ccccaccaga
1920atggccacag ccgtggccag atgcgcccct gatgaggaac tgctgagctg
cagcagcttc 1980tccagaagcg gcaagcggag aggcgagcgg atggaagccc
agggcggcaa gctcgtgtgc 2040agagcccaca atgccttcgg cggcgagggc
gtgtacgcca ttgccagatg ctgcctgctg 2100cctcaggcca actgcagcgt
gcacacagcc cctccagccg aggccagcat gggcaccaga 2160gtgcactgcc
accagcaggg ccacgtgctg accggctgta gcagccactg ggaggtggaa
2220gatctgggca cccacaagcc ccccgtgctg aggcccagag gccagcctaa
tcagtgcgtg 2280ggccacagag aggcctccat ccacgccagc tgttgccacg
cccctggcct ggaatgcaaa 2340gtgaaagagc acggcatccc tgccccccag
gaacaggtca cagtggcctg cgaggaaggc 2400tggaccctga caggctgttc
cgccctgcca ggcacctctc acgtgctggg cgcctacgcc 2460gtggacaata
cctgcgtcgt gcgcagccgg gacgtgtcca caaccggctc tacaagcgag
2520ggcgccgtga ccgccgtggc catctgctgc agaagcagac acctggccca
ggcctcccag 2580gaactgcagg gcggatctgc cgaggccggc atcaccggca
cctggtacaa tcagcacggc 2640agcaccttca ccgtgaccgc tggcgccgac
ggcaacctga ccggccagta cgagaacaga 2700gcccagggca ccggctgcca
gaacagccct tacaccctga ccggcagata caacggcacc 2760aagctggaat
ggcgggtgga atggaacaac agcaccgaga actgccacag ccggaccgag
2820tggcggggac agtatcaggg cggagccgag gcccggatca acacccagtg
gaacctgacc 2880tacgagggcg gctctggccc tgccacagag cagggacagg
acaccttcac caaagtgaag 2940caccaccacc atcaccacta agcggccgct ttt
2973302309DNAArtificial
sequenceConstructsmisc_feature(1)..(2309)mSA-ID1ID2a-HIS DNA
30ccatgggcgg tgcagaagca ggtattaccg gcacctggta taatcagcat ggtagcacct
60ttaccgttac cgcaggcgca gatggtaatc tgacaggtca gtatgaaaat cgtgcacagg
120gcaccggttg tcagaatagc ccgtataccc tgaccggtcg ttataatggc
accaaactgg 180aatggcgtgt tgaatggaat aatagcaccg aaaattgtca
tagccgtacc gaatggcgtg 240gtcagtatca gggtggtgca gaagcccgta
ttaataccca gtggaatctg acctatgaag 300gtggtagcgg tccggcaacc
gaacagggtc aggatacctt taccaaagtt aaaggtggca 360gcaactatat
caaaggcgat ccgtattttg cagagtatgc aaccaaactg agctttattc
420tgaatccgag tgatgcaaat aatccgagcg gtgaaaccgc aaatcacaat
gatgaagcct 480gtaattgtaa cgaaagcggt attagcagcg ttggtcaggc
acagaccagc ggtccgagca 540gcaataaaac ctgtattacc catagcagca
ttaaaaccaa taaaaagaaa gaatgcaaag 600atgtgaaact gggcgtgcgc
gaaaatgata aagatctgaa aatttgcgtg atcgaggata 660ccagcctgag
cggtgttgat aattgttgtt gtcaggatct gctgggtatt ctgcaagaaa
720attgcagcga taataaacgt ggtagcagca gcaatgatag ctgcgataac
aaaaatcagg 780atgaatgcca gaaaaaactg gaaaaagttt ttgccagcct
gacgaatggt tacaaatgcg 840ataaatgtaa aagcggcacc agccgcagca
aaaagaaatg gatttggaaa aaaagcagcg 900gcaatgaaga aggtctgcaa
gaggaatatg caaataccat tggtctgcct ccgcgtaccc 960agagcctgta
tctgggtaat ctgccgaaac tggaaaatgt gtgtgaagat gtgaaagata
1020tcaattttga taccaaagaa aaatttctgg caggctgcct gattgtgagc
tttcatgaag 1080gtaaaaacct gaaaaaacgc tatccgcaga ataaaaacag
cggtaacaaa gaaaatctgt 1140gcaaagcact ggaatacagc tttgcagatt
atggcgatct gattaaaggc accagcattt 1200gggataacga gtataccaaa
gatctggaac tgaatctgca gaacaatttc ggtaaactgt 1260tcggcaaata
tatcaaaaaa aacaataccg cagagcagga taccagctat agcagcctgg
1320atgaactgcg tgaaagttgg tggaatacca acaaaaaata catttggacc
gccatgaaac 1380atggtgccga aatgaatatt accacctgta atgcagatgg
tagcgttacc ggtagcggta 1440gcagctgtga tgatattccg accattgatc
tgattccgca gtatctgcgt tttctgcaag 1500aatgggttga aaacttttgt
gaacagcgtc aggcgaaagt gaaagatgtt attaccaatt 1560gcaaaagctg
caaagaaagc ggcaataaat gcaaaaccga gtgcaaaacc aaatgcaaag
1620acgagtgcga gaaatacaaa aaattcattg aagcatgtgg tacagccggt
ggtggtattg 1680gcaccgcagg tagcccgtgg tcaaaacgtt gggatcagat
ctataaacgc tacagcaaac 1740acatcgaaga tgccaaacgt aatcgtaaag
caggcaccaa aaattgtggc accagcagca 1800ccaccaatgc agcagcaagc
accgatgaaa acaaatgtgt tcagagcgat atcgatagct 1860tcttcaaaca
tctgattgat attggtctga ccaccccgag cagctatctg agcaatgttc
1920tggatgataa catttgcggt gcagataaag caccgtggac cacctatacc
acatatacca 1980ccacagaaaa atgcaacaaa gagcgcgata aaagcaaaag
ccagagcagc gataccctgg 2040ttgttgttaa tgttccgagt ccgctgggta
ataccccgta tcgttataag tatgcctgcc 2100agtgtaaaat cccgaccaat
gaagaaacct gtgatgatcg caaagaatac atgaatcagt 2160ggtcatgtgg
tagcgcacgt accatgaaac gtggctataa aaacgataat tatgaactgt
2220gcaaatataa cggcgtggat gttaaaccga ccaccgttcg tagcaatagc
agcaaactgg 2280atcatcatca tcaccatcat taaggatcc
2309312342DNAArtificial
sequenceConstructsmisc_feature(1)..(2342)mSA-RO-HIS DNA
31ccatgggcgg tgcagaagca ggtattaccg gcacctggta taatcagcat ggtagcacct
60ttaccgttac cgcaggcgca gatggtaatc tgacaggtca gtatgaaaat cgtgcacagg
120gcaccggttg tcagaatagc ccgtataccc tgaccggtcg ttataatggc
accaaactgg 180aatggcgtgt tgaatggaat aatagcaccg aaaattgtca
tagccgtacc gaatggcgtg 240gtcagtatca gggtggtgca gaagcccgta
ttaataccca gtggaatctg acctatgaag 300gtggtagcgg tccggcaacc
gaacagggtc aggatacctt taccaaagtt aaaggtggca 360gcacaagtga
gaatagaaat aaacgaatcg ggggtcctaa attaaggggt aatgttacaa
420gtaatataaa gttcccatca gataacaaag gtaaaattat aagaggttcg
aatgataaac 480ttaataaaaa ctctgaagat gttttagaac aaagcgaaaa
atcgcttgtt tcagaaaatg 540ttcctagtgg attagatata gatgatatcc
ctaaagaatc tatttttatt caagaagatc 600aagaaggtca aactcattct
gaattaaatc ctgaaacatc agaacatagt aaagatttaa 660ataataatgg
ttcaaaaaat gaatctagtg atattatttc agaaaataat aaatcaaata
720aagtacaaaa tcattttgaa tcattatcag atttagaatt acttgaaaat
tcctcacaag 780ataatttaga caaagataca atttcaacag aaccttttcc
taatcaaaaa cataaagact 840tacaacaaga tttaaatgat gaacctttag
aaccctttcc tacacaaata cataaagatt 900ataaagaaaa aaatttaata
aatgaagaag attcagaacc atttcccaga caaaagcata 960aaaaggtaga
caatcataat gaagaaaaaa acgtatttca tgaaaatggt tctgcaaatg
1020gtaatcaagg aagtttgaaa cttaaatcat tcgatgaaca tttaaaagat
gaaaaaatag 1080aaaatgaacc acttgttcat gaaaatttat ccataccaaa
tgatccaata gaacaaatat 1140taaatcaacc tgaacaagaa acaaatatcc
aggaacaatt gtataatgaa aaacaaaatg 1200ttgaagaaaa acaaaattct
caaatacctt cgttagattt aaaagaacca acaaatgaag 1260atattttacc
aaatcataat ccattagaaa atataaaaca aagtgaatca gaaataaatc
1320atgtacaaga tcatgcgcta ccaaaagaga atataataga caaacttgat
aatcaaaaag 1380aacacatcga tcaatcacaa cataatataa atgtattaca
agaaaataac ataaacaatc 1440accaattaga acctcaagag aaacctaata
ttgaatcgtt tgaacctaaa aatatagatt 1500cagaaattat tcttcctgaa
aatgttgaaa cagaagaaat aatagatgat gtgccttccc 1560ctaaacattc
taaccatgaa acatttgaag aagaaacaag tgaatctgaa catgaagaag
1620ccgtatctga aaaaaatgcc cacgaaactg tcgaacatga agaaactgtg
tctcaagaaa 1680gcaatcctga aaaagctgat aatgatggaa atgtatctca
aaacagcaac aacgaattaa 1740atgaaaatga attcgttgaa tcggaaaaaa
gcgagcatga agcaagatcc aaagcaaaag 1800aagcttctag ttatgattat
attttaggtt gggaatttgg aggaggcgtt ccagaacaca 1860aaaaagaaga
aaatatgtta tcacatttat atgtttcttc aaaggataag gaaaatatat
1920ctaaggaaaa tgatgatgta ttagatgaga aggaagaaga ggcagaagaa
acagaagaag 1980aagaacttga agaaaaaaat gaagaagaaa cagaatcaga
aataagtgaa gatgaagaag 2040aagaagaaga agaagaagaa aaggaagaag
aaaatgacaa aaaaaaagaa caagaaaaag 2100aacaaagtaa tgaaaataat
gatcaaaaaa aagatatgga agcacagaat ttaatttcta 2160aaaaccagaa
taataatgag aaaaacgtaa aagaagctgc tgaaagcatc atgaaaactt
2220tagctggttt aatcaaggga aataatcaaa tagattctac cttaaaagat
ttagtagaag 2280aattatccaa atattttaaa aatcatagat ctcatcacca
tcatcaccat tagggatcct 2340tt 2342321791DNAArtificial
sequenceConstructsmisc_feature(1)..(1791)HIS-RO-mSA DNA
32ggatccacaa gtgagaatag aaataaacga atcgggggtc ctaaattaag gggtaatgtt
60acaagtaata taaagttccc atcagataac aaaggtaaaa ttataagagg ttcgaatgat
120aaacttaata aaaactctga agatgtttta gaacaaagcg aaaaatcgct
tgtttcagaa 180aatgttccta gtggattaga tatagatgat atccctaaag
aatctatttt tattcaagaa 240gatcaagaag gtcaaactca ttctgaatta
aatcctgaaa catcagaaca tagtaaagat 300ttaaataata atggttcaaa
aaatgaatct agtgatatta tttcagaaaa taataaatca 360aataaagtac
aaaatcattt tgaatcatta tcagatttag aattacttga aaattcctca
420caagataatt tagacaaaga tacaatttca acagaacctt ttcctaatca
aaaacataaa 480gacttacaac aagatttaaa tgatgaacct ttagaaccct
ttcctacaca aatacataaa 540gattataaag aaaaaaattt aataaatgaa
gaagattcag aaccatttcc cagacaaaag 600cataaaaagg tagacaatca
taatgaagaa aaaaacgtat ttcatgaaaa tggttctgca 660aatggtaatc
aaggaagttt gaaacttaaa tcattcgatg aacatttaaa agatgaaaaa
720atagaaaatg aaccacttgt tcatgaaaat ttatccatac caaatgatcc
aatagaacaa 780atattaaatc aacctgaaca agaaacaaat atccaggaac
aattgtataa tgaaaaacaa 840aatgttgaag aaaaacaaaa ttctcaaata
ccttcgttag atttaaaaga accaacaaat 900gaagatattt taccaaatca
taatccatta gaaaatataa aacaaagtga atcagaaata 960aatcatgtac
aagatcatgc gctaccaaaa gagaatataa tagacaaact tgataatcaa
1020aaagaacaca tcgatcaatc acaacataat ataaatgtat tacaagaaaa
taacataaac 1080aatcaccaat tagaacctca agagaaacct aatattgaat
cgtttgaacc taaaaatata 1140gattcagaaa ttattcttcc tgaaaatgtt
gaaacagaag aaataataga tgatgtgcct 1200tcccctaaac attctaacca
tgaaacattt gaagaagaaa caagtgaatc tgaacatgaa 1260gaagccgtat
ctgaaaaaaa tgcccacgaa actgtcgaac atgaagaaac tgtgtctcaa
1320gaaagcaatc ctgaaaaagc tgataatgat ggaaatgtat ctcaaaacag
caacaacgaa 1380ttaaatgaaa atgaattcgt tgaatcggaa aaaagcgagc
atgaagcagg tggtagcggt 1440gcagaagcag gtattaccgg cacctggtat
aatcagcatg gtagcacctt taccgttacc 1500gcaggcgcag atggtaatct
gacaggtcag tatgaaaatc gtgcacaggg caccggttgt 1560cagaatagcc
cgtataccct gaccggtcgt tataatggca ccaaactgga atggcgtgtt
1620gaatggaata atagcaccga aaattgtcat agccgtaccg aatggcgtgg
tcagtatcag 1680ggtggtgcag aagcccgtat taatacccag tggaatctga
cctatgaagg tggtagtggt 1740ccggcaaccg aacagggtca ggataccttt
accaaagtga aataacatat g 1791332313DNAArtificial
sequenceConstructsmisc_feature(1)..(2313)HIS-GMZ2ggsmSA3
33ggatccacaa gtgagaatag aaataaacga atcgggggtc ctaaattaag gggtaatgtt
60acaagtaata taaagttccc atcagataac aaaggtaaaa ttataagagg ttcgaatgat
120aaacttaata aaaactctga agatgtttta gaacaaagcg aaaaatcgct
tgtttcagaa 180aatgttccta gtggattaga tatagatgat atccctaaag
aatctatttt tattcaagaa 240gatcaagaag gtcaaactca ttctgaatta
aatcctgaaa catcagaaca tagtaaagat 300ttaaataata atggttcaaa
aaatgaatct agtgatatta tttcagaaaa taataaatca 360aataaagtac
aaaatcattt tgaatcatta tcagatttag aattacttga aaattcctca
420caagataatt tagacaaaga tacaatttca acagaacctt ttcctaatca
aaaacataaa 480gacttacaac aagatttaaa tgatgaacct ttagaaccct
ttcctacaca aatacataaa 540gattataaag aaaaaaattt aataaatgaa
gaagattcag aaccatttcc cagacaaaag 600cataaaaagg tagacaatca
taatgaagaa aaaaacgtat ttcatgaaaa tggttctgca 660aatggtaatc
aaggaagttt gaaacttaaa tcattcgatg aacatttaaa agatgaaaaa
720atagaaaatg aaccacttgt tcatgaaaat ttatccatac caaatgatcc
aatagaacaa 780atattaaatc aacctgaaca agaaacaaat atccaggaac
aattgtataa tgaaaaacaa 840aatgttgaag aaaaacaaaa ttctcaaata
ccttcgttag atttaaaaga accaacaaat 900gaagatattt taccaaatca
taatccatta gaaaatataa aacaaagtga atcagaaata 960aatcatgtac
aagatcatgc gctaccaaaa gagaatataa tagacaaact tgataatcaa
1020aaagaacaca tcgatcaatc acaacataat ataaatgtat tacaagaaaa
taacataaac 1080aatcaccaat tagaacctca agagaaacct aatattgaat
cgtttgaacc taaaaatata 1140gattcagaaa ttattcttcc tgaaaatgtt
gaaacagaag aaataataga tgatgtgcct 1200tcccctaaac attctaacca
tgaaacattt gaagaagaaa caagtgaatc tgaacatgaa 1260gaagccgtat
ctgaaaaaaa tgcccacgaa actgtcgaac atgaagaaac tgtgtctcaa
1320gaaagcaatc ctgaaaaagc tgataatgat ggaaatgtat ctcaaaacag
caacaacgaa 1380ttaaatgaaa atgaattcgt tgaatcggaa aaaagcgagc
atgaagcaag atccaaagca 1440aaagaagctt ctagttatga ttatatttta
ggttgggaat ttggaggagg cgttccagaa 1500cacaaaaaag aagaaaatat
gttatcacat ttatatgttt cttcaaagga taaggaaaat 1560atatctaagg
aaaatgatga tgtattagat gagaaggaag aagaggcaga agaaacagaa
1620gaagaagaac ttgaagaaaa aaatgaagaa gaaacagaat cagaaataag
tgaagatgaa 1680gaagaagaag aagaagaaga agaaaaggaa gaagaaaatg
acaaaaaaaa agaacaagaa 1740aaagaacaaa gtaatgaaaa taatgatcaa
aaaaaagata tggaagcaca gaatttaatt 1800tctaaaaacc agaataataa
tgagaaaaac gtaaaagaag ctgctgaaag catcatgaaa 1860actttagctg
gtttaatcaa gggaaataat caaatagatt ctaccttaaa agatttagta
1920gaagaattat ccaaatattt taaaaatcat ggtggtagcg gtgcagaagc
aggtattacc 1980ggcacctggt ataatcagca tggtagcacc tttaccgtta
ccgcaggcgc agatggtaat 2040ctgacaggtc agtatgaaaa tcgtgcacag
ggcaccggtt gtcagaatag cccgtatacc 2100ctgaccggtc gttataatgg
caccaaactg gaatggcgtg ttgaatggaa taatagcacc 2160gaaaattgtc
atagccgtac cgaatggcgt ggtcagtatc agggtggtgc agaagcccgt
2220attaataccc agtggaatct gacctatgaa ggtggtagtg gtccggcaac
cgaacagggt 2280caggatacct ttaccaaagt gaaataacat atg
2313342082DNAArtificial
sequenceConstructsmisc_feature(1)..(2082)HIS-GMZ2TggsmSA DNA
34ggatccacaa gtgagaatag aaataaacga atcgggggtc ctaaattaag gggtaatgtt
60acaagtaata taaagttccc atcagataac aaaggtaaaa ttataagagg ttcgaatgat
120aaacttaata aaaactctga agatgtttta gaacaaagcg aaaaatcgct
tgtttcagaa 180aatgttccta gtggattaga tatagatgat atccctaaag
aatctatttt tattcaagaa 240gatcaagaag gtcaaactca ttctgaatta
aatcctgaaa catcagaaca tagtaaagat 300ttaaataata atggttcaaa
aaatgaatct agtgatatta tttcagaaaa taataaatca 360aataaagtac
aaaatcattt tgaatcatta tcagatttag aattacttga aaattcctca
420caagataatt tagacaaaga tacaatttca acagaacctt ttcctaatca
aaaacataaa 480gacttacaac aagatttaaa tgatgaacct ttagaaccct
ttcctacaca aatacataaa 540gattataaag aaaaaaattt aataaatgaa
gaagattcag aaccatttcc cagacaaaag 600cataaaaagg tagacaatca
taatgaagaa aaaaacgtat ttcatgaaaa tggttctgca 660aatggtaatc
aaggaagttt gaaacttaaa tcattcgatg aacatttaaa agatgaaaaa
720atagaaaatg aaccacttgt tcatgaaaat ttatccatac caaatgatcc
aatagaacaa 780atattaaatc aacctgaaca agaaacaaat atccaggaac
aattgtataa tgaaaaacaa 840aatgttgaag aaaaacaaaa ttctcaaata
ccttcgttag atttaaaaga accaacaaat 900gaagatattt taccaaatca
taatccatta gaaaatataa aacaaagtga atcagaaata 960aatcatgtac
aagatcatgc gctaccaaaa gagaatataa tagacaaact tgataatcaa
1020aaagaacaca
tcgatcaatc acaacataat ataaatgtat tacaagaaaa taacataaac
1080aatcaccaat tagaacctca agagaaacct aatattgaat cgtttgaacc
taaaaatata 1140gattcagaaa ttattcttcc tgaaaatgtt gaaacagaag
aaataataga tgatgtgcct 1200tcccctaaac attctaacca tgaaacattt
gaagaagaaa caagtgaatc tgaacatgaa 1260gaagccgtat ctgaaaaaaa
tgcccacgaa actgtcgaac atgaagaaac tgtgtctcaa 1320gaaagcaatc
ctgaaaaagc tgataatgat ggaaatgtat ctcaaaacag caacaacgaa
1380ttaaatgaaa atgaattcgt tgaatcggaa aaaagcgagc atgaagcaag
atccaaaaca 1440aaagaatatg ctgaaaaagc aaaaaatgct tatgaaaagg
caaaaaatgc ttatcaaaaa 1500gcaaaccaag ctgttttaaa agcaaaagaa
gcttctagtt atgattatat tttaggttgg 1560gaatttggag gaggcgttcc
agaacacaaa aaagaagaaa atatgttatc acatttatat 1620gtttcttcaa
aggataagga aaatatatct aaggaaaatg atgatgtatt agatgagaag
1680gaagaagagg cagaagaaac agaagaagaa gaacttgaag gtggtagcgg
tgcagaagca 1740ggtattaccg gcacctggta taatcagcat ggtagcacct
ttaccgttac cgcaggcgca 1800gatggtaatc tgacaggtca gtatgaaaat
cgtgcacagg gcaccggttg tcagaatagc 1860ccgtataccc tgaccggtcg
ttataatggc accaaactgg aatggcgtgt tgaatggaat 1920aatagcaccg
aaaattgtca tagccgtacc gaatggcgtg gtcagtatca gggtggtgca
1980gaagcccgta ttaataccca gtggaatctg acctatgaag gtggtagtgg
tccggcaacc 2040gaacagggtc aggatacctt taccaaagtg aaataacata tg
2082351890DNAArtificial
sequenceConstructsmisc_feature(1)..(1890)mSA-PfRH5-HIS DNA
35gaattcggtg cagaagcagg tattaccggc acctggtata atcagcatgg tagcaccttt
60accgttaccg caggcgcaga tggtaatctg acaggtcagt atgaaaatcg tgcacagggc
120accggttgtc agaatagccc gtataccctg accggtcgtt ataatggcac
caaactggaa 180tggcgtgttg aatggaataa tagcaccgaa aattgtcata
gccgtaccga atggcgtggt 240cagtatcagg gtggtgcaga agcccgtatt
aatacccagt ggaatctgac ctatgaaggt 300ggtagcggtc cggcaaccga
acagggtcag gataccttta ccaaagttaa aggtggcagc 360ctgtccttcg
agaacgccat caagaagacc aagaaccagg aaaacaacct gaccctgctg
420cccatcaagt ccaccgagga agagaaggac gacatcaaga acggcaagga
tatcaagaag 480gaaatcgaca acgacaagga aaacatcaag accaacaacg
ccaaggacca ctccacctac 540atcaagtctt acctgaacac caacgtgaac
gacggcctga agtacctgtt catcccatcc 600cacaacagct tcatcaagaa
gtactccgtt ttcaaccaga tcaacgacgg catgctgctg 660aacgagaaga
acgacgtgaa gaacaacgag gactacaaga acgtcgacta caagaacgtg
720aacttcctgc agtaccactt caaggaactg tccaactaca acatcgccaa
ctccatcgac 780atcctgcaag aaaaggaagg ccacctggac ttcgtgatca
tcccccacta cactttcttg 840gactactaca agcacctgtc ctacaacagc
atctaccaca agtacagcac ctacggcaag 900tacatcgctg tggacgcttt
catcaagaag atcaacgaga cttacgacaa agtgaagtcc 960aagtgtaacg
atatcaagaa cgacctgatc gccaccatca agaagctcga gcacccctac
1020gacatcaaca acaagaacga cgacagctac cgctacgaca tctccgaaga
gatcgacgac 1080aagtccgagg aaaccgacga cgagactgag gaagtcgagg
actccatcca ggacaccgac 1140tccaaccaca ccccctccaa caagaagaag
aacgatctga tgaaccgcac cttcaagaag 1200atgatggacg agtacaacac
taagaagaag aagctgatca agtgcatcaa gaaccacgag 1260aacgacttca
acaagatctg catggacatg aagaactacg gcaccaacct gttcgagcag
1320ctgtcctgct acaacaacaa cttctgcaac actaacggca tccgcttcca
ctacgatgag 1380tacatccaca agctgatcct gtccgtcaag agcaagaacc
tgaacaagga cctgagcgac 1440atgaccaaca tcctccagca gtccgagctg
ctgctgacca acttgaacaa gaagatgggc 1500tcctacatct acatcgacac
tatcaagttc atccacaagg aaatgaagca catcttcaac 1560cgcatcgagt
accacaccaa gatcatcaac gataagacta agatcatcca agacaagatc
1620aagctgaaca tctggcgcac tttccaaaag gacgaactgc tgaagcgtat
cctggacatg 1680tctaacgagt actccctctt catcacctcc gaccacctga
ggcagatgct gtacaacacc 1740ttctactcca aggaaaagca cctcaacaac
atcttccacc acctgatcta cgtgctgcag 1800atgaagttca acgacgtccc
catcaagatg gaatacttcc agacctacaa gaagaacaag 1860cccctgaccc
agcatcatca ccaccaccac 18903615PRTArtificial
sequenceConstructsBINDING(1)..(15)biotin acceptor site 36Gly Leu
Asn Asp Ile Phe Glu Ala Gln Lys Ile Glu Trp His Glu 1 5 10 15
37114PRTArtificial sequenceConstructsPEPTIDE(1)..(114)Monovalent
streptaviding 37Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His
Gly Ser Thr 1 5 10 15 Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu
Thr Gly Gln Tyr Glu 20 25 30 Asn Arg Ala Gln Gly Thr Gly Cys Gln
Asn Ser Pro Tyr Thr Leu Thr 35 40 45 Gly Arg Tyr Asn Gly Thr Lys
Leu Glu Trp Arg Val Glu Trp Asn Asn 50 55 60 Ser Thr Glu Asn Cys
His Ser Arg Thr Glu Trp Arg Gly Gln Tyr Gln 65 70 75 80 Gly Gly Ala
Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr Tyr Glu 85 90 95 Gly
Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr Lys 100 105
110 Val Lys 38321PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(321)BirA OS=Escherichia coli
(strain K12) GN=birA PE=1 SV=1 38Met Lys Asp Asn Thr Val Pro Leu
Lys Leu Ile Ala Leu Leu Ala Asn 1 5 10 15 Gly Glu Phe His Ser Gly
Glu Gln Leu Gly Glu Thr Leu Gly Met Ser 20 25 30 Arg Ala Ala Ile
Asn Lys His Ile Gln Thr Leu Arg Asp Trp Gly Val 35 40 45 Asp Val
Phe Thr Val Pro Gly Lys Gly Tyr Ser Leu Pro Glu Pro Ile 50 55 60
Gln Leu Leu Asn Ala Lys Gln Ile Leu Gly Gln Leu Asp Gly Gly Ser 65
70 75 80 Val Ala Val Leu Pro Val Ile Asp Ser Thr Asn Gln Tyr Leu
Leu Asp 85 90 95 Arg Ile Gly Glu Leu Lys Ser Gly Asp Ala Cys Ile
Ala Glu Tyr Gln 100 105 110 Gln Ala Gly Arg Gly Arg Arg Gly Arg Lys
Trp Phe Ser Pro Phe Gly 115 120 125 Ala Asn Leu Tyr Leu Ser Met Phe
Trp Arg Leu Glu Gln Gly Pro Ala 130 135 140 Ala Ala Ile Gly Leu Ser
Leu Val Ile Gly Ile Val Met Ala Glu Val 145 150 155 160 Leu Arg Lys
Leu Gly Ala Asp Lys Val Arg Val Lys Trp Pro Asn Asp 165 170 175 Leu
Tyr Leu Gln Asp Arg Lys Leu Ala Gly Ile Leu Val Glu Leu Thr 180 185
190 Gly Lys Thr Gly Asp Ala Ala Gln Ile Val Ile Gly Ala Gly Ile Asn
195 200 205 Met Ala Met Arg Arg Val Glu Glu Ser Val Val Asn Gln Gly
Trp Ile 210 215 220 Thr Leu Gln Glu Ala Gly Ile Asn Leu Asp Arg Asn
Thr Leu Ala Ala 225 230 235 240 Met Leu Ile Arg Glu Leu Arg Ala Ala
Leu Glu Leu Phe Glu Gln Glu 245 250 255 Gly Leu Ala Pro Tyr Leu Ser
Arg Trp Glu Lys Leu Asp Asn Phe Ile 260 265 270 Asn Arg Pro Val Lys
Leu Ile Ile Gly Asp Lys Glu Ile Phe Gly Ile 275 280 285 Ser Arg Gly
Ile Asp Lys Gln Gly Ala Leu Leu Leu Glu Gln Asp Gly 290 295 300 Ile
Ile Lys Pro Trp Met Gly Gly Glu Ile Ser Leu Arg Ser Ala Glu 305 310
315 320 Lys 3945DNAArtificial
sequenceConstructsmisc_feature(1)..(45)DNA sequence of the biotin
binding site 39ggtctgaacg acatcttcga ggctcagaaa atcgaatggc acgaa
4540260PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(260)SurvivinmSA (Homo Sapiens)
40Met Gly Ala Pro Thr Leu Pro Pro Ala Trp Gln Pro Phe Leu Lys Asp 1
5 10 15 His Arg Ile Ser Thr Phe Lys Asn Trp Pro Phe Leu Glu Gly Cys
Ala 20 25 30 Cys Thr Pro Glu Arg Met Ala Glu Ala Gly Phe Ile His
Cys Pro Thr 35 40 45 Glu Asn Glu Pro Asp Leu Ala Gln Cys Phe Phe
Cys Phe Lys Glu Leu 50 55 60 Glu Gly Trp Glu Pro Asp Asp Asp Pro
Ile Glu Glu His Lys Lys His 65 70 75 80 Ser Ser Gly Cys Ala Phe Leu
Ser Val Lys Lys Gln Phe Glu Glu Leu 85 90 95 Thr Leu Gly Glu Phe
Leu Lys Leu Asp Arg Glu Arg Ala Lys Asn Lys 100 105 110 Ile Ala Lys
Glu Thr Asn Asn Lys Lys Lys Glu Phe Glu Glu Thr Ala 115 120 125 Lys
Lys Val Arg Arg Ala Ile Glu Gln Leu Ala Ala Met Asp Gly Gly 130 135
140 Ser Gly Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly
145 150 155 160 Ser Thr Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu
Thr Gly Gln 165 170 175 Tyr Glu Asn Arg Ala Gln Gly Thr Gly Cys Gln
Asn Ser Pro Tyr Thr 180 185 190 Leu Thr Gly Arg Tyr Asn Gly Thr Lys
Leu Glu Trp Arg Val Glu Trp 195 200 205 Asn Asn Ser Thr Glu Asn Cys
His Ser Arg Thr Glu Trp Arg Gly Gln 210 215 220 Tyr Gln Gly Gly Ala
Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr 225 230 235 240 Tyr Glu
Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe 245 250 255
Thr Lys Val Lys 260 41259PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(259)mSASurvivin (Homo Sapiens)
41Met Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser 1
5 10 15 Thr Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln
Tyr 20 25 30 Glu Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro
Tyr Thr Leu 35 40 45 Thr Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp
Arg Val Glu Trp Asn 50 55 60 Asn Ser Thr Glu Asn Cys His Ser Arg
Thr Glu Trp Arg Gly Gln Tyr 65 70 75 80 Gln Gly Gly Ala Glu Ala Arg
Ile Asn Thr Gln Trp Asn Leu Thr Tyr 85 90 95 Glu Gly Gly Ser Gly
Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr 100 105 110 Lys Val Lys
Gly Gly Ser Gly Ala Pro Thr Leu Pro Pro Ala Trp Gln 115 120 125 Pro
Phe Leu Lys Asp His Arg Ile Ser Thr Phe Lys Asn Trp Pro Phe 130 135
140 Leu Glu Gly Cys Ala Cys Thr Pro Glu Arg Met Ala Glu Ala Gly Phe
145 150 155 160 Ile His Cys Pro Thr Glu Asn Glu Pro Asp Leu Ala Gln
Cys Phe Phe 165 170 175 Cys Phe Lys Glu Leu Glu Gly Trp Glu Pro Asp
Asp Asp Pro Ile Glu 180 185 190 Glu His Lys Lys His Ser Ser Gly Cys
Ala Phe Leu Ser Val Lys Lys 195 200 205 Gln Phe Glu Glu Leu Thr Leu
Gly Glu Phe Leu Lys Leu Asp Arg Glu 210 215 220 Arg Ala Lys Asn Lys
Ile Ala Lys Glu Thr Asn Asn Lys Lys Lys Glu 225 230 235 240 Phe Glu
Glu Thr Ala Lys Lys Val Arg Arg Ala Ile Glu Gln Leu Ala 245 250 255
Ala Met Asp 42260PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(260)Survivin(F101A/L102A)mSA
(Homo Sapiens) 42Met Gly Ala Pro Thr Leu Pro Pro Ala Trp Gln Pro
Phe Leu Lys Asp 1 5 10 15 His Arg Ile Ser Thr Phe Lys Asn Trp Pro
Phe Leu Glu Gly Cys Ala 20 25 30 Cys Thr Pro Glu Arg Met Ala Glu
Ala Gly Phe Ile His Cys Pro Thr 35 40 45 Glu Asn Glu Pro Asp Leu
Ala Gln Cys Phe Phe Cys Phe Lys Glu Leu 50 55 60 Glu Gly Trp Glu
Pro Asp Asp Asp Pro Ile Glu Glu His Lys Lys His 65 70 75 80 Ser Ser
Gly Cys Ala Phe Leu Ser Val Lys Lys Gln Phe Glu Glu Leu 85 90 95
Thr Leu Gly Glu Ala Ala Lys Leu Asp Arg Glu Arg Ala Lys Asn Lys 100
105 110 Ile Ala Lys Glu Thr Asn Asn Lys Lys Lys Glu Phe Glu Glu Thr
Ala 115 120 125 Lys Lys Val Arg Arg Ala Ile Glu Gln Leu Ala Ala Met
Asp Gly Gly 130 135 140 Ser Gly Ala Glu Ala Gly Ile Thr Gly Thr Trp
Tyr Asn Gln His Gly 145 150 155 160 Ser Thr Phe Thr Val Thr Ala Gly
Ala Asp Gly Asn Leu Thr Gly Gln 165 170 175 Tyr Glu Asn Arg Ala Gln
Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr 180 185 190 Leu Thr Gly Arg
Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp 195 200 205 Asn Asn
Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln 210 215 220
Tyr Gln Gly Gly Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr 225
230 235 240 Tyr Glu Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp
Thr Phe 245 250 255 Thr Lys Val Lys 260 43259PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(259)mSASurvivin(F101A/L102A)
(Homo Sapiens) 43Met Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn
Gln His Gly Ser 1 5 10 15 Thr Phe Thr Val Thr Ala Gly Ala Asp Gly
Asn Leu Thr Gly Gln Tyr 20 25 30 Glu Asn Arg Ala Gln Gly Thr Gly
Cys Gln Asn Ser Pro Tyr Thr Leu 35 40 45 Thr Gly Arg Tyr Asn Gly
Thr Lys Leu Glu Trp Arg Val Glu Trp Asn 50 55 60 Asn Ser Thr Glu
Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln Tyr 65 70 75 80 Gln Gly
Gly Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr Tyr 85 90 95
Glu Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr 100
105 110 Lys Val Lys Gly Gly Ser Gly Ala Pro Thr Leu Pro Pro Ala Trp
Gln 115 120 125 Pro Phe Leu Lys Asp His Arg Ile Ser Thr Phe Lys Asn
Trp Pro Phe 130 135 140 Leu Glu Gly Cys Ala Cys Thr Pro Glu Arg Met
Ala Glu Ala Gly Phe 145 150 155 160 Ile His Cys Pro Thr Glu Asn Glu
Pro Asp Leu Ala Gln Cys Phe Phe 165 170 175 Cys Phe Lys Glu Leu Glu
Gly Trp Glu Pro Asp Asp Asp Pro Ile Glu 180 185 190 Glu His Lys Lys
His Ser Ser Gly Cys Ala Phe Leu Ser Val Lys Lys 195 200 205 Gln Phe
Glu Glu Leu Thr Leu Gly Glu Ala Ala Lys Leu Asp Arg Glu 210 215 220
Arg Ala Lys Asn Lys Ile Ala Lys Glu Thr Asn Asn Lys Lys Lys Glu 225
230 235 240 Phe Glu Glu Thr Ala Lys Lys Val Arg Arg Ala Ile Glu Gln
Leu Ala 245 250 255 Ala Met Asp 44261PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(261)mSASurvivin(F101A/L102A)
(Mus Musculus) 44Met Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn
Gln His Gly Ser 1 5 10 15 Thr Phe Thr Val Thr Ala Gly Ala Asp Gly
Asn Leu Thr Gly Gln Tyr 20 25 30 Glu Asn Arg Ala Gln Gly Thr Gly
Cys Gln Asn Ser Pro Tyr Thr Leu 35 40 45 Thr Gly Arg Tyr Asn Gly
Thr Lys Leu Glu Trp Arg Val Glu Trp Asn 50 55 60 Asn Ser Thr Glu
Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln Tyr 65 70 75 80 Gln Gly
Gly Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr Tyr 85 90 95
Glu Gly Gly Ser Gly Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr 100
105 110 Lys Val Lys Gly Gly Ser Gly Ala Pro Ala Leu Pro Gln Ile Trp
Gln 115 120 125 Leu Tyr Leu Lys Asn Tyr Arg Ile Ala Thr Phe Lys Asn
Trp Pro Phe 130 135 140 Leu Glu Asp Cys Ala Cys Thr Pro Glu Arg Met
Ala Glu Ala Gly Phe 145 150 155 160 Ile His Cys Pro Thr Glu Asn Glu
Pro Asp Leu Ala Gln Cys Phe Phe 165 170 175 Cys Phe Lys Glu Leu Glu
Gly Trp Glu Pro Asp Asp Asn Pro Ile Glu 180 185 190 Glu His Arg Lys
His Ser Pro Gly Cys Ala Phe Leu Thr Val Lys
Lys 195 200 205 Gln Met Glu Glu Leu Thr Val Ser Glu Ala Ala Lys Leu
Asp Arg Gln 210 215 220 Arg Ala Lys Asn Lys Ile Ala Lys Glu Thr Asn
Asn Lys Gln Lys Glu 225 230 235 240 Phe Glu Glu Thr Ala Lys Thr Thr
Arg Gln Ser Ile Glu Gln Leu Ala 245 250 255 Ala Ser Gly Arg Phe 260
45256PRTArtificial sequenceConstructsMISC_FEATURE(1)..(256)Survivin
(F101A/L102A)mSA (Mus Musculus) 45Gly Ala Pro Ala Leu Pro Gln Ile
Trp Gln Leu Tyr Leu Lys Asn Tyr 1 5 10 15 Arg Ile Ala Thr Phe Lys
Asn Trp Pro Phe Leu Glu Asp Cys Ala Cys 20 25 30 Thr Pro Glu Arg
Met Ala Glu Ala Gly Phe Ile His Cys Pro Thr Glu 35 40 45 Asn Glu
Pro Asp Leu Ala Gln Cys Phe Phe Cys Phe Lys Glu Leu Glu 50 55 60
Gly Trp Glu Pro Asp Asp Asn Pro Ile Glu Glu His Arg Lys His Ser 65
70 75 80 Pro Gly Cys Ala Phe Leu Thr Val Lys Lys Gln Met Glu Glu
Leu Thr 85 90 95 Val Ser Glu Ala Ala Lys Leu Asp Arg Gln Arg Ala
Lys Asn Lys Ile 100 105 110 Ala Lys Glu Thr Asn Asn Lys Gln Lys Glu
Phe Glu Glu Thr Ala Lys 115 120 125 Thr Thr Arg Gln Ser Ile Glu Gln
Leu Ala Ala Gly Gly Ser Ala Glu 130 135 140 Ala Gly Ile Thr Gly Thr
Trp Tyr Asn Gln His Gly Ser Thr Phe Thr 145 150 155 160 Val Thr Ala
Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr Glu Asn Arg 165 170 175 Ala
Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu Thr Gly Arg 180 185
190 Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu Trp Asn Asn Ser Thr
195 200 205 Glu Asn Cys His Ser Arg Thr Glu Trp Arg Gly Gln Tyr Gln
Gly Gly 210 215 220 Ala Glu Ala Arg Ile Asn Thr Gln Trp Asn Leu Thr
Tyr Glu Gly Gly 225 230 235 240 Ser Gly Pro Ala Thr Glu Gln Gly Gln
Asp Thr Phe Thr Lys Val Lys 245 250 255 46261PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(261)mSASurvivin (Mus Musculus)
46Met Ala Glu Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser 1
5 10 15 Thr Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln
Tyr 20 25 30 Glu Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro
Tyr Thr Leu 35 40 45 Thr Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp
Arg Val Glu Trp Asn 50 55 60 Asn Ser Thr Glu Asn Cys His Ser Arg
Thr Glu Trp Arg Gly Gln Tyr 65 70 75 80 Gln Gly Gly Ala Glu Ala Arg
Ile Asn Thr Gln Trp Asn Leu Thr Tyr 85 90 95 Glu Gly Gly Ser Gly
Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr 100 105 110 Lys Val Lys
Gly Gly Ser Gly Ala Pro Ala Leu Pro Gln Ile Trp Gln 115 120 125 Leu
Tyr Leu Lys Asn Tyr Arg Ile Ala Thr Phe Lys Asn Trp Pro Phe 130 135
140 Leu Glu Asp Cys Ala Cys Thr Pro Glu Arg Met Ala Glu Ala Gly Phe
145 150 155 160 Ile His Cys Pro Thr Glu Asn Glu Pro Asp Leu Ala Gln
Cys Phe Phe 165 170 175 Cys Phe Lys Glu Leu Glu Gly Trp Glu Pro Asp
Asp Asn Pro Ile Glu 180 185 190 Glu His Arg Lys His Ser Pro Gly Cys
Ala Phe Leu Thr Val Lys Lys 195 200 205 Gln Met Glu Glu Leu Thr Val
Ser Glu Phe Leu Lys Leu Asp Arg Gln 210 215 220 Arg Ala Lys Asn Lys
Ile Ala Lys Glu Thr Asn Asn Lys Gln Lys Glu 225 230 235 240 Phe Glu
Glu Thr Ala Lys Thr Thr Arg Gln Ser Ile Glu Gln Leu Ala 245 250 255
Ala Ser Gly Arg Phe 260 47256PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(256)SurvivinmSA (Mus Musculus)
47Gly Ala Pro Ala Leu Pro Gln Ile Trp Gln Leu Tyr Leu Lys Asn Tyr 1
5 10 15 Arg Ile Ala Thr Phe Lys Asn Trp Pro Phe Leu Glu Asp Cys Ala
Cys 20 25 30 Thr Pro Glu Arg Met Ala Glu Ala Gly Phe Ile His Cys
Pro Thr Glu 35 40 45 Asn Glu Pro Asp Leu Ala Gln Cys Phe Phe Cys
Phe Lys Glu Leu Glu 50 55 60 Gly Trp Glu Pro Asp Asp Asn Pro Ile
Glu Glu His Arg Lys His Ser 65 70 75 80 Pro Gly Cys Ala Phe Leu Thr
Val Lys Lys Gln Met Glu Glu Leu Thr 85 90 95 Val Ser Glu Phe Leu
Lys Leu Asp Arg Gln Arg Ala Lys Asn Lys Ile 100 105 110 Ala Lys Glu
Thr Asn Asn Lys Gln Lys Glu Phe Glu Glu Thr Ala Lys 115 120 125 Thr
Thr Arg Gln Ser Ile Glu Gln Leu Ala Ala Gly Gly Ser Ala Glu 130 135
140 Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser Thr Phe Thr
145 150 155 160 Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr
Glu Asn Arg 165 170 175 Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr
Thr Leu Thr Gly Arg 180 185 190 Tyr Asn Gly Thr Lys Leu Glu Trp Arg
Val Glu Trp Asn Asn Ser Thr 195 200 205 Glu Asn Cys His Ser Arg Thr
Glu Trp Arg Gly Gln Tyr Gln Gly Gly 210 215 220 Ala Glu Ala Arg Ile
Asn Thr Gln Trp Asn Leu Thr Tyr Glu Gly Gly 225 230 235 240 Ser Gly
Pro Ala Thr Glu Gln Gly Gln Asp Thr Phe Thr Lys Val Lys 245 250 255
48783DNAArtificial
sequenceConstructsmisc_feature(1)..(783)mSASurvivin(F101A/L102A)
(Mus Musculus) DNA 48atggcagaag caggtattac cggcacctgg tataatcagc
atggtagcac ctttaccgtt 60accgcaggcg cagatggtaa tctgacaggt cagtatgaaa
atcgtgcaca gggcaccggt 120tgtcagaata gcccgtatac cctgaccggt
cgttataatg gcaccaaact ggaatggcgt 180gttgaatgga ataatagcac
cgaaaattgt catagccgta ccgaatggcg tggtcagtat 240cagggtggtg
cagaagcccg tattaatacc cagtggaatc tgacctatga aggtggtagc
300ggtccggcaa ccgaacaggg tcaggatacc tttaccaaag ttaaaggtgg
cagcggtgca 360ccggcactgc cgcagatttg gcagctgtat ctgaaaaact
atcgtatcgc cacctttaaa 420aactggccgt ttctggaaga ttgtgcatgt
acaccggaac gtatggcaga agcaggtttt 480attcattgtc cgaccgaaaa
tgaaccggat ctggcacagt gttttttttg ctttaaagaa 540ctggaaggtt
gggagccgga tgataatccg attgaagaac atcgtaaaca tagtccgggt
600tgtgcatttc tgaccgtgaa aaaacaaatg gaagaactga ccgttagcga
ggcagcaaaa 660ctggatcgtc agcgtgccaa aaacaaaatt gcaaaagaaa
ccaataacaa acagaaagaa 720ttcgaagaaa ccgccaaaac cacccgtcag
agcattgaac agctggcagc aagcggccgc 780ttt 78349768DNAArtificial
sequenceConstructsmisc_feature(1)..(768)Survivin (F101A/L102A)mSA
(Mus Musculus) DNA 49ggtgcaccgg cactgccgca gatttggcag ctgtatctga
aaaactatcg tatcgccacc 60tttaaaaact ggccgtttct ggaagattgt gcatgtacac
cggaacgtat ggcagaagca 120ggttttattc attgtccgac cgaaaatgaa
ccggatctgg cacagtgttt tttttgcttt 180aaagaactgg aaggttggga
gccggatgat aatccgattg aagaacatcg taaacatagt 240ccgggttgtg
catttctgac cgtgaaaaaa caaatggaag aactgaccgt tagcgaggca
300gcaaaactgg atcgtcagcg tgccaaaaac aaaattgcaa aagaaaccaa
taacaaacag 360aaagaattcg aagaaaccgc caaaaccacc cgtcagagca
ttgaacagct ggcagcaggt 420ggcagcgcag aagcaggtat taccggcacc
tggtataatc agcatggtag cacctttacc 480gttaccgcag gcgcagatgg
taatctgaca ggtcagtatg aaaatcgtgc acagggcacc 540ggttgtcaga
atagcccgta taccctgacc ggtcgttata atggcaccaa actggaatgg
600cgtgttgaat ggaataatag caccgaaaat tgtcatagcc gtaccgaatg
gcgtggtcag 660tatcagggtg gtgcagaagc ccgtattaat acccagtgga
atctgaccta tgaaggtggt 720agcggtccgg caaccgaaca gggtcaggat
acctttacca aagttaaa 76850783DNAArtificial
sequenceConstructsmisc_feature(1)..(783)mSASurvivin (Mus Musculus)
DNA 50atggcagaag caggtattac cggcacctgg tataatcagc atggtagcac
ctttaccgtt 60accgcaggcg cagatggtaa tctgacaggt cagtatgaaa atcgtgcaca
gggcaccggt 120tgtcagaata gcccgtatac cctgaccggt cgttataatg
gcaccaaact ggaatggcgt 180gttgaatgga ataatagcac cgaaaattgt
catagccgta ccgaatggcg tggtcagtat 240cagggtggtg cagaagcccg
tattaatacc cagtggaatc tgacctatga aggtggtagc 300ggtccggcaa
ccgaacaggg tcaggatacc tttaccaaag ttaaaggtgg cagcggtgca
360ccggcactgc cgcagatttg gcagctgtat ctgaaaaact atcgtatcgc
cacctttaaa 420aactggccgt ttctggaaga ttgtgcatgt acaccggaac
gtatggcaga agcaggtttt 480attcattgtc cgaccgaaaa tgaaccggat
ctggcacagt gttttttttg ctttaaagaa 540ctggaaggtt gggagccgga
tgataatccg attgaagaac atcgtaaaca tagtccgggt 600tgtgcatttc
tgaccgtgaa aaaacaaatg gaagaactga ccgttagcga gtttctgaaa
660ctggatcgtc agcgtgccaa aaacaaaatt gcaaaagaaa ccaataacaa
acagaaagaa 720ttcgaagaaa ccgccaaaac cacccgtcag agcattgaac
agctggcagc aagcggccgc 780ttt 78351768DNAArtificial
sequenceConstructsmisc_feature(1)..(768)SurvivinmSA (Mus Musculus)
DNA 51ggtgcaccgg cactgccgca gatttggcag ctgtatctga aaaactatcg
tatcgccacc 60tttaaaaact ggccgtttct ggaagattgt gcatgtacac cggaacgtat
ggcagaagca 120ggttttattc attgtccgac cgaaaatgaa ccggatctgg
cacagtgttt tttttgcttt 180aaagaactgg aaggttggga gccggatgat
aatccgattg aagaacatcg taaacatagt 240ccgggttgtg catttctgac
cgtgaaaaaa caaatggaag aactgaccgt tagcgagttt 300ctgaaactgg
atcgtcagcg tgccaaaaac aaaattgcaa aagaaaccaa taacaaacag
360aaagaattcg aagaaaccgc caaaaccacc cgtcagagca ttgaacagct
ggcagcaggt 420ggcagcgcag aagcaggtat taccggcacc tggtataatc
agcatggtag cacctttacc 480gttaccgcag gcgcagatgg taatctgaca
ggtcagtatg aaaatcgtgc acagggcacc 540ggttgtcaga atagcccgta
taccctgacc ggtcgttata atggcaccaa actggaatgg 600cgtgttgaat
ggaataatag caccgaaaat tgtcatagcc gtaccgaatg gcgtggtcag
660tatcagggtg gtgcagaagc ccgtattaat acccagtgga atctgaccta
tgaaggtggt 720agcggtccgg caaccgaaca gggtcaggat acctttacca aagttaaa
76852268PRTArtificial
sequenceConstructsMISC_FEATURE(1)..(268)mSACIDR1a-HIS 52Gly Ala Glu
Ala Gly Ile Thr Gly Thr Trp Tyr Asn Gln His Gly Ser 1 5 10 15 Thr
Phe Thr Val Thr Ala Gly Ala Asp Gly Asn Leu Thr Gly Gln Tyr 20 25
30 Glu Asn Arg Ala Gln Gly Thr Gly Cys Gln Asn Ser Pro Tyr Thr Leu
35 40 45 Thr Gly Arg Tyr Asn Gly Thr Lys Leu Glu Trp Arg Val Glu
Trp Asn 50 55 60 Asn Ser Thr Glu Asn Cys His Ser Arg Thr Glu Trp
Arg Gly Gln Tyr 65 70 75 80 Gln Gly Gly Ala Glu Ala Arg Ile Asn Thr
Gln Trp Asn Leu Thr Tyr 85 90 95 Glu Gly Gly Ser Gly Pro Ala Thr
Glu Gln Gly Gln Asp Thr Phe Thr 100 105 110 Lys Val Lys Gly Gly Ser
Lys Ile Thr Ser Phe Asp Glu Phe Phe Asp 115 120 125 Phe Trp Val Arg
Lys Leu Leu Ile Asp Thr Ile Lys Trp Glu Thr Glu 130 135 140 Leu Thr
Tyr Cys Ile Asn Asn Thr Asp Val Thr Asp Cys Asn Lys Cys 145 150 155
160 Asn Lys Asn Cys Val Cys Phe Asp Lys Trp Val Lys Gln Lys Glu Asp
165 170 175 Glu Trp Thr Asn Ile Met Lys Leu Phe Thr Asn Lys His Asp
Ile Pro 180 185 190 Lys Lys Tyr Tyr Leu Asn Ile Asn Asp Leu Phe Asp
Ser Phe Phe Phe 195 200 205 Gln Val Ile Tyr Lys Phe Asn Glu Gly Glu
Ala Lys Trp Asn Glu Leu 210 215 220 Lys Glu Asn Leu Lys Lys Gln Ile
Ala Ser Ser Lys Ala Asn Asn Gly 225 230 235 240 Thr Lys Asp Ser Glu
Ala Ala Ile Lys Val Leu Phe Asn His Ile Lys 245