U.S. patent application number 16/588209 was filed with the patent office on 2020-05-14 for isoxazole carboxamide compounds.
The applicant listed for this patent is EPIZYME, INC.. Invention is credited to Megan Alene Cloonan Foley, Darren Martin HARVEY, Kevin Wayne KUNTZ, James Edward John MILLS, Lorna Helen MITCHELL, Michael John MUNCHHOF.
Application Number | 20200148650 16/588209 |
Document ID | / |
Family ID | 55459522 |
Filed Date | 2020-05-14 |
View All Diagrams
United States Patent
Application |
20200148650 |
Kind Code |
A1 |
Foley; Megan Alene Cloonan ;
et al. |
May 14, 2020 |
ISOXAZOLE CARBOXAMIDE COMPOUNDS
Abstract
The present disclosure provides substituted isoxazole
carboxamide compounds having Formula (1) and the pharmaceutically
acceptable salts and solvates thereof, wherein R.sup.1, R.sup.2, A,
X, and Z are defined as set forth in the specification. The present
disclosure is also directed to the use of compounds of Formula I to
treat a disorder responsive to the blockade of SMYD proteins such
as SMYD3 or SMYD2 Compounds of the present disclosure are
especially useful for treating cancer. ##STR00001##
Inventors: |
Foley; Megan Alene Cloonan;
(Somerville, MA) ; KUNTZ; Kevin Wayne; (Woburn,
MA) ; MILLS; James Edward John; (Kent, GB) ;
MITCHELL; Lorna Helen; (Cambridge, MA) ; MUNCHHOF;
Michael John; (Salem, CT) ; HARVEY; Darren
Martin; (Acton, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
EPIZYME, INC. |
Cambridge |
MA |
US |
|
|
Family ID: |
55459522 |
Appl. No.: |
16/588209 |
Filed: |
September 30, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15510593 |
Mar 10, 2017 |
10428029 |
|
|
PCT/US2015/049213 |
Sep 9, 2015 |
|
|
|
16588209 |
|
|
|
|
62048759 |
Sep 10, 2014 |
|
|
|
62146794 |
Apr 13, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07D 413/14 20130101;
A61P 35/00 20180101; C07D 413/12 20130101; C07D 261/18
20130101 |
International
Class: |
C07D 261/18 20060101
C07D261/18; C07D 413/14 20060101 C07D413/14; C07D 413/12 20060101
C07D413/12 |
Claims
1. A compound having Formula I: ##STR00554## or a pharmaceutically
acceptable salt or hydrate thereof, wherein: R.sup.1 is selected
from the group consisting of hydrogen, C.sub.1-6 alkyl, C.sub.1-4
alkenyl, C.sub.1-4 haloalkyl, C.sub.3-6 cycloalkyl, and
hydroxyalkyl; R.sup.2 is selected from the group consisting of
hydrogen, halo, and carboxamido; A is selected from the group
consisting of C.sub.1-10 alkylenyl, (cycloalkylenyl)alkyl,
optionally substituted C.sub.3-12 cycloalkylenyl, optionally
substituted C.sub.6-14 arylenyl, optionally substituted 5- to
14-membered heteroarylenyl, and --C(H)R.sup.3R.sup.4; with the
provisos: a) when R.sup.1 is ethyl or cyclopropyl; R.sup.2 is
hydrogen; and X is
--N(R.sup.7)S(.dbd.O).sub.2--N(R.sup.7)C(.dbd.O)--, or
--N(R.sup.7)C(.dbd.O)C(R.sup.8)(H)--, then A is not optionally
substituted 1,4-cyclohexylenyl; and b) when R.sup.1 is ethyl or
cyclopropyl; R.sup.2 is hydrogen; X is absent; and Z is amino,
alkylamino, dialkylamino, or heterocycloamino, then A is not
optionally substituted 1,4-cyclohexylenyl; R.sup.3 is selected from
the group consisting of hydrogen, C.sub.1-6 alkyl,
(hydroxy)(aryl)alkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, hydroxyalkyl, alkoxyalkyl, aryloxyalkyl,
optionally substituted C.sub.3-12 cycloalkyl, optionally
substituted 4- to 14-membered heterocyclo, optionally substituted
C.sub.6-14 aryl, aralkyl, alkoxycarbonyl, and
--C(.dbd.O)N(R.sup.5)(R.sup.6); R.sup.4 is selected from the group
consisting of C.sub.1-6 alkyl, hydroxyalkyl, optionally substituted
C.sub.3-12 cycloalkyl, optionally substituted C.sub.6-14 aryl,
optionally substituted 5- to 14-membered heteroaryl, optionally
substituted 4- to 14-membered heterocyclo, and (heteroaryl)alkyl;
R.sup.5 is selected from the from the group consisting of hydrogen
and C.sub.1-4 alkyl; R.sup.6 is selected from the group consisting
of hydrogen, optionally substituted C.sub.1-6 alkyl, fluoroalkyl,
hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(carboxamido)alkyl, (amino)(hydroxy)alkyl,
(amino)(aryl)alkyl, (amino)(heteroaryl)alkyl, (hydroxy)(aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl; X is selected from the
group consisting of --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.7)--,
--N(R.sup.7)S(.dbd.O).sub.2--,--S(.dbd.O).sub.2C(R.sup.8)(H)--,
--C(.dbd.O)--, --C(.dbd.O)N(R.sup.7)--, --N(R.sup.7)C(.dbd.O)--,
--C(.dbd.O)O--, --OC(.dbd.O)--,
--C(.dbd.O)C(R.sup.8)(H)N(R.sup.7)--,
--N(R.sup.7)C(.dbd.O)C(R.sup.8)(H)--,
--C(R.sup.8)(H)C(.dbd.O)N(R.sup.7)--,
--C(R.sup.8)(H)N(R.sup.7)C(.dbd.O)--, and
--C(.dbd.O)C(R.sup.8)(H)--; or X is absent; Z is selected from the
group consisting of hydrogen, optionally substituted C.sub.1-6
alkyl, fluoroalkyl, hydroxyalkyl, amino, alkylamino, dialkylamino,
heterocycloamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl,
(cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl,
(amino)(heteroaryl)alkyl (hydroxy)(aryl)alkyl, (aralkylamino)alkyl,
(hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 4- to 14-membered
heterocyclo, optionally substituted 5- to 14-membered heteroaryl
optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl; wherein --X--Z is attached to any available
carbon or nitrogen atom of A, R.sup.3, R.sup.4, or R.sup.6; R.sup.7
is selected from the group consisting of hydrogen and C.sub.1-4
alkyl; and R.sup.8 is selected from the group consisting of
hydrogen, C.sub.1-4 alkyl, hydroxy, amino, alkylamino,
dialkylamino, cycloalkylamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, and hydroxyalkyl.
2. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A is C.sub.1-10 alkylenyl.
3. The compound of claim 2, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula II: ##STR00555## wherein:
R.sup.9a and R.sup.9b are independently selected from the group
consisting of hydrogen and C.sub.1-4 alkyl; R.sup.9c and R.sup.9d
are independently selected from the group consisting of hydrogen
and C.sub.1-4 alkyl; or R.sup.9c and R.sup.9d taken together with
the carbon atom to which they are attached form a 3- to 6-membered
cycloalkyl; R.sup.9 is selected from the group consisting of
hydrogen and C.sub.1-4 alkyl; m is 0 or 1; X is selected from the
group consisting of --N(R.sup.7)C(.dbd.O)--,
--N(R.sup.7)C(.dbd.O)C(R.sup.8)(H)--, and
--N(R.sup.7)S(.dbd.O).sub.2--; R.sup.8 is selected from the group
consisting of C.sub.1-4 alkyl, amino, alkylamino, and dialkylamino;
and Z is selected from the group consisting of C.sub.1-6 alkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, optionally
substituted 4- to 14-membered heterocyclo, and optionally
substituted C.sub.3-12 cycloalkyl.
4. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A is optionally substituted C.sub.6-14
arylenyl.
5. The compound of claim 4, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula III: ##STR00556## wherein:
R.sup.10a is selected from the group consisting of hydrogen, halo,
C.sub.1-6 alkyl, alkoxy, hydroxyalkyl, and alkoxycarbonyl; X is
selected from the group consisting of --C(.dbd.O)N(R.sup.7)--,
--N(R.sup.7)C(.dbd.O)--, --C(.dbd.O)C(R.sup.8)(H)N(R.sup.7)--,
--C(R.sup.8)(H)C(.dbd.O)N(R.sup.7)-- and
--S(.dbd.O).sub.2N(R.sup.7)--; or X is absent; R.sup.8 is selected
from the group consisting of C.sub.1-4 alkyl, amino, alkylamino,
and dialkylamino; and Z is selected from the group consisting of
hydrogen, amino, alkylamino, dialkylamino, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, (amino)(heteroaryl)alkyl,
heteroalkyl, (amino)(hydroxy)alkyl, (heterocyclo)alkyl, optionally
substituted C.sub.3-12 cycloalkyl, and optionally substituted 4- to
14-membered heterocyclo.
6. The compound of claim 5, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula IV: ##STR00557##
7. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A is optionally substituted C.sub.3-12
cycloalkylenyl.
8. The compound of claim 7, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula V: ##STR00558## wherein:
R.sup.10a and R.sup.10b are independently selected from the group
consisting of hydrogen and C.sub.1-4 alkyl; X is selected from the
group consisting of --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.7)--, --N(R.sup.7)C(.dbd.O)--,
--C(.dbd.O)N(R.sup.7)--, --N(R.sup.7)S(.dbd.O)--, and
--OC(.dbd.O)--; or X is absent; Z is selected from the group
consisting of amino, alkylamino, dialkylamino, heterocycloamino,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, and
(hydroxyalkylamino)alkyl; n is 0 or 1; and p is 0 or 1.
9. (canceled)
10. (canceled)
11. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, wherein A is --C(H)R.sup.3R.sup.4.
12-14. (canceled)
15. The compound of claim 11, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula VII, Formula VIII, or Formula
IX: ##STR00559## wherein: R.sup.3 is selected from the group
consisting of hydrogen, C.sub.1-4 alkyl, hydroxyalkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, aryloxyalkyl, and aralkyl X
is selected from the group consisting of --S(.dbd.O).sub.2--,
--S(.dbd.O).sub.2N(R.sup.7)--, --S(.dbd.O).sub.2C(R.sup.8)(H)--,
--C(.dbd.O)--, --C(.dbd.O)N(R.sup.7)--, --C(.dbd.O)O--,
--OC(.dbd.O)--, and --C(.dbd.O)C(R.sup.8)(H)--; or X is absent;
R.sup.8 is selected from the group consisting of C.sub.1-4 alkyl,
amino, alkylamino, and dialkylamino; and Z is selected from the
group consisting of C.sub.1-6 alkyl, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl,
hydroxyalkyl, optionally substituted C.sub.3-12 cycloalkyl,
aralkyl, and (heteroaryl)alkyl.
16. (canceled)
17. The compound of claim 11, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula X, Formula XI, or Formula XII:
##STR00560## wherein R.sup.12 is selected from the group consisting
of hydrogen, halo, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, hydroxyalkyl, (aralkyloxy)alkyl, alkoxyalkyl,
heteroalkyl, (hydroxyalkylamino)alkyl, (heterocycloamino)alkyl, and
carboxamido.
18. The compound of claim 17, or a pharmaceutically acceptable salt
or hydrate thereof, wherein: X is selected from the group
consisting of --C(.dbd.O)N(R.sup.7)-- and
--S(.dbd.O).sub.2N(R.sup.7)--; Z is optionally substituted
C.sub.1-6 alkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(hydroxy)alkyl, optionally substituted C.sub.6-14 aryl,
optionally substituted 4- to 14-membered heterocyclo, optionally
substituted 5- to 14-membered heteroaryl, optionally substituted
C.sub.3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl; and R.sup.12
is hydrogen.
19. (canceled)
20. The compound of claim 11, or a pharmaceutically acceptable salt
or hydrate thereof, having Formula XIII, Formula XIV, or Formula
XV: ##STR00561## wherein: R.sup.6 is selected from the group
consisting of optionally substituted C.sub.1-6 alkyl, hydroxyalkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl, optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl; X is selected from the
group consisting of --C(.dbd.O)N(R.sup.7)--,
--C(.dbd.O)C(R.sup.8)(H)--, and --S(.dbd.O).sub.2N(R.sup.7)--; or X
is absent; R.sup.8 is selected from the group consisting of
C.sub.1-4 alkyl, amino, alkylamino, and dialkylamino; Z is selected
from the group consisting of C.sub.1-4 alkyl, amino, alkylamino,
dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(amino)(heteroaryl)alkyl, and (amino)(hydroxy)alkyl.
21-24. (canceled)
25. The compound of claim 1, or a pharmaceutically acceptable salt
or solvate thereof, wherein R.sup.1 is selected from the group
consisting of C.sub.1-4 alkyl and C.sub.3-6 cycloalkyl.
26. The compound of claim 25, or a pharmaceutically acceptable salt
or solvate thereof, wherein R.sup.1 is cyclopropyl.
27. The compound of claim 1, or a pharmaceutically acceptable salt
or hydrate thereof, selected from the group consisting of:
##STR00562## ##STR00563## ##STR00564## ##STR00565## ##STR00566##
##STR00567## ##STR00568## ##STR00569## ##STR00570## ##STR00571##
##STR00572## ##STR00573## ##STR00574## ##STR00575## ##STR00576##
##STR00577## ##STR00578## ##STR00579## ##STR00580## ##STR00581##
##STR00582## ##STR00583## ##STR00584## ##STR00585## ##STR00586##
##STR00587## ##STR00588## ##STR00589## ##STR00590## ##STR00591##
##STR00592## ##STR00593## ##STR00594## ##STR00595## ##STR00596##
##STR00597## ##STR00598## ##STR00599## ##STR00600## ##STR00601##
##STR00602## ##STR00603## ##STR00604## ##STR00605## ##STR00606##
##STR00607## ##STR00608## ##STR00609## ##STR00610## ##STR00611##
##STR00612## ##STR00613## ##STR00614## ##STR00615## ##STR00616##
##STR00617## ##STR00618## ##STR00619## ##STR00620## ##STR00621##
##STR00622## ##STR00623## ##STR00624## ##STR00625## ##STR00626##
##STR00627## ##STR00628## ##STR00629## ##STR00630##
28. A pharmaceutical composition comprising the compound of claim
1, or a pharmaceutically acceptable salt or solvate thereof, and a
pharmaceutically acceptable carrier.
29. A method of treating a patient comprising administering to the
patient a therapeutically effective amount of the compound of claim
1, or a pharmaceutically acceptable salt or hydrate thereof,
wherein the patient has cancer.
30. The method of claim 29, wherein the cancer is selected from the
group consisting of adrenal cancer, acinic cell carcinoma, acoustic
neuroma, acral lentigious melanoma, acrospiroma, acute eosinophilic
leukemia, acute erythroid leukemia, acute lymphoblastic leukemia,
acute megakaryoblastic leukemia, acute monocytic leukemia, acute
promyelocytic leukemia, adenocarcinoma, adenoid cystic carcinoma,
adenoma, adenomatoid odontogenic tumor, adenosquamous carcinoma,
adipose tissue neoplasm, adrenocortical carcinoma, adult T-cell
leukemia/lymphoma, aggressive NK-cell leukemia, AIDS-related
lymphoma, alveolar rhabdomyosarcoma, alveolar soft part sarcoma,
ameloblastic fibroma, anaplastic large cell lymphoma, anaplastic
thyroid cancer, angioimmunoblastic T-cell lymphoma, angiomyolipoma,
angiosarcoma, astrocytoma, atypical teratoid rhabdoid tumor, B-cell
chronic lymphocytic leukemia, B-cell prolymphocytic leukemia,
B-cell lymphoma, basal cell carcinoma, biliary tract cancer,
bladder cancer, blastoma, bone cancer, Brenner tumor, Brown tumor,
Burkitt's lymphoma, breast cancer, brain cancer, carcinoma,
carcinoma in situ, carcinosarcoma, cartilage tumor, cementoma,
myeloid sarcoma, chondroma, chordoma, choriocarcinoma, choroid
plexus papilloma, clear-cell sarcoma of the kidney,
craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer,
colorectal cancer, Degos disease, desmoplastic small round cell
tumor, diffuse large B-cell lymphoma, dysembryoplastic
neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine
gland neoplasm, endodermal sinus tumor, enteropathy-associated
T-cell lymphoma, esophageal cancer, fetus in fetu, fibroma,
fibrosarcoma, follicular lymphoma, follicular thyroid cancer,
ganglioneuroma, gastrointestinal cancer, germ cell tumor,
gestational choriocarcinoma, giant cell fibroblastoma, giant cell
tumor of the bone, glial tumor, glioblastoma multiforme, glioma,
gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell
tumor, gynandroblastoma, gallbladder cancer, gastric cancer, hairy
cell leukemia, hemangioblastoma, head and neck cancer,
hemangiopericytoma, hematological malignancy, hepatoblastoma,
hepatosplenic T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's
lymphoma, invasive lobular carcinoma, intestinal cancer, kidney
cancer, laryngeal cancer, lentigo maligna, lethal midline
carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer,
lymphangioma, lymphangiosarcoma, lymphoepithelioma, lymphoma, acute
lymphocytic leukemia, acute myelogeous leukemia, chronic
lymphocytic leukemia, liver cancer, small cell lung cancer,
non-small cell lung cancer, MALT lymphoma, malignant fibrous
histiocytoma, malignant peripheral nerve sheath tumor, malignant
triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma,
mast cell leukemia, mediastinal germ cell tumor, medullary
carcinoma of the breast, medullary thyroid cancer, medulloblastoma,
melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic
urothelial carcinoma, mixed Mullerian tumor, mucinous tumor,
multiple myeloma, muscle tissue neoplasm, mycosis fungoides, myxoid
liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma,
neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma,
ocular cancer, oligoastrocytoma, oligodendroglioma, oncocytoma,
optic nerve sheath meningioma, optic nerve tumor, oral cancer,
osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid
cancer, paraganglioma, pinealoblastoma, pineocytoma, pituicytoma,
pituitary adenoma, pituitary tumor, plasmacytoma, polyembryoma,
precursor T-lymphoblastic lymphoma, primary central nervous system
lymphoma, primary effusion lymphoma, preimary peritoneal cancer,
prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma
periotonei, renal cell carcinoma, renal medullary carcinoma,
retinoblastoma, rhabdomyoma, rhabdomyosarcoma, Richter's
transformation, rectal cancer, sarcoma, Schwannomatosis, seminoma,
Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring
cell carcinoma, skin cancer, small blue round cell tumors, small
cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart,
spinal tumor, splenic marginal zone lymphoma, squamous cell
carcinoma, synovial sarcoma, Sezary's disease, small intestine
cancer, squamous carcinoma, stomach cancer, T-cell lymphoma,
testicular cancer, thecoma, thyroid cancer, transitional cell
carcinoma, throat cancer, urachal cancer, urogenital cancer,
urothelial carcinoma, uveal melanoma, uterine cancer, verrucous
carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer,
Waldenstrom's macroglobulinemia, Warthin's tumor, and Wilms'
tumor.
31-38. (canceled)
39. A method of treating a SMYD protein mediated disorder
comprising administering to a subject in need thereof a compound of
claim 1, or a pharmaceutically acceptable salt or hydrate thereof
in an effective amount to treat the SMYD protein mediated disorder.
Description
BACKGROUND OF THE INVENTION
Field of the Invention
[0001] The present disclosure provides substituted isoxazole
carboxamides as SMYD protein inhibitors, such as SMYD3 and SMYD2
inhibitors, and therapeutic methods of treating conditions and
diseases wherein inhibition of SMYD proteins such as SMYD3 and
SMYD2 provides a benefit.
Background
[0002] Epigenetic regulation of gene expression is an important
biological determinant of protein production and cellular
differentiation and plays a significant pathogenic role in a number
of human diseases. Epigenetic regulation involves heritable
modification of genetic material without changing its nucleotide
sequence. Typically, epigenetic regulation is mediated by selective
and reversible modification (e.g., methylation) of DNA and proteins
(e.g., histones) that control the conformational transition between
transcriptionally active and inactive states of chromatin. These
covalent modifications can be controlled by enzymes such as
methyltransferases (e.g., SMYD proteins such as SMYD3 and SMYD2),
many of which are associated with genetic alterations that can
cause human disease, such as proliferative disorders. Thus, there
is a need for the development of small molecules that are capable
of inhibiting the activity of SMYD proteins such as SMYD3 and
SMYD2.
BRIEF SUMMARY OF THE INVENTION
[0003] In one aspect, the present disclosure provides substituted
isoxazole carboxamide compounds represented by Formulae I-XVII
below, and the pharmaceutically acceptable salts and solvates
thereof, collectively referred to herein as "Compounds of the
Disclosure."
[0004] In another aspect, the present disclosure provides a
Compound of the Disclosure and one or more pharmaceutically
acceptable carriers.
[0005] In another aspect, the present disclosure provides a method
of inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a
mammal, comprising administering to the mammal an effective amount
of at least one Compound of the Disclosure.
[0006] In another aspect, the present disclosure provides methods
for treating a disease, disorder, or condition, e.g., cancer,
responsive to inhibition of SMYD proteins, such as SMYD3 or SMYD2,
or both, comprising administering a therapeutically effective
amount of a Compound of the Disclosure.
[0007] In another aspect, the present disclosure provides the use
of Compounds of the Disclosure as inhibitors of SMYD3.
[0008] In another aspect, the present disclosure provides the use
of Compounds of the Disclosure as inhibitors of SMYD2.
[0009] In another aspect, the present disclosure provides the use
of Compounds of the Disclosure as inhibitors of SMYD proteins.
[0010] In another aspect, the present disclosure provides a
pharmaceutical composition for treating a disease, disorder, or
condition responsive to inhibition of SMYD proteins, such as SMYD3
or SMYD2, or both, wherein the pharmaceutical composition comprises
a therapeutically effective amount of a Compound of the Disclosure
in a mixture with one or more pharmaceutically acceptable
carriers.
[0011] In another aspect, the present disclosure provides Compounds
of the Disclosure for use in treating cancer in a mammal, e.g.,
breast, cervical, colon, kidney, liver, head and neck, skin,
pancreatic, ovary, esophageal, lung, and prostate cancer.
[0012] In another aspect, the present disclosure provides a
Compound of the Disclosure for use in the manufacture of a
medicament for treating cancer in a mammal.
[0013] In another aspect, the present disclosure provides kit
comprising a Compound of the Disclosure.
[0014] Additional embodiments and advantages of the disclosure will
be set forth, in part, in the description that follows, and will
flow from the description, or can be learned by practice of the
disclosure. The embodiments and advantages of the disclosure will
be realized and attained by means of the elements and combinations
particularly pointed out in the appended claims.
[0015] It is to be understood that both the foregoing summary and
the following detailed description are exemplary and explanatory
only, and are not restrictive of the invention as claimed.
DETAILED DESCRIPTION OF TILE INVENTION
[0016] One aspect of the present disclosure is based on the use of
Compounds of the Disclosure as inhibitors of SMYD proteins. In view
of this property, the Compounds of the Disclosure are useful for
treating diseases, disorders, or conditions, e.g., cancer,
responsive to inhibition of SMYD proteins.
[0017] One aspect of the present disclosure is based on the use of
Compounds of the Disclosure as inhibitors of SMYD3. In view of this
property, the Compounds of the Disclosure are useful for treating
diseases, disorders, or conditions. e.g., cancer, responsive to
inhibition of SMYD3.
[0018] One aspect of the present disclosure is based on the use of
Compounds of the Disclosure as inhibitors of SMYD2. In view of this
property, the Compounds of the Disclosure are useful for treating
diseases, disorders, or conditions, e.g., cancer, responsive to
inhibition of SMYD2.
[0019] In one embodiment, Compounds of the Disclosure are compounds
having Formula I:
##STR00002##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof wherein:
[0020] R.sup.1 is selected from the group consisting of hydrogen,
C.sub.1-6 alkyl, C.sub.1-4 alkenyl, C.sub.1-4 haloalkyl, C.sub.3-6
cycloalkyl, and hydroxyalkyl;
[0021] R.sup.2 is selected from the group consisting of hydrogen,
halo, and carboxamido;
[0022] A is selected from the group consisting of C.sub.1-10
alkylenyl, (cycloalkylenyl)alkyl, optionally substituted C.sub.3-12
cycloalkylenyl, optionally substituted C.sub.6-14 arylenyl,
optionally substituted 5- to 14-membered heteroarylenyl, optionally
substituted 4- to 14-membered heterocyclenyl, and
--C(H)R.sup.3R.sup.4;
[0023] with the provisos:
[0024] a) when R.sup.1 is ethyl, n-propyl, isopropyl, isobutyl, or
cyclopropyl; and R.sup.2 is hydrogen, then A is not optionally
substituted, optionally bridged piperidinenyl;
[0025] b) when R.sup.1 is ethyl or cyclopropyl; R.sup.2 is
hydrogen; and X is --N(R.sup.7)S(--O).sub.2--,
--N(R.sup.7)C(.dbd.O)--, or --N(R.sup.7)C(.dbd.O)C(R.sup.8)(H)--,
then A is not optionally substituted 1,4-cyclohexylenyl;
[0026] c) when R.sup.1 is ethyl or cyclopropyl; R.sup.2 is
hydrogen; X is absent; and Z is amino, alkylamino, dialkylamino, or
heterocycloamino, then A is not optionally substituted
1,4-cyclohexylenyl; and
[0027] d) when R.sup.1 is hydrogen. C.sub.1-6 alkyl, or Cm
cycloalkyl; and R.sup.2 is hydrogen, then A is not optionally
substituted pyrrolidinenyl;
[0028] R.sup.3 is selected from the group consisting of hydrogen,
C.sub.1-6 alkyl. (hydroxy)(aryl)alkyl, (amino)alkyl.
(alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, alkoxyalkyl,
aryloxyalkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted 4- to 14-membered heterocyclo, optionally
substituted C.sub.6-14 aryl, aralkyl, alkoxycarbonyl, and
--C(.dbd.O)N(R.sup.5)(R.sup.6);
[0029] R.sup.4 is selected from the group consisting of C.sub.1-6
alkyl, hydroxyalkyl, optionally substituted C.sub.3-12 cycloalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 5-
to 14-membered heteroaryl, optionally substituted 4- to 14-membered
heterocyclo, and (heteroaryl)alkyl;
[0030] R.sup.5 is selected from the from the group consisting of
hydrogen and C.sub.1-4 alkyl;
[0031] R.sup.6 is selected from the group consisting of hydrogen,
optionally substituted C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl,
(cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(carboxamido)alkyl, (amino)(hydroxy)alkyl,
(amino)(aryl)alkyl, (amino)(heteroaryl)alkyl, (hydroxy)(aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl;
[0032] X is selected from the group consisting of
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2N(R.sup.7)--,
--N(R.sup.7)S(.dbd.O).sub.2--, --S(.dbd.O).sub.2C(R.sup.8)(H)--,
--C(.dbd.O)--, --C(.dbd.O)N(R.sup.7)--, --N(R.sup.7)C(.dbd.O)--,
--C(.dbd.O)O--, --OC(.dbd.O)--,
--C(.dbd.O)C(R.sup.8)(H)N(R.sup.7)--,
--N(R.sup.7)C(.dbd.O)C(R.sup.8)(H)--,
--C(R.sup.8)(H)C(.dbd.O)N(R.sup.7)--,
--C(R.sup.8)(H)N(R.sup.7)C(.dbd.O)--, and
--C(.dbd.O)C(R.sup.8)(H)--; or X is absent, i.e., Z forms a bond
with A;
[0033] Z is selected from the group consisting of hydrogen,
optionally substituted C.sub.1-6 alkyl, fluoroalkyl, hydroxyalkyl,
amino, alkylamino, dialkylamino, heterocycloamino, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl,
(heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl,
(amino)(aryl)alkyl, (amino)(heteroaryl)alkyl (hydroxy)(aryl)alkyl,
(aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl,
optionally substituted C.sub.6-14 aryl, optionally substituted 4-
to 14-membered heterocyclo, optionally substituted 5- to
14-membered heteroaryl optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl;
[0034] wherein --X--Z is attached to any available carbon or
nitrogen atom of A, R.sup.3, R.sup.4, or R.sup.6; e.g., when
R.sup.4 is C.sub.1-6 alkyl. e.g., ethyl, a hydrogen atom of that
ethyl group is replaced with --X--Z to give
--CH.sub.2CH.sub.2--X--Z or
##STR00003##
or
[0035] when R.sup.4 is optionally substituted C.sub.3-12
cycloalkyl, e.g., cyclohexyl, a hydrogen atom of the cyclohexyl
group is replaced with --X--Z to give:
##STR00004##
or
[0036] when R.sup.4 is optionally substituted 4- to 14-membered
heterocyclo, e.g., piperidinyl, the hydrogen atom attached to the
piperidinyl nitrogen atom is replaced with --X--Z to give:
##STR00005##
[0037] when R.sup.4 is optionally substituted C.sub.6-14 aryl,
e.g., phenyl, a hydrogen atom on that phenyl group is replaced with
--X--Z to give:
##STR00006##
[0038] R.sup.7 is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl; and
[0039] R.sup.8 is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, hydroxy, amino, alkylamino, dialkylamino,
cycloalkylamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, and hydroxyalkyl.
[0040] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein A is C.sub.1-10
alkylenyl.
[0041] In another embodiment, Compounds of the Disclosure are
compounds having Formula II:
##STR00007##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0042] R.sup.9a and R.sup.9b are independently selected from the
group consisting of hydrogen and C.sub.1-4 alkyl;
[0043] R.sup.9c and R.sup.9d are independently selected from the
group consisting of hydrogen and C.sub.1-4alkyl; or
[0044] R.sup.9c and R.sup.9d taken together with the carbon atom to
which they are attached form a 3- to 6-membered cycloalkyl;
[0045] R.sup.9e is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl;
[0046] m is 0 or 1:
[0047] X is selected from the group consisting of
--N(R.sup.7)C(.dbd.O)--, --N(R.sup.7)C(.dbd.O)C(R.sup.8)(H)--, and
--N(R.sup.7)S(.dbd.O).sub.2--;
[0048] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino; and
[0049] Z is selected from the group consisting of C.sub.1-6 alkyl,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, optionally
substituted 4- to 14-membered heterocyclo, and optionally
substituted C.sub.1-4, cycloalkyl, and R.sup.1, R.sup.2, and
R.sup.7 are as defined above in connection with Formula I.
[0050] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein A is optionally
substituted C.sub.6-14 arylenyl.
[0051] In another embodiment, Compounds of the Disclosure are
compounds having Formula III:
##STR00008##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0052] R.sup.10a is selected from the group consisting of hydrogen,
halo, C.sub.1-6 alkyl, alkoxy, hydroxyalkyl, and
alkoxycarbonyl;
[0053] X is selected from the group consisting of
--C(.dbd.O)N(R.sup.7)--, --N(R.sup.7)C(.dbd.O)--,
--C(.dbd.O)C(R.sup.8)(H)N(R.sup.7)--,
--C(R.sup.8)(H)C(.dbd.O)N(R.sup.7)-- and
--S(.dbd.O).sub.2N(R.sup.7)--; or X is absent;
[0054] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino; and
[0055] Z is selected from the group consisting of hydrogen, amino,
alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, (amino)(heteroaryl)alkyl, heteroalkyl,
(amino)(hydroxy)alkyl, (heterocyclo)alkyl, optionally substituted
C.sub.3-12 cycloalkyl, and optionally substituted 4- to 14-membered
heterocyclo, and R.sup.1, R.sup.2, and R.sup.7 are as defined above
in connection with Formula I.
[0056] In another embodiment, Compounds of the Disclosure are
compounds having Formula IV:
##STR00009##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0057] R.sup.10a is selected from the group consisting of hydrogen,
halo. C.sub.1-6 alkyl, alkoxy, hydroxyalkyl, and
alkoxycarbonyl;
[0058] X is selected from the group consisting of
--C(.dbd.O)N(R.sup.7)--, --N(R.sup.7)C(.dbd.O)--,
--C(.dbd.O)C(R.sup.8)(H)N(R.sup.7)--,
--C(R.sup.8)(H)C(.dbd.O)N(R.sup.7)-- and
--S(.dbd.O).sub.2N(R.sup.7)--; or X is absent;
[0059] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino; and
[0060] Z is selected from the group consisting of hydrogen, amino,
alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, (amino)(heteroaryl)alkyl, heteroalkyl,
(amino)hydroxy)alkyl, (heterocyclo)alkyl, optionally substituted
C.sub.3-12 cycloalkyl, and optionally substituted 4- to 14-membered
heterocyclo, and R.sup.1, R.sup.2, and R.sup.7 are as defined above
in connection with Formula I.
[0061] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein A is optionally
substituted C.sub.3-12 cycloalkylenyl.
[0062] In another embodiment, Compounds of the Disclosure are
compounds having Formula V:
##STR00010##
[0063] and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0064] R.sup.10a and R.sup.10b are independently selected from the
group consisting of hydrogen and C.sub.1-4 alkyl;
[0065] X is selected from the group consisting of
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2N(R.sup.7)--,
--N(R.sup.7)C(.dbd.O)--, --C(.dbd.O)N(R.sup.7)--,
--N(R.sup.7)S(.dbd.O)--, and --OC(.dbd.O)--; or X is absent;
[0066] Z is selected from the group consisting of amino,
alkylamino, dialkylamino, heterocycloamino. (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, and
(hydroxyalkylamino)alkyl; n is 0 or 1; and p is 0 or 1, and
R.sup.1, R.sup.2, and R.sup.7 are as defined above in connection
with Formula I.
[0067] In another embodiment. Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein A is optionally
substituted 4- to 14-membered heterocyclenyl.
[0068] In another embodiment, Compounds of the Disclosure are
compounds having Formula VI:
##STR00011##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0069] R.sup.11a and R.sup.11b are each independently selected from
the group consisting of hydrogen, C.sub.1-4 alkyl, and
alkoxycarbonyl;
[0070] X is selected from the group consisting of --C(.dbd.O)--,
--S(.dbd.O).sub.2--, and --C(.dbd.O)C(R.sup.8)(H)--;
[0071] Z is selected from the group consisting of (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, optionally substituted
C.sub.3-12 cycloalkyl, and aralkyl; and
[0072] r is 0 or 1, and R.sup.1, R.sup.2, and R.sup.8 are as
defined above in connection with Formula I.
[0073] In another embodiment, Compounds of the Disclosure are
compounds having Formula XVI:
##STR00012##
[0074] and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0075] R.sup.11c and R.sup.11d are each independently selected from
the group consisting of hydrogen and C.sub.1-4 alkyl;
[0076] X is selected from the group consisting of --C(.dbd.O)-- and
--S(.dbd.O).sub.2; or X is absent; and
[0077] Z, R.sup.1, and R.sup.2 are as defined above in connection
with Formula I.
[0078] In another embodiment, Compounds of the Disclosure are
compounds having Formula XVI, and the pharmaceutically acceptable
salts or solvates. e.g., hydrates, thereof, wherein R.sup.11c and
R.sup.11d are hydrogen; X is absent; Z is selected from the group
consisting of hydrogen, optionally substituted C.sub.1-6 alkyl,
fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl.
(dialkylamino)alkyl. (heterocyclo)alkyl, (cycloalkyl)alkyl,
(hydroxy)(aryl)alkyl, alkoxyalkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 4- to 14-membered
heterocyclo, optionally substituted 5- to 14-membered heteroaryl,
optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl; R.sup.2 is hydrogen; and R.sup.1 is as defined
above in connection with Formula I. In another embodiment, Z is
selected from the group consisting of aralkyl, and
(heteroaryl)alkyl. In another embodiment. Z is (heteroaryl)alkyl
that is substituted with an aralkyl, e.g.,
##STR00013##
or (heteroaryl)alkyl, e.g.,
##STR00014##
In another embodiment, R.sup.1 is selected from the group
consisting of C.sub.1-4 alkyl and C.sub.3-6 cycloalkyl.
[0079] In another embodiment, Compounds of the Disclosure are
compounds having Formula XVII:
##STR00015##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0080] R'' is selected from the group consisting of aralkyl and
(heteroaryl)alkyl; and
[0081] R.sup.1 is as defined above in connection with Formula
I.
[0082] In another embodiment, Compounds of the Disclosure are
compounds having Formula XVII, wherein R.sup.1 is selected from the
group consisting of C.sub.1-6 alkyl and C.sub.3-6 cycloalkyl. In
another embodiment, R'' is aralkyl. In another embodiment, R'' is
(heteroaryl)alkyl. In another embodiment, R'' is benzyl wherein the
phenyl group is optionally substituted with one or two
substituents, e.g., --CH.sub.2(4-Cl-Ph), --CH.sub.2(3-Cl-Ph),
--CH.sub.2(3,4-di-Cl-Ph), and --CH.sub.2(4-CF.sub.3-Ph).
[0083] In another embodiment. Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein A is
--C(H)R.sup.3R.sup.4. In another embodiment, R.sup.3 is selected
from the group consisting of C.sub.1-6 alkyl and optionally
substituted C.sub.3-12 cycloalkyl; and R.sup.4 is selected from the
group consisting of optionally substituted C.sub.3-12 cycloalkyl
and optionally substituted C.sub.6-14 aryl. In another embodiment,
R.sup.4 is optionally substituted 4- to 14-membered heterocyclo. In
another embodiment, R.sup.3 is C.sub.1-4 alkyl, hydroxyalkyl,
alkoxyalkyl, alkoxycarbonyl, optionally substituted C.sub.6-14
aryl, and aralkyl. In each of these embodiments. --X--Z replaces a
hydrogen atom on the R.sup.4 substituent. In certain instances,
--X--Z can be hydrogen, when X is absent and Z is hydrogen.
[0084] In another embodiment, Compounds of the Disclosure are
compounds having Formula VII, Formula VIII, or Formula IX:
##STR00016##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein:
[0085] R.sup.3 is selected from the group consisting of hydrogen,
C.sub.1-4 alkyl, hydroxyalkyl, alkoxyalkyl, optionally substituted
C.sub.6-14 aryl, aryloxyalkyl, and aralkyl;
[0086] X is selected from the group consisting of
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2N(R.sup.7)--,
--S(.dbd.O).sub.2C(R.sup.8)(H)--, --C(.dbd.O)--,
--C(.dbd.O)N(R.sup.7)--, --C(.dbd.O)O--, --OC(.dbd.O)--, and
--C(.dbd.O)C(R.sup.8)(H)--; or X is absent;
[0087] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino; and
[0088] Z is selected from the group consisting of C.sub.1-6 alkyl,
(amino)alkyl. (alkylamino)alkyl, (dialkylamino)alkyl,
(heterocyclo)alkyl, hydroxyalkyl, optionally substituted C.sub.3-12
cycloalkyl, aralkyl, and (heteroaryl)alkyl, and R.sup.1, R.sup.2,
and R.sup.7 are as defined above in connection with Formula I. In
another embodiment, R.sup.3 is selected from the group consisting
of hydrogen and methyl.
[0089] In another embodiment, Compounds of the Disclosure are
compounds having Formula X, Formula XI, or Formula XII:
##STR00017##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein R.sup.12 is selected from the group
consisting of hydrogen, halo, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, hydroxyalkyl, (aralkyloxy)alkyl, alkoxyalkyl,
heteroalkyl, (hydroxyalkylamino)alkyl, (heterocycloamino)alkyl, and
carboxamido, and R.sup.1, R.sup.2, X, and Z are as defined above in
connection with Formula I. In another embodiment, X is selected
from the group consisting of --C(.dbd.O)N(R.sup.7)-- and
--S(.dbd.O).sub.2N(R.sup.7)--; Z is optionally substituted
C.sub.1-6 alkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl. (heterocyclo)alkyl, (cycloalkyl)alkyl,
(amino)(hydroxy)alkyl, optionally substituted C.sub.6-14 aryl,
optionally substituted 4- to 14-membered heterocyclo, optionally
substituted 5- to 14-membered heteroaryl, optionally substituted
C.sub.3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl; and R.sup.12
is hydrogen. In another embodiment, X is absent; Z is hydrogen; and
R.sup.12 is selected from the group consisting of halo,
(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl,
(aralkyloxy)alkyl, alkoxyalkyl, heteroalkyl,
(hydroxyalkylamino)alkyl, (hetcrocycloamino)alkyl, and
carboxamido.
[0090] In another embodiment, Compounds of the Disclosure are
compounds having Formula XIII, Formula XIV, or Formula XV:
##STR00018##
and the pharmaceutically acceptable salts or solvates, e.g.,
hydrates, thereof, wherein.
[0091] R.sup.6 is selected from the group consisting of optionally
substituted C.sub.1-6 alkyl, hydroxyalkyl, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl,
(cycloalkyl)alkyl, (amino)(hydroxy)alkyl, optionally substituted
C.sub.6-14 aryl, optionally substituted 4- to 14-membered
heterocyclo, optionally substituted 5- to 14-membered heteroaryl,
optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and
(heteroaryl)alkyl;
[0092] X is selected from the group consisting of
--C(.dbd.O)N(R.sup.7)--, --C(.dbd.O)C(R.sup.8)(H)--, and
--S(.dbd.O).sub.2N(R.sup.7)--; or X is absent;
[0093] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino:
[0094] Z is selected from the group consisting of C.sub.1-4 alkyl,
amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, (amino)heteroaryl)alkyl, and
(amino)(hydroxy)alkyl, and R.sup.1, R.sup.2, and R.sup.7 are as
defined above in connection with Formula I.
[0095] In another embodiment, Compounds of the Disclosure are
compounds having Formula I, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, wherein:
[0096] X is selected from the group consisting of:
##STR00019##
[0097] R.sup.8 is selected from the group consisting of C.sub.1-4
alkyl, amino, alkylamino, and dialkylamino, and R.sup.1, R.sup.2,
A, and Z are as defined above in connection with Formula I.
[0098] In another embodiment, Compounds of the Disclosure are
compounds having any one of Formulae I-XVII, and the
pharmaceutically acceptable salts or solvates, e.g., hydrates,
thereof, wherein R.sup.1 is selected from the group consisting of
C.sub.10.4 alkyl and C.sub.3-6 cycloalkyl. In another embodiment,
R.sup.1 is cyclopropyl. In another embodiment, R.sup.2 is
hydrogen.
[0099] In another embodiment, a Compound of the Disclosure is not
5-cyclopropyl-N-(pyridin-3-yl)-1,2-oxazole-3-carboxamide.
[0100] In another embodiment, Compounds of the Disclosure are
compounds of Table 1, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof. The chemical names of the compounds of
Table 1 are provided in Table 1A.
[0101] In another embodiment, Compounds of the Disclosure are
compounds of Table 1A, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof.
[0102] In another embodiment, Compounds of the Disclosure are
compounds of Table 2, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof.
[0103] In another embodiment, Compounds of the Disclosure is the
compound of Table 3, and the pharmaceutically acceptable salts or
solvates, e.g., hydrates, thereof.
[0104] In another embodiment, Compounds of the Disclosure are
compounds of Tables 1 and 2, and the pharmaceutically acceptable
salts or solvates, e.g., hydrates, thereof, or different
pharmaceutically acceptable salt thereof.
[0105] In another embodiment, Compounds of the Disclosure are
compounds of Tables 1-3, and the pharmaceutically acceptable salts
or solvates, e.g., hydrates, thereof, or different pharmaceutically
acceptable salt thereof.
[0106] In another embodiment, Compounds of the Disclosure are
compounds of Table 1, Table 1A, Table 2, and Table 3, and the
pharmaceutically acceptable salts or solvates, e.g., hydrates,
thereof, or different pharmaceutically acceptable salt thereof
[0107] It should be appreciated that the Compounds of the
Disclosure in certain embodiments are the free base, various salts,
and hydrate forms, and are not limited to the particular salt
listed in Table 1, Table 2, and Table 3.
TABLE-US-00001 TABLE 1 Cpd. Salt No. Structure Form 2 ##STR00020##
None 3 ##STR00021## None 4 ##STR00022## HCl 5 ##STR00023## None 6
##STR00024## TFA 7 ##STR00025## TFA 8 ##STR00026## HCl 9
##STR00027## HCl 10 ##STR00028## HCl 11 ##STR00029## HCl 12
##STR00030## None 13 ##STR00031## HCl 14 ##STR00032## HCl 15
##STR00033## HCl 16 ##STR00034## HCl 17 ##STR00035## HCl 18
##STR00036## None 19 ##STR00037## None 20 ##STR00038## None 21
##STR00039## HCl 22 ##STR00040## HCl 23 ##STR00041## TFA 24
##STR00042## HCl 25 ##STR00043## None 26 ##STR00044## None 27
##STR00045## None 28 ##STR00046## None 29 ##STR00047## None 30
##STR00048## None 31 ##STR00049## None 32 ##STR00050## None 33
##STR00051## HCl 34 ##STR00052## HCl 35 ##STR00053## HCOOH 36
##STR00054## None 37 ##STR00055## HCl 38 ##STR00056## HCl 39
##STR00057## HCl 40 ##STR00058## HCl 41 ##STR00059## HCl 42
##STR00060## None 43 ##STR00061## None 44 ##STR00062## HCl 45
##STR00063## HCl 46 ##STR00064## None 47 ##STR00065## None 48
##STR00066## None 49 ##STR00067## HCl 50 ##STR00068## None 51
##STR00069## None 52 ##STR00070## None 53 ##STR00071## None 54
##STR00072## None 55 ##STR00073## None 56 ##STR00074## HCl 57
##STR00075## None 58 ##STR00076## None 59 ##STR00077## TFA 60
##STR00078## TFA 61 ##STR00079## None 62 ##STR00080## HCl 63
##STR00081## HCl 64 ##STR00082## None 65 ##STR00083## TFA 66
##STR00084## HCl 67 ##STR00085## HCl 68 ##STR00086## HCl 69
##STR00087## HCl 70 ##STR00088## HCl 71 ##STR00089## None 72
##STR00090## HCl 73 ##STR00091## HCl 74 ##STR00092## HCl 75
##STR00093## HCl 76 ##STR00094## HCl 77 ##STR00095## HCl 78
##STR00096## HCl 79 ##STR00097## HCl 80 ##STR00098## HCl 81
##STR00099## None 82 ##STR00100## HCl 83 ##STR00101## HCl 84
##STR00102## HCl 85 ##STR00103## HCl 86 ##STR00104## HCl 87
##STR00105## HCl 88 ##STR00106## HCl 89 ##STR00107## HCl 90
##STR00108## HCl 91 ##STR00109## HCl 92 ##STR00110## HCl 93
##STR00111## HCl 94 ##STR00112## HCl 95 ##STR00113## None 96
##STR00114## HCl 97 ##STR00115## HCl 98 ##STR00116## HCl 99
##STR00117## HCl 100 ##STR00118## HCl 101 ##STR00119## HCl 102
##STR00120## HCl 103 ##STR00121## TFA 104 ##STR00122## TFA 105
##STR00123## HCl 106 ##STR00124## HCl 107 ##STR00125## TFA 108
##STR00126## TFA 109 ##STR00127## HCl 110 ##STR00128## HCl 111
##STR00129## HCl 112 ##STR00130## HCl 113 ##STR00131## HCl 114
##STR00132## HCl 115 ##STR00133## HCl 116 ##STR00134## HCl 117
##STR00135## HCl 118 ##STR00136## HCl 119 ##STR00137## TFA 120
##STR00138## HCl 121 ##STR00139## HCl 122 ##STR00140## None 123
##STR00141## None
124 ##STR00142## None 125 ##STR00143## None 126 ##STR00144## None
127 ##STR00145## None 128 ##STR00146## None 129 ##STR00147## None
130 ##STR00148## TFA 131 ##STR00149## HCl 132 ##STR00150## HCl 133
##STR00151## HCl 134 ##STR00152## None 135 ##STR00153## None 136
##STR00154## None 137 ##STR00155## None 138 ##STR00156## None 139
##STR00157## HCl 140 ##STR00158## TFA 141 ##STR00159## HCl 142
##STR00160## TFA 143 ##STR00161## None 144 ##STR00162## None 145
##STR00163## None 146 ##STR00164## None 147 ##STR00165## TFA 148
##STR00166## None 149 ##STR00167## None 150 ##STR00168## None 151
##STR00169## None 152 ##STR00170## HCl 153 ##STR00171## TFA 154
##STR00172## None 155 ##STR00173## HCOOH 156 ##STR00174## None 157
##STR00175## None 158 ##STR00176## TFA 159 ##STR00177## TFA 160
##STR00178## HCl 161 ##STR00179## HCl 162 ##STR00180## HCl 163
##STR00181## HCl 164 ##STR00182## HCl 165 ##STR00183## None 166
##STR00184## None 167 ##STR00185## None 168 ##STR00186## None 169
##STR00187## TFA 170 ##STR00188## HCl 171 ##STR00189## HCl 172
##STR00190## HCl 173 ##STR00191## HCl 174 ##STR00192## HCl 175
##STR00193## None 176 ##STR00194## HCl 177 ##STR00195## HCl 178
##STR00196## HCl 179 ##STR00197## HCl 180 ##STR00198## HCl 181
##STR00199## HCl 182 ##STR00200## HCl 183 ##STR00201## HCl 184
##STR00202## HCl 185 ##STR00203## HCl 186 ##STR00204## HCl 187
##STR00205## HCl 188 ##STR00206## HCl 189 ##STR00207## HCl 190
##STR00208## HCl 191 ##STR00209## HCl 192 ##STR00210## HCl 193
##STR00211## HCl 194 ##STR00212## HCl 195 ##STR00213## HCl 196
##STR00214## HCl 197 ##STR00215## HCl 198 ##STR00216## TFA 199
##STR00217## TFA 200 ##STR00218## HCl 201 ##STR00219## HCl 202
##STR00220## HCl 203 ##STR00221## HCl 204 ##STR00222## HCl 205
##STR00223## HCl 206 ##STR00224## HCl 207 ##STR00225## HCl 208
##STR00226## HCl 209 ##STR00227## HCl 210 ##STR00228## HCl 211
##STR00229## HCl 212 ##STR00230## None 213 ##STR00231## HCl 214
##STR00232## HCl 215 ##STR00233## HCl 216 ##STR00234## HCl 218
##STR00235## HCl 219 ##STR00236## HCl 220 ##STR00237## HCl 221
##STR00238## HCl 222 ##STR00239## HCl 223 ##STR00240## HCl 224
##STR00241## HCl 225 ##STR00242## HCl 226 ##STR00243## HCl 227
##STR00244## HCl 228 ##STR00245## HCl 229 ##STR00246## HCl 230
##STR00247## HCl 231 ##STR00248## HCl 232 ##STR00249## HCl 233
##STR00250## TFA 234 ##STR00251## HCl 235 ##STR00252## TFA 236
##STR00253## TFA 237 ##STR00254## HCl 238 ##STR00255## TFA 239
##STR00256## TFA 240 ##STR00257## TFA 241 ##STR00258## HCl 242
##STR00259## HCl 243 ##STR00260## HCl 244 ##STR00261## TFA 245
##STR00262## TFA 246 ##STR00263## TFA 247 ##STR00264## HCl 248
##STR00265## HCOOH 249 ##STR00266## HCl 250 ##STR00267## HCl
251 ##STR00268## HCl 252 ##STR00269## HCl 253 ##STR00270## TFA 254
##STR00271## HCl 255 ##STR00272## HCl 256 ##STR00273## HCl 257
##STR00274## TFA 258 ##STR00275## TFA 259 ##STR00276## TFA 260
##STR00277## TFA 261 ##STR00278## HCl 262 ##STR00279## TFA 263
##STR00280## TFA 264 ##STR00281## HCl 265 ##STR00282## TFA 266
##STR00283## HCl 267 ##STR00284## TFA 268 ##STR00285## HCl 269
##STR00286## TFA 270 ##STR00287## HCl 271 ##STR00288## TFA 272
##STR00289## TFA 273 ##STR00290## TFA 274 ##STR00291## TFA 275
##STR00292## TFA 276 ##STR00293## TFA 277 ##STR00294## TFA 278
##STR00295## TFA 279 ##STR00296## TFA 280 ##STR00297## HCl 281
##STR00298## HCl 282 ##STR00299## TFA 283 ##STR00300## TFA 284
##STR00301## TFA 285 ##STR00302## TFA 286 ##STR00303## TFA 287
##STR00304## TFA 288 ##STR00305## TFA 290 ##STR00306## TFA 291
##STR00307## HCl 292 ##STR00308## None 293 ##STR00309## TFA 294
##STR00310## TFA 295 ##STR00311## TFA 296 ##STR00312## TFA 297
##STR00313## None 298 ##STR00314## None 299 ##STR00315## None 300
##STR00316## HCl 301 ##STR00317## HCl 302 ##STR00318## HCl 303
##STR00319## None 304 ##STR00320## None 305 ##STR00321## HCl 306
##STR00322## HCl 307 ##STR00323## HCl 308 ##STR00324## HCl 309
##STR00325## HCl 310 ##STR00326## HCl 311 ##STR00327## None 312
##STR00328## HCl 313 ##STR00329## HCl 314 ##STR00330## HCl 315
##STR00331## HCl 316 ##STR00332## None 317 ##STR00333## HCl 318
##STR00334## HCl 319 ##STR00335## HCl 320 ##STR00336## HCl 321
##STR00337## HCl 322 ##STR00338## HCl 323 ##STR00339## None 324
##STR00340## HCl 325 ##STR00341## None 326 ##STR00342## HCl 327
##STR00343## HCl 328 ##STR00344## HCl 329 ##STR00345## HCl 330
##STR00346## HCl 331 ##STR00347## HCl 332 ##STR00348## None 333
##STR00349## None 334 ##STR00350## HCl 335 ##STR00351## HCl 336
##STR00352## HCl 337 ##STR00353## HCl 338 ##STR00354## HCl 339
##STR00355## HCl 340 ##STR00356## HCl 341 ##STR00357## HCl 342
##STR00358## HCl 343 ##STR00359## None 344 ##STR00360## HCl 345
##STR00361## HCl 346 ##STR00362## HCl 347 ##STR00363## HCl 348
##STR00364## HCl 349 ##STR00365## HCl 350 ##STR00366## None 351
##STR00367## HCl 352 ##STR00368## HCl 353 ##STR00369## TFA 354
##STR00370## HCl 355 ##STR00371## TFA 356 ##STR00372## HCl 357
##STR00373## None 358 ##STR00374## TFA 359 ##STR00375## TFA 360
##STR00376## HCl 361 ##STR00377## HCl 362 ##STR00378## None 363
##STR00379## HCl 364 ##STR00380## HCl 365 ##STR00381## TFA 366
##STR00382## HCl 367 ##STR00383## HCl 368 ##STR00384## None 369
##STR00385## HCl 370 ##STR00386## HCl 371 ##STR00387## None 372
##STR00388## TFA 373 ##STR00389## TFA 374 ##STR00390## None 375
##STR00391## None 376 ##STR00392## HCl
377 ##STR00393## None 378 ##STR00394## None 379 ##STR00395## HCl
380 ##STR00396## HCl 381 ##STR00397## HCl 382 ##STR00398## None 383
##STR00399## None 384 ##STR00400## HCl 385 ##STR00401## HCl 386
##STR00402## HCl 387 ##STR00403## HCl 388 ##STR00404## None 389
##STR00405## None 390 ##STR00406## None 391 ##STR00407## None 392
##STR00408## HCl 393 ##STR00409## None 394 ##STR00410## None 395
##STR00411## None 396 ##STR00412## HCl 397 ##STR00413## None 398
##STR00414## HCl 399 ##STR00415## None
TABLE-US-00002 TABLE 2 SMYD2 Biochem Cpd. Salt LCMS IC.sub.50 No.
Structure Form Chemical Name M + H (.mu.M)* 400 ##STR00416## None
N-(1-acetylazetidin-3-yl)-5- cyclopropyl-1,2-oxazole-3- carboxamide
250.1 >50.0 401 ##STR00417## None 5-cyclopropyl-N-[1-(2-
methylpropyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 264.2
1.55823 402 ##STR00418## None 5-cyclopropyl-N-[1-(2-
fluoroethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 254.1 7.78955
403 ##STR00419## None 5-cyclopropyl-N-(1-
methanesulfonylazetidin-3-yl)-1,2- oxazole-3-carboxamide 286.1
>50.0 404 ##STR00420## None 5-cyclopropyl-N-[1-(2-
hydroxyethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 252.2
4.67695 405 ##STR00421## None 5-cyclopropyl-N-[1-(oxetan-3-
yl)azetidin-3-yl]-1,2-oxazole-3- carboxamide 264.2 >50.0 406
##STR00422## None 5-cyclopropyl-N-[1-(2,2-
difluoroethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 272.2
>50.0 407 ##STR00423## None 5-cyclopropyl-N-[1-(2-
methoxyethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 266.2
2.68352 408 ##STR00424## None 5-cyclopropyl-N-[1-(2,2,2-
trifluoroethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 290.2
>50.0 409 ##STR00425## None 5-cyclopropyl-N-(1,3-
dimethylazetidin-3-yl)-1,2- oxazole-3-carboxamide 236.2 >50.0
410 ##STR00426## None 5-cyclopropyl-N-[1-(propan-2-
yl)azetidin-3-yl]-1,2-oxazole-3- carboxamide 250.1 1.04736 411
##STR00427## None 5-cyclopropyl-N-(1- methylazetidin-3-yl)-1,2-
oxazole-3-carboxamide 222.1 5.33712 412 ##STR00428## None
5-cyclopropyl-N-(1- ethylazetidin-3-yl)-1,2- oxazole-3-carboxamide
236.2 1.50829 413 ##STR00429## None 5-cyclopropyl-N-(1-
cyclopropylazetidin-3-yl)-1,2- oxazole-3-carboxamide 248.1 1.46882
414 ##STR00430## None 5-cyclopropyl-N-(1- propylazetidin-3-yl)-1,2-
oxazole-3-carboxamide 250.2 1.70142 415 ##STR00431## None
N-(1-benzylazetidin-3-yl)-5- cyclopropyl-1,2- oxazole-3-carboxamide
298.1 2.47021 416 ##STR00432## None 5-cyclopropyl-N-[1-(1-
phenylpropyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 326.1
0.61999 417 ##STR00433## None 5-cyclopropyl-N-[1-(2-hydroxy-1-
phenylethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 328.2 2.22554
418 ##STR00434## None 5-cyclopropyl-N-[1-(1-
phenylethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 312.1 0.58861
419 ##STR00435## None 5-cyclopropyl-N-[1-(2-
phenylethyl)azetidin-3-yl]-1,2- oxazole-3-carboxamide 312.1 2.18872
420 ##STR00436## HCl N-(azetidin-3-yl)-5-cyclopropyl-
1,2-oxazole-3-carboxamide 208.1 421 ##STR00437## None
5-cyclopropyl-N-(pyridin-3-yl)- 1,2-oxazole-3-carboxamide 230.2
>50.0 422 ##STR00438## None 5-cyclopropyl-N-(pyridin-4-yl)-
1,2-oxazole-3-carboxamide 230.2 >50.0 423 ##STR00439## None
5-cyclopropyl-N-{[1-(propan-2- yl)azetidin-3-yl]methyl}-1,2-
oxazole-3-carboxamide 264.1 >50.0 424 ##STR00440## None
5-cyclopropyl-N-{[1- (cyclopropylmethyl)azetidin-3- yl]methyl}-1,2-
oxazole-3-carboxamide 276.1 >50.0 425 ##STR00441## None
5-cyclopropyl-N-[(1- propylazetidin-3-yl)methyl]-
1,2-oxazole-3-carboxamide 264.1 >50.0 426 ##STR00442## None
N-(azetidin-3-ylmethyl)-5- cyclopropyl-1,2-oxazole-3- carboxamide
222.1 33.04122 427 ##STR00443## None (.+-.)-cis-5-cyclopropyl-N-[5-
methyl-1-(propan-2-yl)azepan- 4-yl]-1,2-oxazole-3-carboxamide 306.2
>50.0 *IC.sub.50 values are an average of n = 1 to n = 50
TABLE-US-00003 TABLE 3 SMYD2 Biochem Cpd. Salt LCMS IC.sub.50 No.
Structure Form Chemical Name M + H (.mu.M)* 428 ##STR00444## none
N-(1-((1-(4-chlorobenzyl)-1H- pyrazol-4-yl)methyl)azetidin-3-
yl)-5-cyclopropylisoxazole-3- carboxamide 412.2 0.0095 *IC.sub.50
values are an average of n = 1 to n = 50
TABLE-US-00004 TABLE 1A SMYD3 Biochem SMYD3 LCMA IC.sub.50 cell
IC.sub.50 Cpd. No. Chemical Name M + H (.mu.M)* (.mu.M)* 2
N-(1-((4- 447.15 48.11 acetamidophenyl)sulfonyl)piperidin-4-
yl)-5-cyclobutylisoxazole-3-carboxamide 3 N-(4-((4- 431.91 23.37
acetamidophenyl)sulfonyl)cyclohexyl)-5-
cyclopropylisoxazole-3-carboxamide 4 5-cyclopropyl-N-(piperidin-4-
250.05 31.8 ylmethyl)isoxazole-3-carboxamide 5
5-cyclopropyl-N-((1-methylpiperidin-4- 264.10 39.33
yl)methyl)isoxazole-3-carboxamide 6 N-((1s,3s)-3-((4- 419.25 32.91
acetamidophenyl)sulfonamido)cyclobutyl)
5-cyclopropylisoxazole-3-carboxamide 7 N-((1r,3r)-3-((4- 419.3
46.75 acetamidophenyl)sulfonamido)cyclobutyl)
5-cyclopropylisoxazole-3-carboxamide 8
N-((1r,4r)-4-aminocyclohexyl)-5- 375.83 20.73
cyclopropyl-4-iodoisoxazole-3- carboxamide 9
N-((1r,4r)-4-aminocyclohexyl)-5-(2- 254 33.25
hydroxyethyl)isoxazole-3-carboxamide 10
N3-((1r,4r)-4-ammocyclohexyl)-5- 349.10 38.97
cyclopropyl-N4-isobutylisoxazole-3,4- dicarboxamide 11
N-((1r,4r)-4-aminocyclohexyl)-5- 236.1 27.42
vinylisoxazole-3-carboxamide 12 5-cyclopropyl-N-(2,2-dimethyl-1-
299.05 12.75 phenylpropyl)isoxazole-3-carboxamide 13
N3-((1r,4r)-4-aminocyclohexyl)-5- 293.15 22.42
cyclopropylisoxazole-3,4-dicarboxamide 14
N-(4-(aminomethyl)phenyl)-5- 259.1 10.54
cyclopropylisoxazole-3-carboxamide 15 N-(1-(4-aminophenyl)ethyl)-5-
271.8 40.11 cyclopropylisoxazole-3-carboxamide 16
N-(4-(1-aminoethyl)phenyl)-5- 272.85 6.52
cyclopropylisoxazole-3-carboxamide 17
N-((1r,3r)-3-aminocyclobutyl)-5- 222.05 24.5
cyclopropylisoxazole-3-carboxamide 18
5-cyclopropyl-N-(1-(4-fluorophenyl)- 289.1 41.22
propyl)isoxazole-3-carboxamide 19
5-cyclopropyl-N-(1-(4-fluorophenyl)-2- 303.05 16.38
methylpropyl)isoxazole-3-carboxamide 20
5-cyclopropyl-N-(1-(4-methoxyphenyl)- 329.1 5.85
2,2-dimethylpropyl)isoxazole-3- carboxamide 21
N-((1r,4r)-4-aminocyclohexyl)-5-(3- 268.1 40.64
hydroxypropyl)isoxazole-3-carboxamide 22
N-(azepan-4-yl)-5-cyclopropylisoxazole- 250.15 14.88 3-carboxamide
23 N-(3-(azetidin-3-ylamino)cyclobutyl)-5- 277.1 32.28
cyclopropylisoxazole-3-carboxamide 24
N-((1r,4r)-4-aminocyclohexyl)-5- 234.79 24.63
isopropylisoxazole-3-carboxamide (-NH.sub.2) 25
5-cyclopropyl-N-(cyclopropyl(4- 301.05 16.21
fluorophenyl)methyl)isoxazole-3- carboxamide 26
5-cyclopropyl-N-(3,3-dimethylbutan-2- 237.05 45.92
yl)isoxazole-3-carboxamide 27 N-(1-(4-aminophenyl)-2,2- 336.25 8.54
dimethylpropyl)-5-cyclopropylisoxazole- (+Na) 3-carboxamide 28
5-cyclopropyl-N-(2,2-dimethyl-1- 300.15 38.32
(pyridin-2-yl)propyl)isoxazole-3- carboxamide 29
5-cyclopropyl-N-(1-(4- 275 43.79 fluorophenyl)ethyl)isoxazole-
3-carboxamide 30 5-cyclopropyl-N-(2,2-dimethylpentan-3- 251.15
27.12 yl)isoxazole-3-carboxamide 31 N-(1-(4-acetamidophenyl)-2,2-
356.25 12.82 dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide
32 N-(1-(4-chlorophenyl)-2,2- 333.15 9.03
dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide 33
N-(4-(aminomethyl)-2-methylphenyl)-5- 272.90 7.79
cyclopropylisoxazole-3-carboxamide 34
N-(4-(aminomethyl)-2-chlorophenyl)-5- 293.05 6.45
cyclopropylisoxazole-3-carboxamide (295.00) 35
N-((5-amino-1,3,3-trimethylcyclohexyl)- 306.30 12.99
methyl)-5-cyclopropylisoxazole-3- carboxamide 36
5-cyclopropyl-N-(2,2-dimethyl-1-(p- 312.90 27.61
tolyl)propyl)isoxazole-3-carboxamide 37
N-(4-(2-aminoethyl)phenyl)-5- 272.15 7.25
cyclopropylisoxazole-3-carboxamide 38
N-(4-(1-aminopropyl)phenyl)-5- 286.96 4.43
cyclopropylisoxazole-3-carboxamide 39 N-(4-(1-amino-2,2- 297 2.52
dimethylpropyl)phenyl)-5- (-NH3) cyclopropylisoxazole-3-carboxamide
40 N-(4-(ammomethyl)-2-iodophenyl)-5- 366.9 7.21
cyclopropylisoxazole-3-carboxamide (-NH3) 41
N-(5-(aminomethyl)pyridin-2-yl)-5- 259.15 22.53
cyclopropylisoxazole-3-carboxamide 42
5-ethyl-N-(1-(3-methoxyphenyl)-2,2- 317.20 24.62
dimethylpropyl)isoxazole-3-carboxamide 43
5-cyclopropyl-N-(1-(3-methoxyphenyl)- 329.25 18.91
2.2-dimethylpropyl)isoxazole-3- carboxamide 44
N-(4-(1-amino-2-methylpropyl)phenyl)- 300.04 2.5
5-cyclopropylisoxazole-3-carboxamide 45
N-(5-(aminomethyl)-6-methylpyridin-2- 273.15 29.74
yl)-5-cyclopropylisoxazole-3- carboxamide 46
5-cyclopropyl-N-(2,2-dimethyl-1-(m- 313.25 22.2
tolyl)propyl)isoxazole-3-carboxamide 47
5-ethyl-N-(1-(3-fluorophenyl)-2,2- 305.15 7.26
dimethylpropyl)isoxazole-3-carboxamide 48
5-cyclopropyl-N-(1-(3-fluorophenyl)- 317.25 7.92
2.2-dimethylpropyl)isoxazole-3- carboxamide 49
5-cyclopropyl-N-(phenyl(piperidin-4- 326.25 8.09
yl)methyl)isoxazole-3-carboxamide 50
5-cyclopropyl-N-(2,2-dimethyl-1- 300.15 9.99
(pyridin-3-yl)propyl)isoxazole-3- carboxamide 51
5-cyclopropyl-N-(2,2-dimethyl-1- 300.20 4.08
(pyridin-4-yl)propyl)isoxazole-3- carboxamide 52
N-(1-cyclobutyl-2,2-dimethylpropyl)-5- 277.2 7.4
cyclopropylisoxazole-3-carboxamide 53
N-(1-cyclopentyl-2,2-dimethylpropyl)-5- 291.25 10.58
cyclopropylisoxazole-3-carboxamide 54
N-(1-cyclohexyl-2,2-dimethylpropyl)-5- 305.01 15.14
cyclopropylisoxazole-3-carboxamide 55
N-(cyclobutyl(phenyl)methyl)-5- 297.2 38.47
cyclopropylisoxazole-3-carboxamide 56
N-(4-(aminomethyl)-3-chlorophenyl)-5- 291.95 16.4
cyclopropylisoxazole-3-carboxamide 57 N-(1-(3-chlorophenyl)-2,2-
321.2 6.06 dimethylpropyl)-5-ethylisoxazole-3- carboxamide 58
N-(1-(3-chlorophenyl)-2,2- 333.2 9.97
dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide 59
N-(2-(4-amino-4- 306 10.23 methylcyclohexyl)propan-
2-yl)-5-cyclopropylisoxazole-3- carboxamide 60
N-(4-(2-aminopropan-2-yl)-1- 306 2.98 methylcyclohexyl)-
5-cyclopropylisoxazole-3-carboxamide 61
5-cyclopropyl-N-(2,2-dimethyl-1- 306.15 6.29
(thiazol-4-yl)propyl)isoxazole-3- carboxamide 62
5-cyclopropyl-N-(2,2-dimethyl-1- 306.25 4.35
(piperidin-4-yl)propyl)isoxazole-3- carboxamide 63
N-(((1r,4r)-4-aminocyclohexyl)(phenyl)- 340.25 6.99
methyl)-5-cyclopropylisoxazole-3- carboxamide 64
5-ethyl-N-(phenyl(tetrahydro-2H-pyran- 337.25 37.06
4-yl)methyl)isoxazole-3-carboxamide (+Na) 65
N-(3-(aminomethyl)-3,5,5- 306.15 14.07 trimethylcyclohexyl)-
5-cyclopropylisoxazole-3-carboxamide 66
5-cyclopropyl-N-((S)-phenyl((S)- 312.2 34.2
pyrrolidin-2-yl)methyl)isoxazole-3- carboxamide 67 N-(((1s,4s)-4-
340.25 13 aminocyclohexyl)(phenyl)methyl)-
5-cyclopropylisoxazole-3-carboxamide 68
5-cyclopropyl-N-(2,2-dimethyl-1- 306.25 4.38
(piperidin-3-yl)propyl)isoxazole-3- carboxamide 69
5-cyclopropyl-N-(phenyl(piperidin-3- 326.25 12.68
yl)methyl)isoxazole-3-carboxamide 70
N-(4-(aminomethyl)-3-methylphenyl)-5- 272.97 8.22
cyclopropylisoxazole-3-carboxamide 71
5-ethyl-N-((1-methylpiperidin-4- 328.25 20.51
yl)(phenyl)methyl)isoxazole-3- carboxamide 72
N-((3-chlorophenyl)(piperidin-4- 348.2 1.4
yl)methyl)-5-ethylisoxazole-3- carboxamide 73
N-((3-chlorophenyl)(piperidin-4- 360.25 2.59
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 74
5-ethyl-N-(phenyl(piperidin-4-yl)- 314.2 7.44
methyl)-isoxazole-3-carboxamide 75
N-((3-((4-chlorobenzyl)carbamoyl) 493.3 13.58
phenyl)(piperidin-4-yl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 76 N-((3- 465.35 34.82
((cyclohexylmethyl)carbamoyl)phenyl)- (piperidin-4-yl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 77
N-((3-(cyclohexylcarbamoyl)phenyl)- 451.4 49.05
(piperidin-4-yl)methyl)-5- cyclopropylisoxazole-3-carboxamide 78
N-(4-(ammomethyl)-3-methoxyphenyl)- 270.92 32.1
5-cyclopropylisoxazole-3-carboxamide (-NH.sub.2) 79
5-cyclopropyl-N-((S)-1-(((S)-1,6- 368.25 15.03
diamino-1-oxohexan-2-yl)amino)-
3-hydroxy-1-oxopropan-2-yl)isoxazole- 3-carboxamide 80
N-((2-chlorophenyl)(piperidin-4- 348.15 15.86
yl)methyl)-5-ethylisoxazole-3- carboxamide 81
5-cyclopropyl-N-((1-methylpiperidin-4- 340.2 22.81
yl)(phenyl)methyl)isoxazole-3- carboxamide 82
N-((2-chlorophenyl)(piperidin-4- 360.20 9.05
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 83
5-cyclopropyl-N-(piperidin-4-yl(3- 460.3 30.8
((pyridin-3-ylmethyl)carbamoyl)- phenyl)methyl)isoxazole-
3-carboxamide 84 5-cyclopropyl-N-(piperidin-4-yl(3-((3- 480.4 10.57
(pyrrolidin-1-yl)propyl)carbamoyl) phenyl)methyl)isoxazole-
3-carboxamide 85 5-cyclopropyl-N-((3-((2-(piperidin-1- 480.4 12.59
yl)ethyl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 86 5-cyclopropyl-N-((3-((2-
475.35 20.84 (methylsulfonyl)ethyl)carbamoyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 87
5-cyclopropyl-N-((3-((3- 454.35 24.56
(dimethylamino)propyl)carbamoyl)- phenyl)(piperidin-4-yl)methyl)-
isoxazole-3-carboxamide 88 5-cyclopropyl-N-(piperidin-4-yl(3-
460.35 37.32 ((pyridin-4-ylmethyl)carbamoyl)-
phenyl)methyl)isoxazole- 3-carboxamide 89
N-((3-(((1r,4r)-4-aminocyclohexyl)- 466.35 39.36
carbamoyl)phenyl)(piperidin- 4-yl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 90
5-cyclopropyl-N-((3-((pent-4-yn-1- 11.77
yloxy)methyl)phenyl)(piperidine-4- yl)methyl)isoxazole-
3-carboxamide 91 N-(4-(aminomethyl)-2-isopropylphenyl)- 283.02 6.08
5-cyclopropylisoxazole-3-carboxamide (-NH2) 92
N-((1r,4r)-4-aminocyclohexyl)-5- 266.1 38.15
isobutylisoxazole-3-carboxamide 93 N-((1r,4r)-4-ammocycloliexyl)-5-
252.1 9.93
propylisoxazole-3-carboxamide 94
N-(4-(aminomethyl)-3-iodophenyl)-5- 383.98 19.48
cyclopropylisoxazole-3-carboxamide 95 N-(1-(2H-indazol-4-yl)-2,2-
339.01 6.82 dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide
96 5-cyclopropyl-N-((3-((1- 494.45 48.53 isopropylpiperidin-4-
yl)carbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-
3-carboxamide 97 5-cyclopropyl-N-((3-((3- 475.40 25.88
hydroxybenzyl)carbamoyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 98
5-cyclopropyl-N-((3- 409.3 46.85
(cyclopropylcarbamoyl)phenyl)(piperidin-
4-yl)methyl)isoxazole-3-carboxamide 99
5-cyclopropyl-N-(piperidin-4-yl(3- 394.24 11.9 ((prop-2-yn-1-
yloxy)methyl)phenyl)methyl)isoxazole- 3-carboxamide 100
5-cyclopropyl-N-((3- 411.3 17.98
((diethylamino)methyl)phenyl)(piperidin-
4-yl)methyl)isoxazole-3-carboxamide 101
N-(4-(aminomethyl)-2-ethylphenyl)-5- 268.99 3
cyclopropylisoxazole-3-carboxamide (-NH.sub.2) 102
N-((1r,4r)-4-aminocyclohexyl)-5- 266.10 32.62
butylisoxazole-3-carboxamide 103 5-cyclopropyl-N-((3-((2-hydroxy-3-
496.4 14.1 (pyrrolidin-1-yl)propyl)carbamoyl)-
phenyl)(piperidin-4-yl)methyl)- isoxazole-3-carboxamide 104
5-cyclopropyl-N-((3-((3- 441.3 11.17
hydroxypropyl)(methyl)carbamoyl)- phenyl)(piperidin-4-yl)methyl)-
isoxazole-3-carboxamide 105 5-cyclopropyl-N-(piperidin-4-yl(3-
460.35 45.5 ((pyridin-2-ylmethyl)carbamoyl)-
phenyl)methyl)isoxazole- 3-carboxamide 106
5-cyclopropyl-N-(piperidin-4-yl(3- 446.3 4.76
(pyridin-3-ylcarbamoyl)phenyl)methyl)- isoxazole-3-carboxamide 107
5-cyclopropyl-N-((3-(((3- 464.35 16.78
fluorobenzyl)oxy)methyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 108
N-((3-((but-2-yn-1-yloxy)methyl)phenyl)- 408.3 6.36
(piperidin-4-yl)methyl)-5- cyclopropylisoxazole-3-carboxamide 109
5-cyclopropyl-N-((3-(((3-hydroxypropyl)- 427.35 34.01
(methyl)amino)methyl)phenyl)(piperidin- 4-yl)methyl)isoxazole-
3-carboxamide 110 5-cyclopropyl-N-((3-(((2-iodobenzyl)- 572.3 4.98
oxy)methyl)phenyl)(piperidin-4-yl)- methyl)isoxazole-3-carboxamide
111 5-cyclopropyl-N-((3-((2- 490.4 11.35
methoxyphenethoxy)methyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 112
5-cyclopropyl-N-((3-((2- 474.4 11.25
methylplienethoxy)methyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 113
5-cyclopropyl-N-((3- 356.25 3.67
(hydroxymethyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 114
N-(4-(aminomethyl)-3-ethylphenyl)-5- 268.99 13.86
cyclopropylisoxazole-3-carboxamide (-NH.sub.2) 115
5-cyclopropyl-N-((3-((3- 427.3 17.42
hydroxypropyl)carbamoyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 116
5-cyclopropyl-N-((3-((2- 475.35 18.31
hydroxybenzyl)carbamoyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 117
5-cyclopropyl-N-(piperidin-4-yl(3- 446.40 9.3
(pyridin-2-ylcarbamoyl)phenyl)methyl)- isoxazole-3-carboxamide 118
5-cyclopropyl-N-((3-((2- 427.35 19.37
(ethylamino)ethoxy)methyl)phenyl)-
(piperidin-4-yl)methyl)isoxazole-3- carboxamide 119
N-((3-((2-aminoethoxy)methyl)phenyl)- 399.30 13.19
(piperidin-4-yl)methyl)-5- cyclopropylisoxazole-3-carboxamide 120
5-cyclopropyl-N-(piperidin-4-yl(3- 398.35 20.62
(propoxymethyl)phenyl)methyl)isoxazole- 3-carboxamide 121
N-(4-(1-amino-4-hydroxybutyl)phenyl)- 316.10 4.36
5-cyclopropylisoxazole-3-carboxamide 122 5-cyclopropyl-N-(1- 305.10
11.83 oxaspiro[5.5]undecan-4-yl)isoxazole-3- carboxamide 123
5-cyclopropyl-N-(3- 319.3 4.79
ethoxyspiro[3.5[nonan-1-yl)isoxazole-3- carboxamide 124
5-cyclopropyl-N-(3- 305.10 26.51
oxaspiro[5.5]undecan-9-yl)isoxazole-3- carboxamide 125
N-(1-benzyl-6-methylpiperidin-3-yl)-5- 340.10 21.2
cyclopropylisoxazole-3-carboxamide 126
5-cyclopropyl-N-(3-phenylcyclopentyl)- 297.1 29.97
isoxazole-3-carboxamide 127 5-cyclopropyl-N-(2-(3,4- 335.1 49.59
difluorophenyl)tetrahydrofuran-3-yl)- isoxazole-3-carboxamide 128
5-cyclopropyl-N-(2,2- 265.4 44.55 dimethyltetrahydro-2H-pyran-
4-yl)isoxazole-3-carboxamide 129
5-cyclopropyl-N-(6-oxaspiro[4.5]decan- 291.1 18.41
9-yl)isoxazole-3-carboxamide 130 N-((3-((((1r,4r)-4- 1.38
aminocyclohexyl)oxy)methyl)phenyl)- (piperidin-4-yl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 131 5-cyclopropyl-N-((3- 16.6
((isopropyl(tetrahydro-2H-pyran-
4-yl)amino)methyl)phenyl)(piperidin- 4-yl)methyl)isoxazole-3-
carboxamide 132 methyl 5-(aminomethyl)-2- 299.83 48.66
(5-cyclopropylisoxazole-3- (M - NH.sub.2) carboxamido)benzoate 133
5-cyclopropyl-N-(piperidin-4-yl(3- 466.12 6.48 (pyridin-4-
ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide 134
N-(3-butoxy-2,2-dimethylcyclobutyl)-5- 307.3 18.73
cyclopropylisoxazole-3-carboxamide 135
5-cyclopropyl-N-(6-hydroxy-1,2,3,4- 299.10 23.68
tetiahydronaphthalen-2-yl)isoxazole-3- carboxamide 136
5-cyclopropyl-N-(3-isobutoxy-2,2- 307.2 9.54
dimethylcyclobutyl)isoxazole-3- carboxamide 137
5-cyclopropyl-N-(2-(4- 331.3 2.56
fluorophenyl)tetrahydro-2H-pyran-4- yl)isoxazole-3-carboxamide 138
N-(1-(1-benzylpyrrolidin-3-yl)ethyl)-5- 340.3 24.96
cyclopropylisoxazole-3-carboxamide 139 5-cyclopropyl-N-((3-(((2-
413.25 41.77 hydroxyethyl)(methyl)amino)methyl)-
phenyl)(piperidin-4-yl)methyl) isoxazole-3-carboxamide 140
5-cyclopropyl-N-((3-((4-methyl-1H- 462.17 28.35 pyrrole-2-
carboxamido)methyl)phenyl)(piperidin-
4-yl)methyl)isoxazole-3-carboxamide 141
5-cyclopropyl-N-((3-((3-(4-methyl-1H- 491.35 25.42 pyrazol-1-
yl)propanamido)methyl)phenyl)(piperidin-
4-yl)methyl)isoxazole-3-carboxamide 142
N-((3-carbamoylphenyl)(piperidin-4- 369.15 3.6
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 143
N-((1r,4r)-4-aminocyclohexyl)-5- 260.1 18.56
(difluoromethyl)isoxazole-3- carboxamide 144
5-cyclopropyl-N-(2-isobutyltetrahydro- 293.2 7.16
2H-pyran-4-yl)isoxazole-3-carboxamide 145
N-(1-(1-cyclobutylpiperidin-3-yl)ethyl)- 318.4 18.08
5-cyclopropylisoxazole-3-carboxamide 146
5-cyclopropyl-N-(2-isopropyl-4,5,6,7- 315.1 27.28
tetrahydro-2H-indazo1-6-yl)isoxazole-3- carboxamide 147
N-(4-(aminomethyl)-2- 310.15 4.07 (hydroxymethyl)phenyl)-5- (+Na)
cyclopropylisoxazole-3-carboxamide 148 N-(4-(1-amino-3-(pyridin-2-
363.3 0.97 yl)propyl)phenyl)-5- cyclopropylisoxazole-3-carboxamide
149 N-(4-(1-amino-3-(pyridin-3- 363.3 0.62 yl)propyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 150 N-(4-(1-amino-3-(pyridin-4-
363.3 1.39 yl)propyl)phenyl)-5- cyclopropylisoxazole-3-carboxamide
151 N-(4-(1-amino-3-phenylpropyl)phenyl)- 345.12 2.34
5-cyclopropylisoxazole-3-carboxamide (M - NH.sub.2) 152
5-cyclopropyl-N-((1-glycylpiperidin-4- 383.4 4.47
yl)(phenyl)methyl)isoxazole-3- carboxamide 153
N-((1-(D-alanyl)piperidin-4- 397.35 1.27 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 154 N-((1-(L-alanyl)piperidin-4-
397.35 1.53 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 155 5-cyclopropyl-N-((3- 445.4
4.15 (phenylcarbamoyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 156
(.+-.)-cis-5-cyclopropyl-N-(3- 275.4 31.11
cyclopropylcyclohexyl)isoxazole-3- carboxamide 157
(.+-.)-trans-5-cyclopropyl-N-(3- 275.3 39.9
cyclopropylcyclohexyl)isoxazole-3- carboxamide 158
(.+-.)-cis-5-cyclopropyl-N-(3-(1-methyl- 315.1 10.07
1H-imidazol-2-yl)cyclohexyl)isoxazole- 3-carboxamide 159
(.+-.)-trans-5-cyclopropyl-N-((1S,3S)-3-(1 315.1 14.94
methyl-1H-imidazol-2- yl)cyclohexyl)isoxazole-3-carboxamide 160
N-(4-(aminomethyl)-3-isopropylphenyl) 322.2 17.14
5-cyclopropylisoxazole-3-carboxamide (+Na) 161
N-(4-(aminomethyl)-3- 310.2 12.36 (hydroxymethyl)phenyl)-5- (+Na)
cyclopropylisoxazole-3-carboxamide 162
(R)-5-cyclopropyl-N-(piperidin-4-yl(3- 446.3 49 (pyridin-3-
ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide 163
(S)-5-cyclopropyl-N-(piperidin-4-yl(3- 446.3 0.85 (pyridin-3-
ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide 164 N-(4-((2-
337.1 17.78 aminoacetamido)methyl)phenyl)-5- (+Na)
cyclopropylisoxazole-3-carboxamide 165
N-((1-benzyl-5-methylpyrrolidin-3- 340.2 43.84
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 166
N-((4-chlorophenyl)(4-methylmorpholin- 376.2 31.49
2-yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 167
5-cyclopropyl-N-(1,2-dimethylpiperidin- 263.1 28.85
3-yl)isoxazole-3-carboxamide 168 N-(1-benzylpiperidin-3-yl)-5-
326.1 26.38 cyclopropylisoxazole-3-carboxamide 169
5-cyclopropyl-N-((3-(oxetan-3- 425.3 35.06
ylcarbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
170 N-(4-(2-aminopropan-2-yl)phenyl)-5- 286.88 3.54
cyclopropylisoxazole-3-carboxamide 171
N-(4-(1-amino-2-((1-methylpiperidin-4- 398.25 24.39
yl)amino)-2-oxoethyl)phenyl)-5- cyclopropylisoxazole-3-caxboxamide
172 5-cyclopropyl-N-((3-((6-methylpyridin- 460.3 5.9
3-yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 173
5-cyclopropyl-N-((3-(piperidin-3- 452.3 38.93
ylcarbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
174 N-((3-((5-carbamoylpyridin-3- 489.3 10.82
yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide
175 5-cyclopropyl-N-(1-phenyl-3-(1H-1,2,4- 338.15 41.58
triazol-1-yl)propyl)isoxazole-3- carboxamide 176
5-cyclopropyl-N-((3-((6- 475.35 3.45 (methylamino)pyridin-3-
yl)carbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
177 5-cyclopropyl-N-((3-((6- 476.35 4.59 methoxypyridin-3-
yl)carbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
178 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 335.25 0.47
5-cyclopropylisoxazole-3-carboxamide 179
N-((1-(L-alanyl)piperidin-4-yl)methyl)- 321.25 0.75
5-cyclopropylisoxazole-3-carboxamide 180
N-((1-(D-alanyl)piperidin-4-yl)methyl)- 321.2 9.05
5-cyclopropylisoxazole-3-carboxamide 181
5-cyclopropyl-N-(piperidin-4-yl(3- 447.35 7.34 (pyridazin-4-
ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide 182
5-cyclopropyl-N-(2-((2- 399.30 14.19 hydroxybenzyl)amino)-2-oxo-1-
(pipendin-4-yl)ethyl)isoxazole-3- carboxamide 183
5-cyclopropyl-N-(piperidin-4-yl(3-((6- 514.35 8.28
(trifluoromethyl)pyridin-3- yl)carbamoyl)phenyl)methyl)isoxazole-
3-carboxamide 184 5-cyclopropyl-N-(piperidin-4-yl(3- 447.85 2.16
(pyrimidin-5- ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide
185 5-cyclopropyl-N-(piperidin-4-yl(3- 447.4 1.7 (pyridazin-3-
ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide 186
5-cyclopropyl-N-((3-((2-hydroxypyridin- 462.35 29.68
3-yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 187
5-cyclopropyl-N-((3-((5-methylpyridin- 460.35 2.88
3-yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxarnide 188
N-(1-(1-(D-alanyl)piperidin-4-yl)ethyl)- 335.25 3.69
5-cyclopropylisoxazole-3-carboxamide 189
N-(1-(1-(L-tryptophyl)piperidin-4- 450.4 0.52
yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 190
N-(1-(1-(D-tryptophyl)piperidin-4- 450.4 10.09
yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 191
N-((1-(L-tryptophyl)piperidin-4- 436.35 0.56
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 192
N-((1-(D-tryptophyl)piperidin-4- 435.35 6.5
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 193
N-((1-(L-seryl)piperidin-4- 413.35 3.51 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 194
N-((1-(L-tyrosyl)piperidin-4- 489.5 2.69 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-caxboxamide 195
N-((1-(L-tryptophyl)piperidin-4- 512.29 1.42 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 196
N-((1-(L-seryl)piperidin-4-yl)methyl)-5- 337.25 3.28
cyclopropylisoxazole-3-carboxamide 197
N-((1-(L-tyrosyl)piperidin-4-yl)methyl)- 413.35 0.43
5-cyclopropylisoxazole-3-carboxamide 198
(.+-.)-trans-5-cyclopropyl-N-(4-(4- 319.2 17.68
fluorophenyl)-4-hydroxybutan-2- yl)isoxazole-3-carboxamide 199
ethyl 1-(L-tyrosyl)-5-(5- 471.4 43.3 cyclopropylisoxazole-3-
carboxamido)piperidine-3-carboxylate 200
N-((3-((6-acetamidopyridin-3- 503.45 4.57
yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 201
5-cyclopropyl-N-(piperidin-4-yl(3- 447.3 18.97 (pyrazin-2-
ylcarbamoyl)phenyl)methyl)isoxazole-3- carboxamide 202
5-cyclopropyl-N-((3-((6-hydroxypyridin- 462.35 49.68
3-yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 203 methyl
2-(1-(L-alanyl)piperidin-4-yl)-2- 379.3 0.74
(5-cyclopropylisoxazole-3- carboxamido)acetate 204 methyl
2-(1-(D-alanyl)piperidin-4-yl)-2- 379.3 7.54
(5-cyclopropylisoxazole-3- carboxamido)acetate 205
N-((1-(L-alanyl)piperidin-4-yl)(3- 517.35 0.29
(pyridin-3-ylcarbamoyl)phenyl)methyl)-
5-cyclopropylisoxazole-3-carboxamide 206
N-((1-(D-alanyl)piperidin-4-yl)(3- 517.45 0.59
(pyridin-3-ylcarbamoyl)phenyl)methyl)-
5-cyclopropylisoxazole-3-carboxamide 207
N-((1-(D-tryptophyl)piperidin-4- 534.5 23.23 yl)(phenyl)methyl)-5-
(+Na) cyclopropylisoxazole-3-carboxamide 208
N-(1-(1-(L-valyl)piperidin-4-yl)ethyl)-5- 363.35 0.36
cyclopropylisoxazole-3-carboxamide 209
N-(1-(1-(D-valyl)piperidin-4-yl)ethyl)-5- 363.35 2.42
cyclopropylisoxazole-3-caxboxamide 210
N-(1-(1-(L-seryl)piperidin-4-yl)ethyl)-5- 373.3 1.2
cyclopropylisoxazole-3-carboxamide (+Na) 211
N-(1-(1-(L-tyrosyl)piperidin-4-yl)ethyl)- 427.35 0.2
5-cyclopropylisoxazole-3-carboxamide 212
tert-butyl4-(1-(5-cyclopropylisoxazole- 386.25 28.43
3-carboxamido)ethyl)piperidine-1- (+Na) carboxylate 213
5-cyclopropyl-N-(1-(piperidin-4- 264.2 7.12
yl)ethyl)isoxazole-3-carboxamide 214
5-cyclopropyl-N-(piperidin-4-yl(pyridin- 327.25 3.15
4-yl)methyl)isoxazole-3-carboxamide 215
N-((S)-(1-(L-alanyl)piperidin-4- 397.35 0.21 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 216
N-((R)-(1-(L-alanyl)piperidin-4- 397.35 4.48 yl)(phenyl)methyl)-5-
cyclopropylisoxazole-3-carboxamide 218
5-cyclopropyl-N-(2-oxo-1-(piperidin-4- 370.3 26.87
yl)-2-(pyridin-3- ylamino)ethyl)isoxazole-3-carboxamide 219
5-cyclopropyl-N-(2-oxo-1-(piperidin-4- 384.3 34.17
yl)-2-((pyridin-3- ylmethyl)amino)ethyl)isoxazole-3- carboxamide
220 5-cyclopropyl-N-(piperidin-4-yl(3- 432.35 2.22 ((pyridin-3-
ylamino)methyl)phenyl)methyl)isoxazole- 3-carboxamide 221
N-((3-((6-aminopyridin-3- 461.4 7.49
yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 222
5-cyclopropyl-N-((3-(methyl(pyridin-3- 460.4 31.99
yl)carbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
223 methyl 2-(1-(L-tryptophyl)piperidin-4- 494.18 3.15
yl)-2-(5-cyclopropylisoxazole-3- carboxamido)acetate 224 methyl
2-(1-(D-tiyptophyl)piperidin-4- 494.23 29.42
yl)-2-(5-cyclopropylisoxazole-3- carboxamido)acetate 225
N-(1-(1-(D-seryl)piperidin-4-yl)ethyl)-5- 351.3 5.82
cyclopropylisoxazole-3-carboxamide 226
N-((1-(L-valyl)piperidin-4-yl)methyl)-5- 349.3 0.57
cyclopropylisoxazole-3-carboxamide 227
N-((1-(D-valyl)piperidin-4-yl)methyl)-5- 349.25 4.01
cyclopropylisoxazole-3-carboxamide 228
N-((1-(D-seryl)piperidin-4-yl)methyl)-5- 337.25 13.18
cyclopropylisoxazole-3-carboxamide 229
5-cyclopropyl-N-((3-((1-methyl-1H- 449.4 5.5 pyrazol-4-
yl)carbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
230 N-(1-(1-(D-alanyl)piperidin-4- 349.3 1.93
yl)propyl)-5-cyclopropylisoxazole-3- carboxamide 231
N-(1-(1-(L-alanyl)piperidin-4-yl)propyl)- 349.25 0.9
5-cyclopropylisoxazole-3-carboxamide 232
5-cyclopropyl-N-(2-oxo-1-(piperidin-4- 370.2 6.36 yl)-2-(pyridin-2-
ylamino)ethyl)isoxazole-3-carboxamide 233 N-((3-((4-aminopyridin-2-
461.3 5.1 yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 234
N-((3-((6-cyanopyridin-3- 471.4 5.42
yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 235
N-(1-(1-(D-tyrosyl)piperidin-4-yl)ethyl)- 427.3 6.5
5-cyclopropylisoxazole-3-carboxamide 236
N-((1-(D-tyrosyl)piperidin-4-yl)methyl)- 413.25 14.3
5-cyclopropylisoxazole-3-carboxamide 237
5-cyclopropyl-N-(1-(1-((S)-2- 336.2 25.65
hydroxypropanoyl)piperidin-4- yl)ethyl)isoxazole-3-carboxamide 238
(R)-N-(3-(3-aminobutanamido)-2,2- 323.1 4.43
dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide 239
(S)-N-(3-(3-aminobutanamido)-2,2- 323.1 6.35
dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide 240
N-(3-(3-aminopropanamido)-2,2- 309.1 12.72
dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide 241
N-(1-(1-(L-alanyl)piperidin-4-yl)-2-oxo- 455.3 15.58
2-((pyridin-3-ylmethyl)amino)ethyl)-5-
cyciopropylisoxazole-3-carboxamide 242
N-(1-(1-(L-alanyl)piperidin-4-yl)-2-oxo- 455.25 22.31
2-((pyridin-4-ylmethyl)amino)ethyl)-5-
cyclopropylisoxazole-3-caxboxamide 243
N-(1-(1-(L-alanyl)piperidin-4-yl)-2-((2- 470.35 2.72
hydroxybenzyl)amino)-2-oxoethyl)-5-
cyclopropylisoxazole-3-caxboxamide 244 ethyl
2-(5-cyclopropylisoxazole-3- 322.2 20.57
carboxamido)-2-(piperidin-4-yl)acetate 245
N-((3-((2-aminopyridin-4- 461.3 4.13
yl)carbamoyl)phenyl)(piperidin-4-
yl)methyl)-5-cyclopropylisoxazoIe-3- carboxamide 246
5-cyclopropyl-N-((3-((6- 489.4 5.95 (dimethylamino)pyridin-3-
yl)carbamoyl)phenyl)(piperidin-4- yl)methyl)isoxazole-3-carboxamide
247 N-(1-(1-((R)-3-aminobutanoyl)piperidin- 349.25 0.62
4-yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 248
N-(1-(1-((S)-3-aminobutanoyl)piperidin- 349.25 1.47
4-yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 249
(S)-N-(4-(2-aminopropanamido)butyl)-5- 295.15 14.62
cyclopropylisoxazole-3-caxboxamide 250
(R)-N-(4-(2-aminopropanamido)butyl)- 295.15 36.02
5-cyclopropylisoxazole-3-carboxamide 251
N-(((S)-1-(D-alanyl)pyrrolidin-3- 307.15 30.73
yl)methyl)-5-cyclopropylisoxazole-3- caxboxamide 252
N-(((S)-1-(L-alanyl)pyrrolidin-3- 307.05 21.36
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 253
N-(((R)-1-(D-alanyl)pyrrolidin-3- 307.15 32.34
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 254
N-(4-aminobutyl)-5- 224.1 41.44 cyclopropylisoxazole-3-carboxamide
255 (R)-5-cyclopropyl-N-(pyrrolidin-3- 236.1 39.25
ylmethyl)isoxazole-3-carboxamide 256
(S)-5-cyclopropyl-N-(pyrrolidin-3- 236.1 37.48
ylmethyl)isoxazole-3-carboxamide 257 5-cyclopropyl-N-((3- 446.35
7.37 (nicotmamido)phenyl)(piperidin-4-
yl)methyl)isoxazole-3-carboxamide 258
N-(1-(1-(L-alanyl)piperidin-4-yl)-2-oxo- 441.3 11.47
2-(pyridin-3-ylamino)ethyl)-5- cyclopropylisoxazole-3-carboxamide
259 N-(1-(1-(L-alanyl)piperidin-4-yl)-2-oxo- 455.3 11.04
2-((pyridin-2-ylmethyl)amino)ethyl)-5-
cyclopropylisoxazole-3-carboxamide 260
N-(((R)-1-(L-alanyl)pyrrolidin-3- 307.15 15.5
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 261
N-(1-(1-(L-alanyl)piperidin-4-yl)-2-oxo- 441.3 0.39
2-(pyridin-2-ylamino)ethyl)-5- cyclopropylisoxazole-3-carboxamide
262 N-(1-(1-(L-alanyl)piperidin-4-yl)-2-oxo- 441.35 8.5
2-(pyridin-4-ylamino)ethyl)-5- cyclopropylisoxazole-3-carboxamide
263 5-cyclopropyl-N-((4-hydroxypiperidin-4- 266.15 14.89
yl)methyl)isoxazole-3-carboxamide 264 ethyl
4-((5-cyclopropylisoxazole-3- 322.1 43.56
carboxamido)methyl)piperidine-4- carboxylate 265
5-cyclopropyl-N-((4-methylpiperidin-4- 264.15 41.74
yl)methyl)isoxazole-3-carboxamide 266
5-cyclopropyl-N-((-fluoropiperidin-4- 268.05 18.82
yl)methyl)isoxazole-3-carboxamide 267
N-((1-(L-alanyl)-4-hydroxypiperidin-4- 337.35 5.47
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 268 ethyl
1-(L-alanyl)-4-((5- 393.15 3.22 cyclopropylisoxazole-3-
carboxamido)methyl)piperidine-4- carboxylate 269
N-((1-(L-alanyl)-4-methylpiperidin-4- 335.15 1.67
yl)methyl)-5-cyclopropylisoxazole-3- carboxamide 270
N-((1-(L-alanyl)-4-fluoropiperidin-4- 339.15 4.15
yl)methyl)-5-cyclopropylisoxazoIe-3- carboxamide 271
N-(1-(1-(L-alanyl)piperidin-4-yl)-2- 351.3 2.23
hydroxyethyl)-5-cyclopropylisoxazole-3- carboxamide 272 ethyl
2-(1-(L-tyrosyl)piperidin-4-yl)-2- 485.3 7.39
(5-cyclopropylisoxazole-3- carboxamido)acetate 273
N-(1-(1-(L-tyrosyl)piperidin-4-yl)-2- 465.25 2.37
hydroxyethyl)-5-cyclopropylisoxazole-3- (+Na) carboxamide 274
5-cyclopropyl-N-(2-hydroxy-1- 280.1 5.93
(piperidin-4-yl)ethyl)isoxazole-3- carboxamide 275 N-(6-(3- 333.2
1.8 aminopropanamido)spiro[3.3]heptan-2-
yl)-5-cyclopropylisoxazole-3- carboxamide[transisomer 276
5-cyclopropyl-N-(2-methoxy-1- 294.1 11.92
(piperidin-4-yl)ethyl)isoxazole-3- carboxamide 277
5-cyclopropyl-N-(2-phenoxy-1- 356.1 10.51
(piperidin-4-yl)ethyl)isoxazole-3- carboxamide 278
5-cyclopropyl-N-(2-isopropoxy-1- 322.2 15.25
(piperidin-4-yl)ethyl)isoxazole-3- carboxamide 279 N-(6-((R)-3-
347.5 1.25 aminobutanamido)spiro[3.3]heptan-2-
yl)-5-cyclopropylisoxazole-3- carboxamide[transisomer 280
N-((1r,4r)-4-aminocyclohexyl)-5- 224.2 18.75
methylisoxazole-3-caxboxamide 281 N-(6-((R)-3- 347.1 5.6
aminobutanamido)spiro[3.3]heptan-2- yl)-5-cyclopropylisoxazole-3-
carboxamide[cisisomer 282 N-(1-(1-(L-alanyl)piperidin-4-yl)-2- 387
2.08 methoxyethyl)-5-cyclopropylisoxazole- (+Na) 3-carboxamide 283
N-(1-(1-(L-alanyl)piperidin-4-yl)-2- 427.35 2.67
phenoxyethyl)-5-cyclopropylisoxazole-3 carboxamide 284
N-(1-(1-(L-alajiyl)piperidin-4-yl)-2- 393.35 1.19
isopropoxyethyl)-5- cyclopropylisoxazole-3-carboxamide 285
N-(1-(1-(L-tyrosyl)piperidin-4-yl)-2- 457.25 1.07
methoxyethyl)-5-cyclopropylisoxazole- 3-carboxamide 286
N-(1-(1-(L-tyrosyl)piperidin-4-yl)-2- 519.3 4.35
phenoxyethyl)-5-cyclopropylisoxazole-3 carboxamide 287
N-(1-(1-(L-tyrosyl)piperidin-4-yl)-2- 485.3 5.2 isopropoxyethyl)-5-
cyclopropylisoxazole-3-carboxamide 288 N-(6-((S)-3- 347.58 3.94
aminobutanamido)spiro[3,3]heptan-2- yl)-5-cyclopropylisoxazole-3-
carboxamide[transisomer 290 N-(6-((S)-3- 347.6 1.82
aminobutanamido)spiro[3.3]heptan-2- yl)-5-cyclopropylisoxazole-3-
carboxamide[cisisomer 291 N-(1-(3-aminopropanoyl)piperidin-3-yl)-
307 25.86 5-cyclopropylisoxazole-3-carboxamide 292
5-cyclopropyl-N-((1r,4r)-4-((2-((2- 365.1 4.88
hydroxyethyl)amino)ethyl)carbamoyl)-
cyclohexyl)isoxazole-3-carboxamide 293 N-(6-((R)-3- 375.4 0.56
aminobutanamido)bicyclo[3.3.1]nonan-
2-yl)-5-cyclopropylisoxazole-3- carboxamide 294 N-(6-((S)-3- 375.3
0.66 aminobutanamido)bicyclo[3.3.1]nonan-
2-yl)-5-cyclopropylisoxazole-3- carboxamide 295 N-(6-(3- 361.4 1.2
aminopropanamido)bicyclo[3.3.1Jnonan-
2-yl)-5-cyclopropylisoxazole-3- carboxamide 296
5-cyclopropyl-N-((1-oxo-2-(pyridin-3- 472.63 36.37
yl)-1,2,3,4-tetrahydroisoquinolin-5-
yl)(piperidin-4-yl)methyl)isoxazole-3- carboxamide 297
N-(1-(4-aminobutanoyl)piperidin-3-yl)- 321.05 18.59
5-cyclopropylisoxazole-3-carboxamide 298
N-(1-(1-(3-aminopropanoyl)piperidin-3- 335.1 37.71
yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 299
5-cyclopropyl-N-(1-(1-glycylpiperidin-3- 321.1 21.81
yl)ethyl)isoxazole-3-carboxamide 300
5-cyclopropyl-N-(1-(piperidin-4- 292.1 8.7
yl)butyl)isoxazole-3-carboxamide 301
5-cyclopropyl-N-(2-phenyl-1-(piperidin- 340.1 36.88
4-yl)ethyl)isoxazole-3-carboxamide 302 N-(1-(((1r,4r)-4-(2- 378.1
27.66 aminoacetamido)cyclohexyl)amino)-1-
oxopropan-2-yl)-5-cyclopropylisoxazole- 3-carboxamide 303
5-cyclopropyl-N-(1-glycylpiperidin-3- 293.1 32.81
yl)isoxazole-3-carboxamide 304
N-(1-(1-(4-aminobutanoyl)piperidin-3- 349.1 21.81
yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 305
5-cyclopropyl-N-(3-methyl-1-(piperidin- 306.15 9.24
4-yl)butyl)isoxazole-3-carboxamide 306 N-(3-(3-aminopropanamido)-2-
295.1 41.9 methylpropyl)-5-cyclopropylisoxazole-3- carboxamide 307
N-(1-(3-aminopropanamido)pentan-3- 309.1 21.73
yl)-5-cyclopropylisoxazole-3- carboxamide 308
N-(4-(3-aminopropanamido)-2- 309.1 22.05 methylbutan-2-yl)-5-
cyclopropylisoxazole-3-carboxamide 309
(1r,4r)-4-(5-cyclopropylisoxazole-3- 322.1 0.71
carboxamido)cyclohexyl3- aminopropanoate 310
N-(3-(4-aminobutanamido)cyclohexyl)- 335.1 27.03
5-cyclopropylisoxazole-3-carboxamide 311 (R)-N-((1-((3- 335.05
10.15 aminobutanamido)methyl)cyclobutyl)
methyl)-5-cyclopropylisoxazole-3- carboxamide 312 N-((1r,4r)-4-((3-
335.1 2.75 aminopropyl)carbamoyl)cyclohexyl)-5-
cyclopropylisoxazole-3-carboxamide 313
N-(4-((R)-3-aminobutanamido)-3,3- 337.1 0.8 dimethylbutan-2-yl)-5-
cyclopropylisoxazole-3-carboxamide 314
N-(4-(3-aminopropanamido)butan-2-yl)- 295.05 27.98
5-cyclopropylisoxazole-3-carboxamide 315
N-(3-(3-aminopropanamido)cyclohexyl)- 321.1 20.78
5-cyclopropylisoxazole-3-carboxamide 316 N-((1r,4r)-4-(3- 295.1
8.58 aminopropanamido)cyclohexyl)-5- methylisoxazole-3-caxboxamide
317 N-((1r,4r)-4-((2- 321.1 3.67
aminoethyl)carbamoyl)cyclohexyl)-5-
cyclopropylisoxazole-3-carboxamide 318
N-(4-((S)-3-aminobutanamido)-3,3- 337.1 2.03 dimethylbutan-2-yl)-5-
cyclopropylisoxazole-3-carboxamide 319
N-(1-((1r,4r)-4-aminocyclohexane-1- 335.1 1.83
carboxamido)propan-2-yl)-5- cyclopropylisoxazole-3-carboxamide 320
N-(1-(4-aminobutanamido)propan-2-yl)- 295.1 12.94
5-cyclopropylisoxazole-3-carboxamide 321 5
-cyclopropyl-N-(1-(piperidin-3 - 264 26.78
yl)ethyl)isoxazole-3-carboxamide 322
N-(1-(4-aminobutanamido)butan-2-yl)-5- 309.1 17.38
cyclopropylisoxazole-3-carboxamide 323
N-(1-((1r,4r)-4-aminocyclohexane-1- 349.1 1.3
carboxamido)butan-2-yl)-5- cyclopropylisoxazole-3-carboxamide 324
N-(1-(3-aminopropanamido)butan-2-yl)- 295.1 19.68
5-cyclopropylisoxazole-3-carboxamide 325
N-(4-(3-aminopropanamido)phenyl)-5- 315 1.06
cyclopropylisoxazole-3-carboxamide 326
N-(4-(2-aminoacetamido)phenyl)-5- 301.3 4.24
cyclopropylisoxazole-3-carboxamide 327
N-(4-(4-aminobutanamido)phenyl)-5- 329.05 1.19
cyclopropylisoxazole-3-carboxamide 328
N-(4-((3-aminopropyl)amino)phenyl)-5- 301.05 3.74
cyclopropylisoxazole-3-carboxamide 329
N-(4-((2-aminoethyl)amino)phenyl)-5- 287.05 4.63
cyclopropylisoxazole-3-carboxamide 330 N-((1-((3- 307.1 37.55
aminopropanamido)methyl)cyclopropyl)
methyl)-5-cyclopropylisoxazole-3- carboxamide 331
N-(4-(3-aminopropanamido)-1- 311.1 13.31 hydroxybutan-2-yl)-5-
cyclopropylisoxazole-3-carboxamide 332
5-cyclopropyl-N-(4-(piperidin-4- 355.1 1.37
ylcarbamoyl)phenyl)isoxazole-3- carboxamide 333 N-(4-(((1s,4s)-4-
369.1 8.34 aminocyclohexyl)carbamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 334 N-(4-(((1r,4r)-4- 369.10
3.83 aminocyclohexyl)carbamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 335 N-(3-(N-(2- 351 10
aminoethyl)sulfamoyl)phenyl)-5- cyclopropylisoxazole-3-carboxamide
336 N-(4-(N-(3- 365.10 5.89 aminopropyl)sulfamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 337
N-(3-((2-aminoethyl)carbamoyl)phenyl)- 315 >10
5-cyclopropylisoxazole-3-carboxamide 338 N-(3-(N-(3- 365.1 >10
aminopropyl)sulfamoyl)phenyl)-5- cyclopropylisoxazole-3-carboxamide
339 N-(4-(N-(2- 351.1 7.68 aminoethyl)sulfamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 340
(R)-N-(1-(1-(4-aminobutanoyl)piperidin- 349.15 1.29
4-yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 341
(S)-N-(1-(1-(4-aminobutanoyl)piperidin- 349.15 3.54
4-yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 342
N-(1-((R)-3-aminobutanamido)-2,2- 351.2 1.31
dimethylpentan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 343
N-(1-((3-aminopropyl)sulfonyl)azetidin- 329 >10 >40
3-yl)-5-cyclopropylisoxazole-3- carboxamide 344 (R)-N-(1-(1-((3-
385 5.03 23.42 aminopropyl)sulfonyl)piperidin-4-
yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 345
(S)-N-(1-(1-((3- 385 >10 >40
aminopropyl)sulfonyl)piperidin-4-
yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 346
(S)-5-cyclopropyl-N-(1-(1-(2-(piperidin- 389.1 >10
4-yl)acetyl)piperidin-4- yl)ethyl)isoxazole-3-carboxamide 347
(R)-5-cyclopropyl-N-(1-(1-(2-(piperidin- 389.2 2.6
4-yl)acetyl)piperidin-4- yl)ethyl)isoxazole-3-carboxamide 348
N-((R)-1-(1-((1r,4R)-4- 389.2 0.46 5.16
aminocyclohexane-1-carbonyl)piperidin-
4-yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 349
N-((S)-1-(1-((1r,4S)-4- 389.2 2.79 >40
aminocyclohexane-1-carbonyl)piperidin-
4-yl)ethyl)-5-cyclopropylisoxazole-3- carboxamide 350
N-(1-((1r,4r)-4-aminocyclohexane-1- 333 >10 >40
carbonyl)azetidin-3-yl)-5- cyclopropylisoxazole-3-carboxamide 351
N-(3-((3- 329.10 >10 >40 aminopropyl)carbamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 352
N-(1-(4-aminobutanoyl)azetidin-3-yl)-5- 293.05 >10 >40
cyclopropylisoxazole-3-carboxamide 353 N-(3-bromo-4-(piperidin-4-
433.1/ 1.44 ylcarbamoyl)phenyl)-5- (433)
cyclopropylisoxazole-3-carboxamide 354
5-cyclopropyl-N-(2-methyl-4-(piperidin- 369.2 2.17
4-ylcarbamoyl)phenyl)isoxazole-3- carboxamide 355
N-(4-((3-aminopropyl)carbamoyl)-3- 407.05/ 1.77
bromophenyl)-5-cyclopropylisoxazole-3- (409) carboxamide 356
N-(4-((3-aminopropyl)carbamoyl)-2- 343.10 3.52
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 447.1/ 7.25 357
N-(3-bromo-4-((piperidin-4- (449) ylmethyl)carbamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 358
N-(4-((3-aminocyclobutyl)carbamoyl)-3- 419/ 1.4
bromophenyl)-5-cyclopropylisoxazole-3- (421.05) carboxamide 359
5-cyclopropyl-N-(4-(N-(piperidin-4- 405 5.81 >40
ylmethyl)sulfamoyl)phenyl)isoxazole-3- carboxamide 360
5-cyclopropyl-N-(3-methyl-4-(piperidin- 369.15 1.41
4-ylcarbamoyl)phenyl)isoxazole-3- carboxamide 361
N-(2-bromo-4-(piperidin-4- 433 1.77 >40 ylcarbamoyl)phenyl)-5-
(435) cyclopropylisoxazole-3-carboxamide 362
N-(4-((4-aminocyclohcxyl)carbamoyl)-3- 383.4 3.74
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 363
N-(4-((4-aminocyclohcxyl)carbamoyl)-2- 447/ 5.59 >40
bromophenyl)-5-cyclopropylisoxazole-3- (449.0) carboxamide 364
N-(4-((2-aminoethyl)carbamoyl)-3- 329.1 6
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 365
N-(4-((2-aminoethyl)carbamoyl)-3- 393.05/ 4.5 >40
bromophenyl)-5-cyclopropylisoxazole-3- (395) carboxamide 366
N-(4-((2-aminoethyl)carbamoyl)-2- 393/ 3.7 38.81
bromophenyl)-5-cyclopropylisoxazole-3- (395.1) carboxamide 367
N-(4-((3-aminopropyl)carbamoyl)-3- 343.1 5.23
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 368
N-(3-bromo-4-(pyrrolidin-3- 419.1/ 3.06 >40
ylcarbamoyl)phenyl)-5- (421) cyclopropylisoxazole-3-carboxamide 369
5-cyclopropyl-N-(2-methyl-4- 383.1 8.43 ((piperidin-4-
ylmethyl)carbamoyl)phenyl)isoxazole-3- carboxamide 370
N-(4-((3-aminocyclobutyl)carbamoyl)-2- 419.1/ 2.74 >40
bromophenyl)-5-cyclopropylisoxazole-3- (421) carboxamide 371
N-(4-((3-aminocyclohexyl)carbamoyl)-3- 447/
bromophenyl)-5-cyclopropylisoxazole-3- (449.15) 9.11 carboxamide
372 N-(4-(N-(4- 405 2.57 21.71 aminocyclohexyl)sulfamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 373
5-cyclopropyl-N-(4-(N-(piperidin-4- 391 6.04 39.07
yl)sulfamoyl)phenyl)isoxazole-3- carboxamide 374
5-cyclopropyl-N-(4-(N-(pyrrolidin-3- 377.2 4.03 >40
yl)sulfamoyl)phenyl)isoxazole-3- carboxamide 375 N-(4-(N-(3- 377
4.72 >40 aminocyclobutyl)sulfamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 376
N-(1-((S)-3-aminobutanamido)-2,2- 351.1 1.17
dimethylpentan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 377
N-(4-((4-aminocyclohexyl)carbamoyl)-3- 447.3/ 2.81
bromophenyl)-5-cyclopropylisoxazole-3- (449) carboxamide 378
N-(4-((4-aminocyclohexyl)carbamoyl)-2- 383.3 6.36
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 379
N-(4-((2-aminoethyl)carbamoyl)-2- 329 2.76
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 380
N-(4-((3-aminopropyl)carbamoyl)-2- 406.9 1.74
bromophenyl)-5-cyclopropylisoxazole-3- (409) carboxamide 381
5-cyclopropyl-N-(2-methyl-4- 355 2 (pyrrolidin-3-
ylcarbamoyl)phenyl)isoxazole-3- carboxamide 382
N-(2-bromo-4-(pyrrolidin-3- 419/ 2.95 ylcarbamoyl)phenyl)-5-
(420.9) cyclopropylisoxazole-3-carboxamide 383
N-(4-((3-aminocyclopentyl)carbamoyl)- 433.1/ 3.23
3-bromophenyl)-5-cyclopropylisoxazole- (435) 3-carboxamide 384
N-(4-((3-aminocyclopentyl)carbamoyl)- 369.15 5.54
2-methylphenyl)-5- cyclopropylisoxazole-3-carboxamide 385
N-(4-((3-aminocyclopentyl)carbamoyl)- 433.15/ 3.29
2-bromophenyl)-5-cyclopropylisoxazole- (435) 3-carboxamide 386
N-(4-((3-aminocyclohexyl)carbamoyl)-2- 383.1 8.02
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 387
N-(4-((3-aminocyclohexyl)carbamoyl)-2- 447/ 5.37
bromophenyl)-5-cyclopropylisoxazole-3- (449.0) carboxamide 388
N-(4-(N-(3- 391 5.11 >40 aminocyclopentyl)sulfamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 389 N-(4-(N-(3- 405.15 3.79
38.09 aminocyclohexyl)sulfamoyl)phenyl)-5-
cyclopropylisoxazole-3-carboxamide 390 5-cyclopropyl-N-(3-methyl-4-
355.1 4.45 (pyrrolidin-3- ylcarbamoyl)phenyl)isoxazole-3-
carboxamide 391 5-cyclopropyl-N-(3-methyl-4- 383.1 >10
((piperidin-4- ylmethyl)carbamoyl)phenyl)isoxazole-3- carboxamide
392 N-(2-bromo-4-((piperidin-4- 447/ 4.78
ylmethyl)carbamoyl)phenyl)-5- (449.0)
cyclopropylisoxazole-3-carboxamide 393
N-(4-((3-aminocyclohexyl)carbamoyl)-3- 383.1 >10
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 394
N-((1s,4s)-4-(N-(2- 357 2.12 aminocthyl)sulfamoyl)cyclohexyl)-5-
cyclopropylisoxazole-3-carboxamide 395
N-(4-((3-aminocyclopentyl)carbamoyl)- 369 4.61 3-methylphenyl)-5-
cyclopropylisoxazole-3-carboxamide 396
N-(4-((3-aminocyclobutyl)carbamoyl)-2- 355.2 3.29
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide 397
N-(3-((3-aminopropyl)sulfonamido)-2,2- 359.1 2.16
dimethylpropyl)-5-cyclopropylisoxazole- 3-carboxamide 398
5-cyclopropyl-N-(2,2-dimethyl-3- 385.15 1.74 (piperidine-4-
sulfonamido)propyl)isoxazole-3- carboxamide 399
N-(4-((3-aminocyclobutyl)carbamoyl)-3- 355 4.56
methylphenyl)-5-cyclopropylisoxazole- 3-carboxamide *IC.sub.50
values are an averagoe of n = 1 to n = 50
Definitions
[0108] For the purpose of the present disclosure, the term "alkyl"
as used by itself or as part of another group refers to a straight-
or branched-chain aliphatic hydrocarbon containing one to twelve
carbon atoms (i.e., C.sub.1-12 alkyl) or the number of carbon atoms
designated (i.e., a C.sub.1 alkyl such as methyl, a C.sub.2 alkyl
such as ethyl, a C.sub.3 alkyl such as propyl or isopropyl, etc.).
In one embodiment, the alkyl group is chosen from a straight chain
C.sub.1-10 alkyl group. In another embodiment, the alkyl group is
chosen from a branched chain C.sub.3-10 alkyl group. In another
embodiment, the alkyl group is chosen from a straight chain
C.sub.1-6 alkyl group. In another embodiment, the alkyl group is
chosen from a branched chain C.sub.3-6 alkyl group. In another
embodiment, the alkyl group is chosen from a straight chain
C.sub.1-4 alkyl group. In another embodiment, the alkyl group is
chosen from a branched chain C.sub.3-4 alkyl group. In another
embodiment, the alkyl group is chosen from a straight or branched
chain C.sub.3-4 alkyl group. In another embodiment, the alkyl group
is partially or completely deuterated, i.e., one or more hydrogen
atoms of the alkyl group are replaced with deuterium atoms.
Non-limiting exemplary C.sub.1-10 alkyl groups include methyl
(including --CD.sub.3), ethyl, propyl, isopropyl, butyl, sec-butyl,
tert-butyl, iso-butyl, 3-pentyl, hexyl, heptyl, octyl, nonyl, and
decyl. Non-limiting exemplary C.sub.1-4 alkyl groups include
methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, and
iso-butyl. Non-limiting exemplary C.sub.1-4 groups include methyl,
ethyl, propyl, isopropyl, and tert-butyl.
[0109] For the purpose of the present disclosure, the term
"optionally substituted alkyl" as used by itself or as part of
another group means that the alkyl as defined above is either
unsubstituted or substituted with one, two, or three substituents
independently chosen from nitro, haloalkoxy, aryloxy, aralkyloxy,
alkylthio, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, alkoxycarbonyl, and
carboxyalkyl. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In
another embodiment, the alkyl is a C.sub.1-4 alkyl. In one
embodiment, the optionally substituted alkyl is substituted with
two substituents. In another embodiment, the optionally substituted
alkyl is substituted with one substituent. Non-limiting exemplary
optionally substituted alkyl groups include
--CH.sub.2CH.sub.2NO.sub.2, --CH.sub.2CH.sub.2CO.sub.2H,
--CH.sub.2CH.sub.2SO.sub.2CH.sub.3, --CH.sub.2CH.sub.2COPh, and
--CH.sub.2C.sub.6H.sub.11.
[0110] For the purpose of the present disclosure, the term
"alkylenyl" as used herein by itself or part of another group
refers to a divalent form of an alkyl group as defined above. In
one embodiment, the alkylenyl is a divalent form of a C.sub.1-6
alkyl. In one embodiment, the alkylenyl is a divalent form of a
C.sub.1-4 alkyl. Non-limiting exemplary alkylenyl groups include
--CH.sub.2CH.sub.2--, --CH.sub.2CH.sub.2CH.sub.2--,
--CH.sub.2CH(CH.sub.3)CH.sub.2--, and
--CH.sub.2C(CH.sub.3).sub.2CH.sub.2--.
[0111] For the purpose of the present disclosure, the term
"cycloalkyl" as used by itself or as part of another group refers
to saturated and partially unsaturated (containing one or two
double bonds) cyclic aliphatic hydrocarbons containing one to three
rings having from three to twelve carbon atoms (i.e., C.sub.3-12
cycloalkyl) or the number of carbons designated. In one embodiment,
the cycloalkyl group has two rings. In one embodiment, the
cycloalkyl group has one ring. In another embodiment, the
cycloalkyl group is chosen from a C.sub.3-8 cycloalkyl group. In
another embodiment, the cycloalkyl group is chosen from a C.sub.3-6
cycloalkyl group. Non-limiting exemplary cycloalkyl groups include
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl,
cyclooctyl, norbornyl, decalin, adamantyl, cyclohexenyl,
spiro[3.3]heptane, and bicyclo[3.3.1]nonane.
[0112] For the purpose of the present disclosure, the term
"optionally substituted cycloalkyl" as used by itself or as part of
another group means that the cycloalkyl as defined above is either
unsubstituted or substituted with one, two, or three substituents
independently chosen from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, cycloalkylamino, haloalkyl, hydroxyalkyl,
alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, alkoxyalkyl.
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, or (heteroaryl)alkyl. In one
embodiment, the optionally substituted cycloalkyl is substituted
with two substituents. In another embodiment, the optionally
substituted cycloalkyl is substituted with one substituent. In one
embodiment, the optionally substituted cycloalkyl is an
(amino)cycloalkyl. For the purpose of the present disclosure, the
term "(amino)cycloalkyl" as used by itself or as part of another
group means that the optionally substituted cycloalkyl as defined
above is substituted with one amino or alkylamino group, and
optionally one or two additional substituents. In one embodiment,
the optionally substituted cycloalkyl is an (amino)cyclohexyl. For
the purpose of the present disclosure, the term "(amino)cyclohexyl"
as used by itself or as part of another group means that the
optionally substituted cycloalkyl as defined above is a cyclohexyl
group substituted with one amino or alkylamino group, and
optionally one or two additional substituents. Non-limiting
exemplary optionally substituted cycloalkyl groups include:
##STR00445## ##STR00446##
[0113] Non-limiting exemplary (amino)cycloalkyl groups include:
##STR00447##
[0114] Non-limiting exemplary (amino)cyclohexyl groups include:
##STR00448##
[0115] For the purpose of the present disclosure, the term
"optionally substituted cyclohexyl" as used by itself or as part of
another group means that the optionally substituted cycloalkyl as
defined above is an optionally substituted cyclohexyl group.
[0116] For the purpose of the present disclosure, the term
"cycloalkylenyl" as used herein by itself or part of another group
refers to a divalent form of an optionally substituted cycloalkyl
group as defined above. In one embodiment, the cycloalkylenyl is a
"cyclohexylenyl." The term "cyclohexylenyl" as used herein by
itself or part of another group refers to a divalent form of an
optionally substituted cyclohexyl group. Non-limiting exemplary
cycloalkylenyl groups include:
##STR00449##
[0117] For the purpose of the present disclosure, the term
"1,4-cyclohexylenyl" as used herein by itself or part of another
group refers to a cyclohexylenyl as defined above wherein the
radicals are in the 1 and 4 positions of the cyclohexyl ring.
Non-limiting exemplary 1,4-cyclohexylenyl groups include:
##STR00450##
[0118] For the purpose of the present disclosure, the term
"(cycloalkylenyl)alkyl" as used herein by itself or part of another
group refers to an alkyl group substituted with a divalent form of
an optionally substituted cycloalkyl group. In one embodiment, the
cycloalkylenyl is a divalent form of optionally substituted
cyclohexyl. In one embodiment, the alkyl is C.sub.1-4 alkyl.
Non-limiting exemplary (cycloalkylenyl)alkyl groups include:
##STR00451##
[0119] For the purpose of the present disclosure, the term
"cycloalkenyl" as used by itself or part of another group refers to
a partially unsaturated cycloalkyl group as defined above. In one
embodiment, the cycloalkenyl has one carbon-to-carbon double bond.
In another embodiment, the cycloalkenyl group is chosen from a
C.sub.4-8 cycloalkenyl group. Exemplary cycloalkenyl groups include
cyclopentenyl and cyclohexenyl.
[0120] For the purpose of the present disclosure, the term
"optionally substituted cycloalkenyl" as used by itself or as part
of another group means that the cycloalkenyl as defined above is
either unsubstituted or substituted with one, two, or three
substituents independently chosen from halo, nitro, cyano, hydroxy,
amino, alkylamino, dialkylamino, haloalkyl, monohydroxyalkyl,
dihydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio,
carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one
embodiment, the optionally substituted cycloalkenyl is substituted
with two substituents. In another embodiment, the optionally
substituted cycloalkenyl is substituted with one substituent. In
another embodiment, the cycloalkenyl is unsubstituted.
[0121] For the purpose of the present disclosure, the term
"alkenyl" as used by itself or as part of another group refers to
an alkyl group as defined above containing one, two or three
carbon-to-carbon double bonds. In one embodiment, the alkenyl group
is chosen from a C.sub.2-6 alkenyl group. In another embodiment,
the alkenyl group is chosen from a C.sub.2-4 alkenyl group.
Non-limiting exemplary alkenyl groups include ethenyl, propenyl,
isopropenyl, butenyl, sec-butenyl, pentenyl, and hexenyl.
[0122] For the purpose of the present disclosure, the term
"optionally substituted alkenyl" as used herein by itself or as
part of another group means the alkenyl as defined above is either
unsubstituted or substituted with one, two or three substituents
independently chosen from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy,
haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido,
sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl,
optionally substituted cycloalkyl, alkenyl, alkynyl, optionally
substituted aryl, optionally substituted heteroaryl, or optionally
substituted heterocyclo.
[0123] For the purpose of the present disclosure, the term
"alkynyl" as used by itself or as part of another group refers to
an alkyl group as defined above containing one to three
carbon-to-carbon triple bonds. In one embodiment, the alkynyl has
one carbon-to-carbon triple bond. In one embodiment, the alkynyl
group is chosen from a C.sub.2-6 alkynyl group. In another
embodiment, the alkynyl group is chosen from a C.sub.2-4 alkynyl
group. Non-limiting exemplary alkynyl groups include ethynyl,
propynyl, butynyl, 2-butynyl, pentynyl, and hexynyl groups.
[0124] For the purpose of the present disclosure, the term
"optionally substituted alkynyl" as used herein by itself or as
part of another group means the alkynyl as defined above is either
unsubstituted or substituted with one, two or three substituents
independently chosen from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy,
haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido,
sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl,
cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclo.
[0125] For the purpose of the present disclosure, the term
"haloalkyl" as used by itself or as part of another group refers to
an alkyl group substituted by one or more fluorine, chlorine,
bromine and/or iodine atoms. In one embodiment, the alkyl group is
substituted by one, two, or three fluorine and/or chlorine atoms.
In another embodiment, the haloalkyl group is chosen from a
C.sub.1-4 haloalkyl group. Non-limiting exemplary haloalkyl groups
include fluoromethyl, difluoromethyl, trifluoromethyl,
pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl,
2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, 4,4,4-trifluorobutyl,
and trichloromethyl groups.
[0126] For the purpose of the present disclosure, the term
"fluoroalkyl" as used by itself or as part of another group refers
to an alkyl group substituted by one or more fluorine atoms. In one
embodiment, the alkyl group is substituted by one, two, or three
fluorine atoms. In another embodiment, the fluoroalkyl group is
chosen from a C.sub.1-4 fluoroalkyl group. Non-limiting exemplary
fluoroalkyl groups include fluoromethyl, difluoromethyl,
trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl,
2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, and
4,4,4-trifluorobutyl.
[0127] For the purpose of the present disclosure, the term
"hydroxyalkyl" as used by itself or as part of another group refers
to an alkyl group substituted with one or more, e.g., one, two, or
three, hydroxy groups. In one embodiment, the hydroxyalkyl group is
a monohydroxyalkyl group, i.e., substituted with one hydroxy group.
In another embodiment, the hydroxyalkyl group is a dihydroxyalkyl
group, i.e., substituted with two hydroxy groups. In another
embodiment, the hydroxyalkyl group is chosen from a C.sub.1-4
hydroxyalkyl group. Non-limiting exemplary hydroxyalkyl groups
include hydroxymethyl, hydroxyethyl, hydroxypropyl and hydroxybutyl
groups, such as I-hydroxyethyl, 2-hydroxyethyl, 1,2-dihydroxyethyl,
2-hydroxypropyl, 3-hydroxypropyl, 3-hydroxybutyl, 4-hydroxybutyl,
2-hydroxy-1-methylpropyl, and 1,3-dihydroxyprop-2-yl.
[0128] For the purpose of the present disclosure, the term "alkoxy"
as used by itself or as part of another group refers to an
optionally substituted alkyl, optionally substituted cycloalkyl,
optionally substituted alkenyl or optionally substituted alkynyl
attached to a terminal oxygen atom. In one embodiment, the alkoxy
group is chosen from a C.sub.1-4 alkoxy group. In another
embodiment, the alkoxy group is chosen from a C.sub.1-4 alkyl
attached to a terminal oxygen atom, e.g., methoxy, ethoxy,
tert-butoxy, --OCH.sub.2C.ident.CH, --OCH.sub.2C.ident.CCH.sub.3,
and --OCH.sub.2CH.sub.2CH.sub.2C.ident.CH.
[0129] For the purpose of the present disclosure, the term
"alkylthio" as used by itself or as part of another group refers to
a sulfur atom substituted by an optionally substituted alkyl group.
In one embodiment, the alkylthio group is chosen from a C.sub.1-4
alkylthio group. Non-limiting exemplary alkylthio groups include
--SCH.sub.3, and --SCH.sub.2CH.sub.3.
[0130] For the purpose of the present disclosure, the term
"alkoxyalkyl" as used by itself or as part of another group refers
to an alkyl group substituted with an alkoxy group. Non-limiting
exemplary alkoxyalkyl groups include methoxymethyl, methoxyethyl,
methoxypropyl, methoxybutyl, ethoxymethyl, ethoxyethyl,
ethoxypropyl, ethoxybutyl, propoxymethyl, iso-propoxymethyl,
propoxyethyl, propoxypropyl, butoxymethyl, tert-butoxymethyl,
isobutoxymethyl, sc-butoxymethyl, pentyloxymethyl,
--CH.sub.2OCH.sub.2C.ident.CH and
--CH.sub.2OCH.sub.2CH.sub.2CH.sub.2C.ident.CH.
[0131] For the purpose of the present disclosure, the term
"haloalkoxy" as used by itself or as part of another group refers
to a haloalkyl attached to a terminal oxygen atom. Non-limiting
exemplary haloalkoxy groups include fluoromethoxy, difluoromethoxy,
trifluoromethoxy, and 2,2,2-trifluoroethoxy.
[0132] For the purpose of the present disclosure, the term
"heteroalkyl" as used by itself or part of another group refers to
a stable straight or branched chain hydrocarbon radical containing
1 to 10 carbon atoms and at least two heteroatoms, which can be the
same or different, selected from O, N, or S, wherein: 1) the
nitrogen atom(s) and sulfur atom(s) can optionally be oxidized;
and/or 2) the nitrogen atom(s) can optionally be quaternized. The
heteroatoms can be placed at any interior position of the
heteroalkyl group or at a position at which the heteroalkyl group
is attached to the remainder of the molecule. In one embodiment,
the heteroalkyl group contains two oxygen atoms. In one embodiment,
the heteroalkyl contains one oxygen and one nitrogen atom, e.g., a
(hydroxyalkylamino)alkyl group, e.g.,
--CH.sub.2N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OH. In one embodiment,
the heteroalkyl contains two nitrogen atoms. Non-limiting exemplary
heteroalkyl groups include --CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3,
--OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3,
--CH--.sub.2NHCH.sub.2CH.sub.2OCH.sub.2,
--OCH.sub.2CH.sub.2NH.sub.2, --NHCH.sub.2CH.sub.2N(H)CH.sub.7,
--NHCH.sub.2CH.sub.2OCH.sub.3, --CH.sub.2OCH.sub.2CH.sub.2NH.sub.2,
--CH.sub.2OCH.sub.2CH.sub.2N(H)CH.sub.2CH.sub.3, and
--OCH.sub.2CH.sub.2OCH.sub.3.
[0133] For the purpose of the present disclosure, the term "aryl"
as used by itself or as part of another group refers to a
monocyclic or bicyclic aromatic ring system having from six to
fourteen carbon atoms (i.e., C.sub.6-14 aryl). Non-limiting
exemplary aryl groups include phenyl (abbreviated as "Ph"),
naphthyl, phenanthryl, anthracyl, indenyl, azulenyl, biphenyl,
biphenylenyl, and fluorenyl groups. In one embodiment, the aryl
group is chosen from phenyl or naphthyl. In one embodiment, the
aryl group is phenyl.
[0134] For the purpose of the present disclosure, the term
"optionally substituted aryl" as used herein by itself or as part
of another group means that the aryl as defined above is either
unsubstituted or substituted with one to five substituents
independently selected from the group consisting of halo, nitro,
cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl,
hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl
aralkyloxy, (aralkyloxy)alkyl, alkylthio, carboxamido, sulfonamido,
alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido,
guanidino, carboxy, carboxyalkyl, heteroalkyl optionally
substituted alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, (C.sub.1-4
haloalkoxy)alkyl, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino,
(alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl,
(carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl,
(cycloalkylamino)alkyl, (hydroxyalkylamino)alkyl,
(amino)(heteroaryl)alkyl, (heterocycloamino)alkyl
(amino)(hydroxy)alkyl, (heteroaryl)alkyl, --N(R.sup.43)(R.sup.44),
--CH.sub.2N(H)C(.dbd.O)--R.sup.45, and --N(H)C(.dbd.O)--R.sup.45,
wherein R.sup.43 is hydrogen, C.sub.1-4 alkyl, optionally
substituted aryl, or optionally substituted heteroaryl; R.sup.44 is
alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl,
or (dialkylamino)alkyl; and R.sup.45 is alkyl, alkoxyalkyl,
(heterocyclo)alkyl. (amino)alkyl, (alkylamino)alkyl,
(dialkylamino)alkyl, optionally substituted aryl, optionally
substituted heteroaryl, aralkyl, or (heteroaryl)alkyl In one
embodiment, the optionally substituted aryl is an optionally
substituted phenyl. In one embodiment, the optionally substituted
phenyl has four substituents. In another embodiment, the optionally
substituted phenyl has three substituents. In another embodiment,
the optionally substituted phenyl has two substituents. In another
embodiment, the optionally substituted phenyl has one substituent.
In another embodiment, the optionally substituted phenyl has at
least one amino, alkylamino, dialkylamino, (amino)alkyl,
(alkylamino)alkyl, (dialkylamino)alkyl. (amino)(heteroaryl)alkyl,
or (amino)(hydroxy)alkyl substituent. Non-limiting exemplary
substituted aryl groups include 2-methylphenyl, 2-methoxyphenyl,
2-fluorophenyl, 2-chlorophenyl, 2-bromophenyl, 3-methylphenyl,
3-methoxyphenyl, 3-fluorophenyl, 3-chlorophenyl, 4-methylphenyl,
4-ethylphenyl, 4-methoxyphenyl, 4-fluorophenyl, 4-chlorophenyl,
2,6-di-fluorophenyl, 2,6-di-chlorophenyl, 2-methyl,
3-methoxyphenyl, 2-ethyl, 3-methoxyphenyl, 3,4-di-methoxyphenyl,
3,5-di-fluorophenyl 3,5-di-methylphenyl, 3,5-dimethoxy,
4-methylphenyl, 2-fluoro-3-chlorophenyl, 3-chloro-4-fluorophenyl,
and 2-phenylpropan-2-amine. The term optionally substituted aryl is
meant to include aryl groups having fused optionally substituted
cycloalkyl and fused optionally substituted heterocyclo rings.
Examples include:
##STR00452##
[0135] For the purpose of the present disclosure, the term
"arylenyl" as used herein by itself or part of another group refers
to a divalent form of an optionally substituted aryl group as
defined above. In one embodiment, the arylenyl is a divalent form
of an optionally substituted phenyl. In one embodiment, the
arylenyl is a divalent form of phenyl. Non-limiting exemplary
alkylenyl groups include:
##STR00453##
[0136] For the purpose of the present disclosure, the term
"aryloxy" as used by itself or as part of another group refers to
an optionally substituted aryl attached to a terminal oxygen atom.
A non-limiting exemplary aryloxy group is PhO--.
[0137] For the purpose of the present disclosure, the term
"heteroaryloxy" as used by itself or as part of another group
refers to an optionally substituted heteroaryl attached to a
terminal oxygen atom.
[0138] For the purpose of the present disclosure, the term
"aralkyloxy" or "arylalkyloxy" as used by itself or as part of
another group refers to an aralkyl group attached to a terminal
oxygen atom. A non-limiting exemplary aralkyloxy group is
PhCH.sub.2O--.
[0139] For the purpose of the present disclosure, the term
"(aralkyloxy)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with an aralkyloxy group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting
exemplary "(aralkyloxy)alkyl" groups include
--CH.sub.4OCH.sub.1(3-F-Ph) and
--CH.sub.2OCH.sub.2CH.sub.2CH.sub.2(2-OMe-Ph).
[0140] For the purpose of the present disclosure, the term
"heteroaryl" or "heteroaromatic" refers to monocyclic and bicyclic
aromatic ring systems having 5 to 14 ring members (i.e., a 5- to
14-membered heteroaryl) and 1, 2, 3, or 4 heteroatoms independently
chosen from oxygen, nitrogen or sulfur. In one embodiment, the
heteroaryl has three heteroatoms. In another embodiment, the
heteroaryl has two heteroatoms. In another embodiment, the
heteroaryl has one heteroatom. In one embodiment, the heteroaryl
has 5 ring atoms, e.g., thienyl. In another embodiment, the
heteroaryl has 6 ring atoms, e.g., pyridyl. Non-limiting exemplary
heteroaryl groups include thienyl, benzo[b]thienyl,
naphtho[2,3-b]thienyl, thianthrenyl, furyl, benzofuryl, pyranyl,
isobenzofuranyl, benzooxazonyl, chromenyl, xanthenyl, 2H-pyrrolyl,
pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrazinyl, pyrimidinyl,
pyridazinyl, isoindolyl, 3H-indolyl, indolyl, indazolyl, purinyl,
isoquinolyl, quinolyl, phthalazinyl, naphthyridinyl, cinnolinyl,
quinazolinyl, pteridinyl, 4aH-carbazolyl, carbazolyl,
.beta.-carbolinyl, phenanthridinyl, acridinyl, pyrimidinyl,
phenanthrolinyl, phenazinyl, thiazolyl, isothiazolyl,
phenothiazolyl, isoxazolyl, furazanyl, and phenoxazinyl. In one
embodiment, the heteroaryl is chosen from thienyl (e.g., thien-2-yl
and thien-3-yl), furyl (e.g., 2-furyl and 3-furyl), pyrrolyl (e.g.,
1H-pyrrol-2-yl and 1H-pyrrol-3-yl), imidazolyl (e.g.,
2H-imidazol-2-yl and 2H-imidazol-4-yl), pyrazolyl (e.g.,
1H-pyrazol-3-yl, 1H-pyrazol-4-yl, and 1H-pyrazol-5-yl), pyridyl
(e.g., pyridin-2-yl, pyridin-3-yl, and pyridin-4-yl), pyrimidinyl
(e.g., pyrimidin-2-yl, pyrimidin-4-yl, and pyrimidin-5-yl),
thiazolyl (e.g., thiazol-2-yl, thiazol-4-yl, and thiazol-5-yl),
isothiazolyl (e.g., isothiazol-3-yl, isothiazol-4-yl, and
isothiazol-5-yl), oxazolyl (e.g., oxazol-2-yl, oxazol-4-yl, and
oxazol-5-yl) and isoxazolyl (e.g., isoxazol-3-yl, isoxazol-4-yl,
and isoxazol-5-yl). The term "heteroaryl" is also meant to include
possible N-oxides. Exemplary N-oxides include pyridyl N-oxide.
[0141] For the purpose of the present disclosure, the term
"optionally substituted heteroaryl" as used by itself or as part of
another group means that the heteroaryl as defined above is either
unsubstituted or substituted with one to four substituents, e.g.,
one or two substituents, independently chosen from halo, nitro,
cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl,
hydroxyalkyl, alkoxy, haloalkoxy, aralkyl, aryloxy, aralkyloxy,
alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl,
alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy,
carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl,
alkynyl, optionally substituted aryl, optionally substituted
heteroaryl, optionally substituted heterocyclo, alkoxyalkyl,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl. (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, (heteroaryl)alkyl,
--N(R.sup.43)(R.sup.44), or --N(H)C(.dbd.O)--R.sup.45, wherein
R.sup.43 is hydrogen or C.sub.1-4 alkyl; R.sup.44 is alkoxyalkyl,
(heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, or
(dialkylamino)alkyl; and R.sup.45 is alkyl, optionally substituted
aryl, or optionally substituted heteroaryl. In one embodiment, the
optionally substituted heteroaryl has one substituent. In one
embodiment, the substituent is amino, alkylamino, dialkylamino,
(amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl,
(dialkylamino)alkyl, (heterocyclo)alkyl, --N(R.sup.43)(R.sup.44),
or --N(H)C(.dbd.O)--R.sup.45. In one embodiment, the substituent is
aralkyl or (heteroaryl)alkyl. Examples include:
##STR00454##
In one embodiment, the optionally substituted heteroaryl is an
optionally substituted pyridyl, i.e., 2-, 3-, or 4-pyridyl. Any
available carbon or nitrogen atom can be substituted. The term
optionally substituted heteroaryl is meant to include heteroaryl
groups having fused optionally substituted cycloalkyl and fused
optionally substituted heterocyclo rings. Examples include:
##STR00455##
[0142] For the purpose of the present disclosure, the term
"heteroarylenyl" as used herein by itself or part of another group
refers to a divalent form of an optionally substituted heteroaryl
group as defined above. In one embodiment, the heteroarylenyl is a
divalent form of an optionally substituted pyridyl. Non-limiting
exemplary heteroarylenyl groups include:
##STR00456##
[0143] For the purpose of the present disclosure, the term
"heterocycle" or "heterocyclo" as used by itself or as part of
another group refers to saturated and partially unsaturated (e.g.,
containing one or two double bonds) cyclic groups containing one,
two, or three rings having from three to fourteen ring members
(i.e., a 3- to 14-membered heterocyclo) and at least one
heteroatom. Each heteroatom is independently selected from the
group consisting of oxygen, sulfur, including sulfoxide and
sulfone, and/or nitrogen atoms, which can be quaternized. The term
"heterocyclo" is meant to include cyclic ureido groups such as
imidazolidinyl-2-one, cyclic amide groups such as .beta.-lactam,
.gamma.-lactam, .delta.-lactam and .epsilon.-lactam, and cyclic
carbamate groups such as oxazolidinyl-2-one. The term "heterocyclo"
is also meant to include groups having fused optionally substituted
aryl groups, e.g., indolinyl, indolinyl-2-one,
benzo[d]oxazolyl-2(3H)one. In one embodiment, the heterocyclo group
is chosen from a 4-, 5-, 6-, 7- or 8-membered cyclic group
containing one ring and one or two oxygen and/or nitrogen atoms. In
one embodiment, the heterocyclo group is chosen from a 5- or
6-membered cyclic group containing one ring and one or two nitrogen
atoms. In one embodiment, the heterocyclo group is chosen from a
8-, 9-, 10-, 11-, or 12-membered cyclic group containing two rings
and one or two nitrogen atoms. The heterocyclo can be optionally
linked to the rest of the molecule through a carbon or nitrogen
atom. Non-limiting exemplary heterocyclo groups include
2-oxopyrrolidin-3-yl, 2-imidazolidinone, piperidinyl, morpholinyl,
piperazinyl, pyrrolidinyl, 8-azabicyclo[3.2.1]octane (nortropane),
6-azaspiro[2.5]octane, 6-azaspiro[3.4]octane, indolinyl,
indolinyl-2-one, 1,3-dihydro-2H-benzo[d]imidazol-2-one
[0144] For the purpose of the present disclosure, the term
"optionally substituted heterocyclo" as used herein by itself or
part of another group means the heterocyclo as defined above is
either unsubstituted or substituted with one to four substituents
independently selected from halo, nitro, cyano, hydroxy, amino,
alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy,
haloalkoxy, aryloxy, aralkyl aralkyloxy, alkylthio, carboxamido,
sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl,
arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl,
cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo,
alkoxyalkyl, (amino)alkyl, hydroxyalkylamino. (alkylamino)alkyl,
(dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl,
mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl.
Substitution may occur on any available carbon or nitrogen atom,
and may form a spirocycle. In one embodiment, the optionally
substituted heterocyclo is substituted with at least one amino,
alkylamino, or dialkylamino group. Non-limiting exemplary
optionally substituted heterocyclo groups include:
##STR00457##
[0145] For the purpose of the present disclosure, the term
"heterocyclenyl" as used herein by itself or part of another group
refers to a divalent form of an optionally substituted heterocyclo
group as defined above. In one embodiment, the heterocyclenyl is a
divalent form of an optionally substituted azetidine. In one
embodiment, the heterocyclenyl is a divalent form of an optionally
substituted piperidinyl. Non-limiting exemplary heterocyclenyl
groups include:
##STR00458##
[0146] For the purpose of the present disclosure, the term
"optionally substituted pyrrolidinyl" as used by itself or as part
of another group means that the optionally substituted heterocyclo
as defined above is an optionally substituted pyrrolidinyl
group.
[0147] For the purpose of the present disclosure, the term
"optionally substituted pyrrolidinonyl" as used herein by itself or
part of another group refers to a divalent form of an optionally
substituted pyrrolidinyl group as defined above. Non-limiting
exemplary optionally substituted pyrrolidinenyl groups include:
##STR00459##
[0148] For the purpose of the present disclosure, the term
"optionally substituted, optionally bridged piperidinenyl" as used
by itself or as part of another group refers to a divalent form
having the following structure:
##STR00460##
wherein:
[0149] R.sup.2'a, R.sup.2'b, R.sup.3'a, R.sup.3'b, R.sup.4'a,
R.sup.4'b, R.sup.5'a, and R.sup.5'b are each independently selected
from the group consisting of hydrogen, halo, C.sub.1-6 alkyl,
C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally
substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; or
[0150] R.sup.2'a and R.sup.2'b taken together with the carbon atom
to which they are attached form a C.sub.3-6 cycloalkyl; and
R.sup.3'a, R.sup.3'b, R.sup.4'a, R.sup.4'bR.sup.5'a, and R.sup.5'b
are each independently selected from the group consisting of
hydrogen, halo, and C.sub.1-4 alkyl; or
[0151] R.sup.3'a and R.sup.3'b taken together with the carbon atom
to which they are attached form a C.sub.3-6 cycloalkyl; and
R.sup.2'a, R.sup.2'b, R.sup.4'a, R.sup.4'b, R.sup.5'a, and
R.sup.5'b are each independently selected from the group consisting
of hydrogen, halo, and C.sub.1-4 alkyl; or
[0152] R.sup.4a and R.sup.4b taken together with the carbon atom to
which they are attached form a Cu cycloalkyl; and R.sup.2'a,
R.sup.2'b, R.sup.3'a, R.sup.3'b, R.sup.4'a, and R.sup.4'b are each
independently selected from the group consisting of hydrogen, halo,
and C.sub.1-4 alkyl; or
[0153] R.sup.5'a and R.sup.5'b taken together with the carbon atom
to which they are attached form a C.sub.3-6 cycloalkyl; and
R.sup.2'a, R.sup.2'b, R.sup.3'a, R.sup.3'b, R.sup.4'a, and
R.sup.4'b are each independently selected from the group consisting
of hydrogen, halo, and C.sub.1-4 alkyl; or
[0154] R.sup.2'a and R.sup.5'a taken together form a C.sub.1-4
bridge; and R.sup.2'b, R.sup.3'a, R.sup.3'b, R.sup.4'a, R.sup.4'b,
and R.sup.5'b are each independently selected from the group
consisting of hydrogen, halo, and C.sub.1-4 alkyl, or
[0155] R.sup.3'a and R.sup.4'a taken together form a C.sub.1-4
bridge; and R.sup.2'a, R.sup.2'b, R.sup.3'b, R.sup.4'a, R.sup.5'a,
and R.sup.5'b are each independently selected from the group
consisting of hydrogen, halo, and C.sub.1-4 alkyl; or
[0156] R.sup.2'a and R.sup.4'a taken together form a C.sub.1-4
bridge; and R.sup.2'b, R.sup.3'a, R.sup.3'b, R.sup.4'b, R.sup.5'a,
and R.sup.5'b are each independently selected from the group
consisting of hydrogen, halo, and C.sub.1-4 alkyl; or
[0157] R.sup.3'a and R.sup.5'a taken form a C.sub.1-4 bridge; and
R.sup.2'a, R.sup.2'b, R.sup.3'b, R.sup.4'a, R.sup.4'b, and
R.sup.5'b are each independently selected from the group consisting
of hydrogen, halo, and C.sub.1-4 alkyl;
[0158] R.sup.6' is selected from the group consisting of hydrogen
and C.sub.1-4 alkyl;
[0159] For the purpose of the present disclosure, the term "amino"
as used by itself or as part of another group refers to
--NH.sub.2.
[0160] For the purpose of the present disclosure, the term
"alkylamino" as used by itself or as part of another group refers
to --NHR.sup.22, wherein R.sup.22 is C.sub.1-6 alkyl. In one
embodiment, R.sup.22 is C.sub.1-4 alkyl. Non-limiting exemplary
alkylamino groups include --N(H)CH.sub.3 and
--N(H)CH.sub.2CH.sub.3.
[0161] For the purpose of the present disclosure, the term
"dialkylamino" as used by itself or as part of another group refers
to --NR.sup.23aR.sup.23b, wherein R.sup.23a and R.sup.23b are each
independently C.sub.1-6 alkyl. In one embodiment, R.sup.23a and
R.sup.23b are each independently C.sub.1-4 alkyl. Non-limiting
exemplary dialkylamino groups include --N(CH.sub.3).sub.2 and
--N(CH.sub.3)CH.sub.2CH(CH.sub.3).sub.2.
[0162] For the purpose of the present disclosure, the term
"hydroxyalkylamino" as used by itself or as part of another group
refers to --NR.sup.24a R.sup.24b, wherein R.sup.24a is hydrogen or
C.sub.1-4 alkyl, and R.sup.24b is hydroxyalkyl. Non-limiting
exemplary hydroxyalkylamino groups include
--N(H)CH.sub.2CH.sub.2OH, --N(H)CH.sub.2CH.sub.2CH.sub.2OH,
--N(CH.sub.3)CH.sub.2CH.sub.2OH, and
--N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OH
[0163] For the purpose of the present disclosure, the term
"(hydroxyalkylamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with an
hydroxyalkylamino group. In one embodiment, the alkyl is a
C.sub.1-4 alkyl. A non-limiting exemplary (hydroxyalkylamino)alkyl
group is --CH.sub.2N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OH.
[0164] For the purpose of the present disclosure, the term
"cycloalkylamino" as used by itself or as part of another group
refers to --NR.sup.25aR.sup.25b, wherein R.sup.25a is optionally
substituted cycloalkyl and R.sup.25b is hydrogen or C.sub.1-4
alkyl.
[0165] For the purpose of the present disclosure, the term
"heterocycloamino" as used by itself or as part of another group
refers to --NR.sup.25cR.sup.25d, wherein R.sup.25c is optionally
substituted heterocyclo and R.sup.25d is hydrogen or C.sub.1-4
alkyl. Non-limiting exemplary heterocycloamino groups include:
##STR00461##
[0166] For the purpose of the present disclosure, the term
"(heterocycloamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with an heterocycloamino
group. In one embodiment, the alkyl is a C.sub.1-4 alkyl.
[0167] For the purpose of the present disclosure, the term
"aralkylamino" as used by itself or as part of another group refers
to --NR.sup.26aR.sup.26b, wherein R.sup.26a is aralkyl and
R.sup.26b is hydrogen or C.sub.1-4 alkyl. Non-limiting exemplary
aralkylamino groups include --N(H)CH.sub.2Ph and
--N(CH.sub.3)CH.sub.2Ph.
[0168] For the purpose of the present disclosure, the term
"(amino)alkyl" as used by itself or as part of another group refers
to an alkyl group substituted with an amino group. In one
embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary
(amino)alkyl groups include --CH.sub.2NH.sub.2,
--C(NH.sub.2)(H)CH.sub.3, --CH.sub.2CH.sub.2NH.sub.2,
--CH.sub.2C(NH.sub.2)(H)CH.sub.3,
--CH.sub.2CH.sub.2CH.sub.2NH.sub.2,
--CH.sub.2CH.sub.2CH.sub.2CH.sub.2NH.sub.2, and
--CH.sub.2C(CH.sub.3).sub.2CH.sub.2NH.sub.2.
[0169] For the purpose of the present disclosure, the term
"(alkylamino)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with an alkylamino group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. A non-limiting
exemplary (alkylamino)alkyl group is
--CH.sub.2CH.sub.2N(H)CH.sub.3.
[0170] For the purpose of the present disclosure, the term
"(dialkylamino)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted by a dialkylamino group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting
exemplary (dialkylamino)alkyl groups are
--CH.sub.2CH.sub.2N(CH.sub.3).sub.2.
[0171] For the purpose of the present disclosure, the term
"(cycloalkylamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted by a cycloalkylamino
group. In one embodiment, the alkyl is a C.sub.1-4 alkyl.
Non-limiting exemplary (cycloalkylamino)alkyl groups include
--CH.sub.2N(H)cyclopropyl, --CH.sub.2N(H)cyclobutyl, and
--CH.sub.2N(H)cyclohexyl.
[0172] For the purpose of the present disclosure, the term
"(aralkylamino)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with an aralkylamino group. In
one embodiment, the alkyl is a C.sub.1-4 alkyl. A non-limiting
exemplary (aralkylamino)alkyl group is
--CH.sub.2CH.sub.2CH.sub.2N(H)CH.sub.2Ph.
[0173] For the purpose of the present disclosure, the term
"(hydroxyalkylamino)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with an
hydroxyalkylamino group. A non-limiting exemplary
(hydroxyalkylamino)alkyl group is
--CH.sub.2CH.sub.2NHCH.sub.2CH.sub.2OH
[0174] For the purpose of the present disclosure, the term
"(cyano)alkyl" as used by itself or as part of another group refers
to an alkyl group substituted with one or more cyano, e.g., --CN,
groups. In one embodiment, the alkyl is a C.sub.1-4 alkyl.
Non-limiting exemplary (cyano)alkyl groups include
--CH.sub.2CH.sub.2CN, --CH.sub.2CH.sub.2CH.sub.2CN, and
--CH.sub.2C.sub.2CH.sub.2CH.sub.2CH.sub.2CN.
[0175] For the purpose of the present disclosure, the term
"(amino)(hydroxy)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one amino,
alkylamino, dialkylamino, or heterocyclo group and one hydroxy
group. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In
another embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting
exemplary (amino)(hydroxy)alkyl groups include:
##STR00462##
[0176] For the purpose of the present disclosure, the term
"(amino)(carboxamido)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one amino,
alkylamino, or dialkylamino, and one carboxamido group. In one
embodiment, the alkyl is a C.sub.1-6 alkyl. Non-limiting exemplary
(amino)(carboxamido)alkyl groups include:
##STR00463##
[0177] For the purpose of the present disclosure, the term
"(amino)(aryl)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one amino, alkylamino, or
dialkylamino group and one optionally substituted aryl group. In
one embodiment, the alkyl is a C.sub.1-6 alkyl. In one embodiment,
the optionally substituted aryl group is an optionally substituted
phenyl. Non-limiting exemplary (amino)(aryl)alkyl groups
include:
##STR00464##
[0178] For the purpose of the present disclosure, the term
"(amino)(heteroaryl)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one amino,
alkylamino, or dialkylamino group and one optionally substituted
heteroaryl group. In one embodiment, the alkyl is a C.sub.1-6
alkyl. In one embodiment, the alkyl is a C.sub.1-4 alkyl. In one
embodiment, the optionally substituted heteroaryl group is an
optionally substituted pyridyl. Non-limiting exemplary
(amino)(heteroaryl)alkyl groups include:
##STR00465##
[0179] For the purpose of the present disclosure, the term
"(cycloalkyl)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one optionally
substituted cycloalkyl group. In one embodiment, the alkyl is a
C.sub.1-4 alkyl. In one embodiment, the cycloalkyl is a C.sub.3-6
cycloalkyl. In one embodiment, the optionally substituted
cycloalkyl group is substituted with an amino or (amino)alkyl
group. Non-limiting exemplary (cycloalkyl)alkyl groups include:
##STR00466##
[0180] For the purpose of the present disclosure, the term
"(hydroxy)(aryl)alkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one hydroxy group
and one optionally substituted aryl group. In one embodiment, the
alkyl is a C.sub.1-6 alkyl. In one embodiment, the optionally
substituted aryl group is an optionally substituted phenyl.
Non-limiting exemplary (hydroxy)(aryl)alkyl groups include:
##STR00467##
[0181] For the purpose of the present disclosure, the term
"carboxamido" as used by itself or as part of another group refers
to a radical of formula --C(.dbd.O)NR.sup.26aR.sup.26b, wherein
R.sup.26a and R.sup.26b are each independently hydrogen, optionally
substituted alkyl, optionally substituted aryl, aralkyl,
(heteroaryl)alkyl, or optionally substituted heteroaryl, or
R.sup.26a and R.sup.26b taken together with the nitrogen to which
they are attached from a 3- to 8-membered heterocyclo group. In one
embodiment, R.sup.26a and R.sup.26b are each independently hydrogen
or optionally substituted alkyl. Non-limiting exemplary carboxamido
groups include --CONH.sub.2, --CON(H)CH.sub.3, CON(CH.sub.3).sub.2,
and --CON(H)Ph.
[0182] For the purpose of the present disclosure, the term
"(carboxamido)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with a carboxamido group.
Non-limiting exemplary (carboxamido)alkyl groups include
--CH.sub.2CONH.sub.2, --C(H)CH.sub.3--CONH.sub.2, and
--CH.sub.2CON(H)CH.sub.3.
[0183] For the purpose of the present disclosure, the term
"sulfonamido" as used by itself or as part of another group refers
to a radical of the formula --SO.sub.2NR.sup.27aR.sup.27b, wherein
R.sup.27a and R.sup.27b are each independently hydrogen, optionally
substituted alkyl, or optionally substituted aryl, or R.sup.27a and
R.sup.27b taken together with the nitrogen to which they are
attached from a 3- to 8-membered heterocyclo group. Non-limiting
exemplary sulfonamido groups include --SO.sub.2NH.sub.2,
--SO.sub.2N(H)CH.sub.3, and --SO.sub.2N(H)Ph.
[0184] For the purpose of the present disclosure, the term
"alkylcarbonyl" as used by itself or as part of another group
refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an
alkyl group. A non-limiting exemplary alkylcarbonyl group is
--COCH.sub.3.
[0185] For the purpose of the present disclosure, the term
"arylcarbonyl" as used by itself or as part of another group refers
to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an
optionally substituted aryl group. A non-limiting exemplary
arylcarbonyl group is --COPh.
[0186] For the purpose of the present disclosure, the term
"alkylsulfonyl" as used by itself or as part of another group
refers to a sulfonyl group, i.e., --SO.sub.2--, substituted by any
of the above-mentioned optionally substituted alkyl groups. A
non-limiting exemplary alkylsulfobnyl group is
--SO.sub.2CH.sub.3.
[0187] For the purpose of the present disclosure, the term
"arylsulfonyl" as used by itself or as part of another group refers
to a sulfonyl group, i.e., --SO.sub.2--, substituted by any of the
above-mentioned optionally substituted aryl groups. A non-limiting
exemplary arylsulfonyl group is --SO.sub.2Ph.
[0188] For the purpose of the present disclosure, the term
"mercaptoalkyl" as used by itself or as part of another group
refers to any of the above-mentioned alkyl groups substituted by a
--SH group.
[0189] For the purpose of the present disclosure, the term
"carboxy" as used by itself or as part of another group refers to a
radical of the formula --COOH.
[0190] For the purpose of the present disclosure, the term
"carboxyalkyl" as used by itself or as part of another group refers
to any of the above-mentioned alkyl groups substituted with a
--COOH. A non-limiting exemplary carboxyalkyl group is
--CH.sub.2CO.sub.2H.
[0191] For the purpose of the present disclosure, the term
"alkoxycarbonyl" as used by itself or as part of another group
refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an
alkoxy group. Non-limiting exemplary alkoxycarbonyl groups are
--CO.sub.2Me and --CO.sub.2Et.
[0192] For the purpose of the present disclosure, the term
"aralkyl" or "arylalkyl" as used by itself or as part of another
group refers to an alkyl group substituted with one, two, or three
optionally substituted aryl groups. In one embodiment, the aralkyl
group is a C.sub.1-4 alkyl substituted with one optionally
substituted aryl group. Non-limiting exemplary aralkyl groups
include benzyl, phenethyl, --CHPh.sub.2, --CH.sub.2(4-OH-Ph), and
--CH(4-F-Ph).sub.2.
[0193] For the purpose of the present disclosure, the term "ureido"
as used by itself or as part of another group refers to a radical
of the formula --NR.sup.30a--C(.dbd.O)--NR.sup.30bR.sup.30c,
wherein R.sup.22a is hydrogen, alkyl, or optionally substituted
aryl, and R.sup.30b and R.sup.30c are each independently hydrogen,
alkyl, or optionally substituted aryl, or R.sup.30b and R.sup.30c
taken together with the nitrogen to which they are attached form a
4- to 8-membered heterocyclo group. Non-limiting exemplary ureido
groups include --NH--C(C.dbd.O)--NH.sub.2 and
--NH--C(C.dbd.O)--NHCH.sub.3.
[0194] For the purpose of the present disclosure, the term
"guanidino" as used by itself or as part of another group refers to
a radical of the formula
--NR.sup.28a--C(.dbd.NR.sup.29)--NR.sup.28bR.sup.28c, wherein
R.sup.28a, R.sup.28b, and R.sup.28c are each independently
hydrogen, alkyl, or optionally substituted aryl, and R.sup.29 is
hydrogen, alkyl, cyano, alkylsulfonyl, alkylcarbonyl, carboxamido,
or sulfonamido. Non-limiting exemplary guanidino groups include
--NH--C(C.dbd.NH)--NH.sub.2, --NH--C(C.dbd.NCN)--NH.sub.2, and
--NH--C(C.dbd.NH)--NHCH.sub.3.
[0195] For the purpose of the present disclosure, the term
"(heterocyclo)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one, two, or three
optionally substituted heterocyclo groups. In one embodiment, the
(heterocyclo)alkyl is a C.sub.1-4 alkyl substituted with one
optionally substituted heterocyclo group. The heterocyclo can be
linked to the alkyl group through a carbon or nitrogen atom.
Non-limiting exemplary (heterocyclo)alkyl groups include:
##STR00468##
[0196] For the purpose of the present disclosure, the term
"(heteroaryl)alkyl" as used by itself or as part of another group
refers to an alkyl group substituted with one, two, or three
optionally substituted heteroaryl groups. In one embodiment, the
(heteroaryl)alkyl group is a C.sub.1-4 alkyl substituted with one
optionally substituted heteroaryl group. Non-limiting exemplary
(heteroaryl)alkyl groups include:
##STR00469##
[0197] For the purpose of the present disclosure, the term
"alkylcarbonylamino" as used by itself or as part of another group
refers to an alkylcarbonyl group attached to an amino. A
non-limiting exemplary alkylcarbonylamino group is
--NHCOCH.sub.3.
[0198] For the purpose of the present disclosure, the term
"C.sub.1-4 bridge" refers to a --CH.sub.2--, --(CH.sub.2).sub.2--,
--(CH.sub.2).sub.3--, or --(CH.sub.2).sub.4-- group that joins two
carbon atoms of a piperidine to form an azabicyclo group. For
example, in Formula I, R.sup.3a and R.sup.4a of B can be taken
together to form a 6-azabicyclo[3.1.1]heptane,
8-azabicyclo[3.2.1]octane, 9-azabicyclo[3.3.1]nonane, or
10-azabicyclo[4.3.1]decane group. Each methylene unit of the
C.sub.1-4 bridge can be optionally substituted with one or two
substituents independently selected from the group consisting of
C.sub.1-4 alkyl and halo.
[0199] The present disclosure encompasses any of the Compounds of
the Disclosure being isotopically-labelled (i.e., radiolabeled) by
having one or more atoms replaced by an atom having a different
atomic mass or mass number. Examples of isotopes that can be
incorporated into the disclosed compounds include isotopes of
hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and
chlorine, such as .sup.2H (or deuterium (D)), .sup.3H, .sup.11C,
.sup.13C, .sup.14C, .sup.5N, .sup.13O, .sup.17O, .sup.31P,
.sup.32P, .sup.35S, .sup.18F, and .sup.36Cl, respectively, e.g.,
.sup.3H, .sup.11C, and .sup.14C. In one embodiment, provided is a
composition wherein substantially all of the atoms at a position
within the Compound of the Disclosure are replaced by an atom
having a different atomic mass or mass number. In another
embodiment, provided is a composition wherein a portion of the
atoms at a position within the Compound of the disclosure are
replaced, i.e., the Compound of the Disclosure is enriched at a
position with an atom having a different atomic mass or mass
number." Isotopically-labelled Compounds of the Disclosure can be
prepared by methods known in the art.
[0200] Compounds of the Disclosure may contain one or more
asymmetric centers and may thus give rise to enantiomers,
diasteromers, and other stereoisomeric forms. The present
disclosure is meant to encompass the use of all such possible
forms, as well as their racemic and resolved forms and mixtures
thereof. The individual enantiomers can be separated according to
methods known in the art in view of the present disclosure. When
the compounds described herein contain olefinic double bonds or
other centers of geometric asymmetry, and unless specified
otherwise, it is intended that they include both E and Z geometric
isomers. All tautomers are intended to be encompassed by the
present disclosure as well.
[0201] As used herein, the term "stereoisomers" is a general term
for all isomers of individual molecules that differ only in the
orientation of their atoms in space. It includes enantiomers and
isomers of compounds with more than one chiral center that are not
mirror images of one another (diastereomers).
[0202] The term "chiral center" or "asymmetric carbon atom" refers
to a carbon atom to which four different groups are attached.
[0203] The terms "enantiomer" and "enantiomeric" refer to a
molecule that cannot be superimposed on its mirror image and hence
is optically active wherein the enantiomer rotates the plane of
polarized light in one direction and its mirror image compound
rotates the plane of polarized light in the opposite direction.
[0204] The term "racemic" refers to a mixture of equal parts of
enantiomers and which mixture is optically inactive.
[0205] The term "absolute configuration" refers to the spatial
arrangement of the atoms of a chiral molecular entity (or group)
and its stereochemical description, e.g., R or S.
[0206] The stereochemical terms and conventions used in the
specification are meant to be consistent with those described in
Pure & Appl. Chem 68:2193 (1996), unless otherwise
indicated.
[0207] The term "enantiomeric excess" or "ee" refers to a measure
for how much of one enantiomer is present compared to the other.
For a mixture of R and S enantiomers, the percent enantiomeric
excess is defined as |R-S|*100, where R and S are the respective
mole or weight fractions of enantiomers in a mixture such that
R+S=1. With knowledge of the optical rotation of a chiral
substance, the percent enantiomeric excess is defined as
([.alpha.].sub.obs/[.alpha.].sub.max)*100, where [.alpha.].sub.obs
is the optical rotation of the mixture of enantiomers and
[.alpha.].sub.max is the optical rotation of the pure enantiomer.
Determination of enantiomeric excess is possible using a variety of
analytical techniques, including NMR spectroscopy, chiral column
chromatography or optical polarimetry.
[0208] The terms "enantiomerically pure" or "enantiopure" refer to
a sample of a chiral substance all of whose molecules (within the
limits of detection) have the same chirality sense.
[0209] The terms "enantiomerically enriched" or "enantioenriched"
refer to a sample of a chiral substance whose enantiomeric ratio is
greater than 50:50. Enantiomerically enriched compounds may be
enantiomerically pure.
[0210] The terms "a" and "an" refer to one or more.
[0211] The term "about," as used herein, includes the recited
number.+-.10%. Thus, "about 10" means 9 to 11.
[0212] The present disclosure encompasses the preparation and use
of salts of the Compounds of the Disclosure, including non-toxic
pharmaceutically acceptable salts. Examples of pharmaceutically
acceptable addition salts include inorganic and organic acid
addition salts and basic salts. The pharmaceutically acceptable
salts include, but are not limited to, metal salts such as sodium
salt, potassium salt, cesium salt and the like; alkaline earth
metals such as calcium salt, magnesium salt and the like; organic
amine salts such as triethylamine salt, pyridine salt, picoline
salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine
salt, N,N'-dibenzylethylenediamine salt and the like; inorganic
acid salts such as hydrochloride, hydrobromide, phosphate, sulphate
and the like; organic acid salts such as citrate, lactate,
tartrate, maleate, fumarate, mandelate, acetate, dichloroacetate,
trifluoroacetate, oxalate, formate and the like; sulfonates such as
methanesulfonate, benzenesulfonate, p-toluenesulfonate and the
like; and amino acid salts such as arginate, asparaginate,
glutamate and the like. The term "pharmaceutically acceptable salt"
as used herein, refers to any salt, e.g., obtained by reaction with
an acid or a base, of a Compound of the Disclosure that is
physiologically tolerated in the target patient (e.g., a mammal,
e.g., a human).
[0213] Acid addition salts can be formed by mixing a solution of
the particular Compound of the Disclosure with a solution of a
pharmaceutically acceptable non-toxic acid such as hydrochloric
acid, fumaric acid, maleic acid, succinic acid, acetic acid, citric
acid, tartaric acid, carbonic acid, phosphoric acid, oxalic acid,
dichloroacetic acid, or the like. Basic salts can be formed by
mixing a solution of the compound of the present disclosure with a
solution of a pharmaceutically acceptable non-toxic base such as
sodium hydroxide, potassium hydroxide, choline hydroxide, sodium
carbonate and the like.
[0214] The present disclosure encompasses the preparation and use
of solvates of Compounds of the Disclosure. Solvates typically do
not significantly alter the physiological activity or toxicity of
the compounds, and as such may function as pharmacological
equivalents. The term "solvate" as used herein is a combination,
physical association and/or solvation of a compound of the present
disclosure with a solvent molecule such as, e.g. a desolvate,
monosolvate or hemisolvate, where the ratio of solvent molecule to
compound of the present disclosure is about 2:1, about 1:1 or about
1:2, respectively. This physical association involves varying
degrees of ionic and covalent bonding, including hydrogen bonding.
In certain instances, the solvate can be isolated, such as when one
or more solvent molecules are incorporated into the crystal lattice
of a crystalline solid. Thus, "solvate" encompasses both
solution-phase and isolatable solvates. Compounds of the Disclosure
can be present as solvated forms with a pharmaceutically acceptable
solvent, such as water, methanol, ethanol, and the like, and it is
intended that the disclosure includes both solvated and unsolvated
forms of Compounds of the Disclosure. One type of solvate is a
hydrate. A "hydrate" relates to a particular subgroup of solvates
where the solvent molecule is water. Solvates typically can
function as pharmacological equivalents. Preparation of solvates is
known in the art. See, for example, M. Caira et al, J. Pharmaceut.
Sci., 93(3):601-611 (2004), which describes the preparation of
solvates of fluconazole with ethyl acetate and with water. Similar
preparation of solvates, hemisolvates, hydrates, and the like are
described by E. C, van Tonder et al., AAPS Pharm. Sci. Tech.,
5(l):Article 12 (2004), and A. L. Bingham et al., Chem. Commun.
603-604 (2001). A typical, non-limiting, process of preparing a
solvate would involve dissolving a Compound of the Disclosure in a
desired solvent (organic, water, or a mixture thereof) at
temperatures above 20.degree. C. to about 25.degree. C., then
cooling the solution at a rate sufficient to form crystals, and
isolating the crystals by known methods, e.g., filtration.
Analytical techniques such as infrared spectroscopy can be used to
confirm the presence of the solvent in a crystal of the
solvate.
[0215] Since Compounds of the Disclosure are inhibitors of SMYD
proteins, such as SMYD3 and SMYD2, a number of diseases,
conditions, or disorders mediated by SMYD proteins, such as SMYD3
and SMYD2, can be treated by employing these compounds. The present
disclosure is thus directed generally to a method for treating a
disease, condition, or disorder responsive to the inhibition of
SMYD proteins, such as SMYD3 and SMYD2, in an animal suffering
from, or at risk of suffering from, the disorder, the method
comprising administering to the animal an effective amount of one
or more Compounds of the Disclosure.
[0216] The present disclosure is further directed to a method of
inhibiting SMYD proteins in an animal in need thereof, the method
comprising administering to the animal a therapeutically effective
amount of at least one Compound of the Disclosure.
[0217] The present disclosure is further directed to a method of
inhibiting SMYD3 in an animal in need thereof, the method
comprising administering to the animal a therapeutically effective
amount of at least one Compound of the Disclosure.
[0218] The present disclosure is further directed to a method of
inhibiting SMYD2 in an animal in need thereof, the method
comprising administering to the animal a therapeutically effective
amount of at least one Compound of the Disclosure.
[0219] As used herein, the terms "treat," "treating," "treatment,"
and the like refer to eliminating, reducing, or ameliorating a
disease or condition, and/or symptoms associated therewith.
Although not precluded, treating a disease or condition does not
require that the disease, condition, or symptoms associated
therewith be completely eliminated. As used herein, the terms
"treat." "treating." "treatment," and the like may include
"prophylactic treatment," which refers to reducing the probability
of redeveloping a disease or condition, or of a recurrence of a
previously-controlled disease or condition, in a subject who does
not have, but is at risk of or is susceptible to, redeveloping a
disease or condition or a recurrence of the disease or condition.
The term "treat" and synonyms contemplate administering a
therapeutically effective amount of a Compound of the Disclosure to
an individual in need of such treatment.
[0220] Within the meaning of the disclosure, "treatment" also
includes relapse prophylaxis or phase prophylaxis, as well as the
treatment of acute or chronic signs, symptoms and/or malfunctions.
The treatment can be orientated symptomatically, for example, to
suppress symptoms. It can be effected over a short period, be
oriented over a medium term, or can be a long-term treatment, for
example within the context of a maintenance therapy.
[0221] The term "therapeutically effective amount" or "effective
dose" as used herein refers to an amount of the active
ingredient(s) that is(are) sufficient, when administered by a
method of the disclosure, to efficaciously deliver the active
ingredient(s) for the treatment of condition or disease of interest
to an individual in need thereof. In the case of a cancer or other
proliferation disorder, the therapeutically effective amount of the
agent may reduce (i.e., retard to some extent and preferably stop)
unwanted cellular proliferation; reduce the number of cancer cells;
reduce the tumor size; inhibit (i.e., retard to some extent and
preferably stop) cancer cell infiltration into peripheral organs;
inhibit (i.e., retard to some extent and preferably stop) tumor
metastasis; inhibit, to some extent, tumor growth; modulate protein
methylation in the target cells; and/or relieve, to some extent,
one or more of the symptoms associated with the cancer. To the
extent the administered compound or composition prevents growth
and/or kills existing cancer cells, it may be cytostatic and/or
cytotoxic.
[0222] The term "container" means any receptacle and closure
therefore suitable for storing, shipping, dispensing, and/or
handling a pharmaceutical product.
[0223] The term "insert" means information accompanying a
pharmaceutical product that provides a description of how to
administer the product, along with the safety and efficacy data
required to allow the physician, pharmacist, and patient to make an
informed decision regarding use of the product. The package insert
generally is regarded as the "label" for a pharmaceutical
product.
[0224] The term "disease" or "condition" or "disorder" denotes
disturbances and/or anomalies that as a rule are regarded as being
pathological conditions or functions, and that can manifest
themselves in the form of particular signs, symptoms, and/or
malfunctions. As demonstrated below, Compounds of the Disclosure
inhibit SMYD proteins, such as SMYD3 and SMYD2 and can be used in
treating diseases and conditions such as proliferative diseases,
wherein inhibition of SMYD proteins, such as SMYD3 and SMYD2
provides a benefit.
[0225] In some embodiments, the Compounds of the Disclosure can be
used to treat a "SMYD protein mediated disorder" (e.g., a
SMYD3-mediated disorder or a SMYD2-mediated disorder). A SMYD
protein mediated disorder is any pathological condition in which a
SMYD protein is know to play a role. In some embodiments, a
SMYD-mediated disorder is a proliferative disease.
[0226] In some embodiments inhibiting SMYD proteins, such as SMYD3
and SMYD2, is the inhibition of the activity of one or more
activities of SMYD proteins such as SMYD3 and SMYD2. In some
embodiments, the activity of the SMYD proteins such as SMYD3 and
SMYD2 is the ability of the SMYD protein such as SMYD3 or SMYD2 to
transfer a methyl group to a target protein (e.g., histone). It
should be appreciated that the activity of the one or more SMYD
proteins such as SMYD3 and SMYD2 may be inhibited in vitro or in
vivo. Examplary levels of inhibition of the activity one or more
SMYD proteins such as SMYD3 and SMYD2 include at least 10%
inhibition, at least 20% inhibition, at least 30% inhibition, at
least 40% inhibition, at least 50% inhibition, at least 60%
inhibition, at least 70% inhibition, at least 80% inhibition, at
least 90%/0 inhibition, and up to 100% inhibition.
[0227] The SMYD (SET and MYND domain) family of lysine
methyltransferases (KMTs) plays pivotal roles in various cellular
processes, including gene expression regulation and DNA damage
response. The family of human SMYD proteins consists of SMYD1,
SMYD2, SMYD3. SMYD4 and SMYD5. SMYD1, SMYD2, and SMYD3 share a high
degree of sequence homology and, with the exception of SMYD5, human
SMYD proteins harbor at least one C-terminal tetratrico peptide
repeat (TPR) domain. (See e.g., Abu-Farha et al. J Mol Cell Biol
(2011) 3 (5) 301-308). The SMYD proteins have been found to be
linked to various cancers (See e.g., Hamamoto et al. Nat Cell.
Biol. 2004, 6: 731-740), Hu et al. Cancer Research 2009, 4067-4072,
and Komatsu et al. Carcinogenesis 2009, 301139-1146.)
[0228] SMYD3 is a protein methyltransferase found to be expressed
at high levels in a number of different cancers (Hamamoto, R., et
al., Nat. Cell Biol., 6(8):731-40 (2004)). SMYD3 likely plays a
role in the regulation of gene transcription and signal
transduction pathways critical for survival of breast, liver,
prostate and lung cancer cell lines (Hamamoto, R., et al., Nat.
Cell Biol., 6(8):731-40 (2004); Hamamoto, R., et al., Cancer Sci.,
97(2):113-8 (2006); Van Aller, G. S., et al., Epigenetics,
7(4):340-3 (2012); Liu, C., et al., J. Natl. Cancer Inst.,
105(22):1719-28 (2013): Mazur, P. K., et al., Nature,
510(7504):283-7 (2014)).
[0229] Genetic knockdown of SMYD3 leads to a decrease in
proliferation of a variety of cancer cell lines (Hamamoto, R., et
al., Nat. Cell Biol., 6(8):731-40 (2004); Hamamoto. R., et al.,
Cancer Sci., 97(2):113-8 (2006); Van Aller, U.S., et al.,
Epigenetics, 7(4):340-3 (2012); Liu. C., et al., J. Natl. Cancer
Inst., 105(22):1719-28 (2013); Mazur. P. K., et al., Nature,
510(7504):283-7 (2014)). Several studies employing RNAi-based
technologies have shown that ablation of SMYD3 in hepatocellular
carcinoma cell lines greatly reduces cell viability and that its
pro-survival role is dependent on its catalytic activity (Hamamoto.
R., et al., Nat. Cell Biol., 6(8):731-40 (2004); Van Aller, G. S.,
et al., Epigenetics, 7(4):340-3 (2012)). Moreover, SMYD3 has also
been shown to be a critical mediator of transformation resulting
from gain of function mutations in the oncogene, KRAS for both
pancreatic and lung adenocarcinoma in mouse models. The dependence
of KRAS on SMYD3 was also shown to be dependent on its catalytic
activity (Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)).
SMYD3 function has also been implicated in colerectal cancers and
RNAi mediated knockdown of SMYD3 has been shown to impair
colerectal cell proliferation. (Peserico et al., Cell Physiol. 2015
Feb. 28. doi: 10.1002/jcp.24975. [Epub ahead of print]).
[0230] Furthermore. SMYD3 function has also been shown to play a
role in immunology and development. For instance, de Almeida
reported that SMYD3 plays a role in generation of inducible
regulatory T cells (iTreg) cells. In a mouse model of respiratory
syncytial virus (RSV) infection, a model in which iTreg cells have
a critical role in regulating lung pathogenesis, SMYD3-/- mice
demonstrated exacerbation of RSV-induced disease related to
enhanced proinflammatory responses and worsened pathogenesis within
the lung (de Almeida et al. Mucosal Immunol. 2015 Feb. 11. doi:
10.1038/mi.2015.4. [Epub ahead of print]). In addition, as to
development, Proserpio et al. have shown the importance of SMYD3 in
the regulation of skeletal muscle atrophy (Proserpio et al. Genes
Dev. 2013 Jun. 1; 27(11):1299-312), while Fujii et al. have
elucidated the role of SMYD3 in cardiac and skeletal muscle
development (Fujii et al. PLoS One. 2011; 6(8):e23491).
[0231] SMYD2 (SET and MYND domain-containing protein 2) was first
characterized as protein that is a member of a sub-family of SET
domain containing proteins which catalyze the site-specific
transfer of methyl groups onto substrate proteins. SMYD2 was
initially shown to have methyltransferase activity towards lysine
36 on histone H3 (H3K36) but has subsequently been shown to have
both histone and non-histone methyltrasferase activity.
[0232] SMYD2 has been implicated in the pathogenesis of multiple
cancers. It has been shown to be over-expressed, compared to
matched normal samples, in tumors of the breast, cervix, colon,
kidney, liver, head and neck, skin, pancreas, ovary, esophagus and
prostate, as well as hematologic malignancies such as AML, B- and
T-ALL, CLL and MCL, suggesting a role for SMYD2 in the biology of
these cancers. More specifically, studies using genetic knock-down
of SMYD2 have demonstrated anti-proliferative effects in esophageal
squamous cell carcinoma (ESCC), bladder carcinoma and cervical
carcinoma cell lines. (See e.g., Komatsu et al., Carcinogenesis
2009, 30, 1139, and Cho et al., Neoplasia, 2012 June;
14(6):476-86). Moreover, high expression of SMYD2 has been shown to
be a poor prognostic factor in both ESCC and pediatric ALL. (See
e.g., Komatsu et al. Br J Cancer. 2015 Jan. 20; 112(2):357-64, and
Sakamoto et al., Leuk Res. 2014 April; 38(4):496-502). Recently,
Nguyen et al., have shown that a small molecule inhibitor of SMYD2
(LLY-507) inhibited the proliferation of several esophageal, liver
and breast cancer cell lines in a dose-dependent manner. (Nguyen et
al. J Bio Chem. 2015 Mar. 30, pii: jbc.M114.626861. [Epub ahead of
print]).
[0233] SMYD2 has also been implicated in immunology. For instance,
Xu et al. have shown that SMYD2 is a negative regulator of
macrophage activation by suppressing Interleukin-6 and TNF-alpha
production. (Xu et al., J Biol Chem. 2015 Feb. 27;
290(9):5414-23).
[0234] In one aspect, the present disclosure provides a method of
treating cancer in a patient comprising administering a
therapeutically effective amount of a Compound of the Disclosure.
While not being limited to a specific mechanism, in some
embodiments, Compounds of the Disclosure can treat cancer by
inhibiting SMYD proteins, such as SMYD3 and SMYD2. Examples of
treatable cancers include, but are not limited to, adrenal cancer,
acinic cell carcinoma, acoustic neuroma, acral lentigious melanoma,
acrospiroma, acute eosinophilic leukemia, acute erythroid leukemia,
acute lymphoblastic leukemia, acute megakaryoblastic leukemia,
acute monocytic leukemia, acute promyelocytic leukemia,
adenocarcinoma, adenoid cystic carcinoma, adenoma, adenomatoid
odontogenic tumor, adenosquamous carcinoma, adipose tissue
neoplasm, adrenocortical carcinoma, adult T-cell leukemia/lymphoma,
aggressive NK-cell leukemia, AIDS-related lymphoma, alveolar
rhabdomyosarcoma, alveolar soft part sarcoma, ameloblastic fibroma,
anaplastic large cell lymphoma, anaplastic thyroid cancer,
angioimmunoblastic T-cell lymphoma, angiomyolipoma, angiosarcoma,
astrocytoma, atypical teratoid rhabdoid tumor, B-cell chronic
lymphocytic leukemia, B-cell prolymphocytic leukemia, B-cell
lymphoma, basal cell carcinoma, biliary tract cancer, bladder
cancer, blastoma, bone cancer, Brenner tumor, Brown tumor,
Burkitt's lymphoma, breast cancer, brain cancer, carcinoma,
carcinoma in situ, carcinosarcoma, cartilage tumor, cementoma,
myeloid sarcoma, chondroma, chordoma, choriocarcinoma, choroid
plexus papilloma, clear-cell sarcoma of the kidney,
craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer,
colorectal cancer, Degos disease, desmoplastic small round cell
tumor, diffuse large B-cell lymphoma, dysembryoplastic
neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine
gland neoplasm, endodermal sinus tumor, enteropathy-associated
T-cell lymphoma, esophageal cancer, fetus in fetu, fibroma,
fibrosarcoma, follicular lymphoma, follicular thyroid cancer,
ganglioneuroma, gastrointestinal cancer, germ cell tumor,
gestational choriocarcinoma, giant cell fibroblastoma, giant cell
tumor of the bone, glial tumor, glioblastoma multiforme, glioma,
gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell
tumor, gynandroblastoma, gallbladder cancer, gastric cancer, hairy
cell leukemia, hemangioblastoma, head and neck cancer,
hemangiopericytoma, hematological malignancy, hepatoblastoma,
hepatosplenic T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's
lymphoma, invasive lobular carcinoma, intestinal cancer, kidney
cancer, laryngeal cancer, lentigo maligna, lethal midline
carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer,
lymphangioma, lymphangiosarcoma, lymphoepithelioma, lymphoma, acute
lymphocytic leukemia, acute myelogeous leukemia, chronic
lymphocytic leukemia, liver cancer, small cell lung cancer,
non-small cell lung cancer, MALT lymphoma, malignant fibrous
histiocytoma, malignant peripheral nerve sheath tumor, malignant
triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma,
mast cell leukemia, mediastinal germ cell tumor, medullary
carcinoma of the breast, medullary thyroid cancer, medulloblastoma,
melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic
urothelial carcinoma, mixed Mullerian tumor, mucinous tumor,
multiple myeloma, muscle tissue neoplasm, mycosis fungoides, myxoid
liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma,
neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma,
ocular cancer, oligoastrocytoma, oligodendroglioma, oncocytoma,
optic nerve sheath meningioma, optic nerve tumor, oral cancer,
osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid
cancer, paraganglioma, pinealoblastoma, pineocytoma, pituicytoma,
pituitary adenoma, pituitary tumor, plasmacytoma, polyembryoma,
precursor T-lymphoblastic lymphoma, primary central nervous system
lymphoma, primary effusion lymphoma, preimary peritoneal cancer,
prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma
periotonei, renal cell carcinoma, renal medullary carcinoma,
retinoblastoma, rhabdomyoma, rhabdomyosarcoma, Richter's
transformation, rectal cancer, sarcoma. Schwannomatosis, seminoma,
Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring
cell carcinoma, skin cancer, small blue round cell tumors, small
cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart,
spinal tumor, splenic marginal zone lymphoma, squamous cell
carcinoma, synovial sarcoma. Sezary's disease, small intestine
cancer, squamous carcinoma, stomach cancer, T-cell lymphoma,
testicular cancer, thecoma, thyroid cancer, transitional cell
carcinoma, throat cancer, urachal cancer, urogenital cancer,
urothelial carcinoma, uveal melanoma, uterine cancer, verrucous
carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer,
Waldenstrom's macroglobulinemia, Warthin's tumor, and Wilms'
tumor.
[0235] In another embodiment, the cancer is breast, cervix, colon,
kidney, liver, head and neck, skin, pancreas, ovary, esophagus, or
prostate cancer.
[0236] In another embodiment, the cancer is a hematologic
malignancy such as acute myeloid leukemia (AML), B- and T-acute
lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL),
or mantle cell lymphoma (MCL).
[0237] In another embodiment, the cancer is esophageal squamous
cell carcinoma (ESCC), bladder carcinoma, or cervical
carcinoma.
[0238] In another embodiment, the cancer is a leukemia, for example
a leukemia selected from acute monocytic leukemia, acute
myelogenous leukemia, chronic myelogenous leukemia, chronic
lymphocytic leukemia and mixed lineage leukemia (MLL). In another
embodiment the cancer is NUT-midline carcinoma. In another
embodiment the cancer is multiple myeloma. In another embodiment
the cancer is a lung cancer such as small cell lung cancer (SCLC).
In another embodiment the cancer is a neuroblastoma. In another
embodiment the cancer is Burkitt's lymphoma. In another embodiment
the cancer is cervical cancer. In another embodiment the cancer is
esophageal cancer. In another embodiment the cancer is ovarian
cancer. In another embodiment the cancer is colorectal cancer. In
another embodiment, the cancer is prostate cancer. In another
embodiment, the cancer is breast cancer.
[0239] In another embodiment, the present disclosure provides a
therapeutic method of modulating protein methylation, gene
expression, cell proliferation, cell differentiation and/or
apoptosis in vivo in the cancers mentioned above by administering a
therapeutically effective amount of a Compound of the Disclosure to
a subject in need of such therapy.
[0240] Compounds of the Disclosure can be administered to a mammal
in the form of a raw chemical without any other components present.
Compounds of the Disclosure can also be administered to a mammal as
part of a pharmaceutical composition containing the compound
combined with a suitable pharmaceutically acceptable carrier. Such
a carrier can be selected from pharmaceutically acceptable
excipients and auxiliaries. The term "pharmaceutically acceptable
carrier" or "pharmaceutically acceptable vehicle" encompasses any
of the standard pharmaceutical carriers, solvents, surfactants, or
vehicles. Suitable pharmaceutically acceptable vehicles include
aqueous vehicles and nonaqueous vehicles. Standard pharmaceutical
carriers and their formulations are described in Remington's
Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 19th ed.
1995.
[0241] Pharmaceutical compositions within the scope of the present
disclosure include all compositions where a Compound of the
Disclosure is combined with one or more pharmaceutically acceptable
carriers. In one embodiment, the Compound of the Disclosure is
present in the composition in an amount that is effective to
achieve its intended therapeutic purpose. While individual needs
may vary, a determination of optimal ranges of effective amounts of
each compound is within the skill of the art. Typically, a Compound
of the Disclosure can be administered to a mammal, e.g., a human,
orally at a dose of from about 0.0025 to about 1500 mg per kg body
weight of the mammal, or an equivalent amount of a pharmaceutically
acceptable salt or solvate thereof, per day to treat the particular
disorder. A useful oral dose of a Compound of the Disclosure
administered to a mammal is from about 0.0025 to about 50 mg per kg
body weight of the mammal, or an equivalent amount of the
pharmaceutically acceptable salt or solvate thereof. For
intramuscular injection, the dose is typically about one-half of
the oral dose.
[0242] A unit oral dose may comprise from about 0.01 mg to about 1
g of the Compound of the Disclosure, e.g., about 0.01 mg to about
500 mg, about 0.01 mg to about 250 mg, about 0.01 mg to about 100
mg, 0.01 mg to about 50 mg, e.g., about 0.1 mg to about 10 mg, of
the compound. The unit dose can be administered one or more times
daily, e.g., as one or more tablets or capsules, each containing
from about 0.01 mg to about 1 g of the compound, or an equivalent
amount of a pharmaceutically acceptable salt or solvate
thereof.
[0243] A pharmaceutical composition of the present disclosure can
be administered to any patient that may experience the beneficial
effects of a Compound of the Disclosure. Foremost among such
patients are mammals, e.g., humans and companion animals, although
the disclosure is not intended to be so limited. In one embodiment,
the patient is a human.
[0244] A pharmaceutical composition of the present disclosure can
be administered by any means that achieves its intended purpose.
For example, administration can be by the oral, parenteral,
subcutaneous, intravenous, intramuscular, intraperitoneal,
transdermal, intranasal, transmucosal, rectal, intravaginal or
buccal route, or by inhalation. The dosage administered and route
of administration will vary, depending upon the circumstances of
the particular subject, and taking into account such factors as
age, gender, health, and weight of the recipient, condition or
disorder to be treated, kind of concurrent treatment, if any,
frequency of treatment, and the nature of the effect desired.
[0245] In one embodiment, a pharmaceutical composition of the
present disclosure can be administered orally. In another
embodiment, a pharmaceutical composition of the present disclosure
can be administered orally and is formulated into tablets, dragees,
capsules, or an oral liquid preparation. In one embodiment, the
oral formulation comprises extruded multiparticulates comprising
the Compound of the Disclosure.
[0246] Alternatively, a pharmaceutical composition of the present
disclosure can be administered rectally, and is formulated in
suppositories.
[0247] Alternatively, a pharmaceutical composition of the present
disclosure can be administered by injection.
[0248] Alternatively, a pharmaceutical composition of the present
disclosure can be administered transdermally.
[0249] Alternatively, a pharmaceutical composition of the present
disclosure can be administered by inhalation or by intranasal or
transmucosal administration.
[0250] Alternatively, a pharmaceutical composition of the present
disclosure can be administered by the intravaginal route.
[0251] A pharmaceutical composition of the present disclosure can
contain from about 0.01 to 99 percent by weight, e.g., from about
0.25 to 75 percent by weight, of a Compound of the Disclosure,
e.g., about 1%, about 5%, about 10%, about 15%, about 20%, about
25%, about 30%, about 35%, about 40%, about 45%, about 50%, about
55%, about 60%, about 65%, about 70%, or about 75% by weight of a
Compound of the Disclosure.
[0252] A pharmaceutical composition of the present disclosure is
manufactured in a manner which itself will be known in view of the
instant disclosure, for example, by means of conventional mixing,
granulating, dragee-making, dissolving, extrusion, or lyophilizing
processes. Thus, pharmaceutical compositions for oral use can be
obtained by combining the active compound with solid excipients,
optionally grinding the resulting mixture and processing the
mixture of granules, after adding suitable auxiliaries, if desired
or necessary, to obtain tablets or dragee cores.
[0253] Suitable excipients include fillers such as saccharides (for
example, lactose, sucrose, mannitol or sorbitol), cellulose
preparations, calcium phosphates (for example, tricalcium phosphate
or calcium hydrogen phosphate), as well as binders such as starch
paste (using, for example, maize starch, wheat starch, rice starch,
or potato starch), gelatin, tragacanth, methyl cellulose,
hydroxypropylmethylcellulose, sodium carboxymethylcellulose, and/or
polyvinyl pyrrolidone. If desired, one or more disintegrating
agents can be added, such as the above-mentioned starches and also
carboxymethyl-starch, cross-linked polyvinyl pyrrolidone, agar, or
alginic acid or a salt thereof, such as sodium alginate.
[0254] Auxiliaries are typically flow-regulating agents and
lubricants such as, for example, silica, talc, stearic acid or
salts thereof (e.g., magnesium stearate or calcium stearate), and
polyethylene glycol. Dragee cores are provided with suitable
coatings that are resistant to gastric juices. For this purpose,
concentrated saccharide solutions can be used, which may optionally
contain gum arabic, talc, polyvinyl pyrrolidone, polyethylene
glycol and/or titanium dioxide, lacquer solutions and suitable
organic solvents or solvent mixtures. In order to produce coatings
resistant to gastric juices, solutions of suitable cellulose
preparations such as acetylcellulose phthalate or
hydroxypropylmethyl-cellulose phthalate can be used. Dye stuffs or
pigments can be added to the tablets or dragee coatings, for
example, for identification or in order to characterize
combinations of active compound doses.
[0255] Examples of other pharmaceutical preparations that can be
used orally include push-fit capsules made of gelatin, or soft,
sealed capsules made of gelatin and a plasticizer such as glycerol
or sorbitol. The push-fit capsules can contain a compound in the
form of granules, which can be mixed with fillers such as lactose,
binders such as starches, and/or lubricants such as talc or
magnesium stearate and, optionally, stabilizers, or in the form of
extruded multiparticulates. In soft capsules, the active compounds
are preferably dissolved or suspended in suitable liquids, such as
fatty oils or liquid paraffin. In addition, stabilizers can be
added.
[0256] Possible pharmaceutical preparations for rectal
administration include, for example, suppositories, which consist
of a combination of one or more active compounds with a suppository
base. Suitable suppository bases include natural and synthetic
triglycerides, and paraffin hydrocarbons, among others. It is also
possible to use gelatin rectal capsules consisting of a combination
of active compound with a base material such as, for example, a
liquid triglyceride, polyethylene glycol, or paraffin
hydrocarbon.
[0257] Suitable formulations for parenteral administration include
aqueous solutions of the active compound in a water-soluble form
such as, for example, a water-soluble salt, alkaline solution, or
acidic solution. Alternatively, a suspension of the active compound
can be prepared as an oily suspension. Suitable lipophilic solvents
or vehicles for such as suspension may include fatty oils (for
example, sesame oil), synthetic fatty acid esters (for example,
ethyl oleate), triglycerides, or a polyethylene glycol such as
polyethylene glycol-400 (PEG-400). An aqueous suspension may
contain one or more substances to increase the viscosity of the
suspension, including, for example, sodium carboxymethyl cellulose,
sorbitol, and/or dextran. The suspension may optionally contain
stabilizers.
[0258] In another embodiment, the present disclosure provides kits
which comprise a Compound of the Disclosure (or a composition
comprising a Compound of the Disclosure) packaged in a manner that
facilitates their use to practice methods of the present
disclosure. In one embodiment, the kit includes a Compound of the
Disclosure (or a composition comprising a Compound of the
Disclosure) packaged in a container, such as a sealed bottle or
vessel, with a label affixed to the container or included in the
kit that describes use of the compound or composition to practice
the method of the disclosure. In one embodiment, the compound or
composition is packaged in a unit dosage form. The kit further can
include a device suitable for administering the composition
according to the intended route of administration.
General Synthesis of Compounds
[0259] Compounds of the Disclosure are prepared using methods known
to those skilled in the art in view of this disclosure, or by the
illustrative methods shown in the General Schemes below. In the
General Schemes, R.sup.1, R.sup.2, R.sup.3, and Z of Formulae A-C
are as defined in connection with Formula VII, unless otherwise
indicated. In the General Schemes, suitable protecting can be
employed in the synthesis, for example, when Z is (amino)alkyl or
any other group that may require protection. (See, Wuts, P. G. M.;
Greene, T. W., "Greene's Protective Groups in Organic Synthesis",
4th Ed., J. Wiley & Sons, N Y, 2007).
##STR00470##
[0260] Compound A is converted to compound B (i.e, a compound
having Formula VII, wherein X is --S(.dbd.O).sub.2--) by coupling
with a suitable sulfonyl chloride (Z--SO.sub.2Cl) in the presence
of a suitable base such as TEA or DIPEA in a suitable solvent such
as dichloromethane, acetonitrile, or DMF.
##STR00471##
[0261] Compound A was converted to compound C by coupling with a
suitable carboxylic acid (ZCO.sub.2H) in the presence of a suitable
coupling reagent such as HATU or HOBT in the presence of a suitable
base such as TEA or DIPEA in a suitable solvent such as DMF.
Compound A can also be converted to compound C by coupling with a
suitable acid chloride (ZCOCl) in the presence of a suitable base
such as TEA or DIPEA in the presence of a suitable solvent such as
dichloromethane, acetonitrile or DMF.
EXAMPLES
General Synthetic Methods
[0262] General methods and experimental procedures for preparing
and characterizing compounds of Tables 1 and 2 are set forth in the
general schemes above and the examples below. Wherever needed,
reactions were heated using conventional hotplate apparatus or
heating mantle or microwave irradiation equipment. Reactions were
conducted with or without stirring, under atmospheric or elevated
pressure in either open or closed vessels. Reaction progress was
monitored using conventional techniques such as TLC, HPLC, UPLC, or
LCMS using instrumentation and methods described below. Reactions
were quenched and crude compounds isolated using conventional
methods as described in the specific examples provided. Solvent
removal was carried out with or without heating, under atmospheric
or reduced pressure, using either a rotary or centrifugal
evaporator.
[0263] Compound purification was carried out as needed using a
variety of traditional methods including, but not limited to,
preparative chromatography under acidic, neutral, or basic
conditions using either normal phase or reverse phase HPLC or flash
columns or Prep-TLC plates. Compound purity and mass confirmations
were conducted using standard HPLC and/or UPLC and/or MS
spectrometers and/or LCMS and/or GC equipment (i.e., including, but
not limited to the following instrumentation: Waters Alliance 2695
with 2996 PDA detector connected with ZQ detector and ESI source:
Shimadzu LDMS-2020; Waters Acquity H Class with PDA detector
connected with SQ detector and ESI source; Agilent 1100 Series with
PDA detector; Waters Alliance 2695 with 2998 PDA detector; AB SCIEX
API 2000 with ESI source; Agilent 7890 GC).
[0264] Compound structure confirmations were carried out using
standard 300 or 400 MHz NMR spectrometers with nOe's conducted
whenever necessary.
[0265] The following abbreviations are used herein:
TABLE-US-00005 Abbreviation Meaning ACN acetonitrile atm.
atmosphere DCM dichloromethane DHP dihydropyran DIBAL diisobutyl
aluminum hydride DIEA diisopropyl ethylamine DMF dimethyl formamide
DMF-DMA dimethyl formamide dimethyl acetal DMSO dimethyl sulfoxide
Dppf 1,1'- bis(diphenylphosphino)ferrocene EA ethyl acetate ESI
electrospray ionization EtOH Ethanol FA formic acid GC gas
chromatography H hour Hex hexanes HMDS hexamethyl disilazide HPLC
high performance liquid chromatography IPA Isopropanol LCMS liquid
chromatography/mass spectrometry MeOH Methanol Min Minutes NBS
N-bromo succinimide NCS N-chloro succinimide NIS N-iodo succinimide
NMR nuclear magnetic resonance nOe nuclear Overhauser effect Prep.
Preparative PTSA para-toluene sulfonic acid Rf retardation factor
rt room temperature RT retention time sat. Saturated SGC silica gel
chromatography TBAF tetrabutyl ammonium fluoride TEA Triethylamine
TFA trifluoroacetic acid THF Tetrahydrofuran TLC thin layer
chromatography UPLC ultra performance liquid chromatography
Example 1
Synthesis of 5-cyclopropylisoxazole-3-carboxylic Acid
##STR00472##
[0266] Step 1: Synthesis of Ethyl
4-cyclopropyl-2,4-dioxobutanoate
##STR00473##
[0268] Into a 10-L 3-necked round-bottom flask purged and
maintained with an inert atmosphere of nitrogen Na (164 g, 1.20
equiv) was added in portions to ethanol (5 L). A solution of
(CO.sub.2Et).sub.2 (869 g, 1.00 equiv) and 1-cyclopropylethan-1-one
(500 g, 5.94 mol, 1.00 equiv) was added dropwise with stirring at
0-20.degree. C. The resulting solution was stirred for 1 h at
20-30.degree. C. and then for an additional 1 h at 80.degree. C.
The resulting solution was diluted with 15 L of H.sub.2O. The pH
was adjusted to 2 with hydrochloric acid (12N). The resulting
mixture was extracted with ethyl acetate and the organic layers
combined and washed with NaHCO.sub.3 (sat. aq.). The extract was
concentrated under vacuum yielding 820 g (crude) of ethyl
4-cyclopropyl-2,4-dioxobutanoate as yellow oil. TLC (ethyl
acetate/petroleum ether=1/5): Rf=0.5.
Step 2: Synthesis of Ethyl 5-cyclopropylisoxazole-3-carboxylate
##STR00474##
[0270] Into a 10 L round-bottom flask, was placed a solution of
ethyl 4-cyclopropyl-2,4-dioxobutanoate (177 g) in ethanol (1.1 L)
and NH.sub.2OH--HCl (200 g). The resulting solution was stirred for
1 h at 20-30.degree. C. The resulting solution was allowed to
react, with stirring, for an additional 1 h at 80.degree. C. The
resulting mixture was concentrated under vacuum. The residue was
purified on a silica gel column with ethyl acetate/petroleum ether
(1/10). This resulted in 143 g (the two step yield was 66.3%) of
ethyl 5-cyclopropylisoxazole-3-carboxylate as a yellow oil. TLC
(ethyl acetate/petroleum ether=1/5): Rf=0.2.
Step 3: Synthesis of 5-cyclopropylisoxazole-3-carboxylic Acid
##STR00475##
[0272] Into a 10-L round-bottom flask was placed ethyl
5-cyclopropylisoxazole-3-carboxylate (280 g, 1.55 mol, 1.00 equiv)
and a solution of sodium hydroxide (74.3 g, 1.20 equiv) in water (4
L). The resulting solution was stirred for 1 h at room temperature.
The resulting mixture was washed with ether. The pH value of the
aqueous solution was adjusted to 2-3 with hydrochloric acid (12N).
The resulting solution was extracted with ethyl acetate and the
organic layers combined and concentrated under vacuum. This
resulted in 220 g (93%) of 5-cyclopropylisoxazole-3-carboxylic acid
as an off-white solid. .sup.1H-NMR (300 MHz CDCl.sub.3): .delta.
8.42 (brs, 1H), 6.37 (s, 1H), 2.16-2.05 (m, 1H), 1.29-1.12 (m, 2H),
1.12-0.99 (m, 2H): LCMS m/z=153.9 [M+H].sup.-.
Example 2
Synthesis of 5-cyclopropylisoxazole-3-carbonyl Chloride
##STR00476##
[0274] To a stirred solution of 5-cyclopropylisoxazole-3-carboxylic
acid (0.750 g, 4.90 mmol) in DCM (5 ml) was added oxalyl chloride
(1.68 ml, 19.60 mmol) and 2 drops of DMF. The reaction was stirred
at RT 2 hr. After complete consumption of starting material, the
solvent was removed under reduced pressure to obtain
5-cyclopropylisoxazole-3-carbonyl chloride as a residue (0.6 g,
crude). The material was used without further purification.
Example 3
Synthesis of
5-cyclopropyl-N-(1-(piperidin-4-yl)ethyl)isoxazole-3-carboxamide
hydrochloride (Cpd. No. 213
##STR00477##
[0275] Step 1: Synthesis of Tert-Butyl
4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate
##STR00478##
[0277] To a stirred solution of
1-(tert-butoxycarbonyl)piperidine-4-carboxylic acid (5.0 g, 21.7
mmol) in DMF (20 mL) was added HATU (12.39 g, 32.60 mmol) and
diisopropylethylamine (18.94 ml, 108.6 mmol). The solution was
stirred for 10 min at 0.degree. C. After that
N,O-dimethylhydroxylamine hydrochloride (2.12 g, 21.7 mmol) was
added and stirred at RT for 2 h. The progress of the reaction was
monitored by TLC. After complete consumption of starting material,
the reaction was quenched with water and extracted with ethyl
acetate. The organic layer was washed with brine, dried over
anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure
to obtain a crude residue which was purified by column
chromatography to afford tert-butyl
4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate (4.3 g, 71%).
LCMS: m/z=173.05 (M-Boc).sup.+.
Step 2: Synthesis of Tert-Butyl
4-acetylpiperidine-1-carboxylate
##STR00479##
[0279] To a stirred solution of tert-butyl
4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate (4.3 g, 15.8
mmol) in dry THF (20 mL) was added a solution of methyl magnesium
bromide (20 mL, 23.71 mmol, 1.6 M in THF:toluene) at -78.degree. C.
and the reaction was stirred at -78.degree. C. for 2 h and RT for 2
h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with saturated NH.sub.4Cl solution and extracted with
ethyl acetate. The organic layer was washed with brine, dried over
Na.sub.2SO.sub.4 and concentrated under reduced pressure to a crude
residue which was purified by column chromatography to afford
tert-butyl 4-acetylpiperidine-1-carboxylate (2.8 g, 62%).
Step 3: Synthesis of Tert-Butyl
4-(1-aminoethyl)piperidine-1-carboxylate
##STR00480##
[0281] To a stirred solution of compound tert-butyl
4-acetylpiperidine-1- (2.8 g, 9.68 mmol) in dry MeOH (6 mL) was
added ammonium acetate (8.9 g, 16.2 mmol) and the reaction was
stirred at RT for 15 min, sodium cyanoborohydride (2.43 g, 38.7
mmol) was then added. The reaction mixture was heated to reflux for
16 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with 0.5 M NaOH solution and extracted with ethyl acetate.
The organic layer was washed with brine, dried over
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue of tert-butyl 4-(1-aminoethyl)piperidine-1-carboxylate
(2.1 g, crude). This was used in the next step without further
purification. LCMS: m/z=191.25 (M-Boc).sup.+.
Step 4: Synthesis of Tert-Butyl
4-(1-(5-cyclopropylisoxazole-3-carboxamido)ethyl)piperidine-1-carboxylate
##STR00481##
[0283] To a stirred solution of 5-cyclopropylisoxazole-3-carboxylic
acid (1.0 g, 6.5 mmol) in DMF (3 mL) was added HATU (3.72 g, 9.8
mmol) and diisopropylethylamine (3.5 ml, 19.6 mmol). The solution
was stirred for 10 min at 0.degree. C. tert-Butyl
4-(1-aminoethyl)piperidine-1-carboxylate (1.45 g, 6.5 mmol) was
added and the reaction stirred at RT for 2 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with water and
extracted with ethyl acetate. The organic layer was separated,
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford compound tert-butyl
4-(1-(5-cyclopropylisoxazole-3-carboxamido)ethyl)piperidine-1-carboxylate
(2.1 g, 84%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta. 8.44 (d,
J=8.9 Hz, 1H), 6.46 (s, 1H), 3.98-3.90 (m, 2H), 3.79 (p, J=7.3 Hz,
1H), 2.53-2.47 (m, 2H), 2.19-2.16 (m, 1H), 1.6-1.58 (m, 3H), 1.38
(s, 9H), 1.18-0.86 (m, 9H); LCMS: m/z=386.25 (M+H).sup.+.
Step 5: Synthesis of
5-cyclopropyl-N-(1-(piperidin-4-yl)ethyl)isoxazole-3-carboxamide
Hydrochloride
##STR00482##
[0285] To a stirred solution of tert-butyl
4-(l-(5-cyclopropylisoxazole-3-carboxamido)ethyl)piperidine-1-carboxylate
(2.1 g, 5.8 mmol) in dioxane (5 mL) was added 4 M dioxane:HCl (20
mL) at 0.degree. C. and the reaction mixture was stirred at RT for
3 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the solvent was removed
under reduced pressure to obtain a crude residue which was purified
by repeated washing with ether and pentane to obtain
5-cyclopropyl-N-(1-(piperidin-4-yl)ethyl)isoxazole-3-carboxamide
hydrochloride (1.3 g, 86%). .sup.1H NMR (400 MHz, DMSO-d.sub.6)
.delta. 8.95-8.86 (m, 1H), 8.54 (t, J=11.8 Hz, 2H), 6.49 (s, 1H),
3.91-3.77 (m, 1H), 3.24 (d, 0.1=12.4 Hz, 2H), 2.88-2.66 (m, 2H),
2.18 (tt, J=8.4, 5.0 Hz, 1H), 1.86-1.60 (m, 3H), 1.44-1.27 (m, 2H),
1.15-1.03 (m, 5H), 0.95-0.84 (m, 2H); LCMS: m/z=264.20
(M+H).sup.+.
Example 4
Synthesis of
5-cyclopropyl-N-(phenyl(piperidin-4-yl)methyl)isoxazole-3-carboxamide
(Cpd. No. 49
##STR00483##
[0286] Step 1: Synthesis of Tert-Butyl
4-benzoylpiperidine-1-carboxylate
##STR00484##
[0288] To a stirred solution of tert-butyl
4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate (0.5 g, 1.83
mmol) in THF (1.5 mL) was added a 1M solution of phenyl magnesium
bromide in THF (3.67 mL, 3.67 mmol) at 0.degree. C. The reaction
was stirred overnight at RT. The reaction completion was monitored
by TLC and the reaction was quenched with ammonium chloride
solution and extracted with ethyl acetate. The organic layer was
separated, washed with brine, dried using Na.sub.2SO.sub.4 and
concentrated under reduced pressure to a residue. The residue was
purified by column chromatography to obtain ten-butyl
4-benzoylpiperidine-1-carboxylate (0.188 g, 35.5%) LCMS: m/z=190.1
(M+H).sup.+.
Step 2: Synthesis of Tert-Butyl
4-(amino(phenyl)methyl)piperidine-1-carboxylate
##STR00485##
[0290] To a solution of tert-butyl
4-benzoylpiperidine-1-carboxylate (0.188 g, 0.65 mmol) in MeOH (5
mL) was added ammonium acetate (0.6 g, 7.8 mmol). The reaction was
stirred for 10 minutes at 25.degree. C., then sodium
cyanoborohydride (0.163 g, 2.59 mmol) was added. The reaction
heated to 60.degree. C. for 16 hours. The reaction completion was
monitored by TLC and the reaction was quenched with 0.5N NaOH
solution and extracted with ethyl acetate. The organic layer was
separated, washed with brine, dried using Na.sub.2SO.sub.4 and
concentrated under reduced pressure to a residue which was purified
by column chromatography to obtain tert-butyl
4-(amino(phenyl)methyl)piperidine-1-carboxylate (0.2 g, 40%). LCMS:
m/z=190.3 (M+H).sup.+.
Step 3: Synthesis of Tert-Butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piperidine-1-carb-
oxylate
##STR00486##
[0292] To a stirred solution of 5-cyclopropylisoxazole-3-carboxylic
acid (0.1 g, 0.34 mmol) in DCM (5 ml) was added oxalyl chloride
(0.2 ml, 0.68 mmol) and 2 drops of DMF. The reaction was stirred at
RT 2 hr. After complete consumption of starting material, the
solvent was removed under reduced pressure to obtain a residue. The
residue was dissolved in DCM and cooled to 0.degree. C. tert-Butyl
4-(amino(phenyl)methyl)piperidine-1-carboxylate was added (0.070 g,
0.41 mmol) in DCM (5 mL) followed by triethylamine (0.23 mL, 0.17
mmol). The reaction was stirred at RT for 1 hr. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with sodium
bicarbonate and, extracted with DCM. The organic layer was
separated, washed with brine, dried using Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a residue which was
purified by column chromatography to obtain tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piperidine-1-carb-
oxylate (0.057 g, 50%) LCMS: m/z=326.23 (M+H).sup.+.
Step 4: Synthesis of
5-cyclopropyl-N-(phenyl(piperidin-4-yl)methyl)isoxazole-3-carboxamide
Hydrochloride
##STR00487##
[0294] To a stirred solution of tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piperidine-1-carb-
oxylate (0.057 g, 0.13 mmol) in dioxane (1 mL) at 0.degree. C. was
added 4 M dioxane:HCl (2 mL). The reaction was stirred at rt for 2
h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the solvent was removed
under reduced pressure and the residue was purified by washing with
ether and pentane to obtain
5-cyclopropyl-N-(phenyl(piperidin-4-yl)methyl)isoxazole-3-carboxamide
hydrochloride (0.028 g, 65%). .sup.1H NMR (400 MHz, DMSO-d.sub.6)
.delta. 9.21 (d, J=9.0 Hz, 1H), 8.70 (d, J=11.2 Hz, 1H), 8.36 (d,
J=11.7 Hz, 1H), 7.46-7.37 (m, 2H), 7.39-7.22 (m, 3H), 6.47 (s, 1H),
4.71 (t, J=9.5 Hz, 1H), 3.22-3.13 (m, 2H), 2.77 (q, J=11.0, 10.1
Hz, 2H), 2.23-2.03 (m, 3H), 1.47-1.19 (m, 3H), 1.14-1.02 (m, 2H),
0.94-0.83 (m, 2H); LCMS: m/z=326.25 (M+H).
Example 5
Synthesis of
N-(1-(1-((S)-2-amino-3-(4-hydroxyphenyl)propanoyl)piperidin-4-yl)ethyl)-5-
-cyclopropylisoxazole-3-carboxamide (Cpd. No. 211
##STR00488##
[0295] Step 1: Synthesis of Tert-Butyl
((2S)-1-(4-(1-(5-cyclopropylisoxazole-3-carboxamido)ethyl)piperidin-1-yl)-
-3-(4-hydroxyphenyl)-1-oxopropan-2-yl)carbamate
##STR00489##
[0297] To a stirred solution of
(S)-2-((tert-butoxycarbonyl)amino)-3-(4-hydroxyphenyl) propanoic
acid (0.188 g, 0.68 mmol) in DMF (2 mL) was added EDCI (0.191 g,
1.10 mmol), HOBt (0.135 g, 1.10 mmol), and triethylamine (0.3 mL,
2.27 mmol). The solution was stirred for 30 min at 0.degree. C.
5-Cyclopropyl-N-(1-(piperidin-4-yl)ethyl)isoxazole-3-carboxamide
hydrochloride (0.2 g, 0.66 mmol) was then added and the reaction
stirred at rt overnight. The progress of the reaction was monitored
by TLC. After complete consumption of starting material, the
reaction was quenched with water and extracted with ethyl acetate.
The organic layer was separated, washed with brine, dried over
anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure
to obtain a crude residue which was purified by column
chromatography to afford tert-butyl
((2S)-1-(4-(1-(5-cyclopropylisoxazole-3-carboxamido)ethyl)piperidin-1-yl)-
-3-(4-hydroxyphenyl)-1-oxopropan-2-yl)carbamate (0.09 g, 25%).
LCMS: m/z=428.05 (M-Boc).sup.+.
Step 2: Synthesis of
N-1-(1-((S)-2-amino-3-(4-hydroxyphenyl)propanoyl)piperidin-4-yl)ethyl)-5--
cyclopropylisoxazole-3-carboxamide Hydrochloride
##STR00490##
[0299] To a stirred solution of tert-butyl
((2S)-1-(4-(1-(5-cyclopropylisoxazole-3-carboxamido)ethyl)piperidin-1-yl)-
-3-(4-hydroxyphenyl)-1-oxopropan-2-yl)carbamate (0.09 g, 0.17 mmol)
in dioxane (1 mL) was added 4 M dioxane:HCl (5 mL) at 0.degree. C.
and the reaction mixture stirred at rt for 3 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the solvent was removed under reduced pressure
to obtain a crude residue which was purified by repeated washing
with ether and pentane to obtain
N-(1-((S)-2-amino-3-(4-hydroxyphenyl)propanoyl)piperidin-4-yl)ethyl)-5-cy-
clopropylisoxazole-3-carboxamide hydrochloride (0.020 g, 28%).
.sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta. 9.44-9.35 (m, 1H), 8.46
(q, J=7.3 Hz, 1H), 8.12 (s, 3H), 6.99 (dd, J=173, 7.9 Hz, 2H),
6.75-6.66 (m, 2H), 6.46 (d, J=3.5 Hz, 1H), 4.52 (p, J=6.8, 6.2 Hz,
1H), 4.37 (d, J=12.8 Hz, 1H), 3.83-3.59 (m, 2H), 2.96-2.73 (m, 2H),
2.47-2.33 (m, 2H), 2.27-2.12 (m, 1H), 1.76-1.62 (m, 1H), 1.62-1.35
(m, 2H), 1.14-0.81 (m, 9H); LCMS: m/z=427.35 (M+H).sup.+.
Example 6
Synthesis
N--((S)-(1-((S)-2-aminopropanoyl)piperidin-4-yl)(phenyl)methyl)--
5-cyclopropylisoxazole-3-carboxamide Hydrochloride (Cpd. No. 215)
and
N--((R)-(1-((S)-2-aminopropanoyl)piperidin-4-yl)(phenyl)methyl)-5-cyclopr-
opylisoxazole-3-carboxamide Hydrochloride (Cpd. No. 216
##STR00491##
[0300] Step 1: Synthesis of tert-butyl
((S)-1-(4-((S)-(5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piper-
idin-1-yl)-1-oxopropan-2-yl)carbamate and tert-butyl
((S)-1-(4-((R)-(5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piper-
idin-1-yl)-1-oxopropan-2-yl)carbamate
##STR00492##
[0302] To a stirred solution of
(S)-2-((tert-butoxycarbonyl)amino)propanoic acid (0.044 g, 0.230
mmol) in DMF (1 mL) was added HATU (0.131 g, 0.34 mmol) and
diisopropyl ethylamine (0.12 mL, 0.69 mmol). The solution was
stirred for 10 min at 0.degree. C. Next,
5-cyclopropyl-N-(phenyl(piperidin-4-yl)methyl)isoxazole-3-carboxami-
de ((0.1 g, 0.277 mmol) was added and the reaction stirred at rt
for 2 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was washed with brine, dried over anhydrous Na.sub.2SO.sub.4
and concentrated under reduced pressure to obtain a crude residue
which was purified by preparative chiral HPLC to afford tert-butyl
((S)-1-(4-((S)-(5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piper-
idin-1-yl)-1-oxopropan-2-yl)carbamate (0.13 g, 18%) and tert-butyl
((S)-1-(4-((R)-(5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piper-
idin-1-yl)-1-oxopropan-2-yl)carbamate (0.12 g, 17.4%).
Step 2: Synthesis of
N--((S)-(1-((S)-2-aminopropanoyl)piperidin-4-yl)(phenyl)methyl)-5-cyclopr-
opylisoxazole-3-carboxamide Hydrochloride
##STR00493##
[0304] To a stirred solution of tert-butyl
((S)-1-(4-(5)-5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piperid-
in-1-yl)-1-oxopropan-2-yl)carbamate (0.05 g, 0.126 mmol) in dioxane
(1 mL) at 0.degree. C. was added 4 M dioxane:HCl (3 mL). The
reaction mixture was stirred at RT for 1 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material the solvent was removed under reduced pressure to
obtain a crude residue. The material was purified by repeated
washing with ether and pentane to obtain
N--((S)-(1-((S)-2-aminopropanoyl)piperidin-4-yl)(phenyl)methyl)-5-cyclopr-
opylisoxazole-3-carboxamide hydrochloride (0.035 g, 50%). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.19 (dd. J=9.0, 6.3 Hz, 1H),
8.09 (s, 3H), 7.44-7.21 (m, 5H), 6.46 (s, 1H), 4.69 (q, J=10.0 Hz,
1H), 4.29 (s, 2H), 3.76 (d, J=13.7 Hz, 1H), 2.98-2.96 (m, 1H),
2.66-2.50 (m, 1H), 2.23-2.06 (m, 2H), 2.02-1.91 (m, 1H), 1.30 (d,
J=6.8 Hz, 1H), 1.21 (dd, J=24.0, 9.9 Hz, 4H), 1.14-0.83 (m, 5H);
LCMS: m/z=397.35 (M+H).sup.+.
Step 2: Synthesis of
N--((R)-(1-((S)-2-aminopropanoyl)piperidin-4-yl)(phenyl)methyl)-5-cyclopr-
opylisoxazole-3-carboxamide Hydrochloride
##STR00494##
[0306] To a stirred solution of tert-butyl
((S)-1-(4-((R)-(5-cyclopropylisoxazole-3-carboxamido)(phenyl)methyl)piper-
idin-1-yl)-1-oxopropan-2-yl)carbamate (0.06 g, 0.12 mmol) in
dioxane (1 mL) at 0.degree. C. was added 4 M dioxane:HCl (3 mL).
The reaction mixture was stirred at RT for 1 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material the solvent was removed under reduced pressure to
obtain a crude residue. The material was purified by repeated
washing with ether and pentane to obtain
N--(R)-(1-((S)-2-aminopropanoyl)piperidin-4-yl)(phenyl)methyl)-5-c-
yclopropylisoxazole-3-carboxamide (0.02 g, 30%). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.20 (t, J=8.8 Hz, 1H), 8.08 (s, 3H),
7.46-7.21 (m, 5H), 6.46 (d, J 1.5 Hz, 1H), 4.7-4.68 (m, 1H),
4.35-4.32 (m, 2H), 3.90 (d, J=13.7 Hz, 1H), 3.07-2.87 (m, 1H),
2.66-2.51 (m, 1H), 2.23-2.06 (m, 2H), 1.95 (d, J=11.4 Hz, 1H),
1.36-1.00 (m, 8H), 1.01-0.82 (m, 2H); LCMS: m/z=397.22
(M+H).sup.+.
Example 7
Synthesis of
N-((1-((S)-2-aminopropanoyl)piperidin-4-yl)(3-(pyridin-3-ylcarbamoyl)phen-
yl)methyl)-5-cyclopropylisoxazole-3-carboxamide Hydrochloride (Cpd.
No. 205
##STR00495##
[0307] Step 1: Synthesis of Tert-Butyl
4-(hydroxy(3-(methoxycarbonyl)phenyl)methyl)
piperidine-1-carboxylate
##STR00496##
[0309] To a stirred solution of methyl 3-iodobenzoate (3.0 g, 11.45
mmol) in anhydrous THF (100 mL) was added isopropyl magnesium
chloride (6.27 mL, 12.59 mmol, 2M solution in THF) at -40.degree.
C., tert-Butyl 4-formylpiperidine-1-carboxylate (2.68 g, 12.59
mmol) was added. The reaction was stirred at rt overnight. The
reaction was quenched with saturated NH.sub.4Cl solution and
extracted with ethyl acetate. The organic layer was washed with
brine, dried over Na.sub.2SO.sub.4 and concentrated under reduced
pressure to obtain a crude residue which was purified by column
chromatography to afford tert-butyl
4-(hydroxy(3-(methoxycarbonyl)phenyl)methyl)piperidine-1-carboxylate
(2.91 g, 73%). LCMS: m/z=350.15 (M+H).sup.+.
Step 2: Synthesis of tert-butyl
4-(3-(methoxycarbonyl)benzoyl)piperidine-1-carboxylate
##STR00497##
[0311] To a stirred solution of
4-(hydroxy(3-(methoxycarbonyl)phenyl)
methyl)piperidine-1-carboxylate (1.9 g, 5.44 mmol) in DCM (30 mL)
was added Dess Martin periodane (3.0 g, 7.07 mmol) at 0.degree. C.
The reaction mixture was stirred at rt for 1 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched by the addition of a
mixture of saturated solution of Na.sub.2S.sub.2O.sub.3 (10 mL) and
NaHCO.sub.3 (10 mL). The organic layer was extracted, dried over
anhydrous Na.sub.2SO.sub.4, concentrated under reduced pressure to
obtain a crude residue which was purified by column chromatography
to afford tert-butyl
4-(3-(methoxycarbonyl)benzoyl)piperidine-1-carboxylate (1.78 g,
94%). LCMS: m/z=348.15 (M+H).sup.+.
Step 3: Synthesis of Tert-Butyl
4-(amino(3-(methoxycarbonyl)phenyl)methyl)piperidine-1-carboxylate
##STR00498##
[0313] To a stirred solution of tert-butyl
4-(3-(methoxycarbonyl)benzoyl)piperidine-1-carboxylate (1.5 g, 4.32
mmol) in methanol (30 mL) at 0.degree. C. was added ammonium
acetate (4.0 g, 51.8 mmol) followed by portionwise addition of
sodium cyanoborohydride (1.0 g, 17.2 mmol). The reaction mixture
was heated to reflux at 80.degree. C. for 12 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with dilute HCl
solution and extracted with ethyl acetate. The organic layer was
separated, washed with brine, dried over Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford tert-butyl
4-(amino(3-(methoxycarbonyl)phenyl)methyl)piperidine-1-carboxylate
(1.05 g, 70%).
Step 4: Synthesis of tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(3-(methoxycarbonyl)phenyl)methy-
l)piperidine-1-carboxylate
##STR00499##
[0315] To a stirred solution of 5-cyclopropylisoxazole-3-carboxylic
acid (0.65 g, 1.86 mmol) in DMF (10 mL) was added HATU (1.0 g, 2.8
mmol) and diisopropylethylamine (1.2 ml, 7.44 mmol). The reaction
mixture was stirred for 10 min at 0.degree. C. and then tert-butyl
4-(amino(3-(methoxycarbonyl)phenyl)methyl)piperidine-1-carboxylate
(0.284 g, 1.86 mmol) was added. The reaction mixture was stirred at
rt for 2 h. The progress of the reaction was monitored by TLC.
After complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was separated, washed with brine, dried over Na.sub.2SO.sub.4
and concentrated under reduced pressure to obtain a crude residue
which was purified by column chromatography to afford tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(3-(methoxycarbonyl)
phenyl)methyl)piperidine-1-carboxylate (0.789 g, 95%).
Step 5: Synthesis of
3-((1-(tert-butoxycarbonyl)piperidin-4-yl)(5-cyclopropylisoxazole-3-carbo-
xamido)methyl)benzoic Acid
##STR00500##
[0317] To a stirred solution of tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(3-(methoxycarbonyl)phenyl)methy-
l)piperidine-1-carboxylate (0.77 g, 1.59 mmol) in THF:MeOH:H.sub.2O
(1:1:1, 15 mL) was added lithium hydroxide (0.133 g, 3.18 mmol).
The reaction mixture was then stirred at rt for 12 h. The progress
of the reaction was monitored by TLC. After complete consumption of
starting material the solvent was removed under reduced pressure to
obtain a crude residue. The residue was taken up in MeOH and
acidified with dilute HCl to pH=2. The reaction mixture was
filtered and the filtrate was concentrated under reduced pressure
to obtain
3-((l-(ten-butoxycarbonyl)piperidin-4-yl)(5-cyclopropylisoxazole-3-carbox-
amido)methyl)benzoic acid (0.580 g, crude).
Step 6: Synthesis of Tert-Butyl
4-((5-cyclopropylisoxazole-3-carboxamido)(3-(pyridin-3-ylcarbamoyl)phenyl-
)methyl)piperidine-1-carboxylate
##STR00501##
[0319] To a stirred solution of
3-((1-(tert-butoxycarbonyl)piperidin-4-yl)(5-cyclopropylisoxazole-3-carbo-
xamido)methyl)benzoic acid (0.5 g, 1.06 mmol) in DMF (3 mL) was
added HATU (0.607 g, 1.59 mmol) and diisopropylethylamine (0.63 mL,
3.73 mmol). The solution was stirred for 10 min at 0.degree. C.
Then pyridin-3-amine (0.14 g, 1.49 mmol) was added and stirred at
rt for 2 h. The progress of the reaction was monitored by TLC.
After complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was washed with brine, dried over anhydrous Na.sub.2SO.sub.4
and concentrated under reduced pressure to obtain a crude residue
which was purified by column chromatography to afford
tert-butyl-4-((5-cyclopropylisoxazole-3-carboxamido)(3-(pyridin-3-ylcarba-
moyl)phenyl)methyl)piperidine-1-carboxylate (0.445 g, 76%). LCMS:
m/z=446.4 (M-Boc).sup.-.
Step 7: Synthesis of
5-cyclopropyl-N-(piperidin-4-yl(3-(pyridin-3-ylcarbamoyl)phenyl)methyl)is-
oxazole-3-carboxamide Hydrochloride
##STR00502##
[0321] To a stirred solution of
tert-butyl-4-((5-cyclopropylisoxazole-3-carboxamido)(3-(pyridin-3-ylcarba-
moyl)phenyl)methyl)piperidine-1-carboxylate (0.445 g, 0.81 mmol) in
dioxane (4 mL) at 0.degree. C. was added 4 M dioxane:HCl (8 mL) and
the reaction mixture stirred at rt for 3 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material the solvent was removed under reduced pressure to
obtain a crude residue which was purified by repeated washing with
ether and pentane to obtain
5-cyclopropyl-N-(piperidin-4-yl(3-(pyridin-3-ylcarbamoyl)phenyl)methyl)
isoxazole-3-carboxamide hydrochloride (0.380 g, 96%). LCMS:
m/z=446.25 (M+H).sup.+.
Step 8: Synthesis of Tert-butyl
((2S)-1-(4-((5-cyclopropylisoxazole-3-carboxamido)(3-(pyridin-3-ylcarbamo-
yl)phenyl)methyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate
##STR00503##
[0323] To a stirred solution of
(S)-2-((tert-butoxycarbonyl)amino)propanoic acid (0.089 g, 0.474
mmol) in DMF (3 mL) was added HATU (0.225 g, 0.592 mmol) and
diisopropylethylamine (0.23 mL, 1.38 mmol). The solution was
stirred for 10 min at 0.degree. C. Next
5-cyclopropyl-N-(piperidin-4-yl(3-(pyridin-3-ylcarbamoyl)phenyl)meth-
yl) isoxazole-3-carboxamide hydrochloride (0.19 g, 0.395 mmol) was
added and the reaction stirred at rt for 2 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with water and
extracted with ethyl acetate. The organic layer was separated,
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford tert-butyl
((2S)-1-(4-((5-cyclopropylisoxazole-3-carboxamido)(3-(pyridin-3-ylcarbamo-
yl)phenyl)methyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate (0.170
g, 83%). LCMS: m/z=517.4 (M-Boc).sup.+.
Step 9: Synthesis of
N-((1-((S)-2-aminopropanoyl)piperidin-4-yl)(3-(pyridin-3-ylcarbamoyl)phen-
yl)methyl)-5-cyclopropylisoxazole-3-carboxamide Hydrochloride
##STR00504##
[0325] To a stirred solution of tert-butyl
((2S)-1-(4-((5-cyclopropylisoxazole-3-carboxamido)(3-(pyridin-3-ylcarbamo-
yl)phenyl methyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate (0.170
g, 0.275 mmol) in dioxane (3 mL) at 0.degree. C. was added 4 M
dioxane:HCl (2 mL) and the reaction mixture stirred at rt for 3 h.
The progress of the reaction was monitored by TLC. After complete
consumption of starting material the solvent was removed under
reduced pressure to obtain a crude residue which was purified by
repeated washing with ether and pentane to obtain
N-((1-((S)-2-aminopropanoyl)piperidin-4-yl)(3-(pyridin-3-ylcarbamo-
yl)phenyl)methyl)-5-cyclopropylisoxazole-3-carboxamide
hydrochloride (0.135 g, 83%). .sup.1H NMR (400 MHz.
DMSO-d.sub.6)(mixture of diastereomers): .delta. 11.09 (d, J=14.5
Hz, 1H), 9.38-9.24 (m, 2H), 8.64 (d, 0.1=8.0 Hz, 1H), 8.55 (dd,
J=5.4, 1.4 Hz, 1H), 8.17-8.09 (m, 4H), 8.03-7.94 (m, 1H), 7.84 (dd,
J=8.4, 5.2 Hz, 1H), 7.71 (dd, J=7.7, 5.0 Hz, 1H), 7.56 (td, J=7.7,
4.2 Hz, 1H), 6.51 (d, J=3.7 Hz, 1H), 4.90-4.74 (m, 1H), 4.48-4.32
(m, 1H), 4.35-4.23 (m, 2H), 3.92 (d, J=13.6 Hz, 1H), 3.79 (dd,
J=13.8, 9.2 Hz, 1H), 3.69-3.53 (m, 1H), 3.18-2.91 (m, 211),
2.67-2.51 (m, 211), 2.19-2.17 (m, 311), 1.97 (d, J=12.6 Hz, 111),
1.35-0.97 (m, 2H), 0.95-0.82 (m, 2H); LCMS: m/z=517.35
(M+H).sup.+.
Example 8
Synthesis of
5-cyclopropyl-N-(piperidin-4-ylmethyl)isoxazole-3-carboxamide
Hydrochloride (Cpd. No. 4)
##STR00505##
[0326] Step 1: Synthesis of Tert-Butyl
4-((5-cyclopropylisoxazole-3-carboxamido)methyl)
piperidine-1-carboxylate
##STR00506##
[0328] To a stirred solution of tert-butyl
4-(aminomethyl)piperidine-1-carboxylate (0.514 g, 2.43 mmol) in DCM
(10 mL) was added triethylamine (0.68 mL, 4.87 mmol) and the
solution was stirred at 0.degree. C. for 10 min.
5-Cyclopropylisoxazole-3-carbonyl chloride (0.6 g, 3.166 mmol) in
DCM (5 mL) was added dropwise and the reaction mixture stirred at
rt overnight. The progress of the reaction was monitored by TLC.
After complete consumption of starting material, the reaction was
diluted with excess of DCM and washed with water and, the organic
layer was separated, washed with brine, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue which was purified by column chromatography to afford
tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)methyl)piperidine-1-carboxylate
(0.750 g, 89%). .sup.1H NMR (DMSO-d.sub.6, 400 MHz) .delta.
8.69-8.66 (t, J=5.8 Hz, 1H) 6.46 (s, 1H), 3.90 (d, J=12.4 Hz, 2-),
3.11-3.08 (m, J=6.4 Hz, 2H), 2.67 (brs, 2H), 2.19-2.15 (m, 1H),
1.70-1.68 (m, 1H), 1.6 (brs, 1H), 1.58 (brs, 1H), 1.38 (s, 9H),
1.11-1.06 (m, 2H), 0.90-0.89 (m, 4H).
Step 2: Synthesis of
5-cyclopropyl-N-(piperidin-4-ylmethyl)isoxazole-3-carboxamide
Hydrochloride
##STR00507##
[0330] To a stirred solution of tert-butyl
4-((5-cyclopropylisoxazole-3-carboxamido)methyl)piperidine-1-carboxylate
(0.750 g, 2.148 mmol) in MeOH (4 mL) at 0.degree. C. was added 4 M
methanolic HCl (6 mL). The reaction was stirred at rt for 16 hours.
The progress of the reaction was monitored by TLC. After complete
consumption of starting material the solvent was removed under
reduced pressure and the residue was washed with DCM and hexanes to
obtain
5-cyclopropyl-N-(piperidin-4-ylmethyl)isoxazole-3-carboxamide
hydrochloride (0.590 g, 96%). .sup.1H NMR (400 MHz, DMSO-d.sub.6)
.delta. 8.88 (s, 1H), 8.78 (t, J=6.1 Hz, 1H), 8.59 (m, 1H), 6.49
(s, 1H), 3.27-3.09 (m, 4H), 2.80 (q, J=11.8 Hz, 2H), 2.18 (m, 1H),
1.79 (m, 3H), 1.41-1.26 (m, 2H), 1.09 (m, 2H), 1.00-0.87 (m, 2H);
LCMS: m/z=250.05 (M+H).
Example 9
Synthesis of
(S)--N-((1-(2-amino-3-methylbutanoyl)piperidin-4-yl)methyl)-5-cyclopropyl-
isoxazole-3-carboxamide Hydrochloride (Cpd. No. 226)
##STR00508##
[0331] Step 1: Synthesis of (S)-tert-butyl
(1-(4-((5-cyclopropylisoxazole-3-carboxamido)methyl)piperidin-1l-yl)-3-me-
thyl-1-oxobutan-2-yl)carbamate
##STR00509##
[0333] To a stirred solution of
(S)-2-((tert-butoxycarbonyl)amino)-3-methylbutanoic acid (0.156 g,
0.72 mmol) in DMF (2 mL) was added EDCI (0.172 g, 0.9 mmol), HOBt
(0.121 g, 0.9 mmol), and triethylamine (0.3 mL, 1.8 mmol). The
solution was stirred for 30 min at 0.degree. C.
5-Cyclopropyl-N-(piperidin-4-ylmethyl)isoxazole-3-carboxamide (0.15
g, 0.6 mmol) was added and the reaction stirred at rt overnight.
The progress of the reaction was monitored by TLC. After complete
consumption of starting material, the reaction was quenched with
water and extracted with ethyl acetate. The organic layer was
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford (S)-tert-butyl
(1-(4-((5-cyclopropylisoxazole-3-carboxamido)methyl)piperidin-1-yl)-3-met-
hyl-1-oxobutan-2-yl)carbamate (0.185 g, 68%). LCMS m/z=349.1
(M-Boc).sup.+.
Step 2: Synthesis of
(S)--N-((1-(2-amino-3-methylbutanoyl)piperidin-4-yl)methyl)-5-cyclopropyl-
isoxazole-3-carboxamide Hydrochloride
##STR00510##
[0335] To a stirred solution of (S)-tert-butyl
(1-(4-((5-cyclopropylisoxazole-3-carboxamido)methyl)piperidin-1-yl)-3-met-
hyl-1-oxobutan-2-yl)carbamate (0.185 g, 0.33 mmol) in dioxane (1
mL) at 0.degree. C. was added 4M dioxane:HCl (3 mL). The reaction
mixture was stirred at rt for 3 h. The progress of the reaction was
monitored by TLC. After complete consumption of starting material
the solvent was removed under reduced pressure to obtain a crude
residue. The material was purified by repeated washing with ether
and pentane to obtain
(S)--N--((-(2-amino-3-methylbutanoyl)piperidin-4-yl)methyl)-5-cyclopropyl-
isoxazole-3-carboxamide hydrochloride (0.1 g, 69%). .sup.1H NMR
(400 MHz. DMSO-d.sub.6): .delta. 8.75 (dt, J=7.1, 3.4 Hz, 1H), 8.03
(s, 3H), 6.48 (s, 1H), 4.43-4.31 (m, 1H), 4.27 (s, 1H), 3.93 (d,
J=13.6 Hz, 1H), 3.21-2.97 (m, 3H), 2.66-2.53 (m, 1H), 2.18 (tt,
J=8.4, 5.0 Hz, 1H), 2.01 (h, J=6.9 Hz, 1H), 1.89-1.78 (m, 1H), 1.70
(t, J=12.7 Hz, 1H), 1.26 (dd, J=10.3, 4.4 Hz, 1H), 1.16-0.82 (m,
12H); LCMS: m/z=349.3 (M+H).sup.+.
Example 10
Synthesis of
N-(4-(1-amino-3-(pyridin-3-yl)propyl)phenyl)-5-cyclopropylisoxazole-3-car-
boxamide (Cpd. No. 149)
##STR00511##
[0336] Step 1: Synthesis of
(E)-1-(4-aminophenyl)-3-(pyridin-3-yl)prop-2-en-1-one
##STR00512##
[0338] To a stirred solution of 1-(4-aminophenyl)ethanone (2.0 g,
14.81 mmol) in MeOH:Water (1:1, 30 mL) was added nicotinaldehyde
(1.58 g, 14.81 mmol) and potassium hydroxide (1.24 g, 22.22 mmol).
The reaction mixture was stirred at rt for 12 h. The progress of
the reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with dilute HCl and
extracted with ethyl acetate. The organic layer was separated,
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford
(E)-1-(4-aminophenyl)-3-(pyridin-3-yl)prop-2-en-1-one (2.0 g, 60%).
LCMS: m/z=225.3 (M+H).sup.+.
Step 2. Synthesis of
1-(4-aminophenyl)-3-(pyridin-3-yl)propan-1-one
##STR00513##
[0340] To a stirred solution of
(E)-1-(4-aminophenyl)-3-(pyridin-3-yl)prop-2-en-1-one (2.0 g, 8.9
mmol) in methanol (20 mL), 10% palladium-carbon (0.2 g) was added
and the reaction mixture stirred under hydrogen atmosphere at 1 atm
pressure at rt for 3 h. The progress of the reaction was monitored
by TLC. After complete consumption of starting material, the
reaction mixture was filtered through a pad of Celite and the
filtrate was concentrated under reduced pressure to obtain a crude
residue of 1-(4-aminophenyl)-3-(pyridin-3-yl)propan-1-one (1.5 g)
which was used in the next step without purification. LCMS:
m/z=227.05 (M+H).sup.+.
Step 3: Synthesis of
5-cyclopropyl-N-(4-(3-(pyridin-3-yl)propanoyl)phenyl)isoxazole-3-carboxam-
ide
##STR00514##
[0342] To a stirred solution of 5-cyclopropylisoxazole-3-carboxylic
acid (0.2 g, 1.3 mmol) and 2 drops of DMF in DCM (10 mL) was added
oxalyl chloride (1 mL). The reaction mixture was stirred at rt for
2 h. After complete consumption of starting material, the solvent
was removed under reduced pressure to obtain a crude residue. The
residue was redissolved in DCM (5 mL). Triethylamine (0.35 mL, 2.61
mmol) and a solution of
1-(4-aminophenyl)-3-(pyridin-3-yl)propan-1-one (0.354 g, 1.56 mmol)
in DCM (1 mL) was added at 0.degree. C. to the reaction mixture.
The mixture was stirred at rt for 1 h. The progress of the reaction
was monitored by TLC. After complete consumption of starting
material, the reaction mixture was quenched with saturated
NaHCO.sub.3 solution and extracted with DCM. The organic layer was
separated, washed with brine, dried over Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford
5-cyclopropyl-N-(4-(3-(pyridin-3-yl)propanoyl)phenyl)isoxazole-3-carboxam-
ide (0.4 g, 42%). LCMS: m/z=362.05 (M+H) .sup.+.
Step 4: Synthesis of
N-(4-(1-amino-3-(pyridin-3-yl)propyl)phenyl)-5-cyclopropylisoxazole-3-car-
boxamide
##STR00515##
[0344] To a stirred solution of
5-cyclopropyl-N-(4-(3-(pyridin-3-yl)propanoyl)phenyl)isoxazole-3-carboxam-
ide (0.05 g, 0.13 mmol) in dry MeOH (10 mL) was added ammonium
acetate (0.127 g, 1.66 mmol) and the reaction stirred at rt for 15
min. Sodium cyanoborohydride (0.034 g, 0.55 mmol) was then added.
The reaction mixture was heated to reflux for 16 h. The progress of
the reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with 0.5 M NaOH
solution and extracted with ethyl acetate. The organic layer was
washed with brine, dried over Na.sub.2SO.sub.4 and concentrated
under reduced pressure to obtain a crude residue which was purified
by prep HPLC to afford compound
N-(4-(1-amino-3-(pyridin-3-yl)propyl)phenyl)-5-cyclopropylisoxazole-3-car-
boxamide (0.030 g, 12%). .sup.1H NMR (400 MHz, Methanol-d4):
.delta. 8.41-8.29 (m, 2H), 7.88-7.79 (m, 2H), 7.69-7.65 (m, 1H),
7.49-7.41 (m, 2H), 7.39-7.35 (m, 1H), 6.48 (s, 1H), 4.21 (dd,
J=8.8, 6.3 Hz, 1H), 2.70-2.51 (m, 2H), 2.34-2.23 (m, 2H), 2.2-2.15
(m, 1H), 1.31 (d, J=18.9 Hz, 1H), 1.21-1.11 (m, 2H), 1.04-0.95 (m,
2H); LCMS: m/z=362.17 (M+1).sup.-.
Example 11
Synthesis of N-(4-aminobutyl)-5-cyclopropylisoxazole-3-carboxamide
Hydrochloride (Cpd. No. 254)
##STR00516##
[0345] Step 1: Synthesis of Tert-Butyl
(4-(5-cyclopropylisoxazole-3-carboxamido) butyl)carbamate
##STR00517##
[0347] To a stirred solution of 5-cyclopropylisoxazole-3-carboxylic
acid (0.5 g, 3.2 mmol) in DMF (3 mL) was added EDCI.HCl (0.93 g,
4.9 mmol), HOBt (0.66 g, 4.9 mmol) and triethylamine (1.41 mL, 9.8
mmol). The solution was stirred for 10 min at 0.degree. C. After
that tert-butyl (4-aminobutyl) carbamate (0.67 g, 3.5 mmol) was
added and the reaction stirred at rt for 16 h. The progress of the
reaction was monitored by TLC. After complete consumption of
starting material, the reaction was quenched with water and
extracted with ethyl acetate. The organic layer was washed with
brine, dried over anhydrous Na.sub.2SO.sub.4 and concentrated under
reduced pressure to obtain a crude residue which was purified by
column chromatography to afford tert-butyl
(4-(5-cyclopropylisoxazole-3-carboxamido)butyl)carbamate (0.25 g,
20%). LCMS: m/z=234.05 (M-Boc).sup.+.
Step 2: Synthesis of
N-(4-aminobutyl)-5-cyclopropylisoxazole-3-carboxamide
Hydrochloride
##STR00518##
[0349] To a stirred solution of tert-butyl
(4-(5-cyclopropylisoxazole-3-carboxamido)butyl)carbamate (0.24 g,
0.74 mmol) in dioxane (2 mL), was added 4M dioxane:HCl (2 mL) at
0.degree. C. and the reaction mixture was stirred at rt for 5 h.
The progress of the reaction was monitored by TLC. After complete
consumption of starting material, the solvent was removed under
reduced pressure to obtain a crude residue which was purified by
Prep HPLC to obtain
N-(4-aminobutyl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride
(0.16 g, 96%). .sup.1H NMR (400 MHz, DMSO-d.sub.6):.delta. 8.71 (t,
J=5.9 Hz, 1H), 7.76 (s, 2H), 6.48 (s, 1H), 3.23 (q, J=6.0 Hz, 2H),
2.78 (q, J=6.1 Hz, 2H), 2.18 (td, J=8.6, 4.5 Hz, 1H), 1.54 (p,
J=3.4 Hz, 4H), 1.1-1.08 (m, 2H), 0.96-0.87 (m, 2H); LCMS (method A,
ESI): m/z=224.10 (M+H).sup.+.
Example 12
Synthesis of
(S)--N-(4-(2-aminopropanamido)butyl)-5-cyclopropylisoxazole-3-carboxamide
Hydrochloride (Cpd. No. 249)
##STR00519##
[0350] Step 1: Synthesis of (S)-Tert-butyl
(1-((4-(5-cyclopropylisoxazole-3-carboxamido)butyl)
amino)-1-oxopropan-2-yl)carbamate
##STR00520##
[0352] To a stirred solution of (S)-2-((tert-butoxycarbonyl)
amino)propanoic acid (0.08 g, 0.37 mmol) in DMF (2 mL) was added
EDCI.HCl (0.098 g, 0.51 mmol), HOBt (0.069 g, 0.51 mmol), and
triethylamine (0.14 mL, 1.0 mmol). The solution was stirred for 10
min at 0.degree. C.
N-(4-Aminobutyl)-5-cyclopropylisoxazole-3-carboxamide (0.065 g,
0.34 mmol) was added and the reaction stirred at it for 16 h. The
progress of the reaction was monitored by TLC. After complete
consumption of starting material, the reaction was quenched with
water and extracted with ethyl acetate. The organic layer was
washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and
concentrated under reduced pressure to obtain a crude residue which
was purified by column chromatography to afford (S)-tert-butyl
(1-((4-(5-cyclopropylisoxazole-3-carboxamido)butyl)amino)-1-oxopropan-2-y-
l)carbamate (0.08 g, 59%). LCMS: m/z=296.15 (M-Boc).sup.+.
Step 2: Synthesis of
(S)--N-(4-(2-aminopropanamido)butyl)-5-cyclopropylisoxazole-3-carboxamide
Hydrochloride
##STR00521##
[0354] To a stirred solution of (S)-tert-butyl
(1-((4-(5-cyclopropylisoxazole-3-carboxamido)butyl)amino)-1-oxopropan-2-y-
l)carbamate (0.08 g, 0.20 mmol) in dioxane (2 mL) at 0.degree. C.
was added 4M dioxane:HCl solution (4 mL). The reaction mixture was
stirred at rt for 5 h. The progress of the reaction was monitored
by TLC. After complete consumption of starting material, the
solvent was removed under reduced pressure to obtain a crude
residue which was purified by repeated washing with ether and
pentane to obtain
(S)--N-(4-(2-aminopropanamido)butyl)-5-cyclopropylisoxazole-3-carboxamide
hydrochloride (0.049 g, 83%). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.67 (t, J=5.9 Hz, 1H), 8.39 (t, J=5.6 Hz, 1H), 8.10 (s,
3H), 6.47 (s, 1H), 3.80-3.70 (m, 1H), 3.26-3.03 (m, 4H), 2.24-2.12
(m, 1H), 1.56-1.36 (m, 4H), 1.33 (d, J=6.9 Hz, 3H), 1.16-1.02 (m,
2H), 0.96-0.87 (m, 2H); LCMS (method A, ESI): m/z=295.15
(M+H).sup.+.
Example 13
Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-5-(2-hydroxyethyl)isoxazole-3-carboxamide
Hydrochloride (Cpd. No. 9)
##STR00522##
[0355] Step 1: Synthesis of Ethyl
5-(2-hydroxyethyl)isoxazole-3-carboxylate
##STR00523##
[0357] To a stirred solution of but-3-yn-1-ol (2 g, 28.5 mmol) in
ethanol (15 mL), was added ethyl nitro acetate (7.59 g, 57.06 mmol)
and DABCO (0.32 g, 2.85 mmol). The reaction was heated in a sealed
tube at 80.degree. C. The progress of the reaction was monitored by
TLC. After complete consumption of staring material the reaction
was quenched with water and extracted with ethyl acetate, the
organic layer was separated, washed with brine, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue which was purified by column chromatography to obtain
ethyl 5-(2-hydroxyethyl)isoxazole-3-carboxylate (3.1 g, 59%). LCMS:
m/z=186 (M+H).sup.+.
Step 2: Synthesis of 5-(2-hydroxyethyl)isoxazole-3-carboxylic
Acid
##STR00524##
[0359] To a stirred solution of ethyl
5-(2-hydroxyethyl)isoxazole-3-carboxylate (0.7 g, 3.78 mmol) in
THF: MeOH: H.sub.2O (1:1:1, 15 ml) was added LiOH (0.317 g, 7.56
mmol). The reaction was stirred at rt for 16 hr. The progress of
the reaction was monitored by TLC. After complete consumption of
starting material, the solvent was removed under reduced pressure
and the residue was acidified with dilute HCl to pH 2. The solid
precipitated was collected by filtration and dried under reduced
pressure to obtain 5-(2-hydroxyethyl)isoxazole-3-carboxylic acid
(0.529 g, crude). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.0
(brs, 1H), 6.40 (s, 1H), 3.69-3.65 (m, 2H), 3.0-2.95 (m, 2H).
Step 3: Synthesis of Pentafluorophenyl
5-(2-hydroxyethyl)isoxazole-3-carboxylate
##STR00525##
[0361] To a solution of 5-(2-hydroxyethyl)isoxazole-3-carboxylic
acid (0.529 g, 1.27 mmol) in DMF (5 mL) at 0.degree. C. under an
N.sub.2 atmosphere was added DCC (0.26 g, 1.27 mmol) followed by
pentafluorophenol (0.233 g, 1.27 mmol). The reaction was stirred at
rt for 2 h. The progress of the reaction was monitored by TLC.
After complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was separated, washed with brine, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue which was purified by column chromatography to give
pentafluorophenyl 5-(2-hydroxyethyl)isoxazole-3-carboxylate (0.26
g, 63%). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 6.40 (s, 1H),
3.7-3.65 (m, 2H), 3.0-2.96 (m, 2H).
Step 4: Synthesis of Tert-Butyl
((1r,4r)-4-(5-(2-hydroxyethyl)isoxazole-3-carboxamido)cyclohexyl)carbamat-
e
##STR00526##
[0363] To a stirred solution of pentafluorophenyl
5-(2-hydroxyethyl)isoxazole-3-carboxylate (0.25 g, 0.77 mmol) in
DMF (5 mL) was added tert-butyl ((1r, 4r)-4-aminocyclohexyl)
carbamate (0.16 g, 0.77 mmol). The reaction was stirred at rt for 2
hr. and the progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
quenched with water and extracted with ethyl acetate. The organic
layer was separated, washed with brine, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue which was purified by column chromatography to obtain
tert-butyl ((1
r,4r)-4-(5-(2-hydroxyethyl)isoxazole-3-carboxamido)cyclohexyl)carbama-
te (0.130 g, 47%). LCMS: m/z=254 (M+H).sup.+.
Step 5: Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-5-(2-hydroxyethyl)isoxazole-3-carboxamide
Hydrochloride
##STR00527##
[0365] To a stirred solution of tert-butyl ((1
r,4r)-4-(5-(2-hydroxyethyl)isoxazole-3-carboxamido)cyclohexyl)carbamate
(0.1 g, 0.28 mmol) in methanol (1 mL) at 0.degree. C. was added 4 M
methanol:HCl (10 mL). The reaction was at rt stirred for 2 h. The
progress of the reaction was monitored by TLC. After complete
consumption of starting material, the solvent was removed under
reduced pressure and the residue was purified by washings with
diethyl ether and hexane to obtain compound
N-((1r,4r)-4-aminocyclohexyl)-5-(2-hydroxyethyl)isoxazole-3-carboxamide
hydrochloride (0.060 g, 83%). .sup.1H NMR (400 MHz, DMSO-d.sub.5)
.delta. 8.62-8.54 (m, 1H), 8.04 (d, J=5.6 Hz, 3H), 6.58 (s, 1H),
4.89 (s, 1H), 3.70 (t, J=6.3 Hz, 3H), 2.93 (t, J=6.3 Hz, 3H),
2.02-1.95 (m, 2H), 1.85 (d, J=7.1 Hz, 2H), 1.51-1.34 (m, 4H), LCMS:
m/z=254 (M+H).sup.+.
Example 14
Synthesis of
N-((1r,4r)-4-aminocyclohexyl)-5-cyclopropyl-4-iodoisoxazole-3-carboxamide
Hydrochloride (Cpd. No. 8
##STR00528##
[0366] Step 1: Synthesis of Ethyl
5-cyclopropyl-4-iodooxazole-3-carboxylate
##STR00529##
[0368] To the stirred solution of ethyl
5-cyclopropylisoxazole-3-carboxylate (1 g, 5.52 mmol) in TFA (16
ml), was added N-iodosuccinimide (1.48 g, 6.62 mmol) and reaction
mixture stirred at rt for 2 h. The progress of the reaction was
monitored by TLC. After complete consumption of starting material,
the reaction was quenched with water and extracted with ethyl
acetate. The organic layer was dried over sodium sulphate and
evaporated under reduced pressure. The material was purified by
column chromatography to afford ethyl
5-cyclopropyl-4-iodoisoxazole-3-carboxylate (1.27 g, 75%).
Step 2: Synthesis of 5-cyclopropyl-4-iodoisoxazole-3-carboxylic
Acid
##STR00530##
[0370] To a stirred solution of ethyl
5-cyclopropyl-4-iodoisoxazole-3-carboxylate (1.27 g, 4.14 mmol) in
THF:MeOH:H.sub.2O (1:1:1, 9 ml) was added LiOH (1.04 g, 24.8 mmol).
The solution was stirred at rt for 16 hr. After complete
consumption of starting material, the residue was acidified to pH 2
with Amberlyst. The reaction mixture was filtration and
concentrated under reduced pressure to obtain a compound
5-cyclopropyl-4-iodoisoxazole-3-carboxylic acid (1.01 g, 87%).
LCMS: m/z=278.9 (M+H).sup.+.
Step 3: Synthesis of Tert-Butyl
((1r,4r)-4-(5-cyclopropyl-4-iodoisoxazole-3-carboxamido)cyclohexyl)carbam-
ate
##STR00531##
[0372] To a stirred solution of
5-cyclopropyl-4-iodoisoxazole-3-carboxylic acid (1.0 g, 3.59 mmol)
in DMF (10 ml) was added EDCI (0.892 g, 4.66 mmol) and HOBT (0.533
g, 3.94 mmol). The solution was stirred for 10 min at 0.degree. C.
Next tert-butyl ((1r,4r)-4-aminocyclohexyl)carbamate (0.769 g, 3.59
mmol) was added and the reaction was stirred at it for 2 hr. The
progress of the reaction was monitored by TLC. After complete
consumption of starting material, the reaction was quenched with
water and the solid precipitated was collected by filtration and
dried under reduced pressure to obtain a residue. The material was
purified by column chromatography to afford tert-butyl ((1
r,4r)-4-(5-cyclopropyl-4-iodoisoxazole-3-carboxamido)cyclohexyl)carbamate
(0.48 g, 28%).
Step 4: Synthesis of
N-((1r,4r)-4-aminocyclohexyl-5-cyclopropyl-4-iodoisoxazole-3-carboxamide
Hydrochloride
##STR00532##
[0374] To a stirred solution of tert-butyl
((1r,4r)-4-(5-cyclopropyl-4-iodoisoxazole-3-carboxamido)cyclohexyl)carbam-
ate (0.1 g, 0.210 mmol) in methanol (3 ml) at 0.degree. C. was
added 4 M methanolic:HCl (3 ml). The reaction was stirred for at rt
for 1 h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the solvent was removed
under reduced pressure and the residue was purified by washing with
diethyl ether to obtain
N-((1r,4r)-4-aminocyclohexyl)-5-cyclopropyl-4-iodoisoxazole-3-carboxamide
hydrochloride (0.008 g, 10%). .sup.1H NMR (400 MHz. DMSO-d.sub.6)
.delta. 8.70 (d, J=7.9 Hz, 1H), 7.92 (s, 3H), 3.67 (d, J=10.0 Hz,
1H), 2.96 (t, J=9.5 Hz, 1H), 2.20-2.17 (m, 1H), 1.97 (d, J=9.4 Hz,
2H), 1.87 (d, J 10.4 Hz, 2H), 1.39 (q, J=12.2, 11.2 Hz, 4H),
1.21-1.11 (m, 2H), 1.07-0.98 (m, 2H); LCMS (method C, ESI): m/z=375
(M+H).sup.+.
Example 15
Synthesis of N3-((1
r,4r)-4-aminocyclohexyl)-5-cyclopropylisoxazole-3,4-dicarboxamide
Hydrochloride (Cpd. No. 13)
##STR00533##
[0375] Step 1: Synthesis of
3-(((r,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)carbamoyl)-5-cyclopro-
pylisoxazole-4-carboxylic Acid
##STR00534##
[0377] To the stirred solution of tert-butyl
((1r,4r)-4-(5-cyclopropyl-4-iodoisoxazole-3-carboxamido)cyclohexyl)carbam-
ate (1.6 g, 3.37 mmol) in DMF:H.sub.2O (4:1, 10 ml) was added
Pd(OAc).sub.2 (0.037 g, 0.168 mmol) and dppf (0.186 g, 0.337 mmol)
and the reaction heated at 55.degree. C. under CO balloon pressure
overnight. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
filtered, diluted with water and extracted with ethyl acetate. The
organic layer was separated, washed with brine, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
a residue which was purified by column chromatography to obtain
3-(((1r,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)carbamoyl)-5-cyclopr-
opylisoxazole-4-carboxylic acid (0.350 g, 26%).
Step 2: Synthesis of Pentafluorophenyl
3-(((1r,4r)-4-((tert-butoxycarbonyl)amino)
cyclohexyl)carbamoyl)-5-cyclopropylisoxazole-4-carboxylate
##STR00535##
[0379] To the stirred solution of
3-(((1r,4r)-4-((tert-butoxycarbonyl)amino)
cyclohexyl)carbamoyl)-5-cyclopropylisoxazole-4-carboxylic acid (0.2
g, 0.508 mmol) in DMF (2 mL) at 0.degree. C. was added
pentafluorophenol (0.093 g, 0.508 mmol) and DCC (0.054 g, 0.508
mmol). The reaction was stirred at rt for 30 min. After complete
consumption of starting material, the reaction was quenched with
water and extracted with DCM; the organic layer was separated,
washed with sodium bicarbonate solution, dried using
Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain
pentafluorophenyl
3-(((r,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)carbamoyl)-5-cyclopro-
pylisoxazole-4-carboxylate (0.250 g). The material was used without
further purification LCMS: m/z=583.12 (M+Na) .sup.+.
Step 3: Synthesis of Tert-Butyl
((1r,4r)-4-(4-carbamoyl-5-cyclopropylisoxazole-3-carboxamido)cyclohexyl)c-
arbamate
##STR00536##
[0381] Ammonia was bubbled through a stirred solution of
pentafluorophenyl 3-(((1
r,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)carbamoyl)-5-cyclop-
ropylisoxazole-4-carboxylate (0.08 g, 0.143 mmol) in DCM (2 mL) at
0.degree. C. for 30 min. The reaction was then stirred at rt for 2
h. The progress of the reaction was monitored by TLC. After
complete consumption of starting material, the reaction was
evaporated to complete dryness. The material was purified by
trituration with hexane and diethyl ether to obtain tert-butyl ((1
r,4r)-4-4-carbamoyl-5-cyclopropylisoxazole-3-carboxamido)cyclohexyl)
carbamate (0.040 g, 71%.).
Step 4: Synthesis of
N3-((1r,4r)-4-aminocyclohexyl)-5-cyclopropylisoxazole-3,4-dicarboxamide
Hydrochloride
##STR00537##
[0383] To a stirred solution of tert-butyl
((1r,4r)-4-(4-carbamoyl-5-cyclopropylisoxazole-3-carboxamido)cyclohexyl)c-
arbamate (0.040 g, 0.101 mmol) in dioxane (2 mL) at 0.degree. C.
was added 4 M dioxane:HCl (3 mL). The reaction was stirred at rt
for 1 h and progress monitored by TLC. After complete consumption
of starting material, the solvent was removed under reduced
pressure and the residue was purified by washing with diethyl ether
to obtain N3-((1
r,4r)-4-aminocyclohexyl)-5-cyclopropylisoxazole-3,4-dicarboxamide
hydrochloride (0.022 g, 75%). .sup.1H NMR (400 MHz, DMSO-d.sub.6)
.delta. 9.10 (d, J=7.8 Hz, 1H), 8.50-8.45 (m, 1H), 7.91 (s, 3H),
7.64 (s, 1H), 3.83 (brs, 1H), 3.0-2.97 (m, 2H), 1.96 (d, J=7.6 Hz,
2H), 1.91-1.84 (m, 2H), 1.49-136 (m, 4H), 1.24-1.21 (m, 2H),
1.15-1.10 (m, 2H); LCMS: m/z=293.15 (M+H).sup.+.
Example 16
Synthesis of
N-(6-((R)-3-aminobutanamido)bicyclo[3.3.1]nonan-2-yl)-5-cyclopropylisoxaz-
ole-3-carboxamide (Cpd. No. 293)
##STR00538##
[0384] Step 1: Synthesis of
N.sup.2,N.sup.6-dibenzylbicyclo[3.3.1]nonane-2,6-diamine
##STR00539##
[0386] To a solution of bicyclo[3.3.1]nonane-2,6-dione (1.0 g,
6.5707 mmol) in THF (10 mL) was added benzyl amine (2.87 mL, 26.283
mmol) under N.sub.2 atmosphere at rt and stirred for 5 minutes.
AcOH (0.8 mL, 1.3798 mmol) was added and mixture was cooled to
0.degree. C. Sodium triacetoxy borohydride (5.57 g, 26.283 mmol)
was added portionwise over 30 min. The reaction was allowed to stir
at rt overnight. The reaction was diluted with water (20 mL) and
neutralized with saturated aq. solution of NaHCO.sub.3 (80 mL). The
mixture was extracted with DCM (40 mL.times.4). The combined
organic layer was washed with saturated aq solution of
NaHCO.sub.J(50 mL), brine (50 mL), dried over Na.sub.2SO.sub.4 and
concentrated under reduced pressure to give crude product, which
was purified by column chromatography using mobile phase 0.3%
methanol in DCM to obtain
N.sup.2,N.sup.6-dibenzylbicyclo[3.3.1]nonane-2,6-diamine (1.3 g,
yield 59.14%) LCMS: m/z=335.16 [M+H].sup.+.
Step 2: Synthesis of bicyclo[3.3.1]nonane-2,6-diamine
##STR00540##
[0388] To a suspension of 10% Pd/C (dry) in MeOH (3 mL) was added
solution of
N.sup.2,N.sup.6-dibenzylbicyclo[3.3.1]nonane-2,6-diamine (1.3 g,
3.886 mmol) in MeOH (10 mL). The reaction was stirred overnight
under a H.sub.2 atmosphere. The reaction was filtered through a
celite pad and washed with MeOH (50 mL). The filtrate was
concentrated under reduced pressure to obtain title compound (0.5
g, yield 83.4%). LCMS: m/z=155.20 [M+H].sup.+.
Step 3: Synthesis of Tert-Butyl
(6-aminobicyclo[3.3.1]nonan-2-yl)carbamate
##STR00541##
[0390] To a solution of bicyclo[3.3.1]nonane-2,6-diamine (500 mg,
3.241 mmol) in a mixture of MeOH (10 mL) and THF (20 mL) at
0.degree. C. under N.sub.2 atmosphere was added a solution of
Boc-anhydride (0.37 mL, 1.620 mmol) in mixture of MeOH (20 mL) and
THF (50 mL) over a period of 6 hours. The reaction was allowed to
stir at rt overnight. The reaction was concentrated under reduced
pressure to give crude product which was purified by column
chromatography using basic alumina as stationary phase and 0-4%
MeOH in DCM as mobile phase to obtain title compound (290 mg, yield
35.17%). LCMS: m/z=255.25 [M+H].sup.+.
Step 4: Synthesis of Tert-Butyl
(6-(5-cyclopropylisoxazole-3-carboxamido)bicyclo[3.3.1]nonan-2-yl)carbama-
te
##STR00542##
[0392] To a solution of 5-cyclopropylisoxazole-3-carboxylic acid
(175 mg, 1.14 mmol) in DMF at 0.degree. C. under N.sub.2 atmosphere
was added HATU (650 mg, 1.71 mmol). The reaction stirred for 20
min. and then then tert-butyl
(6-aminobicyclo[3.3.1]nonan-2-yl)carbamate (290 mg, 1.14 mmol) was
added followed by addition of DIPEA (0.6 mL, 3.42 mmol). The
reaction was brought to rt and stirred overnight. The reaction was
diluted with water (50 mL) and extracted with ethyl acetate (50
mL.times.3). The combined organic layer was washed with brine (20
mL), dried over Na.sub.2SO.sub.4 and concentrated to give crude
product which was purified by column chromatography using mobile
phase to 0-12% ethyl acetate in hexane to obtain the title compound
(300 mg, yield 75.5%). LCMS: m/z=334.36 [M-56].sup.+.
Step 5: Synthesis of
N-(6-aminobicyclo[3.3.1]nonan-2-yl)-5-cyclopropylisoxazole-3-carboxamide
TFA Salt
##STR00543##
[0394] To a solution of tert-butyl
(6-(5-cyclopropylisoxazole-3-carboxamido)bicyclo[3.3.1]nonan-2-yl)carbama-
te (300 mg, 0.7702 mmol) in DCM (3 mL) at 0.degree. C. under
N.sub.2 atmosphere was added TFA (1.5 mL). The reaction was allowed
to stir at rt for 2 hours. The reaction was concentrated under
reduced pressure and triturated with diethyl ether to obtain the
title compound as the TFA salt (300 mg, yield 96.5%). LCMS:
m/z=290.36 [M+H].sup.+.
Step 6: Synthesis of Tert-Butyl
((2R)-4-((6-(5-cyclopropylisoxazole-3-carboxamido)
bicyclo[3.3.1]nonan-2-yl)amino)-4-oxobutan-2-yl)carbamate
##STR00544##
[0396] To a solution of the TFA salt of
(R)-3-((tert-butoxycarbonyl) amino)butanoic acid (50 mg, 0.246
mmol) in DMF (1.0 mL) at 0.degree. C. was added HATU (140 mg, 0.369
mmol). After stirring for 15 minutes, the TFA salt of
N-(6-aminobicyclo[3.3.1]nonan-2-yl)-5-cyclopropylisoxazole-3-carboxamide
(100 mg, 0.246 mmol) was added followed by addition of DIPEA (0.126
mL, 0.738 mmol). The reaction was brought to rt and stirred
overnight. The reaction was diluted with water (20 mL) and
extracted with ethyl acetate (20 mL.times.3). The combined organic
layer was dried over Na.sub.2SO4 and concentrated under reduced
pressure to give crude product which was purified by column
chromatography using mobile phase 0-70% ethyl acetate in hexane to
obtain the title compound (80 mg, 67.9%). LCMS: m/z=475.16
[M+H].sup.+.
Step 7: Synthesis of
N-(6-((R)-3-aminobutanamido)bicyclo[3.3.]nonan-2-yl)-5-cyclopropylisoxazo-
le-3-carboxamide
##STR00545##
[0398] To a solution of tert-butyl
((2R)-4-((6-(5-cyclopropylisoxazole-3-carboxamido)bicyclo[3.3.1]nonan-2-y-
l)amino)-4-oxobutan-2-yl)carbamate (80 mg, 0.1686 mmol) in DCM (0.8
mL) at 0.degree. C. under N.sub.2 atmosphere was added TFA (0.4 mL)
dropwise. The reaction was allowed to stir at room temperature for
2 hours. The reaction was concentrated under reduced pressure to
give crude product which was triturated with diethyl ether (10 mL)
and hexanes (10 mL) to obtain the title compound as TFA salt (50
mg, 60.7%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta. 8.667 (d,
1H), 8.180 (d, 111, 7.792 (s, 3H), 6.478 (s, 1H), 4.067 (s, 1H),
3.907 (s, 1H), 3.39 (s, 1H), 2.42 (s, 2H), 2.18 (s, 2H), 2.42 (s,
2H), 1.91-1.88 (m, 4H), 1.78-1.65 (m, 4H), 1.54-1.50 (m, 4H),
1.16-1.09 (m, 5H), 0.917 (s, 1H); LCMS: m/z=375.4 [M+1].sup.-.
Example 17
Synthesis of
N-(4-(3-aminopropanamido)phenyl)-5-cyclopropylisoxazole-3-carboxamide
Hydrochloride (Cpd. No. 325)
##STR00546##
[0399] Step 1: Synthesis of
N-(4-aminophenyl)-5-cycloproplisoxazole-3-carboxamide
##STR00547##
[0401] Into a 250-mL round-bottom flask purged and maintained with
an inert atmosphere of nitrogen was placed dichloromethane (40 mL)
and benzene-1,4-diamine (1.059 g, 9.79 mmol, 1.05 equiv); then
5-cyclopropyl-1,2-oxazole-3-carbonyl chloride (1.6 g, 9.33 mmol,
1.00 equiv) in 10 mL DCM was added dropwise. The resulting solution
was stirred for 12 h at room temperature. The resulting mixture was
concentrated under vacuum. The solids were filtered off. The
filtrate was extracted with 2.times.100 mL of ethyl acetate and the
organic layers combined and concentrated under vacuum. The residue
was purified on a silica gel column with ethyl acetate/petroleum
ether (10:1). This resulted in 750 mg (33%) of
N-(4-aminophenyl)-5-cyclopropylisoxazole-3-carboxamide as a yellow
solid. LCMS: rt=1.04 min, m/z=285.0 [M+CN].sup.+.
Step 2: Synthesis of Tert-Butyl
3-(4-(5-cyclopropylisoxazole-3-carboxamido)
phenylamino)-3-oxopropylcarbamate
##STR00548##
[0403] Into a 100-mL round-bottom flask purged and maintained with
an inert atmosphere of nitrogen was placed
N-(4-aminophenyl)-5-cyclopropylisoxazole-3-carboxamide (170 mg,
0.70 mmol, 1.00 equiv), tetrahydrofuran (5 mL), dichloromethane (5
mL), EDCI (401 mg, 2.09 mmol, 2.99 equiv), DIEA (271 mg, 2.10 mmol,
3.00 equiv), HOBT (283 mg, 2.09 mmol, 3.00 equiv), and
3-[[(tert-butoxy)carbonyl]amino]propanoic acid (264 mg, 1.40 mmol,
2.00 equiv). The resulting solution was stirred for 6 h at room
temperature. The mixture was concentrated under vacuum. The residue
was diluted with 50 mL of H.sub.2O and extracted with DCM. The
organic phase was collected and dried over anhydrous sodium
sulfate. The residue was purified on a silica gel column with ethyl
acetate/petroleum ether (5:1). This resulted in 120 mg (41%) of
tert-butyl
3-(4-(5-cyclopropylisoxazole-3-carboxamido)phenylamino)-3-oxopropylcarbam-
ate as a light yellow solid. LCMS: m/z=437.1 [M+Na].sup.+.
Step 3: Synthesis of
N-(4-(3-aminopropanamido)phenyl)-5-cyclopropylisoxazole-3-carboxamide
Hydrochloride
##STR00549##
[0405] Into a 50-mL round-bottom flask purged and maintained with
an inert atmosphere of nitrogen was placed tert-butyl
3-(4-(5-cyclopropylisoxazole-3-carboxamido)phenylamino)-3-oxopropylcarbam-
ate (120 mg, 0.29 mmol, 1.00 equiv) and 1,4-dioxane (5 mL). Then
hydrogen chloride was introduced into the mixture. The resulting
solution was stirred for 2 h at room temperature. The mixture was
then concentrated under vacuum. The crude product was purified by
Flash-Prep-HPLC with the following conditions (IntelFlash-1):
Column, silica gel; mobile phase, detector, UV 254 nm. The result
solution was acidified by dilute hydrochloric acid (1N), then
concentrated and dried. This resulted in 21.4 mg (24%) of
N-(4-(3-aminopropanamido)phenyl)-5-cyclopropylisoxazole-3-carboxamide
hydrochloride as a white solid. .sup.1H-NMR (300 MHz, D.sub.2O):
.delta. 7.54-7.37 (m, 4H), 6.36 (s, 1H), 3.25 (t, J=6.6 Hz, 2H),
2.77 (t, J=6.6 Hz, 2H), 2.12-2.04 (m, 1H), 1.08-1.02 (m, 2H),
0.97-0.92 (m, 2H). LCMS: m/z=315.0 [M+H].sup.+.
Example 18
Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylisoxazole-3-carboxamide (Cpd. No. 428)
##STR00550##
[0406] Step 1: Synthesis of Tert-Butyl
3-(5-cyclopropylisoxazole-3-carboxamido)azetidine-1-carboxylate
##STR00551##
[0408] To a solution of 5-cyclopropylisoxazole-3-carboxylic acid
(1.53 g) in DMF (20 mL) was added HATU (6.84 g, DIPEA (3.87 g) and
tert-butyl 3-aminoazetidine-1-carboxylate (2.58 g). The resulting
mixture was stirred at r.t. overnight. The reaction mixture was
diluted with ethyl acetate (120 mL), washed with brine (30
mL.times.4), dried over Na.sub.2SO.sub.4 and concentrated under
reduced pressure. The residue was purified by flash column
chromatography (eluant petroleum ether: ethyl acetate gradient
elution 100:0 to 50:50) to afford tert-butyl
3-(5-cyclopropylisoxazole-3-carboxamido)azetidine-1-carboxylate
(2.55 g, 83%) as a pale yellow solid. ESI-LCMS (m/z):
330[M+Na].sup.+.
Step 2: Synthesis of
N-(azetidin-3-yl)-5-cyclopropylisoxazole-3-carboxamide
##STR00552##
[0410] To a solution of tert-butyl
3-(5-cyclopropylisoxazole-3-carboxamido)azetidine-1-carboxylate
(2.55 g) in DCM (10 mL) was added TFA (4 mL) drop-wise. The
resulting mixture was stirred at r.t. overnight. The reaction
mixture was concentrated under reduced pressure and the residue was
treated with ammonia in MeOH (7N, 30 mL) and the solution
concentrated under reduced pressure. The residue was purified by
flash column chromatography (eluant: DCM:MeOH (MeOH:7N NH.sub.3
100:1) 10:1) to afford
N-(azetidin-3-yl)-5-cyclopropylisoxazole-3-carboxamide (1.35 g,
78%) as a white solid. ESI-LCMS (m/z): 208[M+H].sup.+.
Step 3: Synthesis of
N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylisoxazole-3-carboxamide
##STR00553##
[0412] Into the stirred solution of
N-(azetidin-3-yl)-5-cyclopropylisoxazole-3-carboxamide (400 mg, 1.9
mmol) and 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (425 mg,
1.9 mmol) in MeOH (10 mL) was added NaBH.sub.3CN (363 mg, 5.8
mmol). The mixture was stirred at 60.degree. C. for 20 h. The
product was purified by reversed phased pre-HPLC (NH.sub.4HCO3.
CH.sub.3CN:H.sub.2O=5%-95%) to afford
N-(l-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopr-
opylisoxazole-3-carboxamide as a white solid (70 mg, 8.8%).
ESI-LCMS (m/z): 412 [M+H].sup.-; .sup.1HNMR (400 MHz, CD.sub.3OD) d
ppm: 7.64 (s, 1H), 7.50 (s, 1H), 7.37-7.33 (m, 2H), 7.20 (d, J=8.81
Hz, 2H), 6.37 (s, 1H), 5.32 (s, 2H), 4.61-4.58 (m, 1H), 3.70-3.66
(m, 2H), 3.61 (s, 2H), 3.22-3.18 (m, 2H), 2.19-2.15 (m, 1H),
1.18-1.13 (m, 2H), 1.00-0.96 (m, 2H).
Example 19
SMYD3 Biochemical Assay
General Materials
[0413] S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH),
Tris, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin (BSG),
and Tris(2-carboxyethyl)phosphine hydrochloride solution (TCEP)
were purchased from Sigma-Aldrich at the highest level of purity
possible. .sup.3H-SAM was purchase from American Radiolabeled
Chemicals with a specific activity of 80 Ci/mmol. 384-well opaque
white OptiPlates and SPA beads (Perkin Elmer, catalog # RPNQ0013)
were purchased from PerkinElmer.
Substrates
[0414] N-terminally GST-tagged MEKK2 (MAP3K2) protein corresponding
to reference sequence AAF63496.3 was purchased from Life
Technologies (catalog # PV4010). This protein was expressed in High
Five insect cells and purified to >85% purity. Protein identity
was confirmed by MS/MS analysis after proteolytic digestion. The
protein sequence used was:
TABLE-US-00006 (SEQ ID No. 1).
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGTMDDQQALNSIMQDL
AVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVK
LEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKALELLDRSIHMKS
LKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSS
PPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQMLDPLSLSSPENSGS
GSCPSLDSPLDGESYPKSRMPRAQSYPDNHQEFSDYDNPIFEKFGKGGTY
PRRYHVSYHHQEYNDGRKTFPRARRTQGNQLTSPVSFSPTDHSLSTSSGS
SIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGKLLGQ
GAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL
HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYT
RQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLS
GTGMKSVTGTPYWMSPEVISGQGYGRKADIWSVACTVVEMLTEKPPWAEF
EAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLRHM FVHYH.
Molecular Biology
[0415] Full-length human SMYD3 isoform 1 (BAB86333) was inserted
into a modified pET21 b plasmid containing a His6 tag and TEV and
SUMO cleavage sites. Because two common variants of SMYD3 exist in
the population, site directed mutagenesis was subsequently
performed to change amino acid 13 from an asparagine to a lysine,
resulting in plasmid pEPZ533. A lysine at position 13 conforms to
the more commonly occurring sequence (NP_001161212).
Protein Expression
[0416] E. coli (BL21 codonplus RIL strain, Stratagene) were
transformed with plasmid pEPZ553 by mixing competent cells and
plasmid DNA and incubating on ice for 30 minutes followed by heat
shock at 42.degree. C. for 1 minute and cooling on ice for 2
minutes. Transformed cells were grown and selected on LB agar with
100 .mu.g/mL ampicillin and 17 .mu.g/mL chloramphenicol at
37.degree. C. overnight. A single clone was used to inoculate 200
mL of LB medium with 100 g/mL ampicillin and 17 .mu.g/mL
chloramphenicol and incubated at 37.degree. C. on an orbital shaker
at 180 rpm. Once in log growth, the culture was diluted 1:100 into
2 L of LB medium and grown until OD.sub.600 was about 0.3 after
which the culture was incubated at 15.degree. C. and 160 rpm. Once
OD.sub.600 reached about 0.4, IPTG was added to a final
concentration of 0.1 mM and the cells were grown overnight at
15.degree. C. and 160 rpm. Cells were harvested by centrifugation
at 8000 rpm, for 4 minutes at 4.degree. C. and stored at
-80.degree. C. for purification.
Protein Purification
[0417] Expressed full-length human His-tagged SMYD3 protein was
purified from cell paste by Nickel affinity chromatography after
equilibration of the resin with Buffer A (25 mM Tris, 200 mM NaCl,
5% glycerol, 5 mM .beta.-mercaptoethanol, pH7.8). The column was
washed with Buffer B (Buffer A plus 20 mM imidazole) and His-tagged
SMYD3 was eluted with Buffer C (Buffer A plus 300 mM imidazole).
The His tag, TEV and SUMO cleavage sites were removed generating
native SMYD3 by addition of ULP1 protein at a ratio of 1:200
(ULP1:SMYD3). Imidazole was removed by dialysis overnight in Buffer
A. The dialyzed solution was applied to a second Nickel column and
the native SMYD3 protein was collected from the column
flow-through. The flow-through was dialyzed in Buffer D (25 mM
Tris, 5% glycerol, 5 mM .beta.-mercaptoethanol, 50 mM NaCl, pH7.8)
and ULP1 was removed using a Q sepharose fast flow column. SMYD3
was eluted in Buffer A and further purified using an S200
size-exclusion column equilibrated with Buffer A. SMYD3 was
concentrated to 2 mg/mL with a final purity of 89%.
Predicted Translation:
TABLE-US-00007 [0418] SMYD3 (Q9H7B4) (SEQ ID No. 2).
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCD
RCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPD
SVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
FQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPS
ISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERR
KQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHW
KWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIM
RVTHGREHSLIEDLILLLEECDANIRAS.
General Procedure for SMYD3 Enzyme Assays on MEKK2 Protein
Substrate
[0419] The assays were all performed in a buffer consisting of 25
mM Tris-Cl pH 8.0, 1 mM TCEP, 0.005% BSG, and 0.005% Tween 20,
prepared on the day of use. Compounds in 100% DMSO (1 ul) were
spotted into a 384-well white opaque OptiPlate using a Bravo
automated liquid handling platform outfitted with a 384-channel
head (Agilent Technologies). DMSO (1 ul) was added to Columns 11,
12, 23, 24, rows A-H for the maximum signal control and 1 ul of
SAH, a known product and inhibitor of SMYD3, was added to columns
11, 12, 23, 24, rows I-P for the minimum signal control. A cocktail
(40 ul) containing the SMYD3 enzyme was added by Multidrop Combi
(Thermo-Fisher). The compounds were allowed to incubate with SMYD3
for 30 min at room temperature, then a cocktail (10 ul) containing
SAM and MEKK2 was added to initiate the reaction (final volume=51
ul). The final concentrations of the components were as follows:
SMYD3 was 0.4 nM, .sup.3H-SAM was 8 nM, MEKK2 was 12 nM. SAH in the
minimum signal control wells was 1 mM, and the DMSO concentration
was 2%. The assays were stopped by the addition of non-radiolabeled
SAM (10 ul) to a final concentration of 100 uM, which dilutes the
.sup.3H-SAM to a level where its incorporation into MEKK2 is no
longer detectable. Radiolabeled MEKK2 was detected using a
scintillation proximity assay (SPA). 10 uL of a 10 mg/mL solution
of SPA beads in 0.5 M citric acid was added and the plates
centrifuged at 600 rpm for 1 min to precipitate the radiolabeled
MEKK2 onto the SPA beads. The plates were then read in a
PerkinElmer TopCount plate reader to measure the quantity of
.sup.3H-labeled MEKK2 as disintegrations per minute (dpm) or
alternatively, referred to as counts per minute (cpm).
% Inhibition Calculation
[0420] % inh = 100 - ( dpm cmpd - dpm m i n dpm ma x - dpm m i n )
.times. 100 ##EQU00001##
[0421] Where dpm=disintegrations per minute, cmpd=signal in assay
well, and min and max are the respective minimum and maximum signal
controls.
Four-Parameter IC50 Fit
[0422] Y = Bottom + ( Top - Bottom ) ( 1 + ( X IC 50 ) Hill
Coefficient ##EQU00002##
[0423] Where top and bottom are the normally allowed to float, but
may be fixed at 100 or 0 respectively in a 3-parameter fit. The
Hill Coefficient normally allowed to float but may also be fixed at
1 in a 3-parameter fit. Y is the % inhibition and X is the compound
concentration.
[0424] SMYD3 biochemical assay data for representative Compounds of
the Disclosure are presented in Table 1 in the column titled "SMYD3
Biochem IC.sub.50 (.mu.M)."
Example 20
SMYD3 Cell Assay
Trimethyl-MEKK2-in-Cell Western Assay
[0425] 293T/17 adherent cells were purchased from ATCC (American
Type Culture Collection), Manassas, Va., USA. MEM/Glutamax medium,
Optimem Reduced Serum medium, penicillin-streptomycin, 0.05%
trypsin and 1.times.D-PBS were purchased from Life Technologies,
Grand Island, N.Y., USA. PBS-10X was purchased from Ambion, Life
Technologies, Grand Island. N.Y., USA. PBS with Tween 20 (PBST
(10.times.)) was purchased from KPL, Gaithersburg, Md., USA. Tet
System FBS-- approved FBS US Source was purchased from Clontech.
Mountain View, Calif., USA. Odyssey blocking buffer, 800CW goat
anti-rabbit IgG (H+L) antibody, 680CW Goat anti-mouse IgG (H+L) and
Licor Odyssey infrared scanner were purchased from Licor
Biosciences. Lincoln, Nebr., USA. Tri-methyl-Lysine [A260]-MEKK2
antibody, MEKK2 and SMYD3 plasmids were made at Epizyne. Anti-flag
monoclonal mouse antibody was purchased from Sigma, St. Louis, Mo.,
USA. Methanol was purchased from VWR. Franklin, Mass., USA. 10%
Tween 20 was purchased from KPL, Inc., Gaithersburg, Md. USA.
Fugene was purchased from Promega, Madison, Wis., USA. The Biotek
ELx405 was purchased from BioTek, Winooski, Vt., USA. The multidrop
combi was purchased from Thermo Scientific, Waltham, Mass.,
USA.
[0426] 293T/17 adherent cells were maintained in growth medium
(MEM/Glutamax medium supplemented with 10% v/v Tet System FBS and
cultured at 37.degree. C. under 5% CO.sub.2.
Cell treatment, In Cell Western (ICW) for detection of
trimethyl-lysine-MEKK2 and MEKK2.
[0427] 293T/17 cells were seeded in assay medium at a concentration
of 33,333 cells per cm.sup.2 in 30 mL medium per T150 flask and
incubated at 37.degree. C. under 5% CO.sub.2. Plasmids were
prepared for delivery to cells by first mixing 1350 .mu.L Opti-MEM
with Fugene (81 .mu.L) in a sterile Eppendorf and incubated for
five minutes at room temperature (RT). MEKK2-flag (13.6 ug/T150)
MEKK2 p3XFlag-CMV-14 with C-3XFlag and SMYD3 (0.151 ug/T150) SMYD3
p3XFlag-CMV-14 without C-3XFlag plasmids were aliquotted to a 1.7
mL sterile microfuge tube. The gene ID for MEKK2 and SMYD3 is
NM_006609.3 and Q9H7B4, respectively. Entire volume of
Opti-MEM/Fugene mixture was then added to a microfuge tube
containing DNA plasmid, mixed and then incubated.times.15 minutes
at RT. The medium on the 293T/17 cells was refreshed, and the
DNA/Fugene complex is added aseptically to each flask, rocked
gently, and incubated at 37 C for 5 hours. Medium was then removed,
and cells were washed once with PBS in the flask. Trypsin 0.05% (3
mL) was added and cells incubated for three minutes. Room
temperature MEM+10% Tet system FBS was added and cells were mixed
gently, and counted using the Vi-cell. Cells were seeded at 100,000
cells/mL in 50 .mu.L MEM/10% Tet FBS/Pen/Strep to a 384 well
black/clear poly-D-lysine coated plate containing test agent
diluted in DMSO. The final top concentration of test compound was
40 .mu.M. The total concentration of DMSO did not exceed 0.2%
(v/v). Plates were incubated.times.30 minutes at RT in low-airflow
area, followed by incubation at 37.degree. C. under 5% CO.sub.2 for
24 hours. Medium was aspirated from all wells of assay plates prior
to fixation and permeabilization with ice cold (-20.degree. C.)
methanol (90 .mu.L/well) for ten minutes. Plates were rinsed with
PBS three times on BioTek ELx405. PBS was removed with a final
aspiration, and Odyssey blocking buffer (50 .mu.L/well) was added
to each well and incubated for one hour at RT. Primary antibody
solution was prepared (anti-trimethyl-MEKK2 at 1:600 dilution plus
mouse anti-flag antibody at 1:10,000 dilution in diluent (Odyssey
Blocking buffer+0.1% Tween 20)) and 20 .mu.L per well was dispensed
using the Multidrop Combi. Assay plates were then sealed with foil,
and incubated overnight at 4.degree. C. Plates were washed five
times with PBS-Tween (1X) on Biotek ELx405 and blotted on paper
towel to remove excess reagent. Detection antibody solution (IRDye
800 CW goat anti-rabbit IgG diluted 1:400 in diluent (Odyssey
Blocking buffer+0.1% Tween 20), plus IRDye 680CW goat anti-mouse
IgG at 1:500 in diluent (Odyssey Blocking buffer+0.1% Tween 20) was
added (20 .mu.L/well) and incubated in dark for one hour at RT.
Plates were then washed four times with PBS-T (1X) on ELx405. A
final rinse with water was performed (115 .mu.L/well.times.three
washes on the ELx405). Plates were then centrifuged upside down, on
paper towel, at 200.times.g to remove excess reagent. Plates were
left to dry in dark for one hour. The Odyssey Imager was used to
measure the integrated intensity of 700 and 800 wavelengths at
resolution of 84 .mu.m, medium quality, focus offset 4.0, 700
channel intensity=3.5 to measure the MEKK2-flag signal, 800 channel
intensity=5 to measure the Trimethyl-MEKK2 signal of each well.
Calculations:
[0428] First, the ratio for each well was determined by:
( Trimethyl MEKK 2 800 nm value flag tagged MEKK 2 700 nm value )
##EQU00003##
[0429] Each plate included fourteen control wells of DMSO only
treatment (Minimum Inhibition) as well as fourteen control wells
for maximum inhibition (Background). The average of the ratio
values for each control type was calculated and used to determine
the percent inhibition for each test well in the plate. Reference
compound was serially diluted two-fold in DMSO for a total of nine
test concentrations, beginning at 40 .mu.M. Percent inhibition was
calculated (below).
Percent Inhibition = 100 - ( ( ( individual Test Sample Ratio ) - (
Background Avg Ratio ) ( Minimum inhibition Ratio ) ( Background
Average Ratio ) ) * 100 ) ##EQU00004##
[0430] Non-linear regression curves were generated to calculate the
IC.sub.50 and dose-response relationship using triplicate wells per
concentration of compound.
[0431] SMYD3 cell assay data for representative Compounds of the
Disclosure are presented in Table 1 in the column titled "SMYD3
Cell IC.sub.50 (.mu.M)."
Example 21
SMYD2 Biochemical Assay
General Materials
[0432] S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH),
bicine, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin
(BSG), and Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) were
purchased from Sigma-Aldrich at the highest level of purity
possible. 3H-SAM was purchase from American Radiolabeled Chemicals
with a specific activity of 80 Ci/mmol. 384-well streptavidin
Flashplates were purchased from PerkinElmer.
Substrates
[0433] Peptide was synthesized with a N-terminal linker-affinity
tag motif and a C-terminal amide cap by 21.sup.st Century
Biochemicals. The peptide was high high-performance liquid
chromatography (HPLC) purified to greater than 95% purity and
confirmed by liquid chromatography mass spectrometry (LC-MS). The
sequence was ARTKQTARKSTGGKAPRKQLATKAARKSA(K-Biot)-amide. (SEQ ID
No: 3)
Production of Recombinant SMYD2 Enzymes for Biochemical Enzyme
Activity Assays
[0434] Full length SMYD2 (NP_064582.2) was cloned into a
pFastbac-Htb-lic vector with an N-terminal His6 tag and FLAG tag,
preceded by a TEV protease cleavage site. The protein was expressed
in Sf9 insect cells. Cells were resuspended in lysis buffer (25 mM
HEPES-NaOH, pH 7.5, 200 mM NaCl, 5% glycerol, and 5 mM .beta.-ME)
and lysed by sonication. The protein was purified by Ni-NTA
(Qiagen), followed by TEV cleavage to remove the His6 tag,
subtractive Ni-NTA (Qiagen), and gel filtration chromatography
using an S200 column (GE Healthcare). Purified protein was stored
in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl. and 1 mM TCEP.
General Procedure for SMYD2 Enzyme Assays on Peptide Substrates
[0435] The assays were all performed in a buffer consisting of 20
mM Bicine (pH=7.6), 1 mM TCEP, 0.005% Bovine Skin Gelatin, and
0.002% Tween20, prepared on the day of use. Compounds in 100% DMSO
(1 ul) were spotted into a polypropylene 384-well V-bottom plates
(Greiner) using a Platemate Plus outfitted with a 384-channel head
(Thermo Scientific). DMSO (1 ul) was added to Columns 11, 12, 23,
24, rows A-H for the maximum signal control and 1 ul of SAH, a
known product and inhibitor of SMYD2, was added to columns 11, 12,
23, 24, rows I-P for the minimum signal control. A cocktail (40 ul)
containing the SMYD2 enzyme was added by Multidrop Combi
(Thermo-Fisher). The compounds were allowed to incubate with SMYD2
for 30 min at room temperature, then a cocktail (10 ul) containing
.sup.3H-SAM and peptide was added to initiate the reaction (final
volume=51 ul). The final concentrations of the components were as
follows: SMYD2 was 1.5 nM, .sup.3H-SAM was 10 nM, and peptide was
60 nM, SAH in the minimum signal control wells was 1000 uM, and the
DMSO concentration was 2%. The assays were stopped by the addition
of non-radioactive SAM (10 ul) to a final concentration of 600 uM,
which dilutes the .sup.3H-SAM to a level where its incorporation
into the peptide substrate is no longer detectable. 50 ul of the
reaction in the 384-well polypropylene plate was then transferred
to a 384-well Flashplate and the biotinylated peptides were allowed
to bind to the streptavidin surface for at least 1 hour before
being washed three times with 0.1% Tween20 in a Biotek ELx405 plate
washer. The plates were then read in a PerkinElmer TopCount plate
reader to measure the quantity of .sup.3H-labeled peptide bound to
the Flashplate surface, measured as disintegrations per minute
(dpm) or alternatively, referred to as counts per minute (cpm).
% Inhibition Calculation
[0436] % inh = 100 - ( dpm ? - dpm ? dpm ? - dpm m i n ) .times.
100 ##EQU00005## ? indicates text missing or illegible when filed
##EQU00005.2##
[0437] Where dpm=disintegrations per minute, cmpd=signal in assay
well, and min and max are the respective minimum and maximum signal
controls.
Four-Parameter IC50 Fit
[0438] % inhibition = Bottom + Top - Bottom ( 1 + ( IC 50 / [ I ] )
Hill coefficient ) ##EQU00006##
[0439] Where top and bottom are the normally allowed to float, but
may be fixed at 100 or 0 respectively in a 3-parameter fit. The
Hill Coefficient normally allowed to float but may also be fixed at
1 in a 3-parameter fit. I is the compound concentration.
[0440] SMYD2 biochemical assay data for representative Compounds of
the Disclosure are presented in Tables 2 and 3 in the column titled
"SMYD2 Biochem IC.sub.50 (.mu.M)."
[0441] Having now fully described this invention, it will be
understood by those of ordinary skill in the art that the same can
be performed within a wide and equivalent range of conditions,
formulations, and other parameters without affecting the scope of
the invention or any embodiment thereof.
[0442] Other embodiments of the invention will be apparent to those
skilled in the art from consideration of the specification and
practice of the invention disclosed herein. It is intended that the
specification and examples be considered as exemplary only, with a
true scope and spirit of the invention being indicated by the
following claims.
[0443] All patents and publications cited herein are fully
incorporated by reference herein in their entirety.
Sequence CWU 1
1
31855PRTArtificial Sequencesynthesized protein 1Met Ala Pro Ile Leu
Gly Tyr Trp Lys Ile Lys Gly Leu Val Gln Pro1 5 10 15Thr Arg Leu Leu
Leu Glu Tyr Leu Glu Glu Lys Tyr Glu Glu His Leu 20 25 30Tyr Glu Arg
Asp Glu Gly Asp Lys Trp Arg Asn Lys Lys Phe Glu Leu 35 40 45Gly Leu
Glu Phe Pro Asn Leu Pro Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60Leu
Thr Gln Ser Met Ala Ile Ile Arg Tyr Ile Ala Asp Lys His Asn65 70 75
80Met Leu Gly Gly Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu Glu
85 90 95Gly Ala Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile Ala Tyr
Ser 100 105 110Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu Ser Lys
Leu Pro Glu 115 120 125Met Leu Lys Met Phe Glu Asp Arg Leu Cys His
Lys Thr Tyr Leu Asn 130 135 140Gly Asp His Val Thr His Pro Asp Phe
Met Leu Tyr Asp Ala Leu Asp145 150 155 160Val Val Leu Tyr Met Asp
Pro Met Cys Leu Asp Ala Phe Pro Lys Leu 165 170 175Val Cys Phe Lys
Lys Arg Ile Glu Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190Leu Lys
Ser Ser Lys Tyr Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195 200
205Thr Phe Gly Gly Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro Arg
210 215 220His Asn Gln Thr Ser Leu Tyr Lys Lys Ala Gly Thr Met Asp
Asp Gln225 230 235 240Gln Ala Leu Asn Ser Ile Met Gln Asp Leu Ala
Val Leu His Lys Ala 245 250 255Ser Arg Pro Ala Leu Ser Leu Gln Glu
Thr Arg Lys Ala Lys Ser Ser 260 265 270Ser Pro Lys Lys Gln Asn Asp
Val Arg Val Lys Phe Glu His Arg Gly 275 280 285Glu Lys Arg Ile Leu
Gln Phe Pro Arg Pro Val Lys Leu Glu Asp Leu 290 295 300Arg Ser Lys
Ala Lys Ile Ala Phe Gly Gln Ser Met Asp Leu His Tyr305 310 315
320Thr Asn Asn Glu Leu Val Ile Pro Leu Thr Thr Gln Asp Asp Leu Asp
325 330 335Lys Ala Leu Glu Leu Leu Asp Arg Ser Ile His Met Lys Ser
Leu Lys 340 345 350Ile Leu Leu Val Ile Asn Gly Ser Thr Gln Ala Thr
Asn Leu Glu Pro 355 360 365Leu Pro Ser Leu Glu Asp Leu Asp Asn Thr
Val Phe Gly Ala Glu Arg 370 375 380Lys Lys Arg Leu Ser Ile Ile Gly
Pro Thr Ser Arg Asp Arg Ser Ser385 390 395 400Pro Pro Pro Gly Tyr
Ile Pro Asp Glu Leu His Gln Val Ala Arg Asn 405 410 415Gly Ser Phe
Thr Ser Ile Asn Ser Glu Gly Glu Phe Ile Pro Glu Ser 420 425 430Met
Glu Gln Met Leu Asp Pro Leu Ser Leu Ser Ser Pro Glu Asn Ser 435 440
445Gly Ser Gly Ser Cys Pro Ser Leu Asp Ser Pro Leu Asp Gly Glu Ser
450 455 460Tyr Pro Lys Ser Arg Met Pro Arg Ala Gln Ser Tyr Pro Asp
Asn His465 470 475 480Gln Glu Phe Ser Asp Tyr Asp Asn Pro Ile Phe
Glu Lys Phe Gly Lys 485 490 495Gly Gly Thr Tyr Pro Arg Arg Tyr His
Val Ser Tyr His His Gln Glu 500 505 510Tyr Asn Asp Gly Arg Lys Thr
Phe Pro Arg Ala Arg Arg Thr Gln Gly 515 520 525Asn Gln Leu Thr Ser
Pro Val Ser Phe Ser Pro Thr Asp His Ser Leu 530 535 540Ser Thr Ser
Ser Gly Ser Ser Ile Phe Thr Pro Glu Tyr Asp Asp Ser545 550 555
560Arg Ile Arg Arg Arg Gly Ser Asp Ile Asp Asn Pro Thr Leu Thr Val
565 570 575Met Asp Ile Ser Pro Pro Ser Arg Ser Pro Arg Ala Pro Thr
Asn Trp 580 585 590Arg Leu Gly Lys Leu Leu Gly Gln Gly Ala Phe Gly
Arg Val Tyr Leu 595 600 605Cys Tyr Asp Val Asp Thr Gly Arg Glu Leu
Ala Val