U.S. patent application number 16/614454 was filed with the patent office on 2020-03-12 for mic-1 compounds and uses thereof.
The applicant listed for this patent is Novo Nordisk A/S. Invention is credited to Kilian Waldemar Conde Frieboes, Xiang Gao, Hongtao Guan, Kristian Tage Hansen, Lars Fogh Iversen, Sebastian Beck Joergensen, Per Noergaard, Kristian Sass-Oerum, Henning Thoegersen, Yi Wang, Birgit Wieczorek, Xujia Zhang.
Application Number | 20200079829 16/614454 |
Document ID | / |
Family ID | 62567604 |
Filed Date | 2020-03-12 |
![](/patent/app/20200079829/US20200079829A1-20200312-C00001.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00002.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00003.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00004.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00005.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00006.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00007.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00008.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00009.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00010.png)
![](/patent/app/20200079829/US20200079829A1-20200312-C00011.png)
View All Diagrams
United States Patent
Application |
20200079829 |
Kind Code |
A1 |
Gao; Xiang ; et al. |
March 12, 2020 |
MIC-1 COMPOUNDS AND USES THEREOF
Abstract
The invention relates to MIC-1 compounds. More specifically it
relates to compounds comprising a MIC-1 polypeptide with an
N-terminal amino acid extension and a protractor wherein the amino
acid extension comprises 3 to 36 amino acid residues and where the
MIC-1 polypeptide and the N-terminal amino acid extension together
have a calculated pI lower than 6.5. The compounds of the invention
have MIC-1 activity. The invention also relates to pharmaceutical
compositions comprising such compounds and pharmaceutically
acceptable excipients, as well as the medical use of the
compounds.
Inventors: |
Gao; Xiang; (Beijing,
CN) ; Zhang; Xujia; (Beijing, CN) ; Guan;
Hongtao; (Shanghai, CN) ; Thoegersen; Henning;
(Farum, DK) ; Sass-Oerum; Kristian; (Koebenhavn V,
DK) ; Iversen; Lars Fogh; (Holte, DK) ;
Noergaard; Per; (Humlebaek, DK) ; Joergensen;
Sebastian Beck; (Virum, DK) ; Hansen; Kristian
Tage; (Slangerup, DK) ; Wang; Yi; (Beijing,
CN) ; Frieboes; Kilian Waldemar Conde; (Maaloev,
DK) ; Wieczorek; Birgit; (Koebenhavn NV, DK) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Novo Nordisk A/S |
Bagsvaerd |
|
DK |
|
|
Family ID: |
62567604 |
Appl. No.: |
16/614454 |
Filed: |
May 23, 2018 |
PCT Filed: |
May 23, 2018 |
PCT NO: |
PCT/EP2018/063476 |
371 Date: |
November 18, 2019 |
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 14/50 20130101;
G01N 33/68 20130101; A61K 47/64 20170801; C07K 14/52 20130101; C07K
14/475 20130101; A61K 38/19 20130101; C07K 14/495 20130101; A61P
3/00 20180101; A61K 38/00 20130101 |
International
Class: |
C07K 14/495 20060101
C07K014/495 |
Foreign Application Data
Date |
Code |
Application Number |
May 23, 2017 |
CN |
PCT/CN2017/085576 |
Nov 28, 2017 |
CN |
PCT/CN2017/113335 |
Claims
1.-15. (canceled)
16. A MIC-1 compound, comprising a MIC-1 polypeptide; an amino acid
extension attached to the N-terminal of the MIC-1 polypeptide; and
a protractor attached to the amino acid extension; wherein the
amino acid extension comprises 3 to 36 amino acid residues; wherein
one of the amino acid residues is a Cys and the remainder of the
amino acid residues are selected from the group consisting of Ala,
Glu, Gly, Pro, Ser, and Thr; wherein the distance between the Cys
residue and the N-terminal amino acid of the MIC-1 polypeptide is
at least 3 amino acids; wherein the protractor is attached to the
amino acid extension at the Cys residue; wherein the protractor
comprises Chem. 1, Chem. 2, Chem. 3, and Chem. 4; wherein Chem. 1
is selected from the group consisting of:
HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--*, Chem. 1D: wherein x is
an integer in the range of 12-20, and wherein y is an integer in
the range of 5-15; wherein Chem. 2 is selected from the group
consisting of: *--(NH--CH(COOH)--(CH.sub.2).sub.m--CO).sub.k*,
Chem. 2A: *--(NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO).sub.k*,
and Chem. 2B: *--(NH--(CH.sub.2).sub.m-cyclohexane-CO).sub.k--*,
Chem. 2C: wherein m of Chem. 2 is an integer in the range of 1-5,
and wherein k of Chem. 2 is an integer in the range of 0-4; wherein
Chem. 3 is
*(NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2].sub.n--
-CO--*).sub.l, wherein k of Chem. 3 is an integer in the range of
1-10, wherein n is an integer in the range of 1-5, and wherein 1 is
an integer in the range of 0-5; wherein Chem. 4 is selected from
the group consisting of:
*--NH--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, and Chem. 4A:
*--NH--CH(COOH)--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem. 4B:
*--NH--(CH.sub.2).sub.m--CH(COOH)--NH--CO--CH.sub.2--*, and Chem.
4C: Chem. 4D: ##STR00086## wherein m of Chem. 4 is an integer in
the range of 1-5; wherein Chem. 1, Chem. 2, Chem. 3, and Chem. 4
are interconnected via amide bonds; wherein Chem. 4 at its
CH.sub.2--* end is connected to a sulphur atom of the Cys residue
of the amino acid extension; and wherein the MIC-1 polypeptide with
the amino acid extension has a calculated pI lower than 6.5.
17. The MIC-1 compound according to claim 16, wherein the MIC-1
polypeptide comprises an amino acid sequence that displays at least
85% sequence identity to SEQ ID NO:1.
18. The MIC-1 compound according to claim 16, wherein the MIC-1
polypeptide comprises an amino acid sequence that displays at least
90% sequence identity to SEQ ID NO:1.
19. The MIC-1 compound according to claim 16, wherein the MIC-1
polypeptide comprises an amino acid sequence that displays at least
95% sequence identity to SEQ ID NO:1.
20. The MIC-1 compound according to claim 16, wherein the MIC-1
polypeptide comprises at least one of M57L and M86L, when compared
to SEQ ID NO:1.
21. The MIC-1 compound according to claim 16, wherein the MIC-1
polypeptide comprises a deletion of the first three residues or a
deletion of N3 when compared to SEQ ID NO: 1.
22. The MIC-1 compound according to claim 16, wherein the MIC-1
polypeptide comprises (i) at least one of M57L and M86L and (ii) a
deletion of the first three residues or a deletion of N3, when
compared to SEQ ID NO: 1.
23. The MIC-1 compound according to claim 17, wherein the MIC-1
polypeptide comprises at least one of M57L and M86L, when compared
to SEQ ID NO:1.
24. The MIC-1 compound according to claim 17, wherein the MIC-1
polypeptide comprises a deletion of the first three residues or a
deletion of N3 when compared to SEQ ID NO: 1.
25. The MIC-1 compound according to claim 17, wherein the MIC-1
polypeptide comprises (i) at least one of M57L and M86L and (ii) a
deletion of the first three residues or a deletion of N3, when
compared to SEQ ID NO: 1.
26. The MIC-1 compound according to claim 18, wherein the MIC-1
polypeptide comprises at least one of M57L and M86L, when compared
to SEQ ID NO:1.
27. The MIC-1 compound according to claim 18, wherein the MIC-1
polypeptide comprises a deletion of the first three residues or a
deletion of N3 when compared to SEQ ID NO: 1.
28. The MIC-1 compound according to claim 18, wherein the MIC-1
polypeptide comprises (i) at least one of M57L and M86L and (ii) a
deletion of the first three residues or a deletion of N3, when
compared to SEQ ID NO: 1.
29. The MIC-1 compound according to claim 19, wherein the MIC-1
polypeptide comprises at least one of M57L and M86L, when compared
to SEQ ID NO:1.
30. The MIC-1 compound according to claim 19, wherein the MIC-1
polypeptide comprises a deletion of the first three residues or a
deletion of N3 when compared to SEQ ID NO: 1.
31. The MIC-1 compound according to claim 19, wherein the MIC-1
polypeptide comprises (i) at least one of M57L and M86L and (ii) a
deletion of the first three residues or a deletion of N3, when
compared to SEQ ID NO: 1.
Description
TECHNICAL FIELD OF THE INVENTION
[0001] The present invention relates to MIC-1 compounds and their
pharmaceutical use.
INCORPORATION-BY-REFERENCE OF THE SEQUENCE LISTING
[0002] The Sequence Listing, entitled "SEQUENCE LISTING", is
205.032 bytes, was created on 23 May 2018 and is incorporated
herein by reference.
BACKGROUND OF THE INVENTION
[0003] Macrophage Inhibitory Cytokine-1 (MIC-1) was first described
in 1997 (Bootcov et al, Proc. Natl. Acad. Sci. October 1997) based
on experiments showing increased expression in activated
macrophages. MIC-1 has subsequently been identified by others and
given several additional names such as placental transforming
growth factor beta (PTGF-.beta.), placental bone morphogenetic
protein, growth differentiation factor-15 (GDF15), prostate derived
factor (PDF), non-steroidal anti-inflammatory drug-activated gene
(NAG-1) and PL74. MIC-1 is a distant member of the TGF-beta super
family, a family of peptide hormones involved in cell growth and
differentiation. MIC-1 circulates as a cysteine-rich homodimer with
a molecular mass of 24.5 kDa. Human wild-type MIC-1 has a short
half-life, meaning that treatment with wt-MIC-1 requires daily
administration to maintain efficacy.
[0004] Accumulating evidence support the therapeutic utility of
MIC-1 in metabolic disorders such as obesity and diabetes. Data
from patients with advanced cancer showed that weight loss
correlated with circulating levels of MIC-1 (Johnen et al, Nat
Med., November, 2007). Transgenic mice overexpressing MIC-1 gain
less weight and body fat both on a normal low fat diet and on a
high fat diet (Macia et al, PLoS One, April, 2012). Also,
transgenic mice overexpressing MIC-1 fed both on a low and high fat
diet, respectively, had improved glucose tolerance compared with
wild type animals on a comparable diet.
[0005] WO 2005099746 concerns a method of modulating appetite
and/or body weight by administering a MIC-1 modulating agent.
SUMMARY OF INVENTION
[0006] The present invention relates to MIC-1 compounds comprising
a MIC-1 polypeptide with an N-terminal amino acid extension and a
protractor attached to the amino acid extension. In one aspect, the
MIC-1 compounds of the invention comprise a MIC-1 polypeptide with
an N-terminal amino acid extension and a protractor attached to the
amino acid extension, wherein the amino acid extension comprises 3
to 200 amino acid residues, and the MIC-1 polypeptide with the
amino acid extension has a calculated pI lower than 6.5.
[0007] In some embodiments, the MIC-1 compounds of the invention
have an N-terminal amino acid extension with one Cysteine residue,
wherein the protractor is attached to the Cysteine residue. In
these embodiments the protractor comprises, or consists of at least
one of each of Chem. 1, Chem. 2, Chem. 3 and Chem. 4; [0008]
wherein Chem. 1 is selected from the group consisting of:
[0008] HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--*, Chem. 1D: [0009]
wherein x is an integer in the range of 12-20, [0010] wherein y is
an integer in the range of 5-15; [0011] wherein Chem. 2 is selected
from the group consisting of:
[0011] *--(NH--CH(COOH)--(CH.sub.2).sub.m--CO).sub.k*, Chem.
2A:
*--(NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO).sub.k*, and Chem.
2B:
*--(NH--(CH.sub.2).sub.m-cyclohexane-CO).sub.k--*, Chem. 2C: [0012]
wherein m of Chem. 2 is an integer in the range of 1-5, and [0013]
k of Chem. 2 is an integer in the range of 0-4; [0014] wherein
Chem. 3 is
[0014]
*(NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2-
].sub.n--CO--*).sub.l, [0015] wherein k of Chem. 3 is an integer in
the range of 1-10, [0016] n is an integer in the range of 1-5, and
[0017] l is an integer in the range of 0-5; [0018] wherein Chem. 4
is selected from
[0018] *--NH--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem. 4A:
*--NH--CH(COOH)--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem.
4B:
*--NH--(CH.sub.2).sub.m--CH(COOH)--NH--CO--CH.sub.2--*, and Chem.
4C:
Chem. 4D:
##STR00001## [0019] wherein m of Chem. 4 is an integer in the range
of 1-5, and n is an integer in the range 2-6; and
[0020] wherein Chem. 1, Chem. 2, Chem. 3, and Chem. 4 are
interconnected via amide bonds, connecting the*--NH end of a Chem.
to the CO--* end of another Chem., and wherein Chem. 4 is connected
to the sulphur atom of the Cysteine residue of the amino acid
extension.
[0021] An asterisk (*) in a chemical formula designates a point of
attachment.
[0022] In some embodiments, the MIC-1 compounds of the invention
comprise an N-terminal extension that has surplus of acidic amino
acid residues (Aspartic acid and/or Glutamic acid) of at least 3,
4, 5 or 6 compared to the number of basic amino acid residues
(Lysine, Arginine and/or Histidine).
[0023] In some embodiments of the invention the MIC-1 compounds
comprise N-terminal extensions composed of amino acid residues
selected among the group consisting of A, C, E, G, P, S, T, Q, N
and D, wherein the amino acid extension comprises at least three E
and/or D amino acid residues.
[0024] In some embodiments the MIC-1 compounds of the invention
comprise an MIC-1 polypeptide that display at least 85%, 90%, 95%
or 98% sequence identity to MIC-1 of SEQ ID NO:1.
[0025] In some embodiments the MIC-1 compounds of the invention
comprise an MIC-1 polypeptide that comprises a deletion of the
first three residues (MIC-1-.DELTA.1-3) or a deletion of Asparagine
3 (des-N3) compared to MIC-1 of SEQ ID NO:1.
[0026] In a particular embodiment of the invention the MIC-1
compound comprises a MIC-1 polypeptide and an N-terminal amino acid
extension with an amino acid sequence according to SEQ ID NO: 87,
90, 92, 93, 94, 97, 98, 99, 100, 101, 102, 108, 109, 111, 112, 113,
114, 115, 116, 117, 164, 288, 289, 290, 291 or 292.
[0027] In one aspect, the MIC-1 compounds of the invention have
retained MIC-1 receptor potency and in vivo efficacy on lowering
food intake and body weight. These MIC-1 compounds can therefore be
used for treatment of metabolic disorders such as obesity,
diabetes, cardiovascular diseases like dyslipidaemia and
arteriosclerosis and other disorders such as steatohepatitis and
diabetic nephropathy.
[0028] In one aspect, the invention provides a pharmaceutical
composition comprising the MIC-1 compound of the invention or a
pharmaceutically acceptable salt, amide or ester thereof, and one
or more pharmaceutically acceptable excipients.
[0029] In one aspect, the invention provides a MIC-1 compound for
use in the prevention and/or treatment of a metabolic disorder,
wherein the metabolic disorder is obesity, type 2 diabetes,
dyslipidemia, or diabetic nephropathy.
[0030] In one aspect, the invention provides a MIC-1 compound for
use in the prevention and/or treatment of dyslipidaemia,
arteriosclerosis, non-alcoholic steatohepatitis, or diabetic
nephropathy.
[0031] In one aspect, the MIC-1 compounds of the invention have a
protracted plasma exposure, i.e. a prolonged half-life compared to
human wild type MIC-1.
[0032] In one aspect the MIC-1 compounds of the invention have
improved solubility. In one aspect, the MIC-1 compounds of the
invention have improved chemical stability.
BRIEF DESCRIPTION OF DRAWINGS
[0033] FIG. 1: The expression of MIC-1 polypeptides with
N-extensions with single 12-mer building blocks. All cells were
grown in TB at 37.degree. C. and proteins were induced to express
by adding 0.5 mM IPTG after OD600 reached 1.0. Cells were harvested
after overnight and the expression level was checked by loading the
total lysate on SDS-PAGE. Wild type human MIC-1 (MIC-1) was loaded
as the positive control.
[0034] FIG. 2: The expression of MIC-1 polypeptides with
N-extensions with double 12-mer building blocks. All cells were
grown in TB at 37.degree. C. and proteins were induced to express
by adding 0.5 mM IPTG after OD600 reached 1.0. Cells were harvested
after overnight and the expression level was checked by loading the
total lysate on SDS-PAGE. MIC-1 was loaded as the positive
control.
[0035] FIG. 3: a) Comparison of expression levels among MIC-1
polypeptides with N-extensions initiating with 12mer-(4+2+_),
-(4+4+_) and -(4+3+_). It should be noticed that the group bearing
12mer-(4+3_) and the construct indicated by the dot contain M57L in
the MIC-1 polypeptide sequence. b) the effects of the extended
12mers on the expression level. In addition, the lowest data point
in the group of 3.6 is the MIC-1 polypeptide containing M57L. In
this figure, "1.6 latter" represents TSTEEG, "2.6" represents
TSESAT, "3.6" represents TSTEPS and "4.6" represents SEPATS.
[0036] FIG. 4: SDS-PAGE of representatives bearing 12mer-(4+2+_),
12mer-(4+3+_)+M57L, 12mer-(three repeats) and 12mer-(four repeats).
T: total protein, S: soluble fraction, P: cell pellet (inclusion
body).
[0037] FIG. 5: MIC-1 polypeptides with in-sequence mutations. In
this figure, the MIC-1 polypeptide sequence is MIC-1 .DELTA.1-3. T:
total protein, S: soluble fraction, P: cell pellet (inclusion
body).
[0038] FIG. 6: Body weight change over time during Pharmacodynamic
(PD) study in pigs. 01: Compound 01; 05: Compound 05
DETAILED DESCRIPTION
[0039] The invention relates to MIC-1 compounds comprising a MIC-1
polypeptide with an N-terminal amino acid extension and a
protractor attached to the amino acid extension.
[0040] In one aspect, the MIC-1 compounds of the invention comprise
a MIC-1 polypeptide an N-terminal amino acid extension and a
protractor attached to the amino acid extension, wherein the amino
acid extension comprises 3 to 200 amino acid residues, and the
MIC-1 polypeptide and the amino acid extension together have a
calculated pI lower than 6.5.
[0041] The MIC-1 compounds of the invention are biologically
active. For example, they are potent, retain full efficacy compared
to MIC-1 and also, they have a protracted plasma exposure profile,
i.e. have a pronged half-life. The particular combination of
potency and long half-life is desirable.
MIC-1
[0042] The term "MIC-1" as used herein means Macrophage Inhibitory
Cytokine-1 (MIC-1), also known as Growth Differentiation Factor 15
(GDF-15), placental bone morphogenetic protein (PLAB) and
nonsteroidal anti-inflammatory drug-activated gene (NAG-1). MIC-1
is synthesized as a 62 kDa intracellular homodimer precursor
protein which subsequently is cleaved by a furin-like protease into
a 24.5 kDa homodimer. The sequence of the full length wild type
human MIC-1 is available from the UNIPROT database with accession
no. Q99988. The 308 amino acid precursor sequence includes a signal
peptide (amino acids 1-29), a propeptide (amino acids 30-196) and a
MIC-1 monomer sequence (amino acids 197-308). The 112 amino acid
MIC-1 monomer sequence is included herein as SEQ ID NO:1. MIC-1
monomer contains nine cysteine residues which give rise to the
formation of 4 intrachain disulphide bonds and one interchain
disulphide bond to create a covalently linked 24.5 kDa homodimer. A
naturally occurring mutation corresponding to H6D in the MIC-1
monomer sequence (SEQ ID NO:1) has been described.
[0043] The term "MIC-1 compound", as used herein, refers to a
compound comprising a MIC-1 polypeptide, an N-terminal amino acid
extension, and a protractor. The MIC-1 compound is typically in the
form of a homodimer.
[0044] The terms "MIC-1 polypeptide" as used herein refer to the
human MIC-1 monomer sequence of SEQ ID NO:1 or an analogue thereof.
Numerical references to particular MIC-1 residues, if not stated
otherwise, refer to the 112 amino acid monomer sequence (i.e.,
residue 1 is Alanine (A1), and residue 112 is Isoleucine
(1112).
[0045] The term "MIC-1 analogue", or "analogue of MIC-1" as used
herein refers to a MIC-1 polypeptide, which is an amino acid
variant of the monomer MIC-1 sequence of SEQ ID NO:1. In other
words, a MIC-1 analogue is a MIC-1 polypeptide in which a number of
amino acid residues have been changed when compared to human MIC-1
(SEQ ID NO: 1). These changes may represent, independently, one or
more amino acid substitutions, additions, and/or deletions.
[0046] MIC-1 analogues may be described by reference to the amino
acid residue which is changed, the number of the amino acid residue
(i.e. the corresponding position in the MIC-1 monomer sequence (SEQ
ID NO:1)), and the change (e.g. the amino acid residue change
to).
[0047] In one aspect, the MIC-1 analogue is a functional variant of
the MIC-1 of SEQ ID NO:1. In one aspect of the invention, the MIC-1
analogues display at least 85%, 90% or 95% sequence identity to
MIC-1 of SEQ ID NO:1. As an example of a method for determination
of the sequence identity between two analogues the two peptides H6D
MIC-1 and MIC-1 of SEQ ID NO:1 are aligned. The sequence identity
of the H6D MIC-1 analogue relative to MIC-1 of SEQ ID NO:1 is given
by the number of aligned identical residues divided by the total
number of aligned residues in MIC-1 of SEQ ID NO: 1. Accordingly,
in the example the sequence identity in percentage is
(112-1)/112.times.100. In the determination of the sequence
identity of a MIC-1 analogue, the N-terminal amino acid extension
is not included. A suitable alignment program can be tested with a
suitable alignment program "needle", which is a Needleman-Wunsch
alignment. The algorithm for this alignment program is described in
Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular
Biology, 48: 443-453.
[0048] In another aspect of the invention, the MIC-1 analogues
comprise less than 15, 10 or 5, amino acid modifications
(substitutions, deletions, additions (including insertions) and any
combination thereof) relative to human MIC-1 of SEQ ID NO:1. The
term "amino acid modification" used throughout this application is
used in the meaning of a modification to an amino acid as compared
to monomer MIC-1 (SEQ ID NO:1). This modification can be the result
of a deletion of an amino acid, addition of an amino acid,
substitution of one amino acid with another or a substituent
covalently attached to an amino acid of the peptide.
[0049] Substitutions:
[0050] In one aspect amino acids may be substituted by conservative
substitution. The term "conservative substitution" as used herein
denotes that one or more amino acids are replaced by another,
biologically similar residue. Examples include substitution of
amino acid residues with similar characteristics, e.g. small amino
acids, acidic amino acids, polar amino acids, basic amino acids,
hydrophobic amino acids and aromatic amino acids.
[0051] In one aspect amino acids may be substituted by
non-conservative substitution. The term "non-conservative
substitution" as used herein denotes that one or more amino acids
are replaced by another amino acid having different
characteristics. Examples include substitution of a basic amino
acid residue with an acidic amino acid residue, substitution of a
polar amino acid residue with an aromatic amino acid residue, etc.
In one aspect, the non-conservative substitution is substitution of
a coded amino acid to another coded amino acid having different
characteristics. In one aspect, the MIC-1 analogues may comprise
substitutions of one or more unnatural and/or non-amino acids,
e.g., amino acid mimetics, into the sequence of MIC-1.
[0052] In one aspect of the invention, the asparagine in the
position corresponding to position 3 of monomer MIC-1 sequence (SEQ
ID NO:1) is substituted to Serine (N3S), Glutamic acid (N3E),
Alanine (N3A), or Glutamine (N3Q). In one aspect of the invention,
the asparagine in the position corresponding to position 3 of human
MIC-1 monomer sequence (SEQ ID NO:1) is substituted to Glutamic
acid (N3E).
[0053] In one aspect of the invention, the arginine in the position
corresponding to position 2 of human MIC-1 monomer sequence (SEQ ID
NO:1) has been substituted to alanine (R2A), and the asparagine in
the position corresponding to position 3 of human MIC-1 monomer
sequence (SEQ ID NO: 1) has been substituted to Glutamic acid
(N3E).
[0054] In one aspect of the invention, the arginine in the position
corresponding to position 2 of human MIC-1 monomer sequence (SEQ ID
NO:1) has been substituted to Glutamic acid (R2E), and the
asparagine in the position corresponding to position 3 of human
MIC-1 monomer sequence (SEQ ID NO: 1) has been substituted to
Serine (N3S).
[0055] Deletions and Truncations:
[0056] In one aspect, the MIC-1 analogues of the invention may have
one or more amino acid residues deleted from the amino acid
sequence of MIC-1 (SEQ ID NO:1), alone or in combination with one
or more insertions or substitutions.
[0057] MIC-1 analogues with amino acid deletions may be described
by "des", reference to the amino acid residue which is deleted, and
followed by the number of the deleted amino acid (i.e. the
corresponding position in the monomer MIC-1 (SEQ ID NO:1)). In some
embodiments of the invention, the asparagine in the position
corresponding to position 3 of human monomer MIC-1 (SEQ ID NO:1) is
deleted (MIC-1 des-N3, SEQ ID NO:2). In some embodiments of the
invention, the alanine in the position corresponding to position 1
of human monomer MIC-1 (SEQ ID NO:1) is deleted (MIC-1,
des-A1).
[0058] MIC-1 analogues with a truncation of one or more amino acid
residues at the N or C terminal may be described by "MIC-1-A" and
reference to the number(s) of the deleted amino acid residues (i.e.
the corresponding position in the monomer MIC-1 (SEQ ID NO:1)). In
some embodiments of the invention, the first three residues (A1,
R2, N3) at the N terminal are deleted (MIC-1-.DELTA.1-3, SEQ ID
NO:3).
[0059] Insertions:
[0060] In one aspect, the MIC-1 analogues of the invention have one
or more amino acid residues inserted into the amino acid sequence
of human MIC-1, alone or in combination with one or more deletions
and/or substitutions.
[0061] In one aspect, the MIC-1 analogues of the invention include
insertions of one or more unnatural amino acids and/or non-amino
acids into the sequence of MIC-1.
[0062] The term "protein" or "polypeptide", as e.g. used herein,
refers to a compound which comprises a series of amino acids
interconnected by amide (or peptide) bonds.
[0063] Amino acids are molecules containing an amine group and a
carboxylic acid group, and, optionally, one or more additional
groups, often referred to as a side chain.
[0064] The term "amino acid" includes coded (or proteinogenic or
natural) amino acids (amongst those the 20 standard amino acids),
as well as non-coded (or non-proteinogenic or non-natural) amino
acids. Coded amino acids are those which are naturally incorporated
into proteins. The standard amino acids are those encoded by the
genetic code. Non-coded amino acids are either not found in
proteins, or not produced by standard cellular machinery (e.g.,
they may have been subject to post-translational modification). In
what follows, all amino acids of the MIC-1 proteins for which the
optical isomer is not stated is to be understood to mean the
L-isomer (unless otherwise specified).
[0065] As is apparent from the above, amino acid residues may be
identified by their full name, their one-letter code, and/or their
three-letter code. These three ways are fully equivalent. For the
reader's convenience, the single and three letter amino acid codes
are provided below:
[0066] Glycine: G and Gly; Proline: P and Pro; Alanine: A and Ala;
Valine: V and Val; Leucine: L and Leu; Isoleucine: I and Ile;
Methionine: M and Met; Cysteine: C and Cys; Phenylalanine: F and
Phe; Tyrosine: Y and Tyr; Tryptophan: W and Trp; Histidine: H and
His; Lysine: K and Lys; Arginine: R and Arg; Glutamine: Q and Gin;
Asparagine: N and Asn; Glutamic Acid: E and Glu; Aspartic Acid: D
and Asp; Serine: S and Ser; and Threonine: T and Thr.
N-Terminal Amino Acid Extension
[0067] The MIC-1 compounds of the invention comprise an N-terminal
amino acid extension.
[0068] The term "N-terminal amino acid extension" as used herein,
means that the N-terminal of the MIC-1 polypeptide is attached to
the C-terminal of the N-terminal amino acid extension via a peptide
bond. The terms "N-terminal amino acid extension", "N-terminal
extension", and "N-extension" herein means the same thing and are
used interchangeably. In one embodiment, the compound of the
invention comprises human MIC-1 monomer sequence (SEQ ID NO:1) with
an amino acid extension attached at the N-terminal, i.e. the
Alanine at position 1 (A1) via a peptide bond.
[0069] In some embodiments of the invention, the N-terminal amino
acid extension is up to 200 amino acid residues long. In a
particular embodiment of the invention the N-terminal amino acid
extension has from 3 to 36 amino acid residues.
[0070] In one aspect of the invention, the N-terminal amino acid
extension has a surplus of acidic amino acid residues (Aspartic
acid and/or Glutamic acid) of at least 3, 4, 5 or 6 compared to the
number of basic amino acid residues (Lysine, Arginine and/or
Histidine). A "surplus" of acidic amino acid residues means that
the number of acidic residues exceeds the number of basic residues.
A defined value of the surplus of acidic amino acid residues is
calculated as the number of acidic residues minus the number of
basic residues.
[0071] Methionine is the initial amino acid for protein expression
in prokaryotic cells (e.g. bacteria, for instance, E. coli). In
some embodiments of the invention, the initial Methionine is
removed from the protein during the protein expression. Therefore,
the initial Methionine is not included in the sequence of the
N-extension of MIC-1 compound. However, a person skilled in the art
knows that the start codon, coding the initial Methionine, is
required for the protein translation initiation and should be
incorporated right in front of the nucleotide sequence for protein
expression without exception.
[0072] Meanwhile, it can be understood that those MIC-1 compounds
with N-extensions having the initial Methionine also fall into the
scope of the invention.
Protractor
[0073] The MIC-1 compounds of the invention comprise a protractor.
The protractor is covalently attached to a specific amino acid
residue of the MIC-1 polypeptide or N-terminal amino acid
extension.
[0074] The term "protractor" relates to the properties of conveying
extended plasma exposure ("half-life extending moiety") and is
herein understood to refer to a chemical group attached to an amino
acid site chain functionalities such as --SH, --OH, --COOH,
--CONH2, --NH2 that can increase in vivo circulatory half-life of
MIC-1 when conjugated to the MIC-1. Examples of protractors include
but are not limited to: fatty acids and derivatives thereof,
Hydroxy Alkyl Starch (HAS) e.g. Hydroxy Ethyl Starch (HES), Poly
Ethylen Glycol (PEG), Poly (Glyx-Sery)n (HAP), Hyaluronic acid
(HA), Heparosan polymers (HEP), Phosphorylcholine-based polymers
(PC polymer), Fleximers, Dextran, Poly-sialic acids (PSA), an Fc
domain, Transferrin, Albumin, Elastin like peptides, unstructured
and repeated amino sequences (e.g. XTEN polymers), Albumin binding
peptides, a CTP peptide, and any combination thereof.
[0075] In some embodiments of the invention, the protractor is
capable of forming non-covalent associations with albumin, thereby
increasing the blood/plasma exposure time of the MIC-1 compound,
and also having the effect of protracting the time of action of the
MIC-1 compound, due to the fact that the association of the MIC-1
compound and albumin is only slowly disintegrated to release the
active pharmaceutical ingredient.
[0076] In some embodiments, the fatty acid comprising protractors
of the invention are capable of forming non-covalent associations
with albumin and thereby prolonging plasma half-life of the MIC-1
compound compared to human wide type MIC-1.
[0077] In some embodiments of the invention, the protractor is
covalently attached to a cysteine residue of the N-terminal amino
acid extension of the MIC-1 polypeptide. In an embodiment, the
protractor comprises a haloacetamide group, which reacts with the
thiol group of a cysteine residue, under formation of a covalent
sulfur-carbon bond (this process being referred to as
Cys-alkylation) which is also referred to as a thio-ether bond. In
another embodiment, the protractor comprises a maleimide group,
which reacts with the thiol group of a cysteine residue, under
formation of a covalent sulfur-carbon bond.
[0078] In some embodiments of the invention, the protractor is
covalently attached the N-terminal amino acid of the N-terminal
amino acid extension.
Fatty Acid Comprising Protractor
[0079] In an aspect of the invention, the protractor comprises, or
consists of, at least one of each of Chem. 1, Chem. 2, Chem. 3, and
Chem. 4: [0080] wherein Chem. 1 is selected from the group
consisting of:
[0080] HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--*, Chem. 1D: [0081]
wherein x is an integer in the range of 12-20, [0082] wherein y is
an integer in the range of 5-15; [0083] wherein Chem. 2 is selected
from the group consisting of:
[0083] *--NH--CH(COOH)--(CH.sub.2).sub.m--CO--*, Chem. 2A:
*--NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO--*, and Chem. 2B:
*--NH--(CH.sub.2).sub.m-cyclohexane-CO--*, Chem. 2C: [0084] wherein
m of Chem. 2 is an integer in the range of 1-5; [0085] wherein
Chem. 3 is
[0085] *
NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2-
].sub.n--CO--*, [0086] wherein k of Chem. 3 is an integer in the
range of 1-10, [0087] n is an integer in the range of 1-5; and
[0088] wherein Chem. 4 is selected from
[0088] *--NH--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem. 4A:
*--NH--CH(COOH)--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem.
4B:
*--NH--(CH.sub.2).sub.m--CH(COOH)--NH--CO--CH.sub.2--*, and Chem.
4C:
Chem. 4D:
##STR00002## [0089] wherein m of Chem. 4 is an integer in the range
of 1-5 and n is an integer in the range of 2-6 or [0090] wherein
Chem. 4 is selected from the group consisting of Formula I, II or
III:
##STR00003##
[0091] wherein Chem. 1, Chem. 2, Chem. 3, and Chem. 4 are
interconnected via amide bonds, connecting the*--NH end of a Chem.
to the CO--* end of another Chem.
[0092] In some embodiments, the protractor of the invention
comprises one Chem. 1, one Chem. 4, and one or more of Chem. 2 and
Chem. 3. As a non-limiting example, the protractor consists of one
Chem. 1 element, two Chem. 2 elements, two Chem. 3 elements, and
one Chem. 4 element.
[0093] The elements Chem. 2 and Chem. 3 both hold a --NH-- and CO--
end allowing them to be linked by amide bonds to each other and to
either --CO-- or --NH-- of Chem. 1 or Chem. 4. Chem. 4 has a --NH--
end (capable of forming an amide bond with Chem. 2 or Chem. 3).
Chem. 4 further has either a --NH--CO--CH.sub.2-- end, which in the
unreacted form is a haloacetamide capable of reacting with the
thiol group of a cysteine residue, or a
(--N*--CO--CH.sub.2--CH**--CO)-- end, the parenthesis representing
a cyclic structure, which in the unreacted form is a maleimide
capable of reacting with the thiol group of the cysteine; or an
aldehyde capable of reacting with the N-terminal amino group in a
reductive alkylation reaction.
[0094] The length of the carbon chain of Chem. 1 defined by x or y
may vary from 12-20 for x and 5-15 for y. Shorter or longer
versions may be favoured for different types of protractors. In a
particular embodiment of Chem. 1A, *--(CH.sub.2).sub.x--* refers to
straight alkylene in which x is an integer in the range of 12-20,
such as 14-18 or such as 16.
[0095] This Chem. 1 may be briefly referred to as C18 diacid, i.e.
a fatty di-carboxylic acid with 18 carbon atoms. When x=16 the
structure of this linker element corresponds to Chem. 1a:
HOOC--(CH.sub.2).sub.16--CO--*.
[0096] In further embodiments Chem. 1 is selected from the group
consisting of:
HOOC--(CH.sub.2).sub.16--CO--*, Chem. 1a:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.15--CO--* Chem. 1b:
HOOC-benzene-O--(CH.sub.2).sub.9--CO--*, and Chem. 1c:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.15--CO--*, Chem. 1d:
[0097] In further embodiments Chem. 2 is selected from the group
consisting of:
*--NH--CH(COOH)--(CH.sub.2).sub.2--CO--*, Chem. 2a:
*--NH--S(.dbd.O).sub.2--(CH.sub.2).sub.3--CO--* and Chem. 2b:
*--NH--CH.sub.2-cyclohexane-CO--*. Chem. 2c:
[0098] In an aspect of the invention, protractor is attached to a
Cysteine residue; and the protractor comprises, or consists of, at
least one of each of Chem. 1, Chem. 2, Chem. 3 and Chem. 4; [0099]
wherein Chem. 1 is selected from the group consisting of:
[0099] HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--*, Chem. 1D: [0100]
wherein x is an integer in the range of 12-20, [0101] wherein y is
an integer in the range of 5-15; [0102] wherein Chem. 2 is selected
from the group consisting of:
[0102] *--(NH--CH(COOH)--(CH.sub.2).sub.m--CO).sub.k*, Chem.
2A:
*--(NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO).sub.k*, and Chem.
2B:
*--(NH--(CH.sub.2).sub.m-cyclohexane-CO).sub.k--*, Chem. 2C: [0103]
wherein m of Chem. 2 is an integer in the range of 1-5, and [0104]
k is an integer in the range of 0-4; [0105] wherein Chem. 3 is
[0105]
*(NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2-
].sub.n--CO--*).sub.l, [0106] wherein k of Chem. 3 is an integer in
the range of 1-10, [0107] n is an integer in the range of 1-5, and
[0108] l is an integer in the range of 0-5; [0109] wherein Chem. 4
is selected from
[0109] *--NH--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, and Chem.
4A:
*--NH--CH(COOH)--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem. 4B:
[0110] wherein m of Chem. 4 is an integer in the range of 1-5; and
[0111] wherein Chem. 1, Chem. 2, Chem. 3, and Chem. 4 are
interconnected via amide bonds, connecting the*--NH end of a Chem.
to the CO--* end of another Chem., and wherein the CH.sub.2--* end
of Chem. 4 is connected to the sulphur atom of the Cysteine residue
of the amino acid extension.
[0112] In an aspect of the invention, the protractor is attached to
an N-terminal amino acid, and comprises, or consists of, at least
one of each of Chem. 1, Chem. 2, Chem. 3 and Chem. 4; [0113]
wherein Chem. 1 is selected from the group consisting of:
[0113] HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--* Chem. 1D: [0114] wherein
x is an integer in the range of 12-20, [0115] wherein y is an
integer in the range of 5-15; [0116] wherein Chem. 2 is selected
from the group consisting of:
[0116] *--(NH--CH(COOH)--(CH.sub.2).sub.m--CO).sub.k*, Chem.
2A:
*--(NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO).sub.k*, and Chem.
2B:
*--(NH--(CH.sub.2).sub.m-cyclohexane-CO).sub.k--*, Chem. 2C: [0117]
wherein m of Chem. 2 is an integer in the range of 1-5, and [0118]
k is an integer in the range of 0-4; [0119] wherein Chem. 3 is
[0119]
*(NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2-
].sub.n--CO--*).sub.l, [0120] wherein k of Chem. 3 is an integer in
the range of 1-10, [0121] n is an integer in the range of 1-5, and
[0122] l is an integer in the range of 0-5; [0123] wherein Chem. 4
is selected from the group consisting of Formula I, II or III:
##STR00004##
[0124] wherein Chem. 1, Chem. 2, Chem. 3, and Chem. 4 are
interconnected via amide bonds, connecting the*--NH end of a Chem.
to the CO--* end of another Chem., and wherein the CH.sub.2--* end
of Chem. 4 is connected to the alpha-amino group of the N-terminal
of the amino acid extension.
[0125] The nomenclature is as is usual in the art, for example in
the above formulas *--CO--* refers to carbonyl (*--C(.dbd.O)--*).
Benzene refers to the ring structure which in Chem. 1C is
substituted at C1 and C3 or C4 by --O--(CH.sub.2).sub.x--* and
--COOH, respectively. HO--S(.dbd.O).sub.2--* describes a sulfonic
acid group.
[0126] The compounds/protractors of the invention may exist in
different stereoisomeric forms having the same molecular formula
and sequence of bonded atoms, but differing only in the
three-dimensional orientation of their atoms in space. The
stereoisomerism of the exemplified compounds/protractors of the
invention is indicated in the experimental section, in the names as
well as the structures, using standard nomenclature. Unless
otherwise stated the invention relates to all stereoisomeric forms
of the claimed compounds/protractors.
Isoelectric Point (pI)
[0127] The calculated pI of the MIC-1 polypeptide with an
N-terminal amino acid extension is defined as the pH at which the
net calculated charge of the MIC-1 polypeptide with the N-extension
is zero. The calculated charge of the MIC-1 polypeptide with the
N-extension as a function of pH is obtained using the pKa values of
the amino acid residues described in Table 1 and the method
described by B. Skoog and A. Wichman (Trends in Analytical
Chemistry, 1986, vol. 5, pp. 82-83). The side chain pKa of cysteine
(Cys) is only included in the charge calculation for cysteines with
a free sulfhydryl group. As an example the calculated pI value of
human wild type MIC-1 as the homodimer is 8.8.
[0128] As described herein, pI calculations on MIC-1 polypeptides
with N-extensions are made on homodimers.
TABLE-US-00001 TABLE 1 pKa of amino acid residues used for
calculating pI. The pKa values are those described in "Correlation
of Electrophoretic Mobilities from Capillary Electrophoresis with
Physicochemical Properties of Proteins and Peptides by Rickard E C,
Strohl M M, Nielsen R G. Analytical Biochemistry 1991, vol 197, pp
197-207". N-terminus C-Terminus Side chain Asp 8.6 2.75 3.5 Asn 7.3
2.75 -- Thr 8.2 3.2 -- Ser 7.3 3.2 -- Glu 8.2 3.2 4.5 Gln 7.7 3.2
-- Pro 9 3.2 -- Gly 8.2 3.2 -- Ala 8.2 3.2 -- Val 8.2 3.2 -- Cys
7.3 2.75 10.3 Met 9.2 3.2 -- Ile 8.2 3.2 -- Leu 8.2 3.2 -- Tyr 7.7
3.2 10.3 Phe 7.7 3.2 -- Lys 7.7 3.2 10.3 His 8.2 3.2 6.2 Trp 8.2
3.2 -- Arg 8.2 3.2 12.5
Functional Properties
[0129] In one aspect, the MIC-1 compounds of the invention have
good biophysical properties.
[0130] The MIC-1 compounds of the invention are biologically
active. For example they are potent, binds to and activate the
MIC-1 receptor complex. Also MIC-1 compounds exhibit protracted
plasma exposure defined as longer half-life. For example MIC-1
compounds have a markedly longer plasma half-life when administered
i.v. to rat and/or mini pigs compared to MIC-1 (SEQ ID 1). The
particular combination of retained receptor potency and long plasma
half-life may be highly desirable.
In Vitro Activity
[0131] In one aspect, the compounds of the invention have retained
MIC-1 receptor potency relative to human MIC-1 (SEQ ID NO:1).
Receptor potency and efficacy can be measured in mammalian cells
transfected with human MIC-1 receptor (hGFRAL, GDNF family receptor
alpha like) and its signalling co-receptor hRET (proto-oncogene
tyrosine-protein kinase receptor Ret). MIC-1 compounds activation
of the receptor complex is measured by phosphorylation of
extracellular signal-regulated kinases (ERKs) as described in
Example 6.
[0132] As described herein receptor potency and efficacy is
measured on MIC-1 compounds as homodimers.
In Vivo Biological Activity
[0133] In one aspect the compounds of the invention are potent in
vivo, which may be determined as is known in the art in any
suitable animal model.
[0134] The non-obese Sprague Dawley rat is one example of a
suitable animal model, and the changes in food intake may be
determined in such rats in vivo, e.g. as described in Example 14.
In one aspect the compounds of the invention inhibits in vivo food
intake in non-obese Sprague Dawley rats.
In Vivo Plasma Half-Life
[0135] In one aspect the MIC-1 compounds of the invention are
protracted and have an extended in vivo plasma half-life, which can
be determined in a suitable pharmacokinetic in vivo study.
[0136] Extended plasma exposure may be determined as plasma
half-life (T1/2) after i.v. administration to animals such as rats
or mini pigs.
[0137] In some embodiments, the MIC-1 compounds of the invention
have a plasma half-life after i.v. administration to rat of at
least 10 hour, more preferably between 25-50 hours, or most
preferably at least 50 hours, determined as described in Example
16.
[0138] In some embodiments, the MIC-1 compounds of the invention
have a plasma half-life after i.v. administration to mini pigs of
at least 50 hours, more preferably between 50-200 hours, even more
preferably at least 200 hours or most preferably at least 300
hours, determined as described in Example 17.
[0139] According to a third aspect, the compounds of the invention
are protracted and at the same time retain in vivo potency. The
particular combination of retained potency and long plasma
half-life may be highly desirable.
Solubility
[0140] The human wild type MIC-1 is a hydrophobic protein, with a
calculated pI 8.8 based on the homodimer. Consequently, wild type
MIC-1 can only be solubilized to around 0.5 mg/ml in neutral pH
aqueous buffer systems. The low solubility of MIC-1 significantly
hampers its pharmaceutical formulation properties and therapeutic
use, so developing a MIC-1 compound with improved solubility would
greatly improve the therapeutic utility.
[0141] In one aspect, the MIC-1 polypeptides with an N-extension of
the invention have improved solubility (i.e. are more soluble)
relative to human MIC-1 of SEQ ID NO:1.
[0142] As described herein, solubility is measured as described in
Example 4.
[0143] In certain embodiments, the MIC-1 polypeptides with an
N-extension of the invention have a solubility of at least 1 mg/ml
in Tris buffer at pH 8.0. In other embodiments, the MIC-1
polypeptides with an N-extension of the invention have a solubility
of at least 5 mg/ml, at least 10 mg/ml, at least 30 mg/ml, or at
least 40 mg/ml in Tris buffer at pH 8.0.
[0144] Adding a protractor to make a MIC-1 compound do not markedly
alter the improved solubility of measured for the corresponding
MIC-1 polypeptides with an N-extension (Example 12).
[0145] As described herein, solubility is measured on MIC-1
compounds and MIC-1 polypeptides with an N-extension as
homodimers.
Stability
[0146] The human wild type MIC-1 sequence is chemically unstable
and several residues of the amino acid sequence could be modified
during storage, including deamidation on Asparagine at position 3
(N3) and oxidation of methionines M43, M57 and M86. Chemical
instability of certain residues could impact pharmaceutical
properties so developing chemical stable MIC-1 compounds would be
another important part of making a MIC-1 therapeutic compound.
[0147] In one aspect, the compounds of the invention have improved
chemical stability relative to human MIC-1 of SEQ ID NO:1.
[0148] The term "chemical stability" refers to chemical changes in
the polypeptide structure leading to formation of chemical
degradation products potentially having a reduced biological
activity, decreased solubility, and/or increased immunogenic effect
as compared to the intact polypeptide. The chemical stability can
be evaluated by measuring the amount of chemical degradation
products at various time-points after exposure to different
environmental conditions, e.g. by SEC-HPLC, and/or RP-HPLC.
[0149] In some embodiments of the invention, certain residues of
the MIC-1 monomer sequence (SEQ ID NO:1) is modified, e.g. by
substitution to increase the chemical stability of the MIC-1
compounds. To avoid deamidation, N3 is deleted or substituted with
other amino acids, e.g. E or Q. To decrease oxidation, Methionine
is substituted with other amino acids, e.g. E or L.
Immunogenicity
[0150] In one aspect, the MIC-1 compounds of the invention have low
immunogenicity risk.
Production Processes
[0151] MIC-1 polypeptides with an N-terminal amino acid extension
of the present invention may be produced by means of recombinant
protein technology known to persons skilled in the art. In general,
nucleic acid sequences encoding the proteins of interest or
functional variants thereof are modified to encode the desired
MIC-1 polypeptide with an N-extension. This modified sequence is
then inserted into an expression vector, which is in turn
transformed or transfected into the expression host cells.
[0152] The nucleic acid construct encoding the MIC-1 polypeptide
with an N-extension may suitably be of genomic, cDNA or synthetic
origin. Amino acid sequence alterations are accomplished by
modification of the genetic code by well-known techniques.
[0153] The DNA sequence encoding the MIC-1 polypeptide with an
N-extension is usually inserted into a recombinant vector which may
be any vector, which may conveniently be subjected to recombinant
DNA procedures, and the choice of vector will often depend on the
host cell into which it is to be introduced. Thus, the vector may
be an autonomously replicating vector, i.e. a vector, which exists
as an extrachromosomal entity, the replication of which is
independent of chromosomal replication, e.g. a plasmid.
Alternatively, the vector may be one which, when introduced into a
host cell, is integrated into the host cell genome and replicated
together with the chromosome(s) into which it has been
integrated.
[0154] The vector is preferably an expression vector in which the
DNA sequence encoding the MIC-1 polypeptide with an N-extension is
operably linked to additional segments required for transcription
of the DNA. The term, "operably linked" indicates that the segments
are arranged so that they function in concert for their intended
purposes, e.g. transcription initiates in a promoter and proceeds
through the DNA sequence coding for the polypeptide until it
terminates within a terminator.
[0155] Thus, expression vectors for use in expressing the MIC-1
polypeptide with an N-extension will comprise a promoter capable of
initiating and directing the transcription of a cloned gene or
cDNA. The promoter may be any DNA sequence, which shows
transcriptional activity in the host cell of choice and may be
derived from genes encoding proteins either homologous or
heterologous to the host cell.
[0156] Additionally, expression vectors for expression of the MIC-1
polypeptide with an N-extension will also comprise a terminator
sequence, a sequence recognized by a host cell to terminate
transcription. The terminator sequence is operably linked to the 3'
terminus of the nucleic acid sequence encoding the polypeptide. Any
terminator which is functional in the host cell of choice may be
used in the present invention.
[0157] Expression of the MIC-1 polypeptide with an N-extension can
be aimed for either intracellular expression in the cytosol of the
host cell or be directed into the secretory pathway for
extracellular expression into the growth medium.
[0158] Intracellular expression is the default pathway and requires
an expression vector with a DNA sequence comprising a promoter
followed by the DNA sequence encoding the MIC-1 polypeptide with an
N-extension followed by a terminator.
[0159] To direct the sequence of the MIC-1 polypeptide with an
N-extension into the secretory pathway of the host cells, a
secretory signal sequence (also known as signal peptide or a pre
sequence) is needed as an extension of the MIC-1 sequence. A DNA
sequence encoding the signal peptide is joined to the 5' end of the
DNA sequence encoding the MIC-1 polypeptide with an N-extension in
the correct reading frame. The signal peptide may be that normally
associated with the protein or may be from a gene encoding another
secreted protein.
[0160] The procedures used to ligate the DNA sequences coding for
the MIC-1 polypeptide with an N-extension, the promoter, the
terminator and/or secretory signal sequence, respectively, and to
insert them into suitable vectors containing the information
necessary for replication, are well known to persons skilled in the
art (cf., for instance, Sambrook et al., Molecular Cloning: A
Laboratory Manual, Cold Spring Harbor, N.Y., 1989).
[0161] The host cell into which the DNA sequence encoding the MIC-1
polypeptide with an N-extension is introduced may be any cell that
is capable of expressing the MIC-1 polypeptide with an N-extension
either intracellularly or extracellularly. The MIC-1 polypeptide
with an N-extension may be produced by culturing a host cell
containing a DNA sequence encoding the MIC-1 polypeptide with an
N-extension and capable of expressing the MIC-1 polypeptide with an
N-extension in a suitable nutrient medium under conditions
permitting the expression of the MIC-1 polypeptide with an
N-extension. Non-limiting examples of host cells suitable for
expression of MIC-1 polypeptide with N-extension are: Escherichia
coli, Saccharomyces cerevisiae, as well as human embryonic kidney
(HEK), Baby Hamster Kidney (BHK) or Chinese hamster ovary (CHO)
cell lines. If posttranslational modifications are needed, suitable
host cells include yeast, fungi, insects and higher eukaryotic
cells such as mammalian cells.
[0162] Once the MIC-1 polypeptide with an N-extension has been
expressed in a host organism it may be recovered and purified to
the required quality by conventional techniques. Non-limiting
examples of such conventional recovery and purification techniques
are centrifugation, solubilization, filtration, precipitation,
ion-exchange chromatography, immobilized metal affinity
chromatography (IMAC), Reversed phase-High Performance Liquid
Chromatography (RP-HPLC), gel-filtration and freeze drying.
[0163] Examples of recombinant expression and purification of MIC-1
proteins may be found in e.g. Cordingley et al., J. Virol. 1989,
63, pp 5037-5045; Birch et al., Protein Expr Purif., 1995, 6, pp
609-618 and in WO2008/043847.
Examples of microbial expression and purification of MIC-1 proteins
may be found in e.g. Chich et al, Anal. Biochem, 1995, 224, pp
245-249 and Xin et al., Protein Expr. Purif. 2002, 24, pp
530-538.
[0164] Specific examples of methods of preparing a number of the
MIC-1 polypeptides with an N-extension of the invention are
included in the experimental part.
Inclusion Body and Protein Expression
[0165] MIC-1 polypeptides with an N-terminal amino acid extension
can be expressed in bacteria such as E. coli. In the context of the
present invention, large scale protein production of the MIC-1
polypeptides with an N-extension could take of using Inclusion
Bodies (IB) as this represent an advantageous approach to
controlling process recovery, protein purity, protease degradation
and general protein stability. This becomes particular important
for large scale protein production. Of critical importance for the
quality of IB is the balance of MIC-1 polypeptides with an
N-extension solubility partly controlled by the calculated pI and
IB formation.
Mode of Administration
[0166] The route of administration may be any route which
effectively transports a compound of this invention to the desired
or appropriate place in the body, such as parenterally, for
example, subcutaneously, intramuscularly or intravenously.
Alternatively, a compound of this invention can be administered
orally, pulmonary, rectally, transdermally, buccally, sublingually,
or nasally.
[0167] The amount of a compound of this invention to be
administered, the determination of how frequently to administer a
compound of this invention, and the election of which compound or
compounds of this invention to administer, optionally together with
another pharmaceutically active agent, is decided in consultation
with a practitioner who is familiar with the treatment of obesity
and related disorders.
Pharmaceutical Compositions
[0168] Pharmaceutical compositions comprising a compound of the
invention or a pharmaceutically acceptable salt, amide, or ester
thereof, and a pharmaceutically acceptable excipient may be
prepared as is known in the art.
[0169] The term "excipient" broadly refers to any component other
than the active therapeutic ingredient(s). The excipient may be an
inert substance, an inactive substance, and/or a not medicinally
active substance.
[0170] The excipient may serve various purposes, e.g. as a carrier,
vehicle, diluent, tablet aid, and/or to improve administration,
and/or absorption of the active substance.
[0171] The formulation of pharmaceutically active ingredients with
various excipients is known in the art, see e.g. Remington: The
Science and Practice of Pharmacy (e.g. 19.sup.th edition (1995),
and any later editions).
Combination Treatment
[0172] The treatment with a compound according to the present
invention may also be combined with one or more pharmacologically
active substances, e.g., selected from antiobesity agents, appetite
regulating agents, and agents for the treatment and/or prevention
of complications and disorders resulting from or associated with
obesity.
Pharmaceutical Indications
[0173] In one aspect, the present invention relates to a compound
of the invention, for use as a medicament.
[0174] In particular embodiments, the compound of the invention may
be used for the following medical treatments:
[0175] (i) Prevention and/or treatment of eating disorders, such as
obesity, e.g. by decreasing food intake, reducing body weight,
suppressing appetite and/or inducing satiety.
[0176] (ii) Prevention and/or treatment of hyperglycemia, insulin
resistance and/or impaired glucose tolerance.
[0177] (iii) Prevention and/or treatment of dyslipidaemia.
[0178] In some embodiments the invention relates to a method for
weight management. In some embodiments the invention relates to a
method for reduction of appetite. In some embodiments the invention
relates to a method for reduction of food intake.
[0179] Generally, all subjects suffering from obesity are also
considered to be suffering from overweight. In some embodiments the
invention relates to a method for treatment or prevention of
obesity. In some embodiments the invention relates to use of the
MIC-1 compounds of the invention for treatment or prevention of
obesity. In some embodiments the subject suffering from obesity is
human, such as an adult human or a paediatric human (including
infants, children, and adolescents). Body mass index (BMI) is a
measure of body fat based on height and weight. The formula for
calculation is BMI=weight in kilograms/height in meters.sup.2. A
human subject suffering from obesity has a BMI of .gtoreq.30; this
subject may also be referred to as obese. In some embodiments the
human subject suffering from obesity has a BMI of .gtoreq.35 or a
BMI in the range of .gtoreq.30 to <40. In some embodiments the
obesity is severe obesity or morbid obesity, wherein the human
subject has a BMI of .gtoreq.40.
[0180] In some embodiments the invention relates to a method for
treatment or prevention of overweight, optionally in the presence
of at least one weight-related comorbidity. In some embodiments the
invention relates to use of the MIC-1 compounds of the invention
for treatment or prevention of overweight, optionally in the
presence of at least one weight-related comorbidity.
[0181] In some embodiments the subject suffering from overweight is
human, such as an adult human or a paediatric human (including
infants, children, and adolescents). In some embodiments a human
subject suffering from overweight has a BMI of .gtoreq.25, such as
a BMI of .gtoreq.27. In some embodiments a human subject suffering
from overweight has a BMI in the range of 25 to <30 or in the
range of 27 to <30. In some embodiments the weight-related
comorbidity is selected from the group consisting of hypertension,
diabetes (such as type 2 diabetes), dyslipidaemia, high
cholesterol, and obstructive sleep apnoea.
[0182] In some embodiments the invention relates to a method for
reduction of body weight. In some embodiments the invention relates
to use of the MIC-1 compounds of the invention for reduction of
body weight. A human to be subjected to reduction of body weight
according to the present invention has a BMI of .gtoreq.25, such as
a BMI of .gtoreq.27 or a BMI of .gtoreq.30. In some embodiments the
human to be subjected to reduction of body weight according to the
present invention has a BMI of .gtoreq.35 or a BMI of
.gtoreq.40.
[0183] In some embodiments the invention relates to a method for
treatment or prevention of cardiovascular diseases like
arteriosclerosis and other disorders such as steatohepatitis, and
diabetic nephropathy.
[0184] The articles "a" and "an" are used herein to refer to one or
to more than one (i.e., to at least one) of the grammatical object
of the article. By way of example, "a MIC-1 polypeptide" means one
MIC-1 polypeptide or more than one MIC-1 polypeptide.
[0185] An asterisk (*) in a chemical formula designates a point of
attachment.
Particular Embodiments
[0186] The invention is further described by the following
non-limiting embodiments of the invention:
1. A MIC-1 compound comprising a MIC-1 polypeptide with an
N-terminal amino acid extension and a protractor, wherein the
protractor is attached to the amino acid extension. 2. The MIC-1
compound according to embodiment 1, wherein the compound is a
homodimer. 3. The MIC-1 compound according to embodiments 1 or 2,
wherein the N-terminal amino acid extension comprises a cysteine
residue, and wherein the protractor is attached to the amino acid
extension at the Cysteine residue. 4. The MIC-1 compound according
to embodiment 3, wherein the protractor comprises, or consists of,
at least one of each of Chem. 1, Chem. 2, Chem. 3 and Chem. 4;
wherein Chem. 1 is selected from the group consisting of:
HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--* Chem. 1D:
wherein x is an integer in the range of 12-20, wherein y is an
integer in the range of 5-15; wherein Chem. 2 is selected from the
group consisting of:
*--(NH--CH(COOH)--(CH.sub.2).sub.m--CO).sub.k*, Chem. 2A:
*--(NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO).sub.k*, and Chem.
2B:
*--(NH--(CH.sub.2).sub.m-cyclohexane-CO).sub.k--*, Chem. 2C:
wherein m of Chem. 2 is an integer in the range of 1-5, and k is an
integer in the range of 0-4; wherein Chem. 3 is
*(NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2].sub.n-
--CO--*),
wherein k of Chem. 3 is an integer in the range of 1-10, n is an
integer in the range of 1-5, and l is an integer in the range of
0-5; wherein Chem. 4 is selected from
*--NH--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, and Chem. 4A:
*--NH--CH(COOH)--(CH.sub.2).sub.m--NH--CO--CH.sub.2--*, Chem.
4B:
*--NH--(CH.sub.2).sub.m--CH(COOH)--NH--CO--CH.sub.2--*, and Chem.
4C:
Chem. 4D:
##STR00005##
wherein m of Chem. 4 is an integer in the range of 1-5 and n is an
integer in the range of 2-6; and wherein Chem. 1, Chem. 2, Chem. 3,
and Chem. 4 are interconnected via amide bonds, connecting the*--NH
end of a Chem. to the CO--* end of another Chem., and wherein the
CH.sub.2--* end of Chem. 4 is connected to a sulfur atom of the
Cysteine residue of the amino acid extension. 5. The MIC-1 compound
according to embodiments 1 or 2, and wherein the protractor is
attached to the N-terminal amino acid of the amino acid extension.
6. The MIC-1 compound according to embodiment 5, wherein the
protractor comprises, or consists of, at least one of each of Chem.
1, Chem. 2, Chem. 3 and Chem. 4; wherein Chem. 1 is selected from
the group consisting of:
HOOC--(CH.sub.2).sub.x--CO--*, Chem. 1A:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.x--CO--*, Chem. 1B:
HOOC-benzene-O--(CH.sub.2).sub.y--CO--*, and Chem. 1C:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.x--CO--* Chem. 1D:
wherein x is an integer in the range of 12-20, wherein y is an
integer in the range of 5-15; wherein Chem. 2 is selected from the
group consisting of:
--(NH--CH(COOH)--(CH.sub.2).sub.m--CO).sub.k*, Chem. 2A:
--(NH--S(.dbd.O).sub.2--(CH.sub.2).sub.m--CO).sub.k*, and Chem.
2B:
--(NH--(CH.sub.2).sub.m-cyclohexane-CO).sub.k--*, Chem. 2C:
wherein m of Chem. 2 is an integer in the range of 1-5, and k is an
integer in the range of 0-4; wherein Chem. 3 is
*(NH--(CH.sub.2).sub.2--[O--(CH.sub.2).sub.2].sub.k--O--[CH.sub.2].sub.n-
--CO--*),
wherein k of Chem. 3 is an integer in the range of 1-10, n is an
integer in the range of 1-5, and l is an integer in the range of
0-5; wherein Chem. 4 is selected from the group consisting of
Formula I, II or III:
##STR00006##
wherein Chem. 1, Chem. 2, Chem. 3, and Chem. 4 are interconnected
via amide bonds, connecting the*--NH end of a Chem. to the CO--*
end of another Chem., and wherein the CH.sub.2--* end of Chem. 4 is
connected to amino group of the N-terminal of the amino acid
extension. 7. The MIC-1 compound according to any one of
embodiments 4 and 6, wherein Chem. 1 is selected from the group
consisting of:
HOOC--(CH.sub.2).sub.16--CO--*, Chem. 1a:
HO--S(.dbd.O).sub.2--(CH.sub.2).sub.15--CO--* Chem. 1b:
HOOC-benzene-O--(CH.sub.2).sub.9--CO--*, and Chem. 1c:
(1H-tetrazol-5-yl)-(CH.sub.2).sub.15--CO--*. Chem. 1d:
8. The MIC-1 compound according to any one of embodiments 4, 6 and
7 wherein Chem. 2 is selected from the group consisting of:
*--NH--CH(COOH)--(CH.sub.2).sub.2--CO--*, Chem. 2a:
*--NH--S(.dbd.O).sub.2--(CH.sub.2).sub.3--CO--* and Chem. 2b:
*--NH--CH.sub.2-cyclohexane-CO--*. Chem. 2c:
9. The MIC-1 compound according to any one of embodiments 4, 6 and
7, wherein Chem. 2-Chem. 3 is the following Formula IV:
##STR00007##
where n is of 0-3 and m is 0-3 PP-33, 10. The MIC-1 compound
according to any one of embodiments 4 and 7-9, wherein Chem. 4 is
selected from the group consisting of:
*--NH--(CH.sub.2).sub.2--NH--CO--CH.sub.2--* and Chem. 4a:
*--NH--CH(COOH)--(CH.sub.2).sub.4--NH--CO--CH.sub.2--*. Chem.
4b:
11. The MIC-1 compound according to any one of embodiments 4 and
7-9, wherein Chem. 4 is selected from the group consisting of
Formula V, VI or VII:
##STR00008##
where n is 1-4. 12. The MIC-1 compound according to any one of
embodiments 4 and 7-9, wherein Chem. 4 is the following Formula
VIII:
##STR00009##
where p is 1-5, and q is 1-5. 13. The MIC-1 compound according to
any one of embodiments 1-3 and 5, wherein the protractor is
selected from the group consisting of Formula IX, Formula X,
Formula XI, Formula XII and Formula XIII:
##STR00010##
14. The MIC-1 compound according to any one of embodiments 1-3 and
5, wherein the protractor is selected from the group consisting of:
Biocompatible fatty acids and derivatives thereof, Hydroxy Alkyl
Starch (HAS) e.g. Hydroxy Ethyl Starch (HES), Poly Ethylen Glycol
(PEG), Poly (Glyx-Sery)n (HAP), Hyaluronic acid (HA), Heparosan
polymers (HEP), Phosphorylcholine-based polymers (PC polymer),
Fleximers, Dextran, Poly-sialic acids (PSA), an Fc domain,
Transferrin, Albumin, Elastin like peptides, XTEN polymers, Albumin
binding peptides, a CTP peptide, and any combination thereof. 15.
The MIC-1 compound according to any one of the preceding
embodiments, wherein the MIC-1 polypeptide with the amino acid
extension has a calculated pI lower than 6.5. 16. The MIC-1
compound according to embodiment 15, wherein the calculated pI is
lower than 6.1. 17. The MIC-1 compound according to embodiment 15,
wherein the calculated pI is lower than 6.0. 18. The MIC-1 compound
according to embodiment 15, wherein the calculated pI is lower than
6.4, 6.3, 6.2, 6.1, 6.0, 5.9, 5.8, 5.7, 5.6, 5.5, 5.4, 5.3, or 5.2,
5.1, or 5.0, 4.9, 4.8, 4.7, 4.6, 4.5, 4.4, 4.3, 4.2, 4.1 or 4.0.
19. The MIC-1 compound according to embodiment 15, wherein the
calculated pI is higher than 4.7. 20. The MIC-1 compound according
to embodiment 15, wherein the calculated pI is higher than 4.8. 21.
The MIC-1 compound according to embodiment 15, wherein the
calculated pI is higher than 4.9. 22. The MIC-1 compound according
to embodiment 15, wherein the calculated pI is higher than 5.0. 23.
The MIC-1 compound according to embodiment 15, wherein the
calculated pI is higher than 5.1. 24. The MIC-1 compound according
to embodiment 15, wherein the calculated pI is in the range of
6.5-3.0, 6.5-3.5, 6.5-4.0, 6.1-3.0, 6.1-3.5, 6.1-4.0, 6.1-4.7,
6.1-4.9, 6.1-5.0, 6.1-5.1, 6.0-3.0, 6.0-3.5, 6.0-4.0, 5.9-3.0,
5.9-3.5, 5.9-4.0, 5.9-5.0, 5.9-5.1, 5.8-3.0, 5.8-3.5, 5.8-4.0,
5.8-5.1, 5.8-5.2, 5.5-3.0, 5.5-3.5, 5.5-4.0, or 5.0-4.0. 25. The
MIC-1 compound according embodiment 15, wherein the calculated pI
is in the range of 5.8-5.2. 26. The MIC-1 compound according to any
of the preceding embodiments, wherein the amino acid extension
comprises 3 to 200 amino acid residues. 27. The MIC-1 compound
according to any of the preceding embodiments, wherein the amino
acid extension is in the range of 3-100, 3-50, 3-40, 3-30, 5-100,
5-50, 5-40, 5-30, 10-100, 10-50, 10-40, 10-30, 3-36, 3-30, 3-25,
3-24, 3-12, 4-36, 4-30, 4-24, 4-12, 5-36, 5-30, 5-24, 5-12, 6-36,
6-30, 6-24, 6-12, 7-36, 7-30, 7-24, 7-12, 8-36, 8-30, 8-24, 8-12,
30-36, 32-36, 30-34, or 30-32 amino acid residues in length. 28.
The MIC-1 compound according to any of the preceding embodiments,
wherein the amino acid extension is in the range of 3-36 or 30-32
amino acid residues in length. 29. The MIC-1 compound according to
any of the preceding embodiments, wherein the amino acid extension
has a surplus of acidic amino acid residues (Aspartic acid or
Glutamic acid) of at least 3, 4, 5, 6, 7, 8, 9 or 10 compared to
the number of basic amino acid residues (Lysine, Arginine or
Histidine). 30. The MIC-1 compound according to any of the
preceding embodiments, wherein the amino acid extension comprise at
least 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70% or 75% surplus of
acidic amino acid residues (Aspartic acid or Glutamic acid)
compared to number of basic amino acid residues (Lysine or Arginine
or Histidine). 31. The MIC-1 compound according to embodiment 30,
wherein the amino acid extension comprise at least 10% acidic amino
acid residues. 32. The MIC-1 compound according to embodiment 30,
wherein the amino acid extension comprise at least 15% acidic amino
acid residues. 33. The MIC-1 compound according to embodiment 11,
wherein the amino acid extension comprise at least 25% acidic amino
acid residues. 34. The MIC-1 compound according to any one of
embodiments 1-33, wherein the amino acid extension is composed of
amino acid residues selected among the group consisting of A, C, E,
G, P, S, T, Q, N and D and wherein the amino acid extension
comprises at least three E and/or D amino acid residues. 35. The
MIC-1 compound according to embodiment 34, wherein the amino acid
extension is composed of amino acid residues A, C, E, G, P, S and
T. 36. The MIC-1 compound according to embodiment 35, wherein the
amino acid extension comprises at least three E and at least one P.
37. The MIC-1 compound according to embodiment 36, wherein the
amino acid extension comprises at least 6 Ser, 4 Pro, 4 Gly, 4 Thr,
4 Glu and 2 Ala. 38. The MIC-1 compound according to embodiment 37,
wherein the amino acid extension comprises two of sequences
selected from the group consisting of SPAGSPTSTEEG, TSESATPESGPG,
TSTEPSEGSAPG and SEPATSGSETPG, and wherein one of the amino acid of
the amino acid extension is replaced with Cysteine. 39. The MIC-1
compound according to embodiment 38, wherein the amino acid
extension further comprises 6-8 consecutive amino acids of
SPAGSPTSTEEG, TSESATPESGPG, TSTEPSEGSAPG or SEPATSGSETPG, such as
the first 6-8 amino acid residues, the last 6-8 residues or the
internal 6-8 residues, and wherein one of the amino acid of the
amino acid extension is replaced with Cysteine. 40. The MIC-1
compound according to any one of embodiments 3-39, wherein Cysteine
locates in any position of the N-terminal amino acid extension. 41.
The MIC-1 compound according to embodiment 40, wherein the distance
between the Cysteine residue of the N-terminal extension and the
N-terminal amino acid of the MIC-1 polypeptide is at least 1, 3, 5,
10, 15, 19, 23, 26, 29, or 32 amino acids (including Cysteine
residue of the N-terminal extension, but not including N-terminal
amino acid of MIC-1 polypeptide). 42. The MIC-1 compound according
to embodiment 40, wherein the distance between Cysteine residue of
the N-terminal extension and the N-terminal amino acid of the MIC-1
polypeptide is at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 or 32 amino acids
(including Cysteine residue of the N-terminal extension, but not
including N-terminal amino acid of MIC-1 polypeptide). 43. The
MIC-1 compound according to embodiment 42, wherein the distance
between Cysteine residue of the N-terminal extension and the
N-terminal amino acid of the MIC-1 polypeptide is 26-29 amino acids
(including Cysteine residue of the N-terminal extension, but not
including N-terminal amino acid of MIC-1 polypeptide). 44. The
MIC-1 compound according to any one of the preceding embodiments,
wherein the amino acid extension starts with S. 45. The MIC-1
compound according to any one of the preceding embodiments, wherein
the amino acid extension starts with SE. 46. The MIC-1 compound
according to any one of the preceding embodiments, wherein the
amino acid extension starts with SEP. 47. The MIC-1 compound
according to any one of the preceding embodiments, wherein the
amino acid extension comprises one or more of the following
sequences SEPATCGSETPGTSESATPESGPGTSTEPS (SEQ ID NO: 223),
SEPATSGCETPGTSESATPESGPGTSTEPS (SEQ ID NO: 224),
SEPCTSGSETPGTSESATPESGPGTSTEPSEG (SEQ ID NO: 225),
SEPCTSGSETPGTSESATPESGPGTSTEPS (SEQ ID NO: 240),
SEPCTSGSETPGTSESATPESGPGTSTE (SEQ ID NO: 241),
SEPCTSGSETPGTSESATPESGPG (SEQ ID NO: 242), SEPCTSGSETPGTSESATPES
(SEQ ID NO: 243), SEPCTSGSETPG (SEQ ID NO: 244),
SEPCTSGSETPGSPAGSPTSTEEGSPAGSP (SEQ ID NO: 245),
SEPCTSGSETPGTSESATPESGPGSPAGSP (SEQ ID NO: 246),
SEPCTSGSETPGTSTEPESGSAPGSPAGSP (SEQ ID NO: 247),
SEPCTSGSETPGSPAGSPTSTEEGTSESAT (SEQ ID NO: 248),
SEPCTSGSETPGTSESATPESGPGTSESAT (SEQ ID NO: 249),
SEPCTSGSETPGTSTEPESGSAPGTSESAT (SEQ ID NO: 250),
SEPCTSGSETPGSPAGSPTSTEEGTSTEPE (SEQ ID NO: 251),
SEPCTSGSETPGTSESATPESGPGTSTEPE (SEQ ID NO: 252),
SEPCTSGSETPGTSTEPESGSAPGTSTEPE (SEQ ID NO: 253),
SEPCTSGSETPGSPAGSPTSTEEGSEPATS (SEQ ID NO: 254),
SEPCTSGSETPGTSESATPESGPGSEPATS (SEQ ID NO: 255),
SEPCTSGSETPGTSTEPESGSAPGSEPATS (SEQ ID NO: 256),
SEPCTSGSETPGSPAGSPTSTEEGTSTEEG (SEQ ID NO: 257),
SEPCTSGSETPGTSESATPESGPGTSTEEG (SEQ ID NO: 258),
SEPCTSGSETPGTSTEPESGSAPGTSTEEG (SEQ ID NO: 259),
SEPCTSGSETPGSPAGSPTSTEEGPESGPG (SEQ ID NO: 260),
SEPCTSGSETPGTSESATPESGPGPESGPG (SEQ ID NO: 261),
SEPCTSGSETPGTSTEPESGSAPGPESGPG (SEQ ID NO: 262),
SEPCTSGSETPGSPAGSPTSTEEGSGSAPG (SEQ ID NO: 263),
SEPCTSGSETPGTSESATPESGPGSGSAPG (SEQ ID NO: 264),
SEPCTSGSETPGTSTEPESGSAPGSGSAPG (SEQ ID NO: 265),
SEPCTSGSETPGSPAGSPTSTEEGGSETPG (SEQ ID NO: 266),
SEPCTSGSETPGTSESATPESGPGGSETPG (SEQ ID NO: 267),
SEPCTSGSETPGTSTEPESGSAPGGSETPG (SEQ ID NO: 268),
SEPCTSGSETPGSPAGSPTSTEEGTSESATPESGPG (SEQ ID NO: 269),
SEPCTSGSETPGSPAGSPTSTEEGSPAGSPTSTEEG (SEQ ID NO: 270),
SEPCTSGSETPGSPAGSPTSTEEGTSTEPESGSAPG (SEQ ID NO: 271),
SEPCTSGSETPGTSESATPESGPGSPAGSPTSTEEG (SEQ ID NO: 272),
SEPCTSGSETPGTSESATPESGPGTSESATPESGPG (SEQ ID NO: 273),
SEPCTSGSETPGTSESATPESGPGTSTEPESGSAPG (SEQ ID NO: 274),
SEPCTSGSETPGTSESATPESGPGSEPATSGSETPG (SEQ ID NO: 275),
SEPCTSGSETPGTSTEPESGSAPGSPAGSPTSTEEG (SEQ ID NO: 276),
SEPCTSGSETPGTSTEPESGSAPGTSESATPESGPG (SEQ ID NO: 277),
SEPCTSGSETPGTSTEPESGSAPGTSTEPESGSAPG (SEQ ID NO: 278),
SEPCTSGSETPGTSTEPESGSAPGSEPATSGSETPG (SEQ ID NO: 279),
SEPCTSGSETPGSEPATSGSETPGSPAGSPTSTEEG (SEQ ID NO: 280),
SEPCTSGSETPGSEPATSGSETPGTSESATPESGPG (SEQ ID NO: 281),
SEPCTSGSETPGSEPATSGSETPGTSTEPESGSAPG (SEQ ID NO: 282),
SEPCTSGSETPGSEPATSGSETPGSEPATSGSETPG (SEQ ID NO: 283),
GPCEGPSEGPSEGPSEGPSEGPSEGPSE (SEQ ID NO: 284),
GECPGEQPGEQPGEQPGEQPGEQPGEQP (SEQ ID NO: 285),
PACEEEDDPDGGGSGGGSGGGS (SEQ ID NO: 286), PDECTEEETEGGGSGGGSGGGS
(SEQ ID NO: 287), SEPATCGSETPGTSESATPESGPGTSTEPSEG (SEQ ID NO:
226), SEPATSCSETPGTSESATPESGPGTSTEPSEG (SEQ ID NO: 227),
SEPACSGSETPGTSESATPESGPGTSTEPSEG (SEQ ID NO: 229),
SEPATSGCETPGTSESATPESGPGTSTEPSEG (SEQ ID NO: 230),
SEPATSGSECPGTSESATPESGPGTSTEPSEG (SEQ ID NO: 231),
SEPATSGSETPCTSESATPESGPGTSTEPSEG (SEQ ID NO: 232),
SEPATSGSETPGTCESATPESGPGTSTEPSEG (SEQ ID NO: 233),
SEPATSGSETPGTSECATPESGPGTSTEPSEG (SEQ ID NO: 234),
SEPATSGSETPGTSESACPESGPGTSTEPSEG (SEQ ID NO: 235),
SEPATSGSETPGTSESATPECGPGTSTEPSEG (SEQ ID NO: 236),
SEPATSGSETPGTSESATPESCPGTSTEPSEG (SEQ ID NO: 237),
SEPATSGSETPGTSESATPESGPGTSCEPSEG (SEQ ID NO: 238),
SEPATSGSETPGTSESATPESGPGTSTEPCEG (SEQ ID NO: 239). 48. The MIC-1
compound according to any one of embodiments 1-2 and 5-33 wherein
the amino acid extension is composed of amino acid residues
selected among the group consisting of A, E, G, P, S, T, D, N, and
Q wherein the amino acid extension comprises at least three E
and/or D amino acid residues. 49. The MIC-1 compound according to
any of the preceding embodiments, wherein the amino acid extension
is composed of amino acid residues selected among the group
consisting of A, E, G, P, S, T, Q and D, wherein the amino acid
extension comprises at least three E and/or D amino acid residues.
50. The MIC-1 compound according to embodiment 48 or 49, wherein
the amino acid extension comprises at least three E and at least
one P. 51. The MIC-1 compound according to embodiment 50, wherein
the amino acid extension further comprises S, G, T and A. 52. The
MIC-1 compound according to embodiment 51, wherein the amino acid
extension comprises 6 Ser, 4 Pro, 4 Gly, 4 Thr, 4 Glu and 2 Ala.
53. The MIC-1 compound according to embodiment 51, wherein the
amino acid extension comprises two of sequences selected from the
group consisting of SPAGSPTSTEEG, TSESATPESGPG, TSTEPSEGSAPG and
SEPATSGSETPG. 54. The MIC-1 compound according to embodiment 53,
wherein the amino acid extension further comprises 6-8 consecutive
amino acids of SPAGSPTSTEEG, TSESATPESGPG, TSTEPSEGSAPG or
SEPATSGSETPG, such as the first 6-8 amino acid residues, the last
6-8 residues or the internal 6-8 residues. 55. The MIC-1 compound
according to any one of embodiments 48 to 54, wherein the amino
acid extension starts with S. 56. The MIC-1 compound according
embodiment 55, wherein the amino acid extension starts with SE. 57.
The MIC-1 compound according to embodiment 56, wherein the amino
acid extension starts with SEP. 58. The MIC-1 compound according to
any one of embodiments 1-2 and 5-33, wherein the amino acid
extension comprises one or more of the following sequences SPAGSP
(SEQ ID NO:4), TSESAT (SEQ ID NO:5), TSTEPE (SEQ ID NO:6), SEPATS
(SEQ ID NO:7), TSTEEG (SEQ ID NO:8), PESGPG (SEQ ID NO:9), SGSAPG
(SEQ ID NO:10), GSETPG (SEQ ID NO:11), SEPATSGSETPGSPAGSPTSTEEG
(SEQ ID NO:12), SEPATSGSETPGTSESATPESGPG (SEQ ID NO:13),
SEPATSGSETPGTSTEPESGSAPG (SEQ ID NO:14),
SEPATSGSETPGSPAGSPTSTEEGSPAGSP (SEQ ID NO:15),
SEPATSGSETPGTSESATPESGPGSPAGSP (SEQ ID NO:16),
SEPATSGSETPGTSTEPESGSAPGSPAGSP (SEQ ID NO:17),
SEPATSGSETPGSPAGSPTSTEEGTSESAT (SEQ ID NO:18),
SEPATSGSETPGTSESATPESGPGTSESAT (SEQ ID NO:19),
SEPATSGSETPGTSTEPESGSAPGTSESAT (SEQ ID NO:20),
SEPATSGSETPGSPAGSPTSTEEGTSTEPE (SEQ ID NO:21),
SEPATSGSETPGTSESATPESGPGTSTEPE (SEQ ID NO:22),
SEPATSGSETPGTSTEPESGSAPGTSTEPE (SEQ ID NO:23),
SEPATSGSETPGSPAGSPTSTEEGSEPATS (SEQ ID NO:24),
SEPATSGSETPGTSESATPESGPGSEPATS (SEQ ID NO:25),
SEPATSGSETPGTSTEPESGSAPGSEPATS (SEQ ID NO:26),
SEPATSGSETPGSPAGSPTSTEEGTSTEEG (SEQ ID NO:27),
SEPATSGSETPGTSESATPESGPGTSTEEG (SEQ ID NO:28),
SEPATSGSETPGTSTEPESGSAPGTSTEEG (SEQ ID NO:29),
SEPATSGSETPGSPAGSPTSTEEGPESGPG (SEQ ID NO:30),
SEPATSGSETPGTSESATPESGPGPESGPG (SEQ ID NO:31),
SEPATSGSETPGTSTEPESGSAPGPESGPG (SEQ ID NO:32),
SEPATSGSETPGSPAGSPTSTEEGSGSAPG (SEQ ID NO:33),
SEPATSGSETPGTSESATPESGPGSGSAPG (SEQ ID NO:34),
SEPATSGSETPGTSTEPESGSAPGSGSAPG (SEQ ID NO:35),
SEPATSGSETPGSPAGSPTSTEEGGSETPG (SEQ ID NO:36),
SEPATSGSETPGTSESATPESGPGGSETPG (SEQ ID NO:37),
SEPATSGSETPGTSTEPESGSAPGGSETPG (SEQ ID NO:38),
SEPATSGSETPGTSESATPESGPGTSTEPS (SEQ ID NO:70),
SEPATSGSETPGTSESATPESGPGTSTEPSEG (SEQ ID NO:71),
SEPATSGSETPGSPAGSPTSTEEGTSESATPESGPG (SEQ ID NO:39),
SEPATSGSETPGSPAGSPTSTEEGSPAGSPTSTEEG (SEQ ID NO:40),
SEPATSGSETPGSPAGSPTSTEEGTSTEPESGSAPG (SEQ ID NO:41),
SEPATSGSETPGTSESATPESGPGSPAGSPTSTEEG (SEQ ID NO:42),
SEPATSGSETPGTSESATPESGPGTSESATPESGPG (SEQ ID NO:43),
SEPATSGSETPGTSESATPESGPGTSTEPESGSAPG (SEQ ID NO:44),
SEPATSGSETPGTSESATPESGPGSEPATSGSETPG (SEQ ID NO:45),
SEPATSGSETPGTSTEPESGSAPGSPAGSPTSTEEG (SEQ ID NO:46),
SEPATSGSETPGTSTEPESGSAPGTSESATPESGPG (SEQ ID NO:47),
SEPATSGSETPGTSTEPESGSAPGTSTEPESGSAPG (SEQ ID NO:48),
SEPATSGSETPGTSTEPESGSAPGSEPATSGSETPG (SEQ ID NO:49),
SEPATSGSETPGSEPATSGSETPGSPAGSPTSTEEG (SEQ ID NO:50),
SEPATSGSETPGSEPATSGSETPGTSESATPESGPG (SEQ ID NO:51),
SEPATSGSETPGSEPATSGSETPGTSTEPESGSAPG (SEQ ID NO:52),
SEPATSGSETPGSEPATSGSETPGSEPATSGSETPG (SEQ ID NO:53), GEPS (SEQ ID
NO:118), GPSE (SEQ ID NO:119), GPES (SEQ ID NO:120), GSPE (SEQ ID
NO:121), GSEP (SEQ ID NO:122), GEPQ (SEQ ID NO:123), GEQP (SEQ ID
NO:124), GPEQ (SEQ ID NO:125), GPQE (SEQ ID NO:126), GQEP (SEQ ID
NO:127) or GQPE (SEQ ID NO:128), PEDEETPEQE (SEQ ID NO:129),
PDEGTEEETE (SEQ ID NO:130), PAAEEEDDPD (SEQ ID NO:131), AEPDEDPQSED
(SEQ ID NO:132), AEPDEDPQSE (SEQ ID NO:133), AEPEEQEED (SEQ ID
NO:134), AEPEEQEE (SEQ ID NO:135), GGGS (SEQ ID NO:136), GSGS (SEQ
ID NO:137), GGSS (SEQ ID NO:138) and SSSG (SEQ ID NO:139). 59. The
MIC-1 compound according to any one of embodiments 1-2 and 5-33,
wherein the amino acid extension comprises one or more of the
following sequences SPAGSP, TSESAT, TSTEPE, SEPATS, TSTEEG, PESGPG,
SGSAPG, GSETPG, SEPATSGSETPGSPAGSPTSTEEG, SEPATSGSETPGTSESATPESGPG,
SEPATSGSETPGTSTEPESGSAPG, SEPATSGSETPGSPAGSPTSTEEGSPAGSP,
SEPATSGSETPGTSESATPESGPGSPAGSP, SEPATSGSETPGTSTEPESGSAPGSPAGSP,
SEPATSGSETPGSPAGSPTSTEEGTSESAT, SEPATSGSETPGTSESATPESGPGTSESAT,
SEPATSGSETPGTSTEPESGSAPGTSESAT, SEPATSGSETPGSPAGSPTSTEEGTSTEPE,
SEPATSGSETPGTSESATPESGPGTSTEPE, SEPATSGSETPGTSTEPESGSAPGTSTEPE,
SEPATSGSETPGSPAGSPTSTEEGSEPATS, SEPATSGSETPGTSESATPESGPGSEPATS,
SEPATSGSETPGTSTEPESGSAPGSEPATS,
SEPATSGSETPGSPAGSPTSTEEGTSTEEG, SEPATSGSETPGTSESATPESGPGTSTEEG,
SEPATSGSETPGTSTEPESGSAPGTSTEEG, SEPATSGSETPGSPAGSPTSTEEGPESGPG,
SEPATSGSETPGTSESATPESGPGPESGPG, SEPATSGSETPGTSTEPESGSAPGPESGPG,
SEPATSGSETPGSPAGSPTSTEEGSGSAPG, SEPATSGSETPGTSESATPESGPGSGSAPG,
SEPATSGSETPGTSTEPESGSAPGSGSAPG, SEPATSGSETPGSPAGSPTSTEEGGSETPG,
SEPATSGSETPGTSESATPESGPGGSETPG, SEPATSGSETPGTSTEPESGSAPGGSETPG
SEPATSGSETPGSPAGSPTSTEEGTSESATPESGPG,
SEPATSGSETPGSPAGSPTSTEEGSPAGSPTSTEEG,
SEPATSGSETPGSPAGSPTSTEEGTSTEPESGSAPG,
SEPATSGSETPGTSESATPESGPGSPAGSPTSTEEG,
SEPATSGSETPGTSESATPESGPGTSESATPESGPG,
SEPATSGSETPGTSESATPESGPGTSTEPESGSAPG,
SEPATSGSETPGTSESATPESGPGSEPATSGSETPG,
SEPATSGSETPGTSTEPESGSAPGSPAGSPTSTEEG,
SEPATSGSETPGTSTEPESGSAPGTSESATPESGPG,
SEPATSGSETPGTSTEPESGSAPGTSTEPESGSAPG,
SEPATSGSETPGTSTEPESGSAPGSEPATSGSETPG,
SEPATSGSETPGSEPATSGSETPGSPAGSPTSTEEG,
SEPATSGSETPGSEPATSGSETPGTSESATPESGPG,
SEPATSGSETPGSEPATSGSETPGTSTEPESGSAPG,
SEPATSGSETPGSEPATSGSETPGSEPATSGSETPG, GEPQ, GEPS, GGGS, GSGS, GGSS,
and SSSG. 60. The MIC-1 compound according to any one of
embodiments 1-2 and 5-33, wherein the amino acid extension
comprises any combination of any 2-6 of the following sequences
SPAGSP, TSESAT, TSTEPE, SEPATS, TSTEEG, PESGPG, SGSAPG, GSETPG,
GEPQ, GEPS, GGGS, GSGS, GGSS, and SSSG. 61. The MIC-1 compound
according to any one of embodiments 1-2 and 5-33, wherein the amino
acid extension comprises one or more of the following sequences
GEPS, GPSE, GPES, GSPE, GSEP, GEPQ, GEQP, GPEQ, GPQE, GQEP, GQPE,
GGGS, GSGS, GGSS, and SSSG. 62. The MIC-1 compound according to
embodiment 61, wherein the amino acid extension comprises any
combination of 2-9 of the following sequences GEPS, GPSE, GPES,
GSPE, GSEP, GEPQ, GEQP, GPEQ, GPQE, GQEP, GQPE, GGGS, GSGS, GGSS,
and SSSG. 63. The MIC-1 compound according to any one of
embodiments 1-2 and 5-33, wherein the amino acid extension
comprises one or more of the following sequences GEPS, GPSE, GPES,
GSPE, GSEP, GGGS, GSGS, GGSS, and SSSG. 64. The MIC-1 compound
according to embodiment 63, wherein the amino acid extension
comprises any combination of 2-9 of the following sequences GEPS,
GPSE, GPES, GSPE, GSEP, GGGS, GSGS, GGSS, and SSSG. 65. The MIC-1
compound according to embodiment 64, wherein the amino acid
extension comprises one or more of the following sequences
GEPSGEPSGEPSGEPSGEPS (SEQ ID NO:140), GPSEGPSEGPSEGPSEGPSE (SEQ ID
NO:141), GPESGPESGPESGPESGPES (SEQ ID NO:142), GSPEGSPEGSPEGSPEGSPE
(SEQ ID NO:143), and GSEPGSEPGSEPGSEPGSEP (SEQ ID NO:144). 66. The
MIC-1 compound according to any one of embodiments 1-2 and 5-33,
wherein the amino acid extension comprises one or more of the
following sequences GEPQ, GEQP, GPEQ, GPQE, GQEP, GQPE, GGGS, GSGS,
GGSS, and SSSG. 67. The MIC-1 compound according to embodiment 66,
wherein the amino acid extension comprises any combination of 2-9
of the following sequences GEPQ, GEQP, GPEQ, GPQE, GQEP, GQPE,
GGGS, GSGS, GGSS, and SSSG. 68. The MIC-1 compound according to
embodiment 67, wherein the amino acid extension comprises one or
more of the following sequences GEPQGEPQGEPQGEPQGEPQ (SEQ ID
NO:145), GEQPGEQPGEQPGEQPGEQP (SEQ ID NO:146), GPEQGPEQGPEQGPEQGPEQ
(SEQ ID NO:147), GPQEGPQEGPQEGPQEGPQE (SEQ ID NO:148),
GQEPGQEPGQEPGQEPGQEP (SEQ ID NO:149), and GQPEGQPEGQPEGQPEGQPE (SEQ
ID NO:150). 69. The MIC-1 compound according to any of the
embodiments 1-2 and 5-33, wherein the amino acid extension
comprises one or more of the following sequences PEDEETPEQE,
PDEGTEEETE, PAAEEEDDPD, AEPDEDPQSED, AEPDEDPQSE, AEPEEQEED, and
AEPEEQEE, GGGS, GSGS, GGSS and SSSG. 70. The MIC-1 compound
according to any of the embodiments 1-2 and 5-33, wherein the amino
acid extension comprises any combination of two to three of the
following sequences PEDEETPEQE, PDEGTEEETE, PAAEEEDDPD,
AEPDEDPQSED, AEPDEDPQSE, AEPEEQEED, AEPEEQEE and AEEAEEAEEAEEAEE.
71. The MIC-1 compound according to any of the embodiments 1-2 and
5-33, wherein the amino acid extension comprises one or more of the
following sequences SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ
ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61,
SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID
NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ
ID NO:71, SEQ ID NO:72, SEQ ID NO:161, SEQ ID NO:162, SEQ ID
NO:181, SEQ ID NO:182, SEQ ID NO:183, SEQ ID NO:184, SEQ ID NO:185,
SEQ ID NO:186, SEQ ID NO:187, SEQ ID NO:188, SEQ ID NO:189, SEQ ID
NO:190, SEQ ID NO:191, SEQ ID NO:192, SEQ ID NO:193, SEQ ID NO:194
and SEQ ID NO:195. 72. The MIC-1 compound according to any one of
preceding embodiments, wherein the amino acid extension comprises
1-3 alanine amino acid residues N-terminally. 73. The MIC-1
compound according to any one of preceding embodiments, wherein the
amino acid extension comprises 1-4 Glycine and Serine amino acid
residues C-terminally. 74. The MIC-1 compound according to any one
of preceding embodiments, wherein the amino acid extension
comprises a (Gly-Ser)n or a (Ser-Gly)n sequence C-terminally,
wherein n is an integer between 1-8. 75. The MIC-1 compound
according to any one of preceding embodiments, wherein the amino
acid extension comprises GGGS, GSGS, GGSS or SSSG C-terminally. 76.
The MIC-1 compound according to any of the preceding embodiments,
wherein the MIC-1 polypeptide displays at least 80%, 85%, 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to wild
type MIC-1 (SEQ ID NO:1). 77. The MIC-1 compound according to
embodiment 70, wherein the MIC-1 polypeptide displays at least 95%
sequence identity to wild type MIC-1 (SEQ ID NO:1). 78. The MIC-1
compound according to any one of embodiments 1-70, wherein the
MIC-1 polypeptide has a maximum of 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1
amino acid modifications compared to MIC-1 of SEQ ID NO:1. 79. The
MIC-1 compound according to any one of embodiments 1-72, wherein
the MIC-1 polypeptide has a maximum of 7, 6, 5, 4, 3 or 2 amino
acid modifications compared to MIC-1 of SEQ ID NO:1. 80. The MIC-1
compound according to any one of the preceding embodiments wherein
the MIC-1 polypeptide comprises one or more of the following
substitutions P11E, H18E, R21E, A30E, M43L, M43E, A47E, R53E, A54E,
M57E, M57L, H66E, R67E, L68E, K69E, A75E, A81E, P85E, M86F, M86L,
Q90E, T92E, L105E, K107E, K69R, K107R and K91R compared to wild
type MIC-1 (SEQ ID NO:1). 81. The MIC-1 compound according to any
one of the preceding embodiments wherein the MIC-1 polypeptide
comprises one or more of the following substitutions R2S, R2A, R2E,
N3S, N3E, N3A, N3T, N3P, N3G, N3V, N3H, N3Y or N3Q compared to
MIC-1 of SEQ ID NO:1. 82. The MIC-1 compound according to any one
of the preceding embodiments wherein the MIC-1 polypeptide
comprises a deletion of N3 (des-N3) compared to MIC-1 of SEQ ID
NO:1. 83. The MIC-1 compound according to any one of the preceding
embodiments wherein the MIC-1 polypeptide comprises a M57E or M57L
substitution compared to MIC-1 of SEQ ID NO:1. 84. The MIC-1
compound according to any one of the preceding embodiments wherein
the MIC-1 polypeptide comprises a M86L or M86F substitution
compared to MIC-1 of SEQ ID NO:1. 85. The MIC-1 compound according
to embodiment 84 wherein the MIC-1 polypeptide further comprises a
Q90E or T92E substitution compared to MIC-1 of SEQ ID NO: 1. 86.
The MIC-1 compound according to any one of the preceding
embodiments wherein the MIC-1 polypeptide comprises a H66E
substitution compared to MIC-1 of SEQ ID NO:1. 87. The MIC-1
compound according to any one of the preceding embodiments wherein
the MIC-1 polypeptide comprises a R67E substitution compared to
MIC-1 of SEQ ID NO:1. 88. The MIC-1 compound according to any one
of the preceding embodiments wherein the MIC-1 polypeptide
comprises a deletion of the first 3, 4, 5 or 6 residues compared to
MIC-1 of SEQ ID NO:1. 89. The MIC-1 compound according to any one
of the preceding embodiments wherein the MIC-1 polypeptide
comprises a deletion of the first 3 residues compared to MIC-1 of
SEQ ID NO:1. 90. The MIC-1 compound according to any one of
embodiments 1-75, wherein the MIC-1 polypeptide has a sequence
according to SEQ ID NO:154 (M43L/des-N3). 91. The MIC-1 compound
according to any one of embodiments 1-75, wherein the MIC-1
polypeptide has a sequence according to SEQ ID NO:155
(M43L/.DELTA.1-3). 92. The MIC-1 compound according to any one of
embodiments 1-75, wherein the MIC-1 polypeptide has a sequence
according to SEQ ID NO:156 (M57E/H66E/des-N3). 93. The MIC-1
compound according to any one of embodiments 1-75, wherein the
MIC-1 polypeptide has a sequence according to SEQ ID NO:157
(M57L/.DELTA.1-3). 94. Compound according to any one of embodiments
1-75, wherein the MIC-1 polypeptide has a sequence according to SEQ
ID NO:158 (M57L/des-N3). 95. The MIC-1 compound according to any
one of embodiments 1-75, wherein the MIC-1 polypeptide has a
according to SEQ ID NO:159 (M86L/.DELTA.1-3). 96. The MIC-1
compound according to any one of embodiments 1-75, wherein the
MIC-1 polypeptide has a sequence according to SEQ ID NO:160
(M86L/des-N3) or SEQ ID NO:222 (M57L, M86L/des-N3). 97. The MIC-1
compound according to any one of embodiments 1-75, wherein the
MIC-1 polypeptide has a sequence according to SEQ ID NO:1. 98. The
MIC-1 compound according to any one of preceding embodiments,
wherein the MIC-1 polypeptide and the N-terminal amino acid
extension together comprises an amino acid sequence according to
SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID
NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97,
SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ
ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID
NO: 106, SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO:
110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO:
114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO:
164,
SEPCTSGSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYD
DLLAKDCHCI (SEQ ID NO: 288),
SEPATSCSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 289),
SEPCTSGSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 290),
SEPATCGSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYD
DLLAKDCHCI (SEQ ID NO: 291),
SEPATSGSETPGTSESACPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 292),
SEPATSGSETPGTSESATPESGPGTSTEPCEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 293),
SEPATSGSETPGSEPATSGSETPGGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCI
GACPSQFRAANEHAQIKTSLERLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
(SEQ ID NO: 294),
SEPATSGSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYD
DLLAKDCHCI (SEQ ID NO: 295),
SEPATSGSETPGTSESATPESGPGTSTEPSARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPR
EVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDDLL
AKDCHCI (SEQ ID NO: 296),
SEPATSGSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYD
DLLAKDCHCI (SEQ ID NO: 297),
SEPATSGSETPGTSESATPESGPGTSTEPSARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPR
EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI (SEQ ID NO: 298),
SEPATSGSETPGSEPATSGSETPGTSTEPSARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPR
EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI (SEQ ID NO: 299),
SAPATSGSATPGSAPATSGSATPGGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCI
GACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
(SEQ ID NO: 300),
SEPCTSGSETPGTSESATPESGPGTSTEPSARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPR
EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI (SEQ ID NO: 301),
SEPATCGSETPGTSESATPESGPGTSTEPSARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPR
EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI (SEQ ID NO: 302),
SEPATSGCETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 303),
SEPATSGSECPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 304),
SEPATSGSETPCTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 305),
SEPATSGSETPGTCESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 306),
SEPATSGSETPGTSECATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 307),
SEPATSGSETPGTSESATPECGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 308),
SEPATSGSETPGTSESATPESCPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 309),
SEPATSGSETPGTSESATPESGPGTSCEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWVLS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLKPDTVPAPCCVPASYNPLVLIQKTDTGVSLQTYDD
LLAKDCHCI (SEQ ID NO: 310),
EEAEADDDDKESGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAAN
MHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI (SEQ ID
NO: 311), or
SEPATSGSETPGTSESATPESGPGTSTEPSEGARGDHCPLGPGRCCRLHTVRASLEDLGWADWV-
LS
PREVQVTMCIGACPSQFRAANLHAQIKTSLHRLRPDTVPAPCCVPASYNPLVLIQRTDTGVSLQTYDD
LLARDCHCI (SEQ ID NO: 312). 99. MIC-1 compound according to
embodiment 1 with one of the following Formulae:
##STR00011## ##STR00012## ##STR00013## ##STR00014## ##STR00015##
##STR00016## ##STR00017## ##STR00018## ##STR00019## ##STR00020##
##STR00021## ##STR00022## ##STR00023## ##STR00024## ##STR00025##
##STR00026## ##STR00027## ##STR00028## ##STR00029## ##STR00030##
##STR00031##
100. The MIC-1 compound according to any one of the preceding
embodiments, showing extended plasma half-life compared with MIC-1
of SEQ ID NO:1. 101. The MIC-1 compound according to any one of the
preceding embodiments, showing improved plasma half-life compared
with MIC-1 of SEQ ID NO:1 as measured by administrating the
compound to rat i.v. and estimate the terminal half-life from
changes in plasma concentration of compound over time. 102. The
MIC-1 compound according to any one of the preceding embodiments,
showing maintained potency compared with MIC-1 of SEQ ID NO:1. 103.
The MIC-1 compound according to any one of the preceding
embodiments, showing retained efficacy compared with MIC-1 of SEQ
ID NO:1 as measured by administrating compound to rat s.c. and
measure changes in daily food intake. 104. The MIC-1 compound
according to any one of the preceding embodiments, wherein the
MIC-1 polypeptide with an amino acid extension has acceptable
solubility compared with MIC-1 of SEQ ID NO:1. 105. The MIC-1
compound according to any one of embodiments 1-99, wherein the
MIC-1 polypeptide with an amino acid extension has a solubility of
0.5, 1.0, 5.0, 10, 30 or 50 mg/ml as measured at pH 8.0 in a Tris
buffer system. 106. The MIC-1 compound according to embodiments 1
or 2, wherein the MIC-1 polypeptide comprises a deletion of N3
(des-N3) compared to MIC-1 of SEQ ID NO:1, wherein the amino acid
extension has the following sequence
SEPCTSGSETPGTSESATPESGPGTSTEPSEG (SEQ ID NO: 225), and wherein the
protractor has the following formula:
##STR00032##
and wherein the protractor is attached to the Cysteine of the amino
acid extension 107. Compound according to embodiments 1 or 2,
wherein the MIC-1 polypeptide with an N-terminal amino acid
extension has the sequence according to SEQ ID NO: 288, and the
protractor has the following formula:
##STR00033##
and wherein the protractor is attached to the Cysteine of the amino
acid extension 108. MIC-1 compound according to any one of
embodiments 1-107 or a pharmaceutically acceptable salt, amide or
ester thereof. 109. The MIC-1 compound according to any of the
preceding embodiments, wherein the compound has improved in vivo
efficacy on lowering food intake and/or lowering body weight
compared with MIC-1 of SEQ ID NO:1. 110. MIC-1 compound according
to any one of embodiments 1-109 and 132-152 for use as a
medicament. 111. MIC-1 compound according to any one of embodiments
1-109 and 132-152 for use in the prevention and/or treatment of a
metabolic disorder. 112. MIC-1 compound according to embodiment 111
for use in the prevention and/or treatment of a metabolic disorder,
wherein the metabolic disorder is obesity, type 2 diabetes,
dyslipidemia, or diabetic nephropathy. 113. MIC-1 compound
according to any one of embodiments 1-109 and 132-152 for use in
the prevention and/or treatment of eating disorders, such as
obesity. 114. MIC-1 compound according to embodiment 113 for use in
the prevention and/or treatment of obesity by decreasing food
intake, reducing body weight, suppressing appetite and/or inducing
satiety. 115. MIC-1 compound according to any one of embodiments
1-109 and 132-152 for use in the prevention and/or treatment of a
cardiovascular disease. 116. MIC-1 compound according to embodiment
115 for use in the prevention and/or treatment of dyslipidaemia,
arteriosclerosis, steatohepatitis, or diabetic nephropathy. 117.
Pharmaceutical composition comprising the MIC-1 compound according
to any one of embodiments 1-109 and 132-152 or a pharmaceutically
acceptable salt, amide or ester thereof, and one or more
pharmaceutically acceptable excipients. 118. The use of a MIC-1
compound according to any one of embodiments 1-109 and 132-152 in
the manufacture of a medicament for the prevention and/or treatment
of a metabolic disorder, wherein the metabolic disorder is obesity,
type 2 diabetes, dyslipidemia, or diabetic nephropathy. 119. The
use of a MIC-1 compound according to any one of embodiments 1-109
and 132-152 in the manufacture of a medicament for the prevention
and/or treatment of eating disorders. 120. The use of a MIC-1
compound according to any one of embodiments 1-109 and 132-152 in
the manufacture of a medicament for the prevention and/or treatment
of obesity. 121. The use of a MIC-1 compound according to any one
of embodiments 1-109 and 132-152 in the manufacture of a medicament
for the prevention and/or treatment of obesity by decreasing food
intake, reducing body weight, suppressing appetite and/or inducing
satiety. 122. The use of a MIC-1 compound according to any one of
embodiments 1-109 and 132-152 in the manufacture of a medicament
for the prevention and/or treatment of a cardiovascular disease.
123. The use of a MIC-1 compound according to any one of
embodiments 1-109 and 132-152 in the manufacture of a medicament
for the prevention and/or treatment of dyslipidaemia,
arteriosclerosis, steatohepatitis, or diabetic nephropathy. 124.
Method of treating and/or preventing a metabolic disorder by
administering a pharmaceutically active amount of a MIC-1 compound
according to any one of embodiments 1-109 and 132-152, wherein the
metabolic disorder is obesity, type 2 diabetes, dyslipidemia, or
diabetic nephropathy. 125. Method of treating and/or preventing
eating disorders by administering a pharmaceutically active amount
of a MIC-1 compound according to any one of embodiments 1-109 and
132-152. 126. Method of treating and/or preventing obesity by
administering a pharmaceutically active amount of a MIC-1 compound
according to any one of embodiments 1-109 and 132-152. 127. Method
of treating and/or preventing obesity by decreasing food intake,
reducing body weight, suppressing appetite and/or inducing satiety
by administering a pharmaceutically active amount of a MIC-1
compound according to any one of embodiments 1-109 and 132-152.
128. Method of treating and/or preventing a cardiovascular disease
by administering a pharmaceutically active amount of a MIC-1
compound according to any one of embodiments 1-109 and 132-152.
129. Method of treating and/or preventing dyslipidaemia,
arteriosclerosis, steatohepatitis, or diabetic nephropathy by
administering a pharmaceutically active amount of a MIC-1 compound
according to any one of embodiments 1-109 and 132-152. 130.
Polynucleotide molecule encoding a MIC-1 compound according to any
one of embodiments 1-109 and 132-152. 131. Method of treating
and/or preventing overweight by decreasing food intake, reducing
body weight, suppressing appetite and/or inducing satiety by
administering a pharmaceutically active amount of a MIC-1 compound
according to any one of embodiments 1-109 and 132-152. 132. MIC-1
compound according to Formula 01:
##STR00034##
133. MIC-1 compound according to Formula 02:
##STR00035##
134. MIC-1 compound according to Formula 03:
##STR00036##
135. MIC-1 compound according to Formula 04:
##STR00037##
136. MIC-1 compound according to Formula 05:
##STR00038##
137. MIC-1 compound according to Formula 06:
##STR00039##
138 MIC-1 compound according to Formula 07:
##STR00040##
139. MIC-1 compound according to Formula 08:
##STR00041##
140. MIC-1 compound according to Formula 09:
##STR00042##
141. MIC-1 compound according to Formula 10:
##STR00043##
142. MIC-1 compound according to Formula 11:
##STR00044##
143. MIC-1 compound according to Formula 12:
##STR00045##
144. MIC-1 compound according to Formula 13:
##STR00046##
145. MIC-1 compound according to Formula 14:
##STR00047##
146. MIC-1 compound according to Formula 15:
##STR00048##
147. MIC-1 compound according to Formula 16:
##STR00049##
148. MIC-1 compound according to Formula 17:
##STR00050##
149. MIC-1 compound according to Formula 18:
##STR00051##
150. MIC-1 compound according to Formula 19:
##STR00052##
151. MIC-1 compound according to Formula 20:
##STR00053##
152. MIC-1 compound according to Formula 21:
##STR00054##
EXAMPLES
List of Abbreviations
[0187] "Main peak" refers to the peak in a purification
chromatogram which has the highest UV intensity in milliabsorbance
units and which contains the fusion protein.
[0188] HPLC is High performance liquid chromatography.
[0189] SDS-PAGE is Sodium dodecyl sulfate Polyacrylamide gel
electrophoresis.
[0190] IMAC is immobilized metal affinity chromatography.
[0191] SEC is size exclusion chromatography.
[0192] MS is mass spectrometry.
[0193] In this description, Greek letters may be represented by
their symbol or the corresponding written name, for example:
.alpha.=alpha; .beta.=beta; .epsilon.=epsilon; .gamma.=gamma;
.omega.=omega; .DELTA.=delta; etc. Also, the Greek letter of may be
represented by "u", e.g. in .mu.l=ul, or in .mu.M=uM.
MIC-1 Polypeptides with Improved Solubility
[0194] In an aspect of the invention, MIC-1 polypeptides were
designed to have increased solubility.
[0195] In an aspect of the invention, this was achieved by adding
an N-terminal "acidic" amino acid extension to the MIC-1
polypeptide.
[0196] In an aspect of the invention, solubility was enhanced and
stability was improved by modification of the amino acid sequence
of the MIC-1 polypeptide. For example, modification was done within
the amino acid sequence of the MIC-1 polypeptide (in-sequence
mutation).
[0197] MIC-1 polypeptides with an N-terminal amino acid extension
can be expressed in bacteria such as E. coli. In the context of the
present invention, large scale protein production of the MIC-1
polypeptides with an N-extension could take of using Inclusion
Bodies (IB) as this represent an advantageous approach to
controlling process recovery, protein purity, protease degradation
and general protein stability. This becomes particular important
for large scale protein production. Of critical importance for the
quality of IB is the balance between improved solubility and IB
formation of MIC-1 polypeptides with an N-extension.
N-Extension Design:
[0198] In the design of the N-terminal amino acid_extension, F, I,
L, M, V, W and Y were excluded, since they could contribute to
protein aggregation. H, K, and R were also excluded, since they
could cause undesired binding on cell membrane. A, C, E, G, P, S,
T, D, N, and Q are preferred for the N-extension sequence. E and D
are particularly preferred since they increase the solubility by
decreasing pI value of the compound. C could provide a --SH group
which can be used for protraction purpose, such as fatty acid
conjugation and PEGylation. Particularly, for some N-extensions,
one or two additional Alanine(s), Glycine(s) or Serine(s) were
added at the very N-terminal to increase the initial Methionine
removing efficiency when MIC-1 polypeptides with N-extension were
expressed in E. coli.
[0199] Various N-terminal amino acid_extensions were designed. Some
N-extensions comprise sequences originating from human proteins
(humanized sequences); some comprise artificially designed
sequence(s) (e.g. GS, SG, AEE, AES, GEPQ (SEQ ID NO:123), GEPS (SEQ
ID NO:118)); some comprise several repeats of the humanized
sequences or artificial sequences; some comprise a combination of
the above. Several 6-residue sequences (6-mers) were designed.
N-extensions could comprise one or more of a 6-mers, part of a
6-mers (e.g., 1-5 residues of a 6-mers), or a combination of the
above. The amino acid residues of the artificial sequences
(including 6-mers) and the humanized sequences could be arranged in
any order.
[0200] Some representative 6-mers and combinations of 6-mers are
listed in Table 2, and other examples of N-extension are listed in
Table 3.
TABLE-US-00002 TABLE 2 6-mers and combinations of 6-mers 6-mers:
6-mer-1: SPAGSP (SEQ ID NO: 4) 6-mer-2: TSESAT (SEQ ID NO: 5)
6-mer-3: TSTEPE (SEQ ID NO: 6) 6-mer-4: SEPATS (SEQ ID NO: 7)
6-mer-5: TSTEEG (SEQ ID NO: 8) 6-mer-6: PESGPG (SEQ ID NO: 9)
6-mer-7: SGSAPG (SEQ ID NO: 10) 6-mer-8: GSETPG (SEQ ID NO: 11)
Combinations: SEPATSGSETPGSPAGSPTSTEEG (SEQ ID NO: 12)
SEPATSGSETPGTSESATPESGPG (SEQ ID NO: 13) SEPATSGSETPGTSTEPESGSAPG
(SEQ ID NO: 14) SEPATSGSETPGSPAGSPTSTEEGSPAGSP (SEQ ID NO: 15)
SEPATSGSETPGTSESATPESGPGSPAGSP (SEQ ID NO: 16)
SEPATSGSETPGTSTEPESGSAPGSPAGSP (SEQ ID NO: 17)
SEPATSGSETPGSPAGSPTSTEEGTSESAT (SEQ ID NO: 18)
SEPATSGSETPGTSESATPESGPGTSESAT (SEQ ID NO: 19)
SEPATSGSETPGTSTEPESGSAPGTSESAT (SEQ ID NO: 20)
SEPATSGSETPGSPAGSPTSTEEGTSTEPE (SEQ ID NO: 21)
SEPATSGSETPGTSESATPESGPGTSTEPE (SEQ ID NO: 22)
SEPATSGSETPGTSTEPESGSAPGTSTEPE (SEQ ID NO: 23)
SEPATSGSETPGSPAGSPTSTEEGSEPATS (SEQ ID NO: 24)
SEPATSGSETPGTSESATPESGPGSEPATS (SEQ ID NO: 25)
SEPATSGSETPGTSTEPESGSAPGSEPATS (SEQ ID NO: 26)
SEPATSGSETPGSPAGSPTSTEEGTSTEEG (SEQ ID NO: 27)
SEPATSGSETPGTSESATPESGPGTSTEEG (SEQ ID NO: 28)
SEPATSGSETPGTSTEPESGSAPGTSTEEG (SEQ ID NO: 29)
SEPATSGSETPGSPAGSPTSTEEGPESGPG (SEQ ID NO: 30)
SEPATSGSETPGTSESATPESGPGPESGPG (SEQ ID NO: 31)
SEPATSGSETPGTSTEPESGSAPGPESGPG (SEQ ID NO: 32)
SEPATSGSETPGSPAGSPTSTEEGSGSAPG (SEQ ID NO: 33)
SEPATSGSETPGTSESATPESGPGSGSAPG (SEQ ID NO: 34)
SEPATSGSETPGTSTEPESGSAPGSGSAPG (SEQ ID NO: 35)
SEPATSGSETPGSPAGSPTSTEEGGSETPG (SEQ ID NO: 36)
SEPATSGSETPGTSESATPESGPGGSETPG (SEQ ID NO: 37)
SEPATSGSETPGTSTEPESGSAPGGSETPG (SEQ ID NO: 38)
SEPATSGSETPGSPAGSPTSTEEGTSESATPESGPG (SEQ ID NO: 39)
SEPATSGSETPGSPAGSPTSTEEGSPAGSPTSTEEG (SEQ ID NO: 40)
SEPATSGSETPGSPAGSPTSTEEGTSTEPESGSAPG (SEQ ID NO: 41)
SEPATSGSETPGTSESATPESGPGSPAGSPTSTEEG (SEQ ID NO: 42)
SEPATSGSETPGTSESATPESGPGTSESATPESGPG (SEQ ID NO: 43)
SEPATSGSETPGTSESATPESGPGTSTEPESGSAPG (SEQ ID NO: 44)
SEPATSGSETPGTSESATPESGPGSEPATSGSETPG (SEQ ID NO: 45)
SEPATSGSETPGTSTEPESGSAPGSPAGSPTSTEEG (SEQ ID NO: 46)
SEPATSGSETPGTSTEPESGSAPGTSESATPESGPG (SEQ ID NO: 47)
SEPATSGSETPGTSTEPESGSAPGTSTEPESGSAPG (SEQ ID NO: 48)
SEPATSGSETPGTSTEPESGSAPGSEPATSGSETPG (SEQ ID NO: 49)
SEPATSGSETPGSEPATSGSETPGSPAGSPTSTEEG (SEQ ID NO: 50)
SEPATSGSETPGSEPATSGSETPGTSESATPESGPG (SEQ ID NO: 51)
SEPATSGSETPGSEPATSGSETPGTSTEPESGSAPG (SEQ ID NO: 52)
SEPATSGSETPGSEPATSGSETPGSEPATSGSETPG (SEQ ID NO: 53)
TABLE-US-00003 TABLE 3 Examples of N-extensions Residue SEQ ID NO
number Sequence of N-extension SEQ ID NO: 54 6 AEEAES SEQ ID NO: 55
3 AES SEQ ID NO: 56 9 (AEE).sub.2AES SEQ ID NO: 57 20 (GEPS).sub.5
SEQ ID NO: 58 24 SPAGSPTSTEEGTSESATPESGPG SEQ ID NO: 59 21
(AEE).sub.6AES SEQ ID NO: 60 18 (AEE).sub.5AES SEQ ID NO: 61 12
(AEE).sub.3AES SEQ ID NO: 62 26 AASPAGSPTSTEEGTSESATPESGPG SEQ ID
NO: 63 24 TSESATPESGPGTSESATPESGPG SEQ ID NO: 64 26
AASPAGSPTSTEEGTSESATPESGPG SEQ ID NO: 65 22 AAPEDEETPEQEGSGSGSGSGS
SEQ ID NO: 66 12 AAPEDEETPEQE SEQ ID NO: 67 22
AAPDEGTEEETEGSGSGSGSGS SEQ ID NO: 68 24 SEPATSGSETPGSEPATSGSETPG
SEQ ID NO: 69 25 A(GPEQGQEP).sub.3 SEQ ID NO: 70 30
SEPATSGSETPGTSESATPESGPGTS TEPS SEQ ID NO: 71 32
SEPATSGSETPGTSESATPESGPGTS TEPSEG SEQ ID NO: 72 24 (GEPS).sub.6 SEQ
ID NO: 161 36 (GEPS).sub.9 SEQ ID NO: 162 36 (GPEQ).sub.9 SEQ ID
NO: 163 25 AGPEQGQEPGEPQGQEPQPGEPEGQ
In-Sequence Mutations:
[0201] Certain internal residues of MIC-1 (SEQ ID NO:1) were
modified, e.g. by substitution. For example, to increase the
solubility of MIC-1 compounds, a hydrophobic residue of MIC-1 could
be substituted with a hydrophilic residue, preferably by with an
acidic residue; a positive charged residue could be substituted
with an acidic residue, etc. To decrease oxidation, methionine
could be substituted with other amino acids, e.g. E, F or L.
[0202] In-sequence mutations for increasing solubility include but
are not limited to: P11E, H18E, R21E, A30E, A47E, R53E, A54E, M57E,
H66E, R67E, L68E, K69E, A75E, A81E, P85E, Q90E, T92E, L105E and
K107E.
[0203] In-sequence mutations for decreasing oxidation include but
are not limited to: M43L, M43E, M57E, M57L, M86F and M86L.
[0204] In-sequence mutations for increasing chemical stability
include but are not limited to N3S, N3E, N3A, N3T, N3P, N3G, N3V,
N3H, N3Y and N3Q.
[0205] In-sequence mutations for conjugation include but are not
limited to K69R, K107R and K91R.
[0206] Other in-sequence mutations include but are not limited to a
deletion of N3 (des-N3) and/or a deletion of the first 3
residues.
pI Calculation
[0207] The calculated pI of a MIC-1 polypeptide with an N-terminal
amino acid extension is defined as the pH at which the net
calculated charge of the MIC-1 polypeptide with a N-terminal amino
acid extension is zero. The calculated charge of the MIC-1
polypeptide with the N-terminal amino acid extension as a function
of pH is obtained using the pKa values of the amino acid residues
described in Table 1 and the method described by B. Skoog and A.
Wichman (Trends in Analytical Chemistry, 1986, vol. 5, pp. 82-83).
The side chain pKa of cysteine (Cys) is only included in the charge
calculation for cysteines with a free sulfhydryl group. The
N-extension may contain one cysteine mutation. As an example the
calculated pI value of human wild type MIC-1 is 8.8 as the
homodimer. The calculated pI values of MIC-1 polypeptide are shown
in Table 4.
[0208] Herein, and throughout this document, pI calculations on the
MIC-1 polypeptide with an N-terminal amino acid extension, if not
stated otherwise, are made on homodimers.
TABLE-US-00004 TABLE 4 Calculated pI values MIC-1- .DELTA.1-3 MIC-1
MIC-1- MIC-1- (M57E, (SEQ MIC-1 - .DELTA.1-3 .DELTA.1-3 H66E ID
MIC-1- MIC-1- .DELTA.1-3 (M57E, (M57E, and NO: 1) des-N3 .DELTA.1-3
(M57E) H66E) R67E) R67E) Any 6.1 6.1 5.8 5.5 5.0 5.0 4.7
combinations of four of 6mers 1-8.infin. Any 5.8 5.8 5.5 5.2 4.8
4.8 4.6 combinations of five 6mers 1-8.infin. (GEPQ*).sub.5 or 5.8
5.8 5.5 5.2 4.8 4.8 4.6 (GEPS*).sub.5.infin. (GEPQ*).sub.6.infin.
5.5 5.5 5.2 5.2 4.7 4.7 4.5 Humanized 4.5~ 4.5~ 4.2~ 4.2 ~
sequences in 5.5 5.5 5.3 5.2 4.2~5.1 4.2~5.1 4.2~5.0
examples.infin. *The amino acid residues of "GEPQ" or "GEPS" may be
arranged in any order .infin.One Cys in the N-terminal extension
change pI by less than .+-.0.1.
Materials and Methods
General Methods of Preparation
Example-1: Expression and Fermentation of the MIC-1 Polypeptide or
the MIC-1 Polypeptide with an N-Terminal Extension
[0209] The cDNA of MIC-1 polypeptide or MIC-1 polypeptide with an
N-terminal extension was sub-cloned into a pET11b derived vector.
Overexpression of MIC-1f polypeptide or MIC-1 polypeptide with an
N-terminal extension as inclusion bodies was induced in E. coli by
0.5 mM isopropyl 3-d-thiogalactoside (IPTG) when the cell density
reached an OD600 of 1.0. After continuous growth in TB for 20 h at
37.degree. C., the cells were harvested and samples for both LC/MS
and UPLC were prepared to confirm the molecular weight.
[0210] Fermentation was carried out on fed-batch process in
chemical defined medium as supplement. Fermentation yield largely
depended on different polypeptide, which varied from 1 g/L to 8 g/L
from polypeptide to polypeptide.
Example-2: Purification and Refolding
[0211] The MIC-1 polypeptide or MIC-1 polypeptide with an
N-terminal extension were further purified as follows:
[0212] Slurry (20% w/v) of E. coli in 10 mM Tris buffer pH 8.0 was
sonicated (3 seconds on/off intervals on ice for 5 minutes) and the
MIC-1 polypeptide or MIC-1 polypeptide with an N-terminal extension
was pelleted by centrifugation (10,000.times.g, for 30 minutes).
The inclusion bodies were re-solubilised by 8 M urea in 20 mM Tris
pH 8.0, and debris removed by centrifugation (10,000.times.g, for
30 minutes). The MIC-1 polypeptide or MIC-1 polypeptide with an
N-terminal extension in the resulting supernatant was collected and
diluted into the refolding buffer (50 mM Tris, pH 8.5 and 10% DMF
or 10% DMSO) to the final concentration of 0.1 mg/ml. The refolding
process lasted for 48 hours in the cold room. The resulting
solution was filtered by 0.4 .mu.m filter and loaded onto
Hydrophobic Interaction column or anion exchange chromatography (50
mM Tris pH 8.0, 0-500 mM NaCl) using Q Sepharose Fast Flow resin
(GE Healthcare), as generally described in Protein Purification.
Principles and Practice Series: Springer Advanced Texts in
Chemistry Scopes, Robert K. 3rd ed., 1994 (Chapters 6 and 8). In
some instances, further purification was done by size exclusion
chromatography using a HiLoad 26/60 Superdex pg 75 column (GE
Healthcare) operated with 50 mM Tris pH 8.0 and 200 mM NaCl. For
storage, the MIC-1 polypeptide or MIC-1 polypeptide with an
N-terminal extension was transferred to DPBS, and stored frozen.
MIC-1 polypeptides or MIC-1 polypeptides with an N-terminal
extension and their maximal solubility at pH8 in Tris buffer are
shown in Table 5.
TABLE-US-00005 TABLE 5 MIC-1 polypeptides or MIC-1 polypeptides
with an N-terminal extension and their maximal solubility at pH8 in
Tris buffer tested according to Example 4 Max. Calculated
solubility SEQ ID NO Structure pI (mg/ml) SEQ ID NO: 1 MIC-1 (SEQ
ID NO: 1) 8.8 0.3 SEQ ID NO: 73 MIC-1(R2A, N3E) 6.8 0.9 SEQ ID NO:
74 MIC-1(R2A, N3E, A54E) 6.4 1.0 SEQ ID NO: 75 MIC-1(R2A, N3E,
A81E) 6.4 N.D.* SEQ ID NO: 76 MIC-1(R2A, N3E, H18E) 6.2 1.7 SEQ ID
NO: 77 MIC-1(R2A, N3E, K69E) 6.1 2.2 SEQ ID NO: 78 MIC-1(R2A, N3E,
K107E) 6.1 1.9 SEQ ID NO: 79 MIC-1(R2A, N3E, L68E) 6.4 3.9 SEQ ID
NO: 80 MIC-1(R2A, N3E, A47E) 6.4 1.0 SEQ ID NO: 81 MIC-1(R2A, N3E,
L105E) 6.4 N.D. SEQ ID NO: 82 MIC-1(R2A, N3E, M57E) 6.4 1.7 SEQ ID
NO: 83 MIC-1(R2A, N3E, P85E) 6.4 N.D. SEQ ID NO: 84 MIC-1(R2A, N3E,
P11E) 6.4 1.6 SEQ ID NO: 85 MIC-1(R2A, N3E, R21E) 6.1 1.8 SEQ ID
NO: 86 MIC-1(R2A, N3E, R53E) 6.1 1.9 SEQ ID NO: 87 MIC-1(R2A, N3E,
R67E) 6.1 1.8 SEQ ID NO: 88 MIC-1(R2A, N3E, A30E) 6.4 1.5 SEQ ID
NO: 89 AEEAES-MIC-1-.DELTA.1-3 6.1 N.D. SEQ ID NO: 90
AES-MIC-1-.DELTA.1-3 6.8 0.9 SEQ ID NO: 91
(AEE).sub.2AES-MIC-1-.DELTA.1-3 5.5 N.D. SEQ ID NO: 92
(GEPS).sub.5-MIC-1(SEQ ID NO: 1) 5.8 35.1 SEQ ID NO: 93
SPAGSPTSTEEGTSESATPESGPG- 6.1 44.5 MIC-1(SEQ ID NO: 1) SEQ ID NO:
94 (AEE).sub.6AES-MIC-1(SEQ ID NO: 1) 4.5 39.0 SEQ ID NO: 95
(AEE).sub.5AES-MIC-1-.DELTA.1-3 4.6 35.0 SEQ ID NO: 96
(AEE).sub.3AES-MIC-1-.DELTA.1-3 5.0 36.0 SEQ ID NO: 97
AASPAGSPTSTEEGTSESATPESG 6.1 N.D. PG-MIC-1(SEQ ID NO: 1) SEQ ID NO:
98 TSESATPESGPGTSESATPESGPG- 5.5 N.D. MIC-1(R2A, N3E) SEQ ID NO: 99
AASPAGSPTSTEEGTSESATPESG 5.8 N.D. PG-MIC-1-.DELTA.1-3 SEQ ID NO:
100 AAPEDEETPEQEGSGSGSGSGS- 5.2 35.7 MIC-1-.DELTA.1-3 SEQ ID NO:
101 AAPEDEETPEQE-MIC-1-.DELTA.1-3 5.2 N.D. SEQ ID NO: 102
AAPDEGTEEETEGSGSGSGSGS- 5.2 N.D. MIC-1-.DELTA.1-3 SEQ ID NO: 103
SEPATSGSETPGTSTEPSEGSAPG- 5.8 N.D. MIC-1-.DELTA.1-3 SEQ ID NO: 104
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 5.8 35.4 SEQ ID NO: 105
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1- 5.5 37.1 3(M57E) SEQ ID NO:
106 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1- 5.8 32.5 3(M57L) SEQ ID
NO: 107 A(GPEQGQEP).sub.3-MIC-1-.DELTA.1-3 5.2 32.2 SEQ ID NO: 108
SEPATSGSETPGTSESATPESGPG 5.5 40.0 TSTEPS-MIC-1-.DELTA.1-3 SEQ ID
NO: 109 SEPATSGSETPG TSESATPESGPG 5.2 40.0
TSTEPSEG-MIC-1-.DELTA.1-3 SEQ ID NO: 110
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1- 5.8 N.D. 3(M86L) SEQ ID NO:
111 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1- 5.8 31.1 3(M57L, M86L) SEQ
ID NO: 112 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1- 5.0 N.D. 3(M57E,
H66E) SEQ ID NO: 113 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1- 5.0 N.D.
3(M57E, R67E) SEQ ID NO: 114 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-
5.0 N.D. 3(M57E, R67E, M86L) SEQ ID NO: 115 SEPATSGSETPG 5.5 N.D.
TSESATPESGPGTSTEPSG-MIC- 1-.DELTA.1-3(M57L, M86L) SEQ ID NO: 116
(GEPS).sub.6-MIC-1-.DELTA.1-3 5.2 N.D. SEQ ID NO: 117
(SEPATSGSETPG).sub.2-MIC-1-des- 6.1 N.D. N3 *N.D.: Not
determined
Example-3: pH-Dependent Solubility of MIC-1 Polypeptide with an
N-Terminal Extension
[0213] The purpose of this experiment was to screen for a MIC-1
polypeptide with an N-extension with improved solubility, and
determine the optimal pH window for formulation.
[0214] MIC-1 polypeptides with N-terminal extensions were dissolved
in a mixture of water and ethanol (60% water and 40% ethanol) with
a concentration range between 3 mg/ml to 10 mg/ml. The solvent was
evaporated with SpeedVac (Concentrator Plus, Eppendorf) for 6 hours
to obtain pellet of the MIC-1 polypeptide with N-terminal
extension.
[0215] Below buffers were used for this pH-dependent solubility
curve assay: acetate buffer (pH 3 to pH 6); Tris buffer (pH 7 to pH
9); CAPS buffer (pH 10 to pH 11).
[0216] Buffers were added into each well of the 96-well plate
together with the MIC-1 polypeptides with N-terminal extensions.
The amount used may not be exactly the same but all targeting a
theoretical concentration within 12-18 mg/ml. The concentration of
MIC-1 polypeptide with N-terminal extension in the supernatant was
determined by UPLC (Table 6). Based on the results, solubility of
the MIC-1 polypeptide with N-terminal extension of the invention
was significantly improved between pH 6-9 compared with wtMIC-1.
The optimal pH window of the MIC-1 polypeptides with an N-extension
falls into the pH range that is preferred for formulation, e.g. pH
6.5-8.5.
TABLE-US-00006 TABLE 6 pH-dependent solubility test of MIC-1
polypeptides with an N-terminal extension (mg/ml) SEQ ID pH NO
Structure 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 SEQ ID MIC-1 (SEQ
12.8 2.0 0.2 0.3 0.2 0.3 0.6 3.6 13.9 NO: 1 ID NO: 1) SEQ ID MIC-
13.3 1.3 0.4 0.6 0.5 1.0 1.5 3.6 15.5 NO: 74 1(R2A, N3E, A54E) SEQ
ID MIC- 14.5 3.4 0.4 0.4 0.9 1.7 3.0 14.3 13.6 NO: 76 1(R2A, N3E,
H18E) SEQ ID MIC- 13.6 1.4 1.4 1.7 3.2 3.9 3.9 4.0 12.1 NO: 79
1(R2A, N3E, L68E) SEQ ID MIC- 13.4 2.5 0.5 0.6 0.9 1.0 1.0 2.9 10.8
NO: 80 1(R2A, N3E, A47E) SEQ ID MIC- 14.9 1.6 0.5 0.5 1.4 1.8 1.7
2.5 12.9 NO: 85 1(R2A, N3E, R21E) SEQ ID MIC- 13.9 1.7 0.8 0.8 1.4
1.5 2.1 2.4 13.7 NO: 88 1(R2A, N3E, A30E) SEQ ID AES-MIC-1- 12.5
2.3 0.6 0.7 1.2 0.9 1.0 3.6 8.9 NO: 90 .DELTA.1-3 SEQ ID SPAGSPTST
12.9 1.5 1.2 1.4 5.1 12.8 13.0 13.0 13.5 NO: 93 EEGTSESAT PESGPG-
MIC-1(SEQ ID NO: 1) SEQ ID (AEE).sub.6AES- 7.3 0.2 2.9 9.5 11.6
15.3 15.1 15.0 14.8 NO: 94 MIC-1-.DELTA.1-3 SEQ ID (AEE).sub.5AES-
11.9 0.3 1.6 5.7 9.4 15.8 15.7 14.9 15.0 NO: 95 MIC-1-.DELTA.1-3
SEQ ID AAPEDEETP 11.2 3.2 2.1 5.1 8.3 15.0 15.3 15.0 15.6 NO: 100
EQEGSGSG SGSGS- MIC-1-.DELTA.1-3 SEQ ID (SEPATSGS 12.2 0.7 0.3 1.0
4.6 16.4 16.9 16.0 16.2 NO: 104 ETPG).sub.2- MIC-1-.DELTA.1-3 SEQ
ID (SEPATSGS 7.2 1.2 0.8 3.8 11.5 15.6 15.2 14.9 16.2 NO: 105
ETPG).sub.2- MIC-1-.DELTA.1- 3(M57E) SEQ ID (SEPATSGS 10.1 0.2 0.3
1.6 4.3 15.6 16.1 16.1 16.8 NO: 106 ETPG).sub.2- MIC-1-.DELTA.1-
3(M57L)
Example 4: Maximal Solubility of MIC-1 Polypeptides with an
N-Terminal Extension at pH 8
[0217] In order to test the maximal solubility, the MIC-1
polypeptides with an N-terminal extension were dissolved in a
mixture of water and ethanol (60% water and 40% ethanol) with a
concentration range between 3 mg/ml to 10 mg/ml. Then the solution
(150 .mu.L each well) was aliquot into a 96-well plate (Corning).
The solvent was evaporated with SpeedVac (Concentrator Plus,
Eppendorf) for 6 hours to obtain pellet of the MIC-1 polypeptide
with an N-terminal extension. Tris buffer (pH 8.0, without
excipients) was added into each well of the 96-well plate. The
amount of buffer added to the well was less than the amount needed
for solving the whole pellet in the well, so that maximal
concentration was achieved. The plate was shaken on a plate shaker
at 800 rpm (MixMate, Eppendorf) for 2 hours. The pellet was spun
down at 3600 g for 5 min. The supernatants were transferred to a
96-deep-well plate and diluted 20 times with 40% ethanol. Then all
of the samples were subject to UPLC (Acquity, Waters), plate reader
(Infinite M200 pro, Tecan) and UV spectrometer (NanoDrop 8000,
Thermo Scientific) to determine the concentration (Table 7)
[0218] Based on the results, solubility of the MIC-1 polypeptides
with an N-terminal extension of the invention was significantly
improved at pH 8.0. Especially, the MIC-1 polypeptides with an
N-terminal extension achieved solubility of more than 30 mg/ml at
pH 8.0.
TABLE-US-00007 TABLE 7 Max solubility test of MIC-1 polypeptides
with an N-terminal extension at pH 8.0 Solubility SEQ IN NO
Structure (mg/ml) SEQ ID NO: 96 (AEE).sub.3AES-MIC-1-.DELTA.1-3
36.0 SEQ ID NO: 95 (AEE).sub.5AES-MIC-1-.DELTA.1-3 35.0 SEQ ID NO:
94 (AEE).sub.6AES-MIC-1(SEQ ID NO: 1) 39.0 SEQ ID NO: 93
SPAGSPTSTEEGTSESATPESGPG-MIC-1 44.5 SEQ ID NO: 92
(GEPS).sub.5-MIC-1(SEQ ID NO: 1) 35.1 SEQ ID NO: 100
AAPEDEETPEQEGSGSGSGSGS-MIC-1-.DELTA.1-3 35.7 SEQ ID NO: 79
MIC-1(R2A, N3E, L68E) 3.9 SEQ ID NO: 85 MIC-1(R2A, N3E, R21E) 1.8
SEQ ID NO: 88 MIC-1(R2A, N3E, A30E) 1.5 SEQ ID NO: 74 MIC-1(R2A,
N3E, A54E) 1.0 SEQ ID NO: 76 MIC-1(R2A, N3E, H18E) 1.7 SEQ ID NO:
77 MIC-1(R2A, N3E, K69E) 2.2 SEQ ID NO: 80 MIC-1(R2A, N3E, A47E)
1.0 SEQ ID NO: 90 AES-MIC-1-.DELTA.1-3 0.9 SEQ ID NO: 78 MIC-1(R2A,
N3E, K107E) 1.9 SEQ ID NO: 82 MIC-1(R2A, N3E, M57E) 1.7 SEQ ID NO:
84 MIC-1(R2A, N3E, P11E) 1.6 SEQ ID NO: 86 MIC-1(R2A, N3E, R53E)
1.9 SEQ ID NO: 87 MIC-1(R2A, N3E, R67E) 1.8 SEQ ID NO: 104
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 35.4 SEQ ID NO: 105
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57E) 37.1 SEQ ID NO: 106
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57L) 32.5 SEQ ID NO: 107
A(GPEQGQEP).sub.3-MIC-1-.DELTA.1-3 32.2 SEQ ID NO: 108
SEPATSGSETPGTSESATPESGPGTSTEPS-MIC-1- 40.0 .DELTA.1-3 SEQ ID NO:
109 SEPATSGSETPGTSESATPESGPG TSTEPSEG-MIC- 40.0 1-.DELTA.1-3 SEQ ID
NO: 111 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57L, M86L) 31.1 SEQ
ID NO: 73 MIC-1(R2A, N3E) 0.9 SEQ ID NO: 164
SEPATSGSETPGTSESATPESGPGTSTEPSEG-MIC- 40.0 1-des-N3 (M57L, M86L)
SEQ ID NO: 1 MIC-1(SEQ ID NO: 1) 0.3
[0219] The improved solubility of MIC-1 polypeptides with an
N-extension was retained in the MIC-1 compounds, i.e. adding a
protractor did not significantly lower the solubility (Example
12).
General Methods of In Vitro Activity Screening
Example 5: Establishment of BHK21-hGFRAL-IRES-hRET Cell Line
[0220] The purpose of this example was to establish a cell based in
vitro assay for testing MIC-1 activity. Mammalian cells were
transfected and stably expressed full length MIC-1 receptor
(hGFRAL) and its full signaling co-receptor hRET51.
[0221] Plasmids expressing full length hGFRAL and full length
hRET51 were constructed by inserting synthesized DNA nucleotides
encoding full length hGFRAL and full length hRET51 into mammalian
expression vector pEL. IRES (internal ribosome entry site) is a
commonly used linker between two DNA sequences, so that the two DNA
sequences can be simultaneously translated into mRNA. pEL vector
backbone was provided by Taihegene CRO company.
[0222] Two millions of BHK21 cells were seeded in a 10 cm petri
dish and cultured for overnight in culture medium (DMEM+10% FBS+1%
PS). Cells were transfected with pEL-hGFRAL-IRES-hRET plasmids.
Transfected cells were split into new 10 cm dishes at different
densities and grew in selection medium (DMEM+10% FBS+1% PS+1 mg/ml
G418) for more than 2 weeks to get single clones. The single clones
were transferred to 6 well plates and cultured to 100% confluence.
mRNA expression of hGFRAL and hRET was measured by qPCR.
Successfully transfected clones were picked up and tested for MIC-1
binding.
Example 6: MIC-1 Cell-Based In Vitro Activity Assay
[0223] wtMIC-1 and MIC-1 polypeptides with an N-terminal extension
induced both phosphorylation of ERK1/2 in BHK21-hGFRAL-IRES-hRET
stable cells (Table 8). It can be concluded from the results that
the ternary complex of MIC-1, GFRAL and RET phosphorylates RET
protein tyrosine kinase to induce in vivo activities of MIC-1
through signal pathways comprising ERK/MAPK pathway by
phosphorylation of ERK1/2.
[0224] Results from screening MIC-1 polypeptides with an N-terminal
extension using BHK21-hGFRAL-IRES-hRET is shown in Table 8. MIC-1
polypeptides with N-extensions only or MIC-1 analogues with
in-sequence mutations only achieved in vitro activity equal to or
even higher than wtMIC-1. Also, combination of N-extension and
in-sequence mutations can also achieve similar activity.
TABLE-US-00008 TABLE 8 In vitro activity pERK EC50 Emax SEQ IN NO
Structure (nM) (%) SEQ ID NO: 1 MIC-1(SEQ ID NO: 1) 0.3 100% SEQ ID
NO: 73 MIC-1(R2A, N3E) 0.3 100% SEQ ID NO: 74 MIC-1(R2A, N3E, A54E)
0.3 100% SEQ ID NO: 75 MIC-1(R2A, N3E, A81E) 0.3 100% SEQ ID NO: 76
MIC-1(R2A, N3E, H18E) 0.5 100% SEQ ID NO: 77 MIC-1(R2A, N3E, K69E)
0.5 100% SEQ ID NO: 78 MIC-1(R2A, N3E, K107E) 0.3 100% SEQ ID NO:
79 MIC-1(R2A, N3E, L68E) 0.8 100% SEQ ID NO: 80 MIC-1(R2A, N3E,
A47E) 0.4 100% SEQ ID NO: 81 MIC-1(R2A, N3E, L105E) 0.7 100% SEQ ID
NO: 82 MIC-1(R2A, N3E, M57E) 0.3 70% SEQ ID NO: 83 MIC-1(R2A, N3E,
P85E) 0.6 100% SEQ ID NO: 84 MIC-1(R2A, N3E, P11E) 0.4 100% SEQ ID
NO: 85 MIC-1(R2A, N3E, R21E) 0.6 100% SEQ ID NO: 86 MIC-1(R2A, N3E,
R53E) 0.4 100% SEQ ID NO: 87 MIC-1(R2A, N3E, R67E) 0.5 100% SEQ ID
NO: 88 MIC-1(R2A, N3E, A30E) 0.7 100% SEQ ID NO: 89
AEEAES-MIC-1-.DELTA.1-3 0.3 100% SEQ ID NO: 90 AES-MIC-1-.DELTA.1-3
0.3 100% SEQ ID NO: 91 (AEE).sub.2AES-MIC-1-.DELTA.1-3 0.4 100% SEQ
ID NO: 92 (GEPS).sub.5-MIC-1(SEQ ID NO: 1) 0.5 100% SEQ ID NO: 93
SPAGSPTSTEEGTSESATPESGPG-MIC- 0.4 100% 1(SEQ ID NO: 1) SEQ ID NO:
94 (AEE).sub.6AES-MIC-1 0.8 100% SEQ ID NO: 95
(AEE).sub.5AES-MIC-1-.DELTA.1-3 0.5 100% SEQ ID NO: 96
(AEE).sub.3AES-MIC-1-.DELTA.1-3 0.5 100% SEQ ID NO: 97
AASPAGSPTSTEEGTSESATPESGPG-MIC- 0.4 100% 1(SEQ ID NO: 1) SEQ ID NO:
98 TSESATPESGPGTSESATPESGPG-MIC- 0.3 100% 1(R2A, N3E) SEQ ID NO: 99
AASPAGSPTSTEEGTSESATPESGPG-MIC-1- 0.7 100% .DELTA.1-3 SEQ ID NO:
100 AAPEDEETPEQEGSGSGSGSGS-MIC-1-.DELTA.1-3 0.5 100% SEQ ID NO: 101
AAPEDEETPEQE-MIC-1-.DELTA.1-3 0.5 100% SEQ ID NO: 102
AAPDEGTEEETEGSGSGSGSGS-MIC-1-.DELTA.1-3 0.5 100% SEQ ID NO: 103
SEPATSGSETPGTSTEPESGSAPG-MIC-1- 0.7 100% .DELTA.1-3 SEQ ID NO: 104
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 0.4 100% SEQ ID NO: 105
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57E) 0.6 60% SEQ ID NO: 106
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57L) 0.6 100% SEQ ID NO: 107
A(GPEQGQEP).sub.3-MIC-1-.DELTA.1-3 0.8 100% SEQ ID NO: 108
SEPATSGSETPGTSESATPESGPGTSTEPS- 0.4 100% MIC-1-.DELTA.1-3 SEQ ID
NO: 109 SEPATSGSETPGTSESATPESGPG 0.4 100% TSTEPSEG-MIC-1-.DELTA.1-3
SEQ ID NO: 110 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M86L) 0.4 100%
SEQ ID NO: 111 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57L, 0.4 100%
M86L)
In Vivo Efficacy
Example 7: Effect of MIC-1 Polypeptides with an N-Terminal
Extension on Food Intake in Lean Sprague Dawley Rats
[0225] The in vivo efficacy of MIC-1 polypeptides with an
N-terminal extension was measured in 9-11 weeks old lean male
Sprague Dawley rats. Animals were injected once daily with a dose
of 8 nmol/kg body weight 1-2 hrs before the onset of the dark
period. Compounds were administrate subcutaneously (1-4 ml/kg) in
appropriate buffered solution. Changes in food intake were measured
by automatic food monitoring systems (BioDAQ system and HM2 system
for rat). In the BioDAQ system animals were single housed; and in
the HM2 system animals were in group housed with up to 3 animals
per cage. Each compound was tested in n=4-8 animals. Animals were
acclimatized for at least 7 days prior to the experiment. Collected
data are expressed as daily food intake (24 hour food intake)
measured from the onset of each daily 12 hour dark phase to the
next day dark phase. Daily changes in food intake in response to
administrated compound were calculated by subtracting the average
daily food intake of the vehicle group from the average daily food
intake of the treatment group. Changes were considered significant
if p<0.1 using a two-tailed student's t-test. Results are
expressed as the "maximum reduction" in food intake compared with
vehicle (percentage) recorded during the study period. Data are
also expressed as the "accumulated reduction" in food intake which
as the sum of significant (p<0.1) daily reductions in food
intake (percentage) during the study period.
TABLE-US-00009 TABLE 9 Effect of daily doses (8 nmol/kg) of MIC-1
polypeptides with an N-extension on food intake in lean SD rats.
Maximum Efficacy Accumulated SEQ ID NO Structure (%) Efficacy (%)
SEQ ID NO: 1 MIC-1(SEQ ID NO: 1) 68 361 SEQ ID NO: 77 MIC-1(R2A,
N3E, K69E) 46 247 SEQ ID NO: 82 MIC-1(R2A, N3E, M57E) 72 395 SEQ ID
NO: 92 (GEPS).sub.5-MIC-1(SEQ ID NO: 1) 84 469 SEQ ID NO: 97
AASPAGSPTSTEEGTSESATPESGPG- 90 456 MIC-1(SEQ ID NO: 1) SEQ ID NO:
98 TSESATPESGPGTSESATPESGPG-MIC- 90 503 1(R2A, N3E) SEQ ID NO: 100
AAPEDEETPEQEGSGSGSGSGS-MIC-1- 84 446 .DELTA.1-3 SEQ ID NO: 101
AAPEDEETPEQE-MIC-1-.DELTA.1-3 75 408 SEQ ID NO: 102
AAPDEGTEEETEGSGSGSGSGS-MIC-1- 82 423 .DELTA.1-3 SEQ ID NO: 103
SEPATSGSETPGTSTEPESGSAPG-MIC-1- 82 452 .DELTA.1-3 SEQ ID NO: 104
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 93 509 SEQ ID NO: 105
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57E) 97 532 SEQ ID NO: 106
(SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3(M57L) 99 532 SEQ ID NO: 107
A(GPEQGQEP).sub.3-MIC-1-.DELTA.1-3 81 395 SEQ ID NO: 108
SEPATSGSETPGTSESATPESGPGTSTEPS- 80 448 MIC-1-.DELTA.1-3 SEQ ID NO:
165 A(GPEQGQEPGEPQGQEPQPGEPEGQ)- 78 382 MIC-1-.DELTA.1-3 SEQ ID NO:
109 SEPATSGSETPGTSESATPESGPGTSTEPS 82 445 EG-MIC-1-.DELTA.1-3 SEQ
ID NO: 110 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 (M86L) 70 398 SEQ
ID NO: 111 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 85 462 (M57L/M86L)
SEQ ID NO: 112 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 80 369
(M57E/H66E) SEQ ID NO: 113 (SEPATSGSETPG).sub.2-MIC-1-.DELTA.1-3 67
266 (M57E/R67E) Note: * means the dose of administration is 4
nmol/kg body weight.
[0226] The inventors surprisingly found that these MIC-1
polypeptides with an N-extension not only increased the solubility
molecules but also resulted in efficacy equal to or even better
than wtMIC-1 (Table 9). For instance compounds according to SEQ ID
NO:105 and SEQ ID NO:106 had a maximum and accumulated in vivo
efficacy which was 40-50% greater than wtMIC-1 with subcutaneous
dosing. The increase in efficacy was furthermore associated with an
increase in solubility as compounds according to SEQ ID NO:92, SEQ
ID NO:104, SEQ ID NO:105 and SEQ ID NO:106 all had elevated
solubility and a significant greater in vivo efficacy compared with
wtMIC-1. This correlation seems not to be explained by changes in
the in vitro Emax as all compounds in table 8, except compound
according to SEQ ID NO:105, had an Emax comparable with wtMIC-1. In
fact, compound SEQ ID NO:105 had a lower Emax than wtMIC-1 and was
still more efficacious than wtMIC-1 in vivo. Also, the in vitro
potencies were comparable between compounds as none of the
compounds had an EC50 which differed from wtMIC-1. Thus, the
association between increased in vivo efficacies and increased
solubility is surprising and cannot be simply be explained by
changes in increased receptor activation in vitro.
Example 8: MIC-1 Expression and Initial Met Removal Efficiency of
Different 12-Mer Blocks
[0227] In the human body, N-Formyl-Methionine is recognized by the
immune system as foreign material, or as an alarm signal released
by damaged cells, and stimulates the body to fight against
potential infection (Pathologic Basis of Veterinary Disease5:
Pathologic Basis of Veterinary Disease, By James F. Zachary, M.
Donald McGavin). In addition, Methionine is an instable residue
that could be easily oxidized. Therefore, the N-Met cleavage
efficiency is very important to MIC-1 expression.
[0228] There are 4 different types of 12mers, and all of them are
comprised of 3 Ser, 2 Pro, 2 Gly, 2 Thr, 2 Glu and 1 Ala. However,
the 12 residues in each repeat are arranged in different ways.
[0229] Little is known about the effects of different 12mers on the
expression level and the N-Met cleavage efficiency. Thus,
systematically investigation of MIC-1 polypeptides initiating with
single and double 12mers respectively is quite necessary.
[0230] The cDNA of MIC-1 polypeptide with N-terminal extension was
sub-cloned into a pET11b derived vector. Overexpression of MIC-1
polypeptides with an N-terminal extension as inclusion bodies or
soluble protein was induced in E. coli by 0.5 mM isopropyl
.beta.-d-thiogalactoside (IPTG) when the cell density reached an
OD600 of 1.0. After continuous growth in TB for 20 h at 37.degree.
C., the cells were harvested and sonicated in buffer A (20 mM Tris,
pH 8.0). The resulting mixture was centrifugated at 10,000 g for 20
min and analysed by LC/MS and SDS-PAGE to confirm the molecular
weight.
[0231] Fermentation was carried out on fed-batch process in
chemical defined medium as supplement. Fermentation yield largely
depended on different compounds, which varied from 1 g/L to 8 g/L
from compound to compound.
[0232] Compounds designed for the single-12mer test and the result
are shown in Table 10 and FIG. 1.
TABLE-US-00010 TABLE 10 Initial Met removal efficiency of single
12-mer building blocks N-Met cleavage N- MIC-1 efficiency extension
N-aa sequence polypeptide (%) 12mer-1 SPAGSPTSTEEG MIC-1 .DELTA.1-3
N/A (SEQ ID NO: 166) 12mer-2 TSESATPESGPG 0 (SEQ ID NO: 167)
12mer-3 TSTEPSEGSAPG 0 (SEQ ID NO: 168) 12mer-4 SEPATSGSETPG 100
(SEQ ID NO: 169) N/A: means MIC-1 with the N-terminal extension did
not express in E. coli.
Compounds bearing double 12mers are listed in Table 11, and the
results are shown as well (see Table 11 and FIG. 2).
TABLE-US-00011 TABLE 11 Initial Met removal efficiency of double
12-mers building blocks N-Met cleavage SEQ ID N- MIC-1 efficiency
NO extension N-aa sequence polypeptide (%) N/A 12mer- SPAGSPTSTEEG-
MIC-1 N/A (1 + 1) SPAGSPTSTEEG .DELTA.1-3 (SEQ ID NO: 170) N/A
12mer- SPAGSPTSTEEG- N/A (1 + 3) TSTEPSEGSAPG (SEQ ID NO: 171) N/A
12mer- SPAGSPTSTEEG- N/A (1 + 4) SEPATSGSETPG (SEQ ID NO: 172) N/A
12mer- TSESATPESGPG- 58.1 (2 + 1) SPAGSPTSTEEG (SEQ ID NO: 173) N/A
12mer- TSESATPESGPG- 30.0 (2 + 2) TSESATPESGPG (SEQ ID NO: 174) N/A
12mer- TSESATPESGPG- 58.5 (2 + 3) TSTEPSEGSAPG (SEQ ID NO: 175) N/A
12mer- TSESATPESGPG- 64.5 (2 + 4) SEPATSGSETPG (SEQ ID NO: 176) N/A
12mer- TSTEPSEGSAPG- 10.0 (3 + 1) SPAGSPTSTEEG (SEQ ID NO: 177) N/A
12mer- TSTEPSEGSAPG- 1.0 (3 + 2) TSESATPESGPG (SEQ ID NO: 178) N/A
12mer- TSTEPESGSAPG- 26.4 (3 + 3) TSTEPESGSAPG (SEQ ID NO: 179) N/A
12mer- TSTEPSEGSAPG- 10.5 (3 + 4) SEPATSGSETPG (SEQ ID NO: 180) N/A
12mer- SEPATSGSETPG- N/A (4 + 1) SPAGSPTSTEEG (SEQ ID NO: 12) SEQ
ID 12mer- SEPATSGSETPG- 100 NO: 182 (4 + 2) TSESATPESGPG (SEQ ID
NO: 13) SEQ ID 12mer- SEPATSGSETPG- 100 NO: 103 (4 + 3)
TSTEPSEGSAPG (SEQ ID NO: 14) SEQ ID 12mer- SEPATSGSETPG- 100 NO:
104 (4 + 4) SEPATSGSETPG (SEQ ID NO: 181) N/A: means MIC-1
polypeptide with N-terminal extension did not express in E.
coli.
[0233] In conclusion, N-extensions starting with the 12mer-1 block
could not be expressed in E. coli. For the other 12mer blocks,
protein expression was achieved but only 12mer-4 as the initial
sequence resulted in complete methionine cleavage. In addition, the
N-met cleavage efficiency of 12mer-2 series is better than that of
12mer-3 series.
Example 9: Expression Level and Inclusion Body Ratio of MIC-1
Polypeptide with 2* or 2.5*12Mer N-Extension
[0234] (1) Expression of MIC-1 Polypeptide with 2.5*12Mer
N-Extension
[0235] See Example 8 for protein production method. The results are
shown in Table 12, FIG. 3 and FIG. 4.
TABLE-US-00012 TABLE 12 Constructs and protein production for
2.5*12mer test UPLC UPLC SEQ ID N- N-aa MIC-1 Shaker Flask
Fermenter NO extension sequence polypeptide (g/L/10OD) (g/L/10OD)
SEQ ID 12mer- SEPATSGSETPG MIC-1 N.D. NO: 200 (4 + 2 + 1.6
TSESATPESGPG .DELTA.1-3 latter) TSTEEG (SEQ ID NO: 28) SEQ ID
12mer- SEPATSGSETPG 0.197 NO: 201 (4 + 2 + 2.6) TSESATPESGPG TSESAT
(SEQ ID NO: 19) SEQ ID 12mer- SEPATSGSETPG 0.206 NO: 202 (4 + 2 +
2.6 TSESATPESGPG inter) ESATPE (SEQ ID NO: 183) SEQ ID 12mer-
SEPATSGSETPG 0.367 0.374 NO: 108 (4 + 2 + 3.6) TSESATPESGPG TSTEPS
(SEQ ID NO: 70) SEQ ID 12mer- SEPATSGSETPG 0.243 NO: 203 (4 + 2 +
3.6 TSESATPESGPG inter) STEPSE (SEQ ID NO: 184) SEQ ID 12mer-
SEPATSGSETPG 0.273 0.162 NO: 109 (4 + 2 + 3.8) TSESATPESGPG
TSTEPSEG (SEQ ID NO: 71) SEQ ID 12mer- SEPATSGSETPG 0.373 NO: 204
(4 + 2 + 4.6) TSESATPESGPG SEPATS (SEQ ID NO: 25) SEQ ID 12mer-
SEPATSGSETPG MIC-1 .DELTA.1-3, 0.195 NO: 205 (4 + 3 + 1.6
TSTEPSEGSAPG M57L latter) TSTEEG (SEQ ID NO: 185) SEQ ID 12mer-
SEPATSGSETPG 0.234 NO: 206 (4 + 3 + 2.6) TSTEPSEGSAPG TSESAT (SEQ
ID NO: 186) SEQ ID 12mer- SEPATSGSETPG 0.367 NO: 207 (4 + 3 + 3.6)
TSTEPSEGSAPG TSTEPS (SEQ ID NO: 187) SEQ ID 12mer- SEPATSGSETPG
0.324 NO: 208 (4 + 3 + 4.6) TSTEPSEGSAPG SEPATS (SEQ ID NO: 188)
SEQ ID 12mer- SEPATSGSETPG MIC-1 .DELTA.1-3, 0.148 NO: 209 (4 + 4 +
1.6 SEPATSGSETPG M57L latter) TSTEEG(SEQ ID NO: 189) SEQ ID 12mer-
SEPATSGSETPG MIC-1 0.361 NO: 210 (4 + 4 + 2.6) SEPATSGSETPG
.DELTA.1-3 TSESAT (SEQ ID NO: 190) SEQ ID 12mer- SEPATSGSETPG N.D.
NO: 211 (4 + 4 + 2.6 SEPATSGSETPG inter) ESATPE (SEQ ID NO: 191)
SEQ ID 12mer- SEPATSGSETPG MIC-1 .DELTA.1-3, 0.262 NO: 212 (4 + 4 +
3.6) SEPATSGSETPG M57L TSTEPS (SEQ ID NO: 192) SEQ ID 12mer-
SEPATSGSETPG MIC-1 N.D. NO: 213 (4 + 4 + 3.6 SEPATSGSETPG
.DELTA.1-3 inter2) STEPSE (SEQ ID NO: 193) SEQ ID 12mer-
SEPATSGSETPG 0.330 NO: 214 (4 + 4 + 4.6) SEPATSGSETPG SEPATS (SEQ
ID NO: 194) Notes: ".6" means the first 6aa of 12mers, "latter"
means the last 6aa of 12mers, "inter" means the internal 6aa from
12mers. "N.D." means "not detected".
[0236] Although the extended 12mer (6aa) locate 24aa away from the
N-terminal, the expression levels of MIC-1 polypeptide with an
N-terminal extension vary a lot among different groups. It is clear
that the fragment from 12mer-1 is not suitable for expression,
which is consistent with previous results. The average expression
levels of 12mer-(4+_+3.6) and -(4+_+4.6) are relatively higher than
others.
(2) Inclusion Body Ratio of MIC-1 Polypeptide with 2* or 2.5*12Mer
N-Extension
[0237] For large scale protein production, inclusion body is
usually considered as a good choice mainly due to its better
up-scaling properties, which mainly include: high expression level,
simple recovery step and high purity, protease-resistant and good
process stability.
[0238] MIC-1 polypeptides with an N-terminal extension could be
expressed either inclusion body or soluble form, which is mainly
dependent on compounds' pI and extension length. The results are
shown in Table 13 and FIG. 4.
TABLE-US-00013 TABLE 13 Solubility in cell cytosol and their pI
values Sequences of MIC-1 Inclusion pI SEQ ID NO N-extension
N-extension polypeptide body ratio.star-solid. values SEQ ID NO:
12mer-(4 + 4) SEPATSGSETPG MIC-1 100% 5.8 104 SEPATSGSETPG
.DELTA.1-3 (SEQ ID NO: 181) SEQ ID NO: 12mer-(4 + 2 + 3.6)
SEPATSGSETPG 100% 5.5 108 TSESATPESGPG TSTEPS (SEQ ID NO: 70) SEQ
ID NO: 12mer-(4 + 2 + 3.8) SEPATSGSETPG 90% 5.2 109 TSESATPESGPG
TSTEPSEG (SEQ ID NO: 71) SEQ ID NO: 12mer-(4 + 2)- SEPATSGSETPG 90%
5.2 215 GPEQGPEQ TSESATPESGPG GPEQGPEQ (SEQ ID NO: 195) SEQ ID NO:
12mer-(4 + 2)- SEPATSGSETPG 95% 5.2 216 GEPSGEPS TSESATPESGPG
GEPSGEPS (SEQ ID NO: 196) SEQ ID NO: 12mer-(4 + 4) SEPATSGSETPG 70%
5.0 112 M57E, H66E SEPATSGSETPG (SEQ ID NO: 181) SEQ ID NO:
12mer-(4 + 4) SEPATSGSETPG 70% 5.0 113 M57E, R67E SEPATSGSETPG (SEQ
ID NO: 181) SEQ ID NO: 12mer-(three SEPATSGSETPG MIC-1-des- 85% 5.4
217 repeats) TSESATPESGPG N3 TSTEPSEGSAPG (SEQ ID NO: 197) SEQ ID
NO: 12mer-(four SEPATSGSETPG MIC-1-des- 30% 5.1 218 repeats)
TSESATPESGPG N3 TSTEPSEGSAPG TSTEPSEGSAPG (SEQ ID NO: 198) SEQ ID
NO: 12mer-(five SPAGSPTSTEEG MIC-1 0% 4.8 219 repeats) TSESATPESGPG
TSTEPSEGSAPG SPAGSPTSTEEG TSTEPSEGSAPG (SEQ ID NO: 199) SEQ ID NO:
12mer-(4 + 4) SEPATSGSETPG MIC-1 0% 4.7 220 M57E, H66E, R67E
SEPATSGSETPG .DELTA.1-3 (SEQ ID NO: 181) SEQ ID NO: 12mer-(4 + 2 +
3.6) SEPATSGSETPG 0% 4.7 221 M57E, R67E TSESATPESGPG TSTEPS (SEQ ID
NO: 70) Note: .star-solid.The number here is estimated by
SDS-PAGE.
[0239] The solubility of MIC-1 polypeptides with in-sequence
mutations are shown in Table 14 and FIG. 5 (the MIC-1 polypeptide
sequence is MIC-1 .DELTA.1-3).
TABLE-US-00014 TABLE 14 Solubility of MIC-1 polypeptide with
in-sequence mutations Solubility N-extension In-sequence M in cell
SEPATSGSETPG M57E IBs SEPATSGSETPG M57E/H66E Partially soluble
(12mer-(4 + 4)) M57E/H66E/R67E Fully soluble (SEQ ID NO: 181)
SEPATSGSETPG M57E N.D. TSESATPESGPG- M57E/H66E Fully soluble TSTEPS
M57E/H66E/R67E Fully soluble (12mer-(4 + 2 + 3.6)) (SEQ ID NO:
70)
[0240] MIC-1 polypeptides initiating with 12mer-(4+2+_), -(4+4+_)
and -(4+3+_) were investigated with their ability to express
inclusion body. It was shown that the inclusion body ratio is
>90% when pI>5.1. In addition, MIC-1 polypeptides with
in-sequence mutations M57E/H66E mainly expressed soluble
fractions.
Example 9: Production of MIC-1 Polypeptides with an N-Terminal
Extension Including a Cys Mutation
[0241] To increase the half-life of MIC-1 polypeptides with an
N-terminal extension, different fatty acid chains that were used
for protraction were conjugated to the N-terminal extension through
alkylation mediated by Cysteine introduced by site-directed
mutation. The position for the Cys mutation has been systematically
mapped and resulting MIC-1 polypeptides with an N-terminal
extension were refolded and purified according to the methods
described in Example 8.
[0242] 1. Introduce a Cys Mutation to the N-Terminal Extension for
Protraction
[0243] Total of 20 different cysteine mutants were generated by
site-directed mutations using PCR method and constructs are listed
as Table 15.
TABLE-US-00015 TABLE 15 Constructs having the Cys mutation at
different positions Constructs N-term. Cys MIC-1 Inclusion pI (SEQ
ID NO) extension mutation polypeptide body ratio.star-solid. values
SEQ ID NO: 301 SEPATCGSETPG- S(-25)C MIC-1, des- 100% 5.7
TSESATPESGPG- N3 TSTEPS (SEQ ID NO: 223) SEQ ID NO: 302
SEPATSGCETPG- S(-23)C 100% 5.7 TSESATPESGPG- TSTEPS(SEQ ID NO: 224)
SEQ ID NO: 288 SEPCTSGSETPG- A(-29)C 100% 5.4 TSESATPESGPG-
TSTEPSEG(SEQ ID NO: 225) SEQ ID NO: 291 SEPATCGSETPG- S(-27)C 100%
5.4 TSESATPESGPG- TSTEPSEG(SEQ ID NO: 226) -- SEPATSCSETPG- G(-26)C
100% 5.4 TSESATPESGPG- TSTEPSEG(SEQ ID NO: 227) -- SEPCTSGSETPG-
A(-29)C MIC-1, des- 100% 5.4 TSESATPESGPG- N3, M57L TSTEPSEG(SEQ ID
NO: 225) -- SEPATSCSETPG- G(-26)C 100% 5.4 TSESATPESGPG-
TSTEPSEG(SEQ ID NO: 227) -- SEPCTSGSETPG- A(-29)C MIC-1, des- 100%
5.4 TSESATPESGPG- N3, M57L, TSTEPSEG(SEQ M86L ID NO: 228) --
SEPACSGSETPG- T(-28)C 100% 5.4 TSESATPESGPG- TSTEPSEG(SEQ ID NO:
229) SEQ ID NO: 289 SEPATSCSETPG- G(-26)C 100% 5.4 TSESATPESGPG-
TSTEPSEG(SEQ ID NO: 227) SEQ ID NO: 303 SEPATSGCETPG- S(-25)C 100%
5.4 TSESATPESGPG- TSTEPSEG(SEQ ID NO: 230) SEQ ID NO: 304
SEPATSGSECPG- T(-23)C 100% 5.4 TSESATPESGPG- TSTEPSEG(SEQ ID NO:
231) SEQ ID NO: 305 SEPATSGSETPC- G(-21)C 100% 5.4 TSESATPESGPG-
TSTEPSEG(SEQ ID NO: 232) SEQ ID NO: 306 SEPATSGSETPG- S(-19)C 100%
5.4 TCESATPESGPG- TSTEPSEG(SEQ ID NO: 233) SEQ ID NO: 307
SEPATSGSETPG- S(-17)C 100% 5.4 TSECATPESGPG- TSTEPSEG(SEQ ID NO:
234) SEQ ID NO: 292 SEPATSGSETPG- T(-15)C 100% 5.4 TSESACPESGPG-
TSTEPSEG(SEQ ID NO: 235) SEQ ID NO: 308 SEPATSGSETPG- S(-12)C 100%
5.4 TSESATPECGPG- TSTEPSEG(SEQ ID NO: 236) SEQ ID NO: 309
SEPATSGSETPG- G(-11)C 100% 5.4 TSESATPESCPG- TSTEPSEG(SEQ ID NO:
237) SEQ ID NO: 310 SEPATSGSETPG- T(-6)C 100% 5.4 TSESATPESGPG-
TSCEPSEG(SEQ ID NO: 238) SEQ ID NO: 293 SEPATSGSETPG- S(-3)C 100%
5.4 TSESATPESGPG- TSTEPCEG(SEQ ID NO: 239) SEQ ID NO: 316
GEQPCEQPGEQP G(-24)C MIC-1 100% 5.3 GEQPGEQPGEQP GEQP (SEQ ID NO:
317) N.A. = Not available. *: The number in bracket (of the Column
Cys mutation) means the distance between Cys and the N-terminal
amino acid of MIC-1 polypeptide.
[0244] It shows that the expression level of MIC-1 polypeptide with
an N-terminal extension with a Cys mutation is similar to those
without Cys mutation.
[0245] 2. Refolding and Purification of MIC-1 Polypeptide with an
N-Terminal
[0246] Extension Including a Cys Mutation
[0247] WtMIC-1 homo-dimer contains total of 9 pairs of disulphide
bonds and in theory, introducing a new cysteine will disturb the
original disulphide bond matching by disulphide bond scrambling,
which could further decrease refolding yield. While in our
experiments, it is surprising to find that these Cys mutants listed
were tested in the same refolding buffer used for wtMIC-1 refolding
and showed similar refolding yield (.about.50% to 60%) as wtMIC-1
or solubility-engineered MIC-1 polypeptide with an N-terminal
extension described.
[0248] 3. pH-Dependent Solubility and Maximal Solubility of MIC-1
Polypeptide with an N-Terminal Extension Including a Cys
Mutation
[0249] The pH-dependent solubility and maximal solubility were
determined by the same method as described in Example 4. The
results are shown in Table 16 and Table 17.
TABLE-US-00016 TABLE 16 pH-dependent solubility test of MIC-1
polypeptide with an N-terminal extension including a Cys mutation
SEQ pH ID NO Structure 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 SEQ ID
SEPCTSGSETPGTS 8.81 4.22 1.34 5.18 13.52 15.65 15.1 15.84 15.97 NO:
ESATPESGPGTSTE 288 PSEG-MIC-1-.DELTA.3 SEQ ID SEPATSCSETPGTS 7.91
5.12 1.37 5.91 13.59 15.62 15.15 15.83 16.47 NO: ESATPESGPGTSTE 289
PSEG-MIC-1 (M57L, M86L) SEQ ID GEQPCEQPGEQPG 6.24 3.14 2.54 4.71
9.43 13.24 14.21 15.21 15.2 NO: EQPGEQPGEQPGE 316 QP-MIC-1
TABLE-US-00017 TABLE 17 Maximal solubility determination test of
MIC-1 polypeptide with an N-terminal extension including a Cys
mutation Max. solubility SEQ ID NO Structure (mg/ml) SEQ ID NO:
SEPCTSGSETPGTSESATPESGPGTST 36.1 288 EPSEG-MIC-1-.DELTA.3 SEQ ID
NO: SEPATSCSETPGTSESATPESGPGTST 38.4 289 EPSEG-MIC-1 (M57L, M86L)
SEQ ID NO: GEQPCEQPGEQPGEQPGEQPGEQPG 32.1 316 EQP-MIC-1
[0250] It can be seen that a Cys mutation does not impact the
improved solubility obtained by adding an N-terminal amino acid
extension to a MIC-1 polypeptide.
Example 10: Preparation of Protractors for MIC-1 Compounds
Example 10.1: Preparation of
17-[(S)-1-carboxy-3-(2-{2-[(2-{2-[(4-formylbenzylcarbamoyl)methoxy]ethoxy-
}ethylcarbamoyl)-methoxy]ethoxy}ethylcarbamoyl)propylcarbamoyl]heptadecano-
ic Acid
##STR00055##
[0252] t-Bu-N-(4-Formylbenzyl) carbamate (100 mg) was treated with
TFA/DCM (1:1) for 1 h. The mixture was concentrated in vacuo and
co-concentrated with toluene (twice). The residue was dissolved in
THF (2.5 ml) and a solution of
17-((S)-1-carboxy-3-{2-[2-({2-[2-(2,5-dioxopyrrolidin-1-yloxycarbonylmeth-
oxy)-ethoxy]ethylcarbamoyl}methoxy)ethoxy]ethylcarbamoyl}propylcarbamoyl)
heptadecanoic acid (320 mg, prepared as described previously in
WO2009/083549) in THF (5 ml) was added. DIPEA (0.5 ml) was added
slowly. After 130 min, the mixture was concentrated in vacuo. The
residue was dissolved in EtOAc and 1N HCl. The organic layer was
extracted with 1N HCl and brine. The organic layer was dried
(Na.sub.2SO.sub.4) and concentrated in vacuo to give the title
compound as a white solid, which was used without further
purification.
[0253] Yield 234 mg (72%)
[0254] LCMS2: Theoretical mass: 851.0 Found: 851.5 (M+1).
Example 10.2 (C16): Preparation of
16-[[(1S)-4-[2-[2-[2-[2-[2-[2-[2-[(2-bromoacetyl)amino]ethylamino]-2-oxo--
ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-1-carboxy-4-oxo--
butyl]amino]-16-oxohexadecanoic Acid
##STR00056##
[0255] Solid Phase Synthetic Protocol:
[0256] A solution of N-(benzyloxycarbonyloxy)succinimide (ZOSu, 100
g, 401 mmol) in dichloromethane (500 mL) was added dropwise over 2
hours to a solution of ethylenediamine (1, 189 mL, 2.81 mol) in
dichloromethane (750 mL). After 30 minutes the suspension was
filtered and solids washed with dichloromethane. The filtrate was
evaporated to dryness and the residue diluted with toluene (1.00 L)
and water (0.50 L). The resulting mixture was filtered and the
filtrate was separated to afford two phases. The aqueous phase
contained the product; therefore it was extracted with
dichloromethane (2.times.250 mL). All organic phases were combined,
dried over anhydrous sodium sulfate, filtered and concentrated in
vacuo. The residue was diluted with toluene (750 mL) and extracted
with 2 M aqueous hydrochloric acid (500 mL) and 1 M aqueous
hydrochloric acid (100 mL). Acidic aqueous phases were combined and
basified with a solution of sodium hydroxide (60.0 g, 1.50 mol) in
water (90 mL). The resulting mixture was extracted with
dichloromethane (4.times.200 mL), dried over anhydrous sodium
sulfate, filtered, concentrated in vacuo and diluted with hexanes
(200 mL). 4 M Solution of hydrogen chloride in ether (100 mL, 400
mmol) was added to the solution, the resulting suspension was
concentrated in vacuo and diluted with hexanes (1.00 L). The
precipitated solid was filtered, washed with hexanes and dried in
vacuo to give (2-amino-ethyl)-carbamic acid benzyl ester
hydrochloride as white powder.
[0257] Yield: 62.62 g (68%).
[0258] RF (SiO2, dichloromethane/methanol 4:1): 0.25 (free
base).
[0259] 1H NMR spectrum (300 MHz, AcOD-d4, 80.degree. C., dH):
7.42-7.26 (m, 5H); 5.16 (s, 2H); 3.60 (t, J=5.7 Hz, 2H); 3.32 (t,
J=5.7 Hz, 2H).
[0260] 2-Chlorotrityl resin 100-200 mesh 1.7 mmol/g (3, 40.1 g,
68.1 mmol) was left to swell in dry dichloromethane (250 mL) for 20
minutes. A solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-Ado-OH, 17.5 g, 45.4 mmol) and N,N-diisopropylethylamine
(30.1 mL, 173 mmol) in dry dichloromethane (50 mL) was added to
resin and the mixture was shaken for 5 hours. Resin was filtered
and treated with a solution of N,N-diisopropylethylamine (15.8 mL,
90.8 mmol) in methanol/dichloromethane mixture (4:1, 250 mL,
2.times.5 min). Then resin was washed with N,N-dimethylformamide
(2.times.250 mL), dichloromethane (2.times.250 mL) and
N,N-dimethylformamide (3.times.250 mL). Fmoc group was removed by
treatment with 20% piperidine in dimethylformamide (1.times.5 min,
1.times.10 min, 1.times.30 min, 3.times.250 mL). Resin was washed
with N,N-dimethylformamide (3.times.250 mL), 2-propanol
(2.times.250 mL) and dichloromethane (300 mL, 2.times.250 mL).
Solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-Ado-OH, 26.3 g, 68.1 mmol),
O-(6-chloro-benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
tetrafluoroborate (TCTU, 24.2 g, 68.1 mmol) and
N,N-diisopropylethylamine (21.4 mL, 123 mmol) in
N,N-dimethylformamide (140 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (2.times.250 mL), dichloromethane
(2.times.250 mL) and N,N-dimethylformamide (250 mL). Fmoc group was
removed by treatment with 20% piperidine in dimethylformamide
(1.times.5 min, 1.times.10 min, 1.times.30 min, 3.times.250 mL).
Resin was washed with N,N-dimethylformamide (3.times.250 mL),
2-propanol (2.times.250 mL) and dichloromethane (300 mL,
2.times.250 mL). Solution of
(S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-pentanedioic acid
1-tert-butyl ester (Fmoc-Glu-OtBu, 29.0 g, 68.1 mmol),
O-(6-chloro-benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
tetrafluoroborate (TCTU, 24.2 g, 68.1 mmol) and
N,N-diisopropylethylamine (21.4 mL, 123 mmol) in
N,N-dimethylformamide (140 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (2.times.250 mL), dichloromethane
(2.times.250 mL) and N,N-dimethylformamide (250 mL). Fmoc group was
removed by treatment with 20% piperidine in dimethylformamide
(1.times.5 min, 1.times.10 min, 1.times.30 min, 3.times.250 mL).
Resin was washed with N,N-dimethylformamide (3.times.250 mL),
2-propanol (2.times.250 mL) and dichloromethane (300 mL,
2.times.250 mL). Solution of 16-(tert-butoxy)-16-oxohexadecanoic
acid (23.3 g, 68.1 mmol),
O-(6-chloro-benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
tetrafluoroborate (TCTU, 24.2 g, 68.1 mmol) and
N,N-diisopropylethylamine (21.4 mL, 123 mmol) in
N,N-dimethylformamide/dichloromethane mixture (4:1, 200 mL) was
added to resin. Resin was shaken for 1 hour, filtered and washed
with N,N-dimethylformamide (3.times.250 mL), dichloromethane
(2.times.250 mL), methanol (2.times.250 mL) and dichloromethane
(350, 6.times.250 mL). The product was cleaved from resin by
treatment with 2,2,2-trifluoroethanol (250 mL) for 18 hours. Resin
was filtered off and washed with dichloromethane (2.times.250 mL),
2-propanol/dichloromethane mixture (1:1, 2.times.250 mL),
2-propanol (250 mL) and dichloromethane (3.times.250 mL). Solutions
were combined; solvent evaporated and crude product was purified by
flash column chromatography (Silicagel 60, 0.040-0.060 mm; eluent:
dichloromethane/methanol 1:0-9:1). Pure
(S)-22-(tert-butoxycarbonyl)-41,41-dimethyl-10,19,24,39-tetraoxo-3,6,12,1-
5,40-pentaoxa-9,18,23-triazadotetracontanoic acid was dried in
vacuo and obtained as pale yellow thick yellow oil.
[0261] Yield: 30.88 g (83%).
[0262] RF (SiO2, dichloromethane/methanol 4:1): 0.30.
[0263] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.36 (t, J=5.7 Hz,
1H); 7.02 (t, J=5.4 Hz, 1H); 6.55 (d, J=7.7 Hz, 1H); 4.46 (m, 1H);
4.18 (s, 2H); 4.02 (s, 2H); 3.83-3.36 (m, 16H); 2.44-2.12 (m, 7H);
2.02-1.86 (m, 1H); 1.60 (m, 4H); 1.47 (s, 9H); 1.45 (s, 9H);
1.36-1.21 (m, 20H).
[0264] LC-MS method 4:
[0265] Purity: 100%
[0266] Rt (Kinetex 4.6 mm.times.50 mm, acetonitrile/water 50:50 to
100:0+0.1% FA): 3.60 min.
[0267] Found m/z, z=1: 818.7 (M+H)+
[0268] 2-(7-Aza-1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium
hexafluorophosphate (HATU, 11.4 g, 30.1 mmol) and triethylamine
(8.77 mL, 62.9 mmol) were subsequently added to a solution of
(S)-22-(tert-butoxycarbonyl)-41,41-dimethyl-10,19,24,39-tetraoxo-3,6,12,1-
5,40-pentaoxa-9,18,23-triazadotetracontanoic acid (22.4 g, 27.4
mmol) in dry dichloromethane (110 mL). Triethylamine (5.72 mL, 41.0
mmol) was added to a suspension of (2-amino-ethyl)-carbamic acid
benzyl ester hydrochloride (6.94 g, 30.1 mmol) in dry
dichloromethane (165 mL) and the resulting mixture was added to the
above solution. The mixture was stirred at room temperature
overnight, and then it was evaporated to dryness. The residue was
re-dissolved in ethyl acetate (500 mL); washed with 1 M aqueous
hydrochloric acid (2.times.200 mL), 5% aqueous solution of sodium
carbonate (2.times.200 mL, very slow separation of phases), 1 M
aqueous hydrochloric acid (8.times.200 mL) and brine; dried over
anhydrous sodium sulfate and evaporated to dryness in vacuo. The
residue was purified by flash column chromatography (Silicagel 60,
0.040-0.060 mm; eluent: dichloromethane/methanol 95:5) to afford
15-[(S)-3-(2-{2-[(2-{2-[(2-benzyloxycarbonylamino-ethylcarbamoyl)-methoxy-
]-ethoxy}-ethylcarbamoyl)-methoxy]-ethoxy}-ethylcarbamoyl)-1-tert-butoxyca-
rbonyl-propylcarbamoyl]-pentadecanoic acid tert-butyl ester as pale
yellow thick oil.
[0269] Yield: 23.84 g (88%)
[0270] RF (SiO2, dichloromethane/methanol 9:1): 0.35
[0271] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.39-7.26 (m, 6H);
7.19 (t, J=6.3 Hz, 1H); 6.91 (t, J=5.7 Hz, 1H); 6.52 (d, J=7.5 Hz,
1H); 5.83 (t, J=5.5 Hz, 1H); 5.09 (s, 2H); 4.41 (ddd, J=12.3, 4.6
and 4.3 Hz, 1H); 3.99 (s, 2H); 3.97 (s, 2H); 3.71-3.30 (m, 20H);
2.33-2.08 (m, 7H); 1.97-1.83 (m, 1H); 1.67-1.51 (m, 4H); 1.45 (s,
9H); 1.44 (s, 9H); 1.35-1.20 (m, 20H).
[0272] LCMS method 4
[0273] Purity: 100%
[0274] Rt (Kinetex 4.6 mm.times.50 mm, acetonitrile/water 50:50 to
100:0+0.1% FA): 4.18 min
[0275] Found m/z, z=1: 994.9 (M+H)+
[0276] Palladium on carbon (10%, 1.27 g, 1.20 mmol) was added to a
solution of the above compound (23.8 g, 24.0 mmol) in methanol (350
mL) and the resulting mixture was hydrogenated at normal pressure
for 4 hours. The catalyst was filtered off and the filtrate
evaporated to dryness. The residue was evaporated several times
from dichloromethane in order to remove residues of methanol and
dried in vacuo to yield tert-butyl
(S)-1-amino-25-(tert-butoxycarbonyl)-4,13,22,27-tetraoxo-6,9,15,18-tetrao-
xa-3,12,21,26-tetraazadotetracontan-42-oate as thick colourless
oil.
[0277] Yield: 20.50 g (99%).
[0278] RF (SiO2, dichloromethane/methanol 9:1): 0.05.
[0279] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.54 (t, J=5.7 Hz,
1H); 7.41 (t, J=5.6 Hz, 1H); 7.14 (t, J=5.5 Hz, 1H); 6.68 (d, J=7.5
Hz, 1H); 5.25 (bs, 2H); 4.39 (td, J=8.3 and 4.2 Hz, 1H); 4.01 (s,
4H); 3.74-3.39 (m, 18H); 2.96 (t, J=5.7 Hz, 2H); 2.34-2.06 (m, 7H);
1.97-1.83 (m, 1H); 1.68-1.50 (m, 4H); 1.45 (s, 9H); 1.43 (s, 9H);
1.37-1.19 (m, 20H).
[0280] LCMS method 4
[0281] Purity: 100%
[0282] Rt (Kinetex 4.6 mm.times.50 mm, acetonitrile/water 50:50 to
100:0+0.1% FA): 1.43 min
[0283] Found m/z, z=1: 860.8 (M+H)+
[0284] N,N-Diisopropylethylamine (4.98 mL, 28.6 mmol) was added to
a solution of the above amine (6, 20.5 g, 23.8 mmol) in dry
dichloromethane (290 mL) at -30.degree. C. under argon. Bromoacetyl
bromide (2.48 mL, 28.6 mmol) was added dropwise and the resulting
solution was stirred at -30.degree. C. for additional 3 hours. The
cooling bath was removed, the mixture was stirred at room
temperature for 1 hour, and then the solvent was removed in vacuo.
The residue was re-dissolved in ethyl acetate (450 mL) and washed
with 5% aqueous solution of citric acid (300 mL). The phases were
separated within 1 hour. The organic layer was washed with water
(300 mL) and the resulting emulsion was left to separate overnight
to give 3 phases. The clear aqueous layer was removed and the
residual 2 phases were shaken with saturated aqueous solution of
potassium bromide (100 mL) was added. The phases were left to
separate overnight, the aqueous one was then removed and the
organic one dried over anhydrous sodium sulfate. The solvent was
removed in vacuo and the residue was purified by flash column
chromatography (Silicagel 60, 0.040-0.060 mm; eluent:
dichloromethane/methanol 95:5) to afford tert-butyl
(S)-1-bromo-28-(tert-butoxycarbonyl)-2,7,16,25,30-pentaoxo-9,12,18,21-tet-
raoxa-3,6,15,24,29-pentaazapentatetracontan-45-oate as colorless
solid.
[0285] Yield: 19.46 g (83%).
[0286] RF (SiO2, dichloromethane/methanol 9:1): 0.25
[0287] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.46 (m, 1H); 7.33 (t,
J=5.9 Hz, 1H); 7.21 (t, J=5.1 Hz, 1H); 6.92 (t, J=5.2 Hz, 1H); 6.50
(d, J=7.5 Hz, 1H); 4.41 (ddd, J=12.2, 4.5 and 4.2 Hz, 1H); 4.01 (s,
4H), 3.85 (s, 2H); 3.75-3.40 (m, 20H), 2.36-2.08 (m, 7H); 1.99-1.84
(m, 1H); 1.68-1.51 (m, 4H), 1.46 (s, 9H); 1.44 (s, 9H); 1.38-1.19
(m, 20H)
[0288] LCMS method 4
[0289] Purity: 100%
[0290] Rt (Kinetex 4.6 mm.times.50 mm, acetonitrile/water 50:50 to
100:0+0.1% FA): 3.51 min.
[0291] Found: m/z, z=1: 980.9, 982.9 (M+H)+
[0292] The above compound (19.5 g, 19.8 mmol) was dissolved in
trifluoroacetic acid (120 mL) and the resulting solution was
stirred at room temperature for 1.5 hours. Trifluoroacetic acid was
removed in vacuo and the residue was evaporated from
dichloromethane (6.times.200 mL). Diethyl ether (200 mL) was added
to the oily residue and the mixture was stirred overnight to give a
suspension. Solid product was filtered, washed with diethyl ether
and hexanes and dried in vacuo to afford the title product
15-{(S)-1-carboxy-3-[2-(2-{[2-(2-{[2-(2-Bromoacetylamino)ethylcarbamoyl]m-
ethoxy}-ethoxy)ethylcarbamoyl]methoxy}ethoxy)ethylcarbamoyl]propylcarbamoy-
l}pentadecanoic acid as white powder.
[0293] Yield: 16.74 g (97%).
[0294] 1H NMR spectrum (300 MHz, AcOD-d4, dH): 4.61 (dd, J=8.8 and
4.8 Hz, 1H); 4.12 (s, 2H), 4.10 (s, 2H); 3.96 (s, 2H); 3.77-3.39
(m, 20H), 2.49-2.18 (m, 7H); 2.16-1.04 (m, 1H); 1.71-1.56 (m, 4H),
1.30 (bs, 20H)
[0295] LCMS method 4:
[0296] Purity: 100%
[0297] Rt (Kinetex 4.6 mm.times.50 mm, acetonitrile/water 50:50 to
100:0+0.1% FA): 3.51 min
[0298] Theoretical m/z, z=1: 869.8, Found: m/z, z=1: 868.7,
870.7
Example 10.3 (C14): Preparation of
14-[[(1S)-4-[2-[2-[2-[2-[2-[2-[2-[(2-bromoacetyl)amino]ethylamino]-2-oxo--
ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-1-carboxy-4-oxo--
butyl]amino]-14-oxo-tetradecanoic Acid
##STR00057##
[0300]
13-{(S)-1-carboxy-3-[2-(2-{[2-(2-{[2-(2-Bromoacetylamino)ethylcarba-
moyl]methoxy}-ethoxy)ethylcarbamoyl]methoxy}ethoxy)ethylcarbamoyl]propylca-
rbamoyl}tridecanoic acid was prepared by the same method as
described in Example 10.2 resulting in a thick yellow oil.
[0301] 1H NMR spectrum (300 MHz, AcOD-d4, dH): 4.61 (dd, J=8.9 and
4.9 Hz, 1H); 4.13 (s, 2H); 4.11 (s, 2H); 3.96 (s, 2H); 3.77-3.40
(m, 20H); 2.49-2.18 (m, 7H); 2.16-2.07 (m, 1H); 1.70-1.56 (m, 4H);
1.31 (bs, 16H).
[0302] LCMS method 4:
[0303] Purity: 100% (ELSD)
[0304] Rt (Kinetex, 4.6 mm.times.50 mm, acetonitrile/water 20:80 to
100:0+0.1% FA): 2.94 min
[0305] Theoretical m/z, z=1: 841.9, Found: m/z, z=1: 841.7,
843.7
Example 10.4 (C18): Preparation of
18-[[(1S)-4-[2-[2-[2-[2-[2-[2-[2-[(2-bromoacetyl)amino]ethylamino]-2-oxo--
ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-1-carboxy-4-oxo--
butyl]amino]-18-oxo-octadecanoic Acid
##STR00058##
[0306] Solution Phase Synthetic Protocol:
[0307] Step 1: benzyl
18-[[(1S)-4-[2-[2-[2-[2-[2-[2-(2-aminoethylamino)-2-oxo-ethoxy]ethoxy]eth-
ylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-1-benzyloxycarbonyl-4-oxo-butyl]a-
mino]-18-oxo-octadecanoate To a solution of ethylenediamine (8.5
ml) in DCM (80 ml) and triethylamine (5.2 ml) at 0.degree. C. was
added a solution of benzyl
18-[[(1S)-1-benzyloxycarbonyl-4-[2-[2-[2-[2-[2-[2-(2,5-dioxopyrrolidin-1--
yl)oxy-2-oxo-ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-4-o-
xo-butyl]amino]-18-oxo-octadecanoate (26 g), prepared as described
in WO10029159, in DCM (320 ml) dropwise over 75 min. After stirring
for 2 h the precipitate was filtered off. To the filtrate was added
water (200 ml) and isopropanol (50 ml). The mixture was extracted.
The organic layer was dried using MgSO4. The MgSO4 was removed by
filtration and the filtrate was dried in vacuo to give the title
compound 20.07 g (81%) LCMS: Theoretical mass: 956.2; Found m/z,
z=1: 957.0
[0308] Step 2: benzyl
18-[[(1S)-1-benzyloxycarbonyl-4-[2-[2-[2-[2-[2-[2-[2-[(2-chloroacetyl)ami-
no]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylam-
ino]-4-oxo-butyl]amino]-18-oxo-octadecanoate
[0309] Chloroacetic acid (0.19 g) was dissolved in DCM (15 ml).
N-hydroxysuccinimide (0.22 g) and EDAC HCl (0.42 g) was added.
After stirring for 2.5 h benzyl
18-[[(1S)-4-[2-[2-[2-[2-[2-[2-(2-aminoethylamino)-2-oxo-ethoxy]ethoxy]eth-
ylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-1-benzyloxycarbonyl-4-oxo-butyl]a-
mino]-18-oxo-octadecanoate (1.5 g) in DCM (5 ml) was added. After
stirring over night at RT the mixture was extracted with 1M HCl
(2.times.20 ml) and water/brine 2:1 (30 ml). The organic layer was
dried (MgSO4), filtered and concentrated in vacuo to give a clear
oil, 1.37 g (84%)
[0310] LCMS: Theoretical mass: 1032.7; Found m/z, z=1: 1033.1
[0311] Step 3:
18-[[(1S)-1-Carboxy-4-[2-[2-[2-[2-[2-[2-[2-[(2-chloroacetyl)amino]ethylam-
ino]-2-oxo-ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-4-oxo-
-butyl]amino]-18-oxo-octadecanoic acid To a solution of benzyl
18-[[(1S)-1-benzyloxycarbonyl-4-[2-[2-[2-[2-[2-[2-[2-[(2-chloroacetyl)ami-
no]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylam-
ino]-4-oxo-butyl]amino]-18-oxo-octadecanoate (10.5 g) in acetone
(140 ml) was added 10% PD/C (1.0 g) after Nitrogen aeration. After
hydrogenation for 6 h, the mixture was heated to 40-50.degree. C.
before filtration. The precipitate in the cold filtrate was
isolated and washed with acetone and dried to give the title
compound, 7.42 g (85%).
[0312] Step 4:
8-[[(1S)-4-[2-[2-[2-[2-[2-[2-[2-[(2-Bromoacetyl)amino]ethylamino]-2-oxo-e-
thoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-1-carboxy-4-oxo-b-
utyl]amino]-18-oxo-octadecanoic acid.
[0313] To a suspension of
18-[[(1S)-1-Carboxy-4-[2-[2-[2-[2-[2-[2-[2-[(2-chloroacetyl)amino]ethylam-
ino]-2-oxo-ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-4-oxo-
-butyl]amino]-18-oxo-octadecanoic acidin acetone (60 ml) was added
sodium bromide (5 eq, 1.21 g). The mixture was stirred at RT in the
dark. After 2 h more sodium bromide (10 eq, 2.41 g) was added.
After 2 days more sodium bromide (5 eq, 1.21 g) was added. After 5
days the mixture was concentrated. To half the residue was added
DCM (30 ml), 10% ascorbic acid (20 ml) and water 30 ml. To the
emulsion was added isopropanol (50 ml) and water (30 ml). The
organic phase was separated and washed twice with a mixture of 10%
ascorbic acid (20 ml) and isopropanol (10 ml). The organic layer
was dried (MgSO4), filtered and concentrated to give a solid oil,
which was crystalised in acetone and isolated by filtration to give
the title compound contaminated with starting material, 0.80 g
(72%).
[0314] LCMS: Theoretical mass: 896.9. Found m/z, z=1: 898.9
(M+1)
Example 10.5 (C12): Preparation of
12-[[(1S)-1-carboxy-4-[2-[2-[2-[2-[2-[2-[(4-formylphenyl)methylamino]-2-o-
xo-ethoxy]ethoxy]ethylamino]-2-oxo-ethoxy]ethoxy]ethylamino]-4-oxo-butyl]a-
mino]-12-oxo-dodecanoic Acid
##STR00059##
[0316] The compound was prepared by the same method as described as
for example 10.1.
[0317] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.39-7.29 (m, 1H);
7.03-6.93 (m, 1H); 6.59-6.51 (m, 1H); 4.49-4.37 (m, 1H); 4.15 (s,
2H); 4.01 (s, 2H); 3.78-3.39 (m, 16H); 2.36-2.10 (m, 7H); 2.01-1.85
(m, 1H); 1.68-1.50 (m, 4H); 1.48-1.41 (m, 18H); 1.34-1.22 (m,
12H).
Example 10.6: Preparation of
(2S)-5-[2-[2-[2-[2-[2-[2-[2-[(2-bromoacetyl)amino]ethylamino]-2-oxoethoxy-
]ethoxy]ethylamino]-2-oxoethoxy]ethoxy]ethylamino]-5-oxo-2-(16-sulfohexade-
canoylamino)pentanoic Acid
##STR00060##
[0319] 2-Chlorotrityl resin 100-200 mesh 1.5 mmol/g (18.0 g, 27.0
mmol) was left to swell in dry dichloromethane (160 mL) for 20
minutes. A solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-OEG-OH, 6.94 g, 18.0 mmol) and N,N-diisopropylethylamine
(12.5 mL, 72.0 mmol) in dry dichloromethane (100 mL) was added to
resin and the mixture was shaken overnight. Resin was filtered and
treated with a solution of N,N-diisopropylethylamine (4.12 mL, 23.7
mmol) in methanol/dichloromethane mixture (4:1, 2.times.5 min,
2.times.100 mL). Then resin was washed with N,N-dimethylformamide
(2.times.100 mL), dichloromethane (2.times.100 mL) and
N,N-dimethylformamide (3.times.100 mL). Fmoc group was removed by
treatment with 20% piperidine in N,N-dimethylformamide (1.times.5
min, 1.times.30 min, 2.times.100 mL). Resin was washed with
N,N-dimethylformamide (3.times.100 mL), 2-propanol (2.times.100 mL)
and dichloromethane (3.times.100 mL). Solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-OEG-OH, 10.4 g, 27.0 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 9.60 g, 27.0 mmol) and
N,N-diisopropylethylamine (8.50 mL, 48.6 mmol) in
N,N-dimethylformamide (100 mL) was added to resin and mixture was
shaken for 2 hours. Resin was filtered and washed with
N,N-dimethylformamide (2.times.100 mL), dichloromethane
(2.times.100 mL) and N,N-dimethylformamide (3.times.100 mL). Fmoc
group was removed by treatment with 20% piperidine in
N,N-dimethylformamide (1.times.5 min, 1.times.30 min, 2.times.100
mL). Resin was washed with N,N-dimethylformamide (3.times.100 mL),
2-propanol (2.times.100 mL) and dichloromethane (3.times.100 mL).
Solution of
(S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-pentanedioic acid
1-tert-butyl ester (Fmoc-gGlu-OtBu, 11.5 g, 27.0 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 9.60 g, 27.0 mmol) and
N,N-diisopropylethylamine (8.50 mL, 48.6 mmol) in
N,N-dimethylformamide (100 mL) was added to resin and mixture was
shaken for 2 hours. Resin was filtered and washed with
N,N-dimethylformamide (2.times.100 mL), dichloromethane
(2.times.100 mL) and N,N-dimethylformamide (2.times.100 mL). Fmoc
group was removed by treatment with 20% piperidine in
N,N-dimethylformamide (1.times.5 min, 1.times.30 min, 2.times.100
mL). Resin (2) was washed with N,N-dimethylformamide (3.times.100
mL), 2-propanol (2.times.100 mL) and dichloromethane (3.times.100
mL). Resin was divided into 4 equal parts and this synthesis was
continued with one quarter of the original amount (4.50 mmol).
Solution of sodium 16-sulfo-hexadecanoic acid (3, 6.16 g, 17.2
mmol, preparation is described in the procedure for synthesis of
compound REaD-22296, Batch No. 195-257-1),
(benzotriazol-1-yloxy)tripyrrolidinophosphonium hexafluorophosphate
(PyBOP, 8.95 g, 17.2 mmol) and N,N-diisopropylethylamine (6.00 mL,
34.0 mmol) in dimethyl sulfoxide (180 mL) was added to resin and
mixture was shaken for 4 hours. Resin was filtered and washed with
N,N-dimethylformamide (2.times.100 mL), N,N-dimethylformamide/water
(2:1, 2.times.100 mL), dimethylsulfoxide (2.times.100 mL), water
(2.times.100 mL) and N,N-dimethylformamide (3.times.100 mL). The
product was cleaved from resin by treatment with
1,1,1,3,3,3-hexafluoro-2-propanol (80 mL) for 2 hours. Resin was
filtered off and washed with dichloromethane (4.times.100 mL).
Solutions were combined, volatiles evaporated and crude
(S)-22-(tert-butoxycarbonyl)-10,19,24-trioxo-39-sulfo-3,6,12,15-tetraoxa--
9,18,23-triazanonatriacontanoic acid (4) was used for the next step
without further purification.
[0320] Yield: quantitative (based on ELSD).
[0321] LC-MS purity: 96%.
[0322] LC-MS Rt (Kinetex C18, 4.6 mm.times.100 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 3.07 min.
[0323] LC-MS m/z: 812.9 (M+H).sup.+.
[0324]
1-((Dimethylamino)(dimethyliminio)methyl)-1H-[1,2,3]triazolo[4,5-b]-
pyridine 3-oxide hexafluorophosphate(V) (HATU, 1.87 g, 4.92 mmol)
and triethylamine (3.43 mL, 24.6 mmol) were subsequently added to a
solution of
(S)-22-(tert-butoxycarbonyl)-10,19,24-trioxo-39-sulfo-3,6,12,15-tetrao-
xa-9,18,23-triazanonatriacontanoic acid (4.5 mmol) in dry
dichloromethane (40 mL). Triethylamine (1.82 mL, 13.1 mmol) was
added to a suspension of (2-amino-ethyl)-carbamic acid benzyl ester
hydrochloride (5, 1.93 g, 8.37 mmol) in dry dichloromethane (20 mL)
and the resulting mixture was added to the above solution. The
mixture was stirred overnight at room temperature. After 16 hours,
another portion of
1-((dimethylamino)(dimethyliminio)methyl)-1H-[1,2,3]triazolo[4,5-b]pyridi-
ne 3-oxide hexafluorophosphate(V) (HATU, 0.38 g, 1 mmol),
triethylamine (2.00 mL, 14.3 mmol) and (2-amino-ethyl)-carbamic
acid benzyl ester hydrochloride (5, 0.40 g, 1.70 mmol) were added
and the mixture was stirred for another 2 hours. The solution was
washed with 1 M aqueous hydrochloric acid (2.times.100 mL) and
brine (50 mL), dried over anhydrous sodium sulfate and evaporated
to dryness. Crude
(S)-29-(tert-butoxycarbonyl)-3,8,17,26,31-pentaoxo-1-phenyl-2,10,13,19,22-
-pentaoxa-4,7,16,25,30-pentaazahexatetracontane-46-sulfonic acid
(6) was used for the next step without further purification.
[0325] Yield: quantitative (based on ELSD).
[0326] LC-MS purity: 83% (ELSD).
[0327] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 3.35 min.
[0328] LC-MS m/z: 989.1 (M+H).sup.+.
[0329] Palladium on carbon (10%, 0.22 g, 0.20 mmol) was added to a
solution of the above compound (4.50 mmol) in methanol (100 mL) and
the resulting mixture was hydrogenated at normal pressure for 16
hours and then in sonicator for 1 hour at 40.degree. C. The
catalyst was filtered off over Celite.TM. and the filtrate was
evaporated to dryness under reduced pressure. The residue was
purified by preparative HPLC (Column DeltaPak C18, 15 m;
50.times.500 mm; acetonitrile/water 30:70 during 80 min+0.05% TFA)
and freeze-dried to afford
(S)-1-amino-25-(tert-butoxycarbonyl)-4,13,22,27-tetraoxo-6,9,15,18-tetrao-
xa-3,12,21,26-tetraazadotetracontane-42-sulfonic acid (7) as
colorless solid.
[0330] Yield: 1.95 g (45% from 1).
[0331] LC-MS purity: 98% (ELSD).
[0332] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 2.87 min.
[0333] LC-MS m/z: 854.7 (M+H).sup.+.
[0334] 2,4,6-Collidine (1.60 mL, 12.0 mmol) was added to a solution
of the above amine (7, 2.06 g, 2.11 mmol) in anhydrous
N,N-dimethylformamide (20 mL) at 0.degree. C. under argon.
2-Bromoacetic anhydride (0.68 g, 2.61 mmol) was added and the
resulting solution was stirred at 0.degree. C. for 1 hour. Reaction
mixture was then evaporated to dryness under reduced pressure and
the residue was triturated with diethyl ether (2.times.10 mL).
Remaining compound
(S)-1-bromo-28-(tert-butoxycarbonyl)-2,7,16,25,30-pentaoxo-9,12,18,21-tet-
raoxa-3,6,15,24,29-pentaazapentatetracontane-45-sulfonic acid (8)
was used for the next step without further purification.
[0335] Yield: quantitative (based on ELSD).
[0336] LC-MS purity: 95% (ELSD).
[0337] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 3.04 min.
[0338] LC-MS m/z: 976.9 (M+H).sup.+.
[0339] The above compound (8, 2.00 mmol) was dissolved in
dichloromethane (20 mL), water (2 mL) and trifluoroacetic acid (25
mL) and the resulting solution was stirred for 2 hours.
Trifluoroacetic acid was removed under reduced pressure and the
residue was co-evaporated with dichloromethane (3.times.80 mL). The
residue was purified by preparative HPLC (Column DeltaPak C18, 15
m; 50.times.500 mm; acetonitrile/water 30:70 during 70 min+0.05%
TFA) and freeze-dried to afford
(S)-1-bromo-2,7,16,25-tetraoxo-28-(16-sulfohexadecanamido)-9,12,18,21-tet-
raoxa-3,6,15,24-tetraazanonacosan-29-oic acid (9) as white
solid.
[0340] Yield: 1.92 g (98% over 2 steps).
[0341] 1H NMR spectrum (300 MHz, AcOD-d4, 80 C, dH): 4.68-4.58 (m,
1H); 4.20-4.08 (m, 4H); 3.94 (s, 2H); 3.82-3.64 (m, 12H); 3.60-3.46
(m, 8H); 3.20-3.10 (m, 2H); 2.51 (t, J=7.2 Hz, 2H); 2.37 (t, J=7.3
Hz, 2H); 2.26 (bs, 1H); 1.92-1.80 (m, 2H); 1.73-1.62 (m, 2H);
1.55-1.44 (m, 2H); 1.43-1.29 (m, 21H).
[0342] LC-MS purity: 95% (ELSD).
[0343] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 2.73 min.
[0344] LC-MS m/z: 920.9 (M+H).sup.+.
Example 10.7: Preparation of
(2S)-6-[(2-bromoacetyl)amino]-2-[[2-[2-[2-[[2-[2-[2-[4-[17-(1H-tetrazol-5-
-yl)heptadecanoylsulfamoyl]butanoylamino]ethoxy]ethoxy]acetyl]amino]ethoxy-
]ethoxy]acetyl]amino]hexanoic Acid
##STR00061##
[0346] Wang Fmoc-Lys(Mtt) resin 0.29 mmol/g (17.24 g, 5.0 mmol) was
left to swell and washed in DMF (60 mL) for 7.times.5 minutes. Fmoc
group was removed by treatment with 20% piperidine in
N,N-dimethylformamide (2.times.60 mL, 2.times.15 min). Resin was
washed with N,N-dimethylformamide (6.times.60 mL). Fmoc-OEG-OH was
weight out for two reactions (2.times.20 mmol 15.416 g). Dissolved
in 120 mL DMF with Oxyma (0.3M) and split out in volume of
2.times.53 mL. A solution of Fmoc-OEG-OH and Oxyma in DMF (53.2 mL,
0.3 M) was mixed with DIC (26.6 mL, 0.6M) in DMF. The AA was
activated over 10 min then added to the resin and the mixture was
shaken for 8 hours.
[0347] The resin was drained and washed with N,N-dimethylformamide
(4.times.60 mL). Fmoc group was removed by treatment with 20%
piperidine in N,N-dimethylformamide (2.times.60 mL, 2.times.15
min). Resin was washed with N,N-dimethylformamide (6.times.60 mL) A
solution of Fmoc-OEG-OH and Oxyma in DMF (53.2 mL, 0.3 M) was mixed
with DIC (26.6 mL, 0.6M) in DMF. The AA was activated over 10 min
then added to the resin and the mixture was shaken for 8 hours. The
resin was drained and washed with N,N-dimethylformamide (4.times.60
mL) and then with acetonitrile (2.times.60 mL 2.times.8 h).
[0348] The above resin, 0.27 mmol/g (2.46 g, 0.66 mmol) was swelled
in DMF (12 mL, 3.times.5 min). Fmoc group was removed by treatment
with 20% piperidine in N,N-dimethylformamide (2.times.12 mL,
1.times.15 min+1.times.30 min). The Resin was washed with
N,N-dimethylformamide (2.times.15 mL), DCM (2.times.15 mL), DMF
(2.times.15 mL).
[0349] A solution of
4-[17-(1H-tetrazol-5-yl)heptadecanoylsulfamoyl]butanoic acid (0.966
g, 1.98 mmol), Oxyma (0.281 g, 1.98 mmol) and DIC (0.309 mL) in
N,N-dimethylformamide (15 mL) was made and left for approximately
10 min in order to activate the amino acid. The mixture was then
added to the reaction-tube and shaken overnight.
[0350] The Resin was drained and washed with N,N-dimethylformamide
(2.times.15 mL), DCM (5.times.15 mL). The MTT group was cleaved by
1,1,1,3,3,3-hexafluoro-2-propanol/DCM/Triisopropylsilane 80/18/2,
3.times.20 ml, (3.times.20 min with DCM wash between each
treatment) and then washed with 4.times.20 mL DCM. Bromoacetic acid
(1.10 g, 7.92 mmol) and DIC (0.62 mL, 3.96 mmol) in 10 mL DMF were
added to the resin and shaken for 1 h. The resin was washed with
N,N-dimethylformamide (3.times.20 mL) and dichloromethane
(5.times.20 mL).
[0351] The product was cleaved from the resin with TFA (98%), water
(2%), 20 mL for 1 h and 20 mL for 1/2 h. The resin was washed with
20 mL DCM. The solvents were evaporated to give a yellow oil. The
oil was dissolved in EtOAc (50 mL) and washed with water
2.times.100 mL). White solid precipitated in the EtOAc layer. The
amount of EtOAc was reduced in vacuum and filtered. The precipitate
was washed with EtOAc and dried on the filter giving 270 mg of
white solid.
[0352] LC-MS m/z: 1026.39 (M+H)+.
Example 10.8: Preparation of
4-[10-[[(1S)-4-[2-[2-[2-[2-[2-[2-[[(5S)-5-[(2-bromoacetyl)amino]-5-carbox-
ypentyl]amino]-2-oxoethoxy]ethoxy]ethylamino]-2-oxoethoxy]ethoxy]ethylamin-
o]-1-carboxy-4-oxobutyl]amino]-10-oxodecoxy]benzoic Acid
##STR00062##
[0354] 2-Chlorotrityl resin 100-200 mesh 1.5 mmol/g (1, 2.70 g,
4.05 mmol) was left to swell in dry dichloromethane (40 mL) for 30
minutes. A solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-OEG-OH, 1.04 g, 2.70 mmol) and N,N-diisopropylethylamine
(1.82 mL, 10.3 mmol) in dry dichloromethane (40 mL) was added to
resin and the mixture was shaken overnight. Resin was filtered and
treated with a solution of N,N-diisopropylethylamine (0.94 mL, 5.40
mmol) in methanol/dichloromethane mixture (4:1, 2.times.5 min,
2.times.40 mL). Then resin was washed with N,N-dimethylformamide
(4.times.40 mL), dichloromethane (4.times.40 mL) and
N,N-dimethylformamide (4.times.40 mL). Fmoc group was removed by
treatment with 20% piperidine in N,N-dimethylformamide (1.times.10
min, 1.times.30 min, 2.times.40 mL). Resin was washed with
N,N-dimethylformamide (3.times.40 mL), 2-propanol (2.times.40 mL),
dichloromethane (3.times.40 mL) and N,N-dimethylformamide
(3.times.40 mL). Solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-OEG-OH, 3.18 g, 8.20 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 2.93 g, 8.20 mmol) and
N,N-diisopropylethylamine (2.87 mL, 16.4 mmol) in
N,N-dimethylformamide (40 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (4.times.40 mL), dichloromethane (4.times.40
mL) and N,N-dimethylformamide (4.times.40 mL). Fmoc group was
removed by treatment with 20% piperidine in N,N-dimethylformamide
(1.times.10 min, 1.times.30 min, 2.times.40 mL). Resin was washed
with N,N-dimethylformamide (3.times.40 mL), 2-propanol (2.times.40
mL), dichloromethane (3.times.40 mL) and N,N-dimethylformamide
(3.times.40 mL). Solution of
(S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-pentanedioic acid
1-tert-butyl ester (Fmoc-L-Glu-OtBu, 3.50 g, 8.20 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 2.93 g, 8.20 mmol) and
N,N-diisopropylethylamine (2.87 mL, 16.4 mmol) in
N,N-dimethylformamide (40 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (4.times.40 mL), dichloromethane (4.times.40
mL) and N,N-dimethylformamide (4.times.40 mL). Fmoc group was
removed by treatment with 20% piperidine in N,N-dimethylformamide
(1.times.10 min, 1.times.30 min, 2.times.40 mL). Resin was washed
with N,N-dimethylformamide (3.times.40 mL), 2-propanol (2.times.40
mL), dichloromethane (3.times.40 mL) and N,N-dimethylformamide
(3.times.40 mL). Solution of
10-(4-(tert-butoxycarbonyl)phenoxy)decanoic acid (CNB, 3.00 g, 8.20
mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2-
,3]triazole 3-oxide tetrafluoroborate (TCTU, 2.93 g, 8.20 mmol) and
N,N-diisopropylethylamine (2.87 mL, 16.4 mmol) in
N,N-dimethylformamide (40 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (4.times.40 mL), dichloromethane (4.times.40
mL), N,N-dimethylformamide (4.times.40 mL) and dichloromethane
(10.times.40 mL).
[0355] The product was cleaved from the resin by the treatment with
2,2,2-trifluoroethanol (40 mL) overnight. Resin was filtered off
and washed with dichloromethane (4.times.40 mL). The solvent was
evaporated to dryness to afford pure
(S)-22-(tert-butoxycarbonyl)-33-(4-(tert-butoxycarbonyl)
phenoxy)-10,19,24-trioxo-3,6,12,15-tetraoxa-9,18,23-triazatritriacontanoi-
c acid as yellow oil.
[0356] Yield: 2.26 g (100%).
[0357] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.95-7.87 (m, 2H);
7.41-7.32 (m, 1H); 7.05-6.95 (m, 1H); 6.92-6.82 (m, 2H); 6.61 (d,
J=7.7 Hz, 1H); 4.49-4.37 (m, 1H); 4.15 (s, 2H); 4.04-3.95 (m, 4H);
3.76-3.36 (m, 17H); 2.39-2.09 (m, 5H); 2.04-1.85 (m, 1H); 1.84-1.70
(m, 2H); 1.67-1.52 (m, 10H); 1.50-1.39 (m, 11H); 1.37-1.24 (m,
8H).
[0358] LC-MS purity: 100% (ELSD).
[0359] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 50:50 to 100:0+0.1% FA): 4.49 min.
[0360] LC-MS m/z: 841.2 (M+H).sup.+.
[0361] Wang-Fmoc-Lys(Mtt)-OH resin 0.33 mmol/g (3, 4.15 g, 1.37
mmol) was left to swell in dichloromethane (50 mL) for 30 minutes.
Mtt group was removed by treatment with 80%
1,1,1,3,3,3-hexafluoropropan-2-ol in dichloromethane (2.times.5
min, 2.times.10 min, 1.times.15 min, 1.times.30 min, 6.times.50
mL). Resin 3 was washed with dichloromethane (4.times.70 mL), 10%
N,N-diisopropylethylamine in dichloromethane (1.times.50 mL) and
dichloromethane (2.times.50 mL).
[0362] A solution of
(S)-22-(tert-butoxycarbonyl)-33-(4-(tert-butoxycarbonyl)phenoxy)-10,19,24-
-trioxo-3,6,12,15-tetraoxa-9,18,23-triazatritriacontanoic acid (2,
2.30 g, 2.73 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 0.97 g, 2.73 mmol) and
N,N-diisopropylethylamine (1.20 mL, 6.85 mmol) in
N,N-dimethylformamide (50 mL) was added to resin and mixture was
shaken overnight. Resin was filtered and washed with
N,N-dimethylformamide (4.times.50 mL), dichloromethane (4.times.50
mL) and N,N-dimethylformamide (4.times.50 mL). Fmoc group was
removed by treatment with 20% piperidine in N,N-dimethylformamide
(1.times.10 min, 1.times.30 min, 2.times.50 mL). Resin was washed
with N,N-dimethylformamide (3.times.50 mL), 2-propanol (2.times.50
mL), dichloromethane (3.times.50 mL) and N,N-dimethylformamide
(3.times.50 mL). A solution of bromoacetic acid (0.76 g, 5.48
mmol), N,N'-diisopropylcarbodiimide (DIC, 0.85 mL, 5.48 mmol),
2,4,6-collidine (0.91 mL, 5.48 mmol) in N,N-dimethylformamide (50
mL) was added to resin and mixture was shaken for 1 hour. Resin was
filtered and washed with N,N-dimethylformamide (4.times.50 mL),
dichloromethane (4.times.50 mL), N,N-dimethylformamide (4.times.50
mL) and dichloromethane (10.times.40 mL). The product (4) was
cleaved from the resin by the treatment with trifluoroacetic
acid/dichloromethane mixture (2:1, 30 mL) for 3 hours. Resin was
filtered off and washed with dichloromethane (4.times.40 mL). The
solvent was evaporated to dryness to afford pure
(2S,29S)-29-(2-bromoacetamido)-2-(10-(4-carboxyphenoxy)decanamido)-5,14,2-
3-trioxo-9,12,18,21-tetraoxa-6,15,24-triazatriacontanedioic acid
(4) as yellow oil.
[0363] Yield: 1.33 g (100%). 1H NMR spectrum (300 MHz, DMSO-d6+DCl,
dH): 7.93-7.76 (m, 2H); 7.05-6.89 (m, 2H); 4.16-4.05 (m, 3H);
4.05-3.93 (m, 2H); 3.93-3.79 (m, 5H); 3.60-3.48 (m, 9H); 3.46-3.32
(m, 4H); 3.30-3.21 (m, 2H); 3.21-3.12 (m, 2H); 3.10-3.00 (m, 2H);
2.19-1.77 (m, 6H); 1.77-1.49 (m, 7H); 1.48-1.22 (m, 12H).
[0364] LC-MS purity: 95% (ELSD).
[0365] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 3.02 min.
[0366] LC-MS m/z: 977.3 (M+H).sup.+.
Example 10.9: Preparation of
4-[12-[[(1S)-4-[2-[2-[2-[2-[2-[2-[[(6S)-6-[(2-bromoacetyl)amino]-6-carbox-
yhexyl]amino]-2-oxoethoxy]ethoxy]ethylamino]-2-oxoethoxy]ethoxy]ethylamino-
]-1-carboxy-4-oxobutyl]amino]-12-oxododecoxy]benzoic Acid
##STR00063##
[0368] 2-Chlorotrityl chloride resin 100-200 mesh 1.5 mmol/g (2.60
g, 3.90 mmol) was left to swell in dry dichloromethane (40 mL) for
30 minutes. A solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-OEG-OH, 1.02 g, 2.60 mmol) and N,N-diisopropylethylamine
(1.75 mL, 10.0 mmol) in dry dichloromethane (40 mL) was added to
resin and the mixture was shaken overnight. Resin was filtered and
treated with a solution of N,N-diisopropylethylamine (0.90 mL, 5.20
mmol) in methanol/dichloromethane mixture (4:1, 2.times.5 min,
2.times.40 mL). Then resin was washed with N,N-dimethylformamide
(4.times.40 mL), dichloromethane (4.times.40 mL) and
N,N-dimethylformamide (4.times.40 mL). Fmoc group was removed by
treatment with 20% piperidine in N,N-dimethylformamide (1.times.10
min, 1.times.30 min, 2.times.40 mL). Resin was washed with
N,N-dimethylformamide (3.times.40 mL), 2-propanol (2.times.40 mL),
dichloromethane (3.times.40 mL) and N,N-dimethylformamide
(3.times.40 mL). Solution of
{2-[2-(9H-fluoren-9-ylmethoxycarbonylamino)-ethoxy]-ethoxy}-acetic
acid (Fmoc-OEG-OH, 3.06 g, 7.90 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 2.82 g, 7.90 mmol) and
N,N-diisopropylethylamine (2.76 mL, 15.0 mmol) in
N,N-dimethylformamide (40 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (4.times.40 mL), dichloromethane (4.times.40
mL) and N,N-dimethylformamide (4.times.40 mL). Fmoc group was
removed by treatment with 20% piperidine in N,N-dimethylformamide
(1.times.10 min, 1.times.30 min, 2.times.40 mL). Resin was washed
with N,N-dimethylformamide (3.times.40 mL), 2-propanol (2.times.40
mL), dichloromethane (3.times.40 mL) and N,N-dimethylformamide
(3.times.40 mL). Solution of
(S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-pentanedioic acid
1-tert-butyl ester (Fmoc-L-Glu-OtBu, 3.40 g, 7.90 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 2.82 g, 7.90 mmol) and
N,N-diisopropylethylamine (2.76 mL, 15.0 mmol) in
N,N-dimethylformamide (40 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (4.times.40 mL), dichloromethane (4.times.40
mL) and N,N-dimethylformamide (4.times.40 mL). Fmoc group was
removed by treatment with 20% piperidine in N,N-dimethylformamide
(1.times.10 min, 1.times.30 min, 2.times.40 mL). Resin was washed
with N,N-dimethylformamide (3.times.40 mL), 2-propanol (2.times.40
mL), dichloromethane (3.times.40 mL) and N,N-dimethylformamide
(3.times.40 mL). Solution of
12-(4-(tert-butoxycarbonyl)phenoxy)dodecanoic acid (CUB, 3.12 g,
7.90 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2-
,3]triazole 3-oxide tetrafluoroborate (TCTU, 2.82 g, 7.90 mmol) and
N,N-diisopropylethylamine (2.76 mL, 15.0 mmol) in
N,N-dimethylformamide (40 mL) was added to resin and mixture was
shaken for 1 hour. Resin was filtered and washed with
N,N-dimethylformamide (4.times.40 mL), dichloromethane (4.times.40
mL), N,N-dimethylformamide (4.times.40 mL) and dichloromethane
(10.times.40 mL).
[0369] The product was cleaved from the resin by the treatment with
2,2,2-trifluoroethanol (40 mL) overnight. Resin was filtered off
and washed with dichloromethane (4.times.40 mL). The solvent was
evaporated to dryness to afford pure
(S)-22-(tert-butoxycarbonyl)-35-(4-(tert-butoxycarbonyl)
phenoxy)-10,19,24-trioxo-3,6,12,15-tetraoxa-9,18,23-triazapentatriacontan-
oic acid as yellow oil.
[0370] Yield: 1.93 g (86%).
[0371] LC-MS purity: 100% (ELSD).
[0372] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 4.88 min.
[0373] LC-MS m/z: 869.2 (M+H).sup.+.
[0374] Wang-Fmoc-Lys(Mtt)-OH resin 0.33 mmol/g (3.40 g, 1.11 mmol)
was left to swell in dichloromethane (50 mL) for 30 minutes. Mtt
group was removed by treatment with 80%
1,1,1,3,3,3-hexafluoropropan-2-ol in dichloromethane (2.times.5
min, 2.times.10 min, 1.times.15 min, 1.times.30 min, 6.times.50
mL). Resin was washed with dichloromethane (4.times.70 mL), 10%
N,N-diisopropylethylamine in dichloromethane (1.times.50 mL) and
dichloromethane (2.times.50 mL).
[0375] A solution of
(S)-22-(tert-butoxycarbonyl)-35-(4-(tert-butoxycarbonyl)phenoxy)-10,19,24-
-trioxo-3,6,12,15-tetraoxa-9,18,23-triazapentatriacontanoic acid
(1.93 g, 2.22 mmol),
5-chloro-1-((dimethylamino)(dimethyliminio)methyl)-1H-benzo[d][1,2,3]tria-
zole 3-oxide tetrafluoroborate (TCTU, 0.79 g, 2.22 mmol) and
N,N-diisopropylethylamine (0.86 mL, 6.66 mmol) in
N,N-dimethylformamide (50 mL) was added to resin and mixture was
shaken overnight. Resin was filtered and washed with
N,N-dimethylformamide (4.times.50 mL), dichloromethane (4.times.50
mL) and N,N-dimethylformamide (4.times.50 mL). Fmoc group was
removed by treatment with 20% piperidine in N,N-dimethylformamide
(1.times.10 min, 1.times.30 min, 2.times.50 mL). Resin was washed
with N,N-dimethylformamide (3.times.50 mL), 2-propanol (2.times.50
mL), dichloromethane (3.times.50 mL) and N,N-dimethylformamide
(3.times.50 mL). A solution of bromoacetic acid (0.62 g, 4.44
mmol), N,N'-diisopropylcarbodiimide (DIC, 0.69 mL, 4.44 mmol) and
2,4,6-collidine (0.59 mL, 4.44 mmol) in N,N-dimethylformamide (50
mL) was added to resin and mixture was shaken for 1 hour. Resin was
filtered and washed with N,N-dimethylformamide (4.times.50 mL),
dichloromethane (4.times.50 mL), N,N-dimethylformamide (4.times.50
mL) and dichloromethane (10.times.40 mL). The product was cleaved
from the resin by the treatment with trifluoroacetic
acid/dichloromethane mixture (2:1, 30 mL) for 3 hours. Resin was
filtered off and washed with dichloromethane (4.times.40 mL). The
solvent was evaporated to dryness to afford pure
(2S,29S)-29-(2-bromoacetamido)-2-(12-(4-carboxyphenoxy)dodecanamido)-5,14-
,23-trioxo-9,12,18,21-tetraoxa-6,15,24-triazatriacontanedioic acid
as yellow oil.
[0376] Yield: 1.10 g (99%).
[0377] 1H NMR spectrum (300 MHz, DMSO-d6+DCl, dH): 7.93-7.74 (m,
2H); 7.06-6.86 (m, 2H); 4.20-3.93 (m, 5H); 3.92-3.78 (m, 6H); 3.54
(s, 9H); 3.46-2.94 (m, 12H); 2.19-1.84 (m, 5H); 1.81-1.52 (m, 6H);
1.51-1.23 (m, 15H).
[0378] LC-MS purity: 97% (ELSD).
[0379] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 3.20 min.
[0380] LC-MS m/z: 1005.3 (M+H).sup.+.
Example 10.10: Preparation of
(2S)-5-[2-[2-[2-[2-[2-[2-[2-[(2-bromoacetyl)amino]ethylamino]-2-oxoethoxy-
]ethoxy]ethylamino]-2-oxoethoxy]ethoxy]ethylamino]-5-oxo-2-[16-(1H-tetrazo-
l-5-yl)hexadecanoylamino]pentanoic Acid
##STR00064##
[0382] 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride
(EDCHCl, 6.25 g, 32.6 mmol) was added to a stirred solution of
16-(1H-tetrazol-5-yl)hexadecanoic acid (1, 5.28 g, 16.3 mmol) and
N-hydroxysuccinic imide (HOSu, 3.75 g, 32.6 mmol) in
N,N-dimethylformamide (70 mL) and mixture was stirred overnight.
The reaction mixture was diluted with 1 M aqueous solution of
hydrochloric acid (400 mL). The crude product was extracted with
ethyl acetate (4.times.400 mL) and the organic phase was dried over
anhydrous sodium sulfate. After filtration the solvent was removed
under reduced pressure. 2-Propanol (100 mL) was added to the oily
residue and the precipitated white solid was filtered off. The pure
product (2) was obtained by recrystallization from 2-propanol (70
mL) as white microcrystalline solid.
[0383] Yield: 4.73 g (69%).
[0384] RF (SiO2, ethyl acetate): 0.35.
[0385] 1H NMR spectrum (300 MHz, AcOD-d4, dH): 3.02 (t, J=7.7 Hz,
2H); 2.86 (s, 4H); 2.62 (t, J=7.3 Hz, 2H); 1.90-1.63 (m, 4H); 1.30
(bs, 22H).
[0386] 2-Chlorotrityl resin bound Fmoc-gGlu(tBu)-OEG-OEG-(11.5
mmol, preparation is described in the procedure for synthesis of
the protractor of Example 10.6) was left to swell in
dichloromethane (100 mL) for 20 minutes. Resin was washed with
N,N-dimethylformamide (2.times.100 mL). Fmoc group was removed by
treatment with 20% piperidine in N,N-dimethylformamide (1.times.5
min, 1.times.30 min, 2.times.100 mL). Resin was washed with
N,N-dimethylformamide (3.times.100 mL), 2-propanol (2.times.100 mL)
and dichloromethane (8.times.100 mL). The product was cleaved from
resin by treatment with 1,1,1,3,3,3-hexafluoro-2-propanol in
dichloromethane (2:8, 80 mL) for 2 hours. Resin was filtered off
and washed with dichloromethane (2.times.80 mL). Solutions were
combined; solvents evaporated to obtain product (4) as brownish
oil. The crude product contained 2 equivalents of
1,1,1,3,3,3-hexafluoro-2-propanol.
[0387] Yield: 9.49 g (99%, counted for adduct with 2 equivalents of
HFIP).
[0388] 1H NMR spectrum (300 MHz, CDCl3, dH): 7.72-7.64 (m, 1H);
7.59-7.50 (m, 1H); 4.00 (s, 2H); 3.94 (s, 2H); 3.94-3.85 (m, 1H);
3.71-3.32 (m, 16H); 2.56-2.45 (m, 2H); 2.42-2.26 (m, 1H); 2.16-2.02
(m, 1H); 1.49 (s, 9H).
[0389] To a solution of the above acid (6.10 g, 7.93 mmol) in
tetrahydrofuran (50 mL) and 2,5-dioxopyrrolidin-1-yl
16-(1H-tetrazol-5-yl)hexadecanoate (2, 3.33 g, 7.93 mmol) was added
N,N-diisopropylethylamine (6.91 mL, 39.6 mmol) and the reaction
mixture was stirred overnight. Then the solvent was removed under
reduced pressure and the residue purified by flash column
chromatography (Silicagel 60, 0.040-0.063 mm; eluent:
dichloromethane/methanol/acetic acid 15:1:0.2 to 5:1:0.2). Residual
acetic acid was removed by freeze-drying from acetonitrile/water
mixture 1:1 giving pure (5) as off-white solid.
[0390] Yield: 1.39 g (22%).
[0391] 1H NMR spectrum (300 MHz, DMSO-d6, dH): 8.13-8.07 (m, 1H);
8.01-7.93 (m, 1H); 7.74-7.68 (m, 1H); 4.11-3.99 (m, 1H); 3.88 (s,
2H); 3.82 (s, 2H); 3.62-3.49 (m, 8H); 3.49-3.37 (m, 4H); 3.33-3.15
(m, 4H); 2.73-2.65 (m, 2H); 2.18-2.03 (m, 4H); 1.94-1.81 (m, 1H);
1.80-1.67 (m, 1H); 1.66-1.53 (m, 2H); 1.53-1.41 (m, 2H); 1.38 (s,
9H); 1.23 (s, 22H).
[0392] To a solution of the above compound (1.39 g, 1.73 mmol),
1-((dimethylamino)(dimethyliminio)methyl)-1H-[1,2,3]triazolo[4,5-b]pyridi-
ne 3-oxide hexafluorophosphate(V) (HATU, 657 mg, 1.73 mmol) and
N,N-diisopropylethylamine (1.21 mL, 6.90 mmol) in
N,N-dimethylformamide (30 mL) was added benzyl
(2-aminoethyl)carbamate (6, 400 mg, 1.73 mmol) and the reaction
mixture was stirred overnight. Then the solvent was removed under
reduced pressure and the residue was purified by flash column
chromatography (Silicagel 60, 0.040-0.063 mm; eluent: ethyl
acetate/methanol/acetic acid 15:1:0.2 to
dichloromethane/methanol/acetic acid 15:1:0.2) giving pure product
(7) as brownish sticky solid.
[0393] Yield: 1.63 g (97%).
[0394] 1H NMR spectrum (300 MHz, AcOD-d4, dH): 7.35 (bs, 5H);
5.25-5.12 (m, 2H); 4.50-4.42 (m, 1H); 4.14 (s, 2H); 4.09 (s, 2H);
3.79-3.30 (m, 20H); 3.02 (t, J=7.6 Hz, 2H); 2.46-2.27 (m, 4H);
2.26-2.09 (m, 1H); 2.05-1.92 (m, 1H); 1.88-1.72 (m, 2H); 1.72-1.53
(m, 2H); 1.47 (s, 9H); 1.29 (bs, 22H).
[0395] To a solution of the above compound (1.63 g, 1.67 mmol) in
methanol was added palladium on carbon (10%, 0.25 g, 0.23 mmol)
under hydrogen blanket and the reaction mixture was vigorously
stirred for 2 hours. Then the reaction mixture was filtered through
a short pad of diatomite and washed with methanol. The solvent was
removed under reduced pressure giving pure product (8) as white
solid foam.
[0396] Yield: 1.32 g (94%).
[0397] 1H NMR spectrum (300 MHz, AcOD-d4, dH): 4.50-4.42 (m, 1H);
4.16-4.10 (m, 4H); 3.71-3.61 (m, 14H); 3.59-3.51 (m, 2H); 3.51-3.45
(m, 2H); 3.40-3.32 (m, 2H); 3.02 (t, J=7.6 Hz, 2H); 2.45-2.28 (m,
4H); 2.27-2.12 (m, 1H); 2.05-1.93 (m, 1H); 1.89-1.74 (m, 2H);
1.70-1.58 (m, 2H); 1.47 (s, 9H); 1.30 (bs, 22H).
[0398] The above compound (1.32 g, 1.57 mmol) was dissolved in a
mixture of trifluoroacetic acid (90 mL) and water (10 mL). After 90
minutes the volatiles were removed under reduced pressure and the
residue was evaporated with toluene (3.times.50 mL). The residue
was dissolved in N,N-dimethylformamide (15 mL) and cooled to
0.degree. C. Bromoacetic anhydride (678 mg, 2.61 mmol) and sodium
bicarbonate (2.02 g, 24.0 mmol) were added while stirring and the
reaction mixture was allowed to warm up to ambient temperature.
After 60 minutes additional bromoacetic anhydride (200 mg, 0.77
mmol) was added to complete the reaction. After 30 minutes the
solvent was removed under reduced pressure giving brownish liquid
immiscible with dichloromethane, ethyl acetate and water. The
residue was placed to separatory funnel and tried to dissolve in
ethyl acetate (50 mL) and water (50). It created three phases.
Ethyl acetate phase and water phase were removed and the third
phase was purified by preparative HPLC (Column labio DeltaPak C18,
15 mm, 50.times.500 mm, acetonitrile/water 25:75 to 50:50+0.05%
TFA). Resulting solution was freeze-dried to give the title product
(9) as white solid.
[0399] Yield: 210 mg (15%).
[0400] 1H NMR spectrum (300 MHz, AcOD-d4, dH): 4.64-4.56 (m, 1H);
4.12 (s, 2H); 4.10 (s, 2H); 3.95 (s, 2H); 3.77-3.59 (m, 12H);
3.59-3.37 (m, 8H); 3.02 (t, J=7.6 Hz, 2H); 2.44 (t, J=7.8 Hz, 2H);
2.34 (t, J=8.0 Hz, 2H); 2.28-2.18 (m, 1H); 2.15-2.04 (m, 1H);
1.86-1.70 (m, 2H); 1.70-1.56 (m, 2H), 1.29 (bs, 22H).
[0401] LC-MS purity: 100%.
[0402] LC-MS Rt (Kinetex C18, 4.6 mm.times.50 mm,
acetonitrile/water 20:80 to 100:0+0.1% FA): 3.35 min.
[0403] LC-MS m/z: 908.8 (M+H).sup.+.
Example 11: Preparation of MIC-1 Compounds with Protractors
Example 11.1: Compound 01
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-
-4-(17-carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino-
]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-29,ThrA-28,SerA-27-
,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,S-
erA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-
-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-3-
0,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadec-
anoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]-
amino]ethylamino]-2-oxoethyl]CysB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB--
24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15-
,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB--
5,ProB-4,SerB-3,GluB-2,GlyB-1,des-AsnA3,AsnB3-MIC-1
##STR00065##
[0405] 30 mg protractor (example 10.4, 8 equivalents) was dissolved
in 1.5 mL of sat. NaHCO.sub.3 and added to 108 mg MIC-1 polypeptide
with N-extension (SEQ ID NO: 288) in PBS buffer, pH 7.4, 2.1 mg/mL.
Added 19 mg bis(p-sulfonatophenyl)phenylphosphine, Kalium salt
dihydrate, Sigma-Aldrich 698539 (8 equivalent). After 24 h standing
at room temperature the protein was purified on a C4 reverse phase
column using a 10-50% ethanol/phosphate buffer pH 3.0 gradient.
Yield .about.20% after purification.
[0406] Theoretical mass: 32006.3; Found: 32006.5.
Example 11.2: Compound 02
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2--
[[(4S)-4-carboxy-4-(17-carboxyheptadecanoylamino)butanoyl]amino]ethoxy]eth-
oxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-27-
,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,S-
erA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-
-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-3-
0,AlaB-29,ThrB-28,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-
-carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox-
y]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysB-27,GlyB-26,SerB-25,GluB--
24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15-
,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB--
5,ProB-4,SerB-3,GluB-2,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00066##
[0408] Compound 02 was prepared using the procedure described in
example 11.1 using MIC-1 polypeptide with N-extension (SEQ ID NO:
291).
[0409] Theoretical mass: 31974.3; Found: 31974.0
Example 11.3: Compound 03
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2--
[[(4S)-4-carboxy-4-(15-carboxypentadecanoylamino)butanoyl]amino]ethoxy]eth-
oxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-27-
,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,S-
erA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-
-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-3-
0,AlaB-29,ThrB-28,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(15-
-carboxypentadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox-
y]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysB-27,GlyB-26,SerB-25,GluB--
24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15-
,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB--
5,ProB-4,SerB-3,GluB-2,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00067##
[0411] Compound 03 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.2 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 291).
[0412] Theoretical mass: 31918.2; Found: 31918.0.
Example 11.4: Compound 04
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2--
[[(4S)-4-carboxy-4-(13-carboxytridecanoylamino)butanoyl]amino]ethoxy]ethox-
y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-27,G-
lyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,Ser-
A-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8-
,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,-
AlaB-29,ThrB-28,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(13-c-
arboxytridecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]et-
hoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysB-27,GlyB-26,SerB-25,GluB-24,T-
hrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,Pro-
B-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,Pr-
oB-4,SerB-3,GluB-2,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00068##
[0414] Compound 04 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.3 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 291).
[0415] Theoretical mass: 31862.1; Found: 31862.0.
Example 11.5: Compound 05
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,S{Beta}-[2-[2-[[2-[2-[2-[[-
2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoylamino)butanoyl]amino]et-
hoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]]acetyl]amino]ethylamino]-2-oxoethy-
l]CysA-26SerA-25GluA-24ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,Ser-
A-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8-
,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,-
AlaB-29,ThrB-28,SerB-27,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-
-4-(17-carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino-
]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysB-26,SerB-25,GluB-24-
,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,P-
roB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,-
ProB-4,SerB-3,GluB-2,GlyB-1[LeuA57,LeuA86,LeuB57,LeuB86],des-AsnA3,AsnB3-M-
IC-1
##STR00069##
[0417] Compound 05 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.4 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 289).
[0418] Theoretical mass: 31962.2; Found: 31962.0.
Example 11.6: Compound 06
[0419]
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,GlyA-26,S{Beta}-[2--
[2-[[2-[12-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoylamino)b-
utanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethyla-
mino]-2-oxoethyl]CysA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,G-
luA-18,SerA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,Gly-
A-9,ThrA-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-3-
1,ProB-30,AlaB-29,ThrB-28,SerB-27,GlyB-26,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[-
2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoylamino)
butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethy-
lamino]-2-oxoethyl]CysB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19-
,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,G-
lyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1[LeuA57,LeuA8-
6,LeuB57,LeuB86],des-AsnA3,AsnB3-MIC-1
##STR00070##
[0420] Compound 06 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.4 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 303).
[0421] Theoretical mass: 31902.1; Found: 31902.0
Example 11.7: Compound 07
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,GlyA-26,SerA-25,GluA-24,Th-
rA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA-17,AlaA-16,S{Beta}-[2-[-
2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoylamino)but-
anoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy
]acetyl]amino]ethylamino]-2-oxoethyl]CysA-15,ProA-14,GluA-13,SerA-12,GlyA-
-11,ProA-10,GlyA-9,ThrA-8,SerA-7,ThrA-6,GluA-5,
ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,AlaB-29,ThrB-28,SerB--
27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18-
,SerB-17,AlaB-16,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17--
carboxyheptadecanoylamino)
butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethy-
lamino]-2-oxoethyl]CysB-15,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,-
ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1[LeuA57,LeuA86,LeuB-
57,LeuB86],des-AsnA3,AsnB3-MIC-1
##STR00071##
[0423] Compound 07 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.4 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 292).
[0424] Theoretical mass: 31874.1; Found: 31873.0.
Example 11.8: Compound 08
SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,GlyA-26,SerA-25,GluA-24,Th-
rA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA-117,AlaA-16,ThrA-15,Pro-
A-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8,SerA-7,ThrA-6,GluA-5,Pr-
oA-4,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyhepta-
decanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acet-
yl]amino]ethylamino]-2-oxoethyl]CysA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB--
30,AlaB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21-
,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,G-
lyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,S{Beta}-[2-[2-[[2-
-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoylamino)butanoyl-
]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-
-oxoethyl]CysB-3,GluB-2,GlyB-1[LeuA57,LeuA86,LeuB57,LeuB86],des-AsnA3,AsnB-
3-MIC-1
##STR00072##
[0426] Compound 08 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.4 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 293).
[0427] Theoretical mass: 31902.1; Found: 31901.0
Example 11.9 and Example 11.10: Compound 09 and Compound 10
Compound 09
N{B-32}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoy-
lamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amin-
o]methyl]phenyl]methyl-SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,Gly-
A-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA--
17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8,S-
erA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,Al-
aB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-
-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB-1-
1,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1[L-
euA57,LeuA86,LeuB57,LeuB86],des-AsnA3,AsnB3-MIC-1
Compound 10
N{A-32}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoy-
lamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amin-
o]methyl]phenyl]methyl,N{B-32}-[4-[[[2-[2-[12-[[2-[2-[12-[[(4S)-4-carboxy--
4-(17-carboxyheptadecanoylamino)
butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]meth-
yl]phenyl]methyl-SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,GlyA-26,S-
erA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA-17,Ala-
A-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8,SerA-7,-
ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,AlaB-29,-
ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-20,Se-
rB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-
-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1[LeuA57,-
LeuA86,LeuB57,LeuB86],des-AsnA3,AsnB3-MIC-1
##STR00073##
##STR00074##
[0429] 20 mg of protractor (example 10.1, 8 equivalents) dissolved
in 2 mL 40% Hydroxypropyl-beta-cyclodextrin was added to 75 mg of
MIC-1 polypeptide with N-extension (SEQ ID NO: 164) in 40 mL PBS
buffer, pH 7.4. 100 .mu.L of borane pyridine complex (8M) was
added. After 24 h standing at room temperature 20 mg of the
protractor and 100 .mu.L of borane reagent were added again.
[0430] After 48 h the mono and dialkylated protein mixture was
purified on a C4 reverse phase column using a 10-50%
ethanol/phosphate buffer pH 3.0 gradient. Yield .about.19%
monoalkylated protein (Compound 09) and 6% dialkylated protein
(Compound 10) after purification.
[0431] Compound 09: Theoretical mass: 31073.0; Found: 31073.5
[0432] Compound 10: Theoretical mass: 31908.1; Found: 31908.5
Example 11.11: Compound 11
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-
-4-(17-carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino-
]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-29,ThrA-28,SerA-27-
,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,S-
erA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-
-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-3-
0,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadec-
anoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]-
amino]ethylamino]-2-oxoethyl]CysB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB--
24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15-
,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB--
5,ProB-4,SerB-3,GluB-2,GlyB-1[LeuA57,LeuA86,LeuB57,LeuB86],des-AsnA3,AsnB3-
-MIC-1
##STR00075##
[0434] Compound 11 was prepared using the procedure described in
example 11.1 using the protractor described in example 10.4 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 290).
[0435] Theoretical mass: 31934.1; Found: 31938.5.
Example 11.12 and Example 11.13: Compound 12 and Compound 13
Compound 12
N{A-9}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoyl-
amino)
butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amin-
o]methyl]phenyl]methyl,N{B-9}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(-
17-carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]eth-
oxy]ethoxy]acetyl]amino]methyl]phenyl]methyl-GluA-9,GluA-8,AlaA-7,GluA-6,A-
laA-5,AspA-4,AspA-3,AspA-2,AspA-1,GluB-9,GluB-8,AlaB-7,GluB-6,AlaB-5,AspB--
4,AspB-3,AspB-2,AspB-1[LysA1,GluA2,SerA3,LysB1,GluB2,SerB3]-MIC-1
Compound 13
N{B-9}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoyl-
amino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino-
]methyl]phenyl]methyl-GluA-9,GluA-8,AlaA-7,GluA-6,AlaA-5,AspA-4,AspA-3,Asp-
A-2,AspA-1,GluB-9,GluB-8,AlaB-7,GluB-6,AlaB-5,AspB-4,AspB-3,AspB-2,AspB-1[-
LysA1,GluA2,SerA3,LysB1,GluB2,SerB3]-MIC-1
##STR00076##
##STR00077##
[0437] Compounds 12 and 13 were prepared using the procedure
described in example 11.10 using the protractor described in
example 10.1 and MIC-1 polypeptide with N-extension (SEQ ID NO:
311).
[0438] Compound 12: Theoretical mass: 28212.3; Found: 28211.9
[0439] Compound 13: Theoretical mass: 27377.2; Found: 27376.8
Example 11.14: Compound 14
N{A-9}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(11-carboxyundecanoylami-
no)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]me-
thyl]phenyl]methyl,N{B-9}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(11-c-
arboxyundecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]eth-
oxy]acetyl]amino]methyl]phenyl]methyl-GluA-9,GluA-8,AlaA-7,GluA-6,AlaA-5,A-
spA-4,AspA-3,AspA-2,AspA-1,GluB-9,GluB-8,AlaB-7,GluB-6,AlaB-5,AspB-4,AspB--
3,AspB-2,AspB-1[LysA1,GluA2,SerA3,LysB1,GluB2,SerB3]-MIC-1
##STR00078##
[0441] Compound 14 was prepared using the procedure described in
example 11.10 using the protractor described in example 10.5 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 311).
[0442] Theoretical mass: 28043.9; Found: 28043.6.
Example 11.15 and Example 11.16: Compound 15 and Compound 16
Compound 15
N{B-32}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoy-
lamino)
butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]ami-
no]methyl]phenyl]methyl-SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,Gl-
yA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA-
-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8,-
SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,A-
laB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,Thr-
B-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB--
11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1[-
LeuA57,ArgA69,LeuA86,ArgA91,ArgA107,LeuB57,ArgB69,LeuB86,ArgB91,ArgB107],d-
es-AsnA3,AsnB3-MIC-1
Compound 16
N{A-32}-[4-[[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-carboxyheptadecanoy-
lamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amin-
o]methyl]phenyl]methyl,N{B-32}-[4-[[II[2-[2-[12-[[2-[2-[12-[[(4S)-4-carbox-
y-4-(17-carboxyheptadecanoylamino)
butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]meth-
yl]phenyl]methyl-SerA-32,GluA-31,ProA-30,AlaA-29,ThrA-28,SerA-27,GlyA-26,S-
erA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA-17,Ala-
A-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8,SerA-7,-
ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,AlaB-29,-
ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-20,Se-
rB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-
-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1[LeuA57,-
ArgA69,LeuA86,ArgA91,ArgA107,LeuB57,ArgB69,LeuB86,ArgB91,ArgB107],des-AsnA-
3,AsnB3-MIC-1
##STR00079##
##STR00080##
[0444] Compounds 15 and 16 were prepared using the procedure
described in example 11.10 using the protractor described in
example 10.1 and MIC-1 polypeptide with N-extension (SEQ ID NO:
312).
[0445] Compounds 15: Theoretical mass: 31241.1; Found: 31242.0.
[0446] Compounds 16: Theoretical mass: 32076.0; Found: 32075.0.
Example 11.17: Compound 17
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-
-4-(16-sulfohexadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]et-
hoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-29,ThrA-28,SerA-27,Gl-
yA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-19,GluA-18,SerA-
-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-10,GlyA-9,ThrA-8,-
SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,GluB-31,ProB-30,S-
{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(16-sulfohexadecanoyla-
mino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]-
ethylamino]-2-oxoethyl]CysB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,Thr-
B-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB--
14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-
-4,SerB-3,GluB-2,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00081##
[0448] 4 mL 2M TRIS buffer was added to 176 mg of MIC-1 polypeptide
with N-extension (SEQ ID NO: 288) in 15 mM citric acid/450 mM
sodium chloride, pH 3, 2.2 mg/mL. The protractor described in
Example 10.6 was dissolved in saturated sodium hydrogen carbonate
to 20 mg/L, 8 equivalents. The protractor was then added to the
polypeptide solution. 12.4 mg of
bis(p-sulfonatophenyl)phenylphosphine, kalium salt dihydrate,
Sigma-Aldrich 698539 dissolved in water (0.1 mg/mL) were added and
the reaction mixture was gently shaken for 10 s. After 6 hours the
compound was purified on a C4 column using a C4 reverse phase
column using a 10-50% ethanol/phosphate buffer pH 3.0.
[0449] Theoretical mass: 32050.3; Found: 32050.0.
Example 11.18: Compound 18
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[[(5S)-5-carboxy-5-[[2-[2-[2-[[2-[2-[2--
[4-[17-(1H-tetrazol-5-yl)heptadecanoylsulfamoyl]butanoylamino]ethoxy]ethox-
y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]pentyl]amino]-2-oxoethyl]CysA-29-
,ThrA-28,SerA-27,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,S-
erA-19,GluA-18,SerA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,Pro-
A-10,GlyA-9,ThrA-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-3-
2,GluB-31,ProB-30,S{Beta}-[2-[[(5S)-5-carboxy-5-[[2-[2-[2-[[2-[2-[2-[4-[17-
-(1H-tetrazol-5-yl)heptadecanoylsulfamoyl]butanoylamino]ethoxy]ethoxy]acet-
yl]amino]ethoxy]ethoxy]acetyl]amino]pentyl]amino]-2-oxoethyl]CysB-29,ThrB--
28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19-
,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,G-
lyB-9,ThrB-8,SerB-7,ThrB-6,Glu
B-5,ProB-4,SerB-3,GluB-2,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00082##
[0451] Compounds 18 was prepared using the procedure described in
Example 11.17 using the protractor described in Example 10.7 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 288).
[0452] Theoretical mass: 32266.6; Found: 32266.0.
Example 11.19: Compound 19
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[[(1S)-1-carboxy-5-[[2-[2-[2-[[2-[2-[2--
[[(4S)-4-carboxy-4-[10-(4-carboxyphenoxy)decanoylamino]butanoyl]amino]etho-
xy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]pentyl]amino]-2-oxoethyl-
]CysA-29,ThrA-28,SerA-27,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,T-
hrA-20,SerA-19,GluA-18,SerA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,Gly-
A-11,ProA-10,GlyA-9,ThrA-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA--
1,SerB-32,GluB-31,ProB-30,S{Beta}-[2-[[(1S)-1-carboxy-5-[[2-[2-[2-[[2-[2-[-
2-[[(4S)-4-carboxy-4-[10-(4-carboxyphenoxy)decanoylamino]butanoyl]amino]et-
hoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]pentyl]amino]-2-oxoeth-
yl]CysB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21-
,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,G-
lyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,Gly-
B-1des-AsnA3,AsnB3-MIC-1
##STR00083##
[0454] Compounds 19 was prepared using the procedure described in
Example 11.17 using the protractor described in Example 10.8 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 288).
[0455] Theoretical mass: 32166.3; Found: 32166.0.
Example 11.20: Compound 20
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[[(1S)-1-carboxy-5-[[2-[2-[2-[[2-[2-[2--
[[(4S)-4-carboxy-4-[12-(4-carboxyphenoxy)dodecanoylamino]butanoyl]amino]et-
hoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]pentyl]amino]-2-oxoeth-
yl]CysA-29,ThrA-28,SerA-27,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21-
,ThrA-20,SerA-19,GluA-18,SerA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,G-
lyA-11,ProA-10,GlyA-9,ThrA-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,Gly-
A-1,SerB-32,GluB-31,ProB-30,S{Beta}-[2-[[(1S)-1-carboxy-5-[[2-[2-[2-[[2-[2-
-[2-[[(4S)-4-carboxy-4-[12-(4-carboxyphenoxy)dodecanoylamino]butanoyl]amin-
o]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]pentyl]amino]-2-ox-
oethyl]CysB-29,ThrB-28,SerB-27,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,Gly-
B-21,ThrB-20,SerB-19,GluB-18,SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB--
12,GlyB-11,ProB-10,GlyB-9,ThrB-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2-
,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00084##
[0457] Compounds 20 was prepared using the procedure described in
Example 11.17 using the protractor described in Example 10.9 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 288).
[0458] Theoretical mass: 32222.4; Found: 32222.0.
Example 11.21: Compound 21
SerA-32,GluA-31,ProA-30,S{Beta}-[2-[12-[[2-[2-[12-[[2-[2-[12-[[(4S)-4-carb-
oxy-4-[16-(1H-tetrazol-5-yl)hexadecanoylamino]butanoyl]amino]ethoxy]ethoxy-
]acetyl]amino]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysA-29,Th-
rA-28,SerA-27,GlyA-26,SerA-25,GluA-24,ThrA-23,ProA-22,GlyA-21,ThrA-20,SerA-
-19,GluA-18,SerA-17,AlaA-16,ThrA-15,ProA-14,GluA-13,SerA-12,GlyA-11,ProA-1-
0,GlyA-9,ThrA-8,SerA-7,ThrA-6,GluA-5,ProA-4,SerA-3,GluA-2,GlyA-1,SerB-32,G-
luB-31,ProB-30,S{Beta}-[2-[2-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[16-(1-
H-tetrazol-5-yl)hexadecanoylamino]butanoyl]amino]ethoxy]ethoxy]acetyl]amin-
o]ethoxy]ethoxy]acetyl]amino]ethylamino]-2-oxoethyl]CysB-29,ThrB-28,SerB-2-
7,GlyB-26,SerB-25,GluB-24,ThrB-23,ProB-22,GlyB-21,ThrB-20,SerB-19,GluB-18,-
SerB-17,AlaB-16,ThrB-15,ProB-14,GluB-13,SerB-12,GlyB-11,ProB-10,GlyB-9,Thr-
B-8,SerB-7,ThrB-6,GluB-5,ProB-4,SerB-3,GluB-2,GlyB-1des-AsnA3,AsnB3-MIC-1
##STR00085##
[0460] Compounds 21 was prepared using the procedure described in
Example 11.17 using the protractor described in Example 10.10 and
MIC-1 polypeptide with N-extension (SEQ ID NO: 288).
[0461] Theoretical mass: 32026.3; Found: 32026.0.
[0462] The structures of Compounds 01-21 are summarized in Table
18.
TABLE-US-00018 TABLE 18 The structures of MIC-1 compounds Compound
No N-extension MIC-1 polypeptide protractor Compound
SEPCTSGSETPGTSE MIC-1, des-N3 (SEQ Formula D 01 SATPESGPGTSTEPS ID
NO: 2) (C18) EG (SEQ ID NO: 225) Compound SEPATCGSETPGTSE MIC-1,
des-N3 (SEQ Formula D 02 SATPESGPGTSTEPS ID NO: 2) (C18) EG (SEQ ID
NO: 226) Compound SEPATCGSETPGTSE MIC-1, des-N3 (SEQ Formula B
(C16) 03 SATPESGPGTSTEPS ID NO: 2) EG (SEQ ID NO: 226) Compound
SEPATCGSETPGTSE MIC-1, des-N3 (SEQ Formula C (C14) 04
SATPESGPGTSTEPS ID NO: 2) EG (SEQ ID NO: 226) Compound
SEPATSCSETPGTSE MIC-1, des-N3, Formula D 05 SATPESGPGTSTEPS M57L,
M86L (SEQ ID (C18) EG (SEQ ID NO: NO: 222) 227) Compound
SEPATSGCETPGTSE MIC-1, des-N3, Formula D 06 SATPESGPGTSTEPS M57L,
M86L (SEQ ID (C18) EG (SEQ ID NO: NO: 222) 230) Compound
SEPATSGSETPGTSE MIC-1, des-N3, Formula D 07 SACPESGPGTSTEPS M57L,
M86L (SEQ ID (C18) EG (SEQ ID NO: NO: 222) 235) Compound
SEPATSGSETPGTSE MIC-1, des-N3, Formula D 08 SATPESGPGTSTEPC M57L,
M86L (SEQ ID (C18) EG (SEQ ID NO: NO: 222) 239) Compound
SEPATSGSETPGTSE MIC-1, des-N3, Formula A 09 SATPESGPGTSTEPS M57L,
M86L (SEQ ID (C18)* EG (SEQ ID NO: NO: 222) 71) Compound
SEPATSGSETPGTSE MIC-1, des-N3, Formula A (C18) 10 SATPESGPGTSTEPS
M57L, M86L (SEQ ID EG (SEQ ID NO: NO: 222) 71) Compound
SEPCTSGSETPGTSE MIC-1, des-N3, Formula D 11 SATPESGPGTSTEPS M57L,
M86L (SEQ ID (C18) EG (SEQ ID NO: NO: 222) 225) Compound EEAEADDDDK
(SEQ MIC-1, des-A1, R2E, Formula D 12 ID NO: 313) N3S (C18)
Compound EEAEADDDDK (SEQ MIC-1, des-A1, R2E, Formula D 13 ID NO:
313) N3S (SEQ ID (C18)* NO: 314) Compound EEAEADDDDK (SEQ MIC-1,
des-A1, R2E, Formula E (C12) 14 ID NO: 313) N3S (SEQ ID NO: 314)
Compound SEPATSGSETPGTSE MIC-1, del-N3, M57L, Formula A 15
SATPESGPGTSTEPS M86L, K69R, K107R, (C18)* EG (SEQ ID NO: K91R (SEQ
ID 71) NO: 315) Compound SEPATSGSETPGTSE MIC-1, del-N3, M57L,
Formula A (C18) 16 SATPESGPGTSTEPS M86L, K69R, K107R, EG (SEQ ID
NO: K91R (SEQ ID 71) NO: 315) Compound SEPCTSGSETPGTSE MIC-1,
des-N3 (SEQ Formula F 17 SATPESGPGTSTEPS ID NO: 2) EG (SEQ ID NO:
225) Compound SEPCTSGSETPGTSE MIC-1, des-N3 (SEQ Formula G 18
SATPESGPGTSTEPS ID NO: 2) EG (SEQ ID NO: 225) Compound
SEPCTSGSETPGTSE MIC-1, des-N3 (SEQ Formula H 19 SATPESGPGTSTEPS ID
NO: 2) EG (SEQ ID NO: 225) Compound SEPCTSGSETPGTSE MIC-1, des-N3
(SEQ Formula K 20 SATPESGPGTSTEPS ID NO: 2) EG (SEQ ID NO: 225)
Compound SEPCTSGSETPGTSE MIC-1, des-N3 (SEQ Formula J 21
SATPESGPGTSTEPS ID NO: 2) EG (SEQ ID NO: 225) Note: *means only one
protractor is attached to Compound 09, Compound 13 or Compound 15,
i.e. Compound 09, Compound 13 or Compound 15 as a dimer has only
one protractor attached to one of its two N-terminal extensions.
For the other Compounds, one protractor is attached to each of the
two N-terminal extensions of the dimer, i.e. two protractors per
dimer Compound.
Example 12: Solubility of MIC-1 Compounds
[0463] Samples of MIC-1 compounds was prepared in PBS buffer pH 7.4
followed by an up-concentrating the samples to above 35 mg/ml.
[0464] MIC-1 compound samples in PBS were concentrated on a
Vivaspin 20 10 kDa MWCO (Sartorius) according to the description in
the Vivaspin manual. A Heraus Multifuge X3R centrifuge equipped
with swinging-bucket rotor (Thermo Scientific) was used at 4000 rpm
(3310.times.g) to concentrate the MIC-1 compound samples. The
concentration was subsequently determined by measuring UV at 280 nm
on a Nanodrop 2000 (Thermo Scientific). The measured concentrations
are presented in Table 19.
TABLE-US-00019 TABLE 19 The solubility of MIC-1 compounds MIC-1
Solubility compounds (mg/ml) Compound 03 43 Compound 05 36 Compound
01 32 Compound 07 35 Compound 17 41 Compound 19 37 Compound 20 39
Compound 21 31
[0465] It can be seen that attaching various protractors does not
impact the improved solubility obtained by adding an N-terminal
amino acid extension to a MIC-1 polypeptide.
Example 13: In Vitro Potency and Binding Activity Assay of MIC-1
Compounds with Protractors
Cell Line
[0466] The stable cell line BHK21-hGFRAL-IRES-hRET was generated at
Novo Nordisk with the addition of a vector with the Serum Response
Element (SRE) in front of the luciferase reporter (See Example 5).
Sequence for human GFRAL and human RET was obtained at Uniprot:
UniProtKB--Q6UXVO (GFRAL_HUMAN) and UniProtKB--P07949 (RET_HUMAN).
This cell line was used for the functional luciferase assay as well
as for membrane preparation for Scintillation proximity assay (SPA)
binding.
[0467] Luciferase assay: BHK21 cells stably transfected with
hGFRAL, hRET receptors and SRE-Luciferase reporter genes were
treated by different concentrations of MIC-1 compounds. Activation
of receptors was measured by quantification of luciferase activity
and potencies of compounds were calculated by EC50.
[0468] SPA binding: Cell membrane of BHK21-hGFRAL-IRES-hRET,
SRE-Luciferase cells were isolated treated by 50 pM of 1125
labelled MIC-1 with different concentrations of MIC-1 compounds.
Binding potencies of MIC-1 compounds were calculated by IC50 of
displacement curves.
Luciferase Assay
[0469] Vials with frozen cells were rapidly thawed and the cells
moved to a 50 ml corning tube with 10 ml pre-warmed complete medium
consisting of DMEM with high glucose and sodium pyrovate, heat
inactivated 10% Fetal Bovine Serum, 1% Penicillin-Streptomycin, 1
mg/ml G418-Geneticin and 400 .mu.g/ml Hygromycin. Cells were
centrifuged at 1200 rpm and the supernatant was discarded. This
washing procedure was repeated once resulting in 2 times washing of
the cells. Cells were resuspended in complete media to a
concentration of 1.2.times.10.sup.6 cells per ml. Cells were seeded
1.2.times.10.sup.5 cells per well (100 .mu.l/well) in 96 well
Poly-D-Lysine coated assay palates. Cells were let to attach to the
bottom surface of the wells for 4-6 hours at +34.degree. C.
followed by change of medium to 80 .mu.l starvation medium
consisting of RPMI medium with 15 mM HEPES. Cells were left to
incubate over night at +34.degree. C. in a humidified milieu with
5% CO.sub.2. Test compounds were serial diluted in assay medium
consisting of RPMI, 15 mM HEPES and 0.5% ovalbumin with or without
5% human serum albumin (HSA). 20 .mu.l of assay buffer containing
test compounds was added to each well resulting in a final
concentration of 0.1% ovalbumin, 1% HSA and test compounds ranging
from 30000 pM to 3 pM with a blank included. Plates were incubated
for 4 hours at +37.degree. C. in a humidified milieu with 5%
CO.sub.2. After incubation, 100 .mu.l luciferase substrate
solutions was added to each well and sealed. The plate was let to
incubate for 15 minutes followed by reading of luminescence. An
intensity measurement of luminescence was used for calculations of
EC.sub.50 values by nonlinear regression analysis of sigmoidal dose
response curves.
SPA Binding
[0470] BHK21-hGFRAL-IRES-hRET cells were cultured at +37.degree. C.
in a humidified atmosphere with 5% CO.sub.2 in complete medium
consisting of DMEM with high glucose and sodium pyrovate, heat
inactivated 10% Fetal Bovine Serum, 1% Penicillin-Streptomycin, 1
mg/ml G418-Geneticin and 400 ug/ml Hygromycin. Cells were washed
twice in ice cold Dulbecco's phosphate-buffered saline (DPBS) and
detached mechanically by scraping, transferred in ice cold DPBS
into conical centrifuge tubes and centrifuged for 5 min at 1500 rpm
at +20.degree. C. Cell pellet was resuspended in a total amount of
10 ml ice cold homogenization buffer A (50 mM Tris, 2.5 mM EDTA,
adjust pH7.4 with one EDTA-free protease inhibitor cocktail
tablet/50 ml) and homogenized for 20 seconds. The homogenate was
centrifuged at 16000 rpm in 20 minutes at +4.degree. C. The
supernatant was discarded and the pellet was reconstituted in 10 ml
homogenization buffer B (50 mM Tris, 320 mM Sucrose, adjust pH 7.4
with one EDTA-free protease inhibitor cocktail tablet/50 ml) and
homogenized for 20 seconds and centrifuged at 16000 rpm in 20
minutes at +4.degree. C. This procedure was repeated one more time.
The supernatant was discarded and the pellet was reconstituted in 3
ml homogenization buffer B and homogenized for 10 seconds at low
speed. Protein concentration was determined by standard Bradford
method and 1.5 mg protein/tube was aliquoted to cryotubes and
stored at -80.degree. C. Binding assays were performed in white
96-well plates in a total volume of 200 .mu.l per well. Wheat germ
agglutinin SPA beads were reconstituted in assay buffer (50 mM
Tris/HCl, 4.5 mM MgCl.sub.2, 0.02% Tween 20 and 0.25% Ovalbumin pH
7.4) and mixed with membrane preparation to give a final
concentration of 0.5 mg SPA beads and 10 .mu.g total protein per
well. Fifty thousand counts per minute per well of the radio ligand
human [125I]-MIC-1 (Generated at Novo Nordisk) was added
corresponding to a concentration of 50 pM. MIC-1 compounds to be
tested were serial diluted in assay buffer to give a final assay
concentration ranging from 1 pM to 1 pM. The plate was sealed and
incubated at +22.degree. C. for 2 hours in a plate shaker set at
350 rpm and thereafter centrifuged at 1500 rpm for 10 minutes prior
to reading of SPA bead light emission. Displacement of radio ligand
was measured as reduction of light emission from SPA beads and
IC.sub.50 values were calculated by nonlinear regression analysis
of sigmoidal dose-response curves (Table 20).
TABLE-US-00020 TABLE 20 Potency and binding activity of MIC-1
compounds Luciferase Luciferase + 0.1% MIC-1 SPA Compound No/ NNDK
EC50 HSA NNDK EC50 binding IC50 SEQ ID NO (pM) (pM) (nM) SEQ ID NO:
1 59 36 0.67 SEQ ID NO: 164 85 64 119 SEQ ID NO: 288 70 47 6.7 SEQ
ID NO: 291 80 45 10 SEQ ID NO: 312 42 35 116 SEQ ID NO: 303 57 34
43 SEQ ID NO: 292 125 115 29 SEQ ID NO: 293 217 243 83 SEQ ID NO:
289 35 26 36 SEQ ID NO: 290 100 75 80 Compound 10 71 146 20
Compound 02 123 107 4.9 Compound 03 96 106 11 Compound 04 90 58 17
Compound 01 72 59 3.8 Compound 15 61 39 39 Compound 16 63 51 11
Compound 06 81 61 21 Compound 05 57 63 23 Compound 08 139 651 56
Compound 11 55 62 29 Compound 07 121 198 29 Compound 17 43 65 4.7
Compound 18 66 67 1.3 Compound 19 45 62 17 Compound 20 49 77 6.5
Compound 21 53 56 1.0
[0471] As can be seen from Table 20, MIC-1 compounds with fatty
acids have similar in vitro potency compared to MIC-1 polypeptides
without fatty acids. But in vitro potency would be lower if the Cys
mutation is close to N-terminal of MIC-1 polypeptide, such as Cys
mutation S(-3)C.
[0472] The finding that MIC-1 compounds with fatty acids have
similar potency as MIC-1 polypeptides without fatty acids is
surprising. In general, adding fatty acids to pharmaceutical
biological compounds for protraction results in a decrease in
potency and this decrease is in general further enhanced by
measuring the potency in the presence of albumin. Therefore, the
finding of no reduction in potency of MIC-1 compounds with fatty
acid protractors is unexpected.
Example 14: Effect of MIC-1 Compounds on Food Intake and Body
Weight in Lean Sprague Dawley Rats
[0473] The in vivo efficacy of MIC-1 compounds of the invention was
measured in 9-11 weeks old lean male Sprague Dawley rats. Animals
were injected daily with a dose of 8 nmol/kg body weight 1-2 hrs
before the onset of the dark period. Compounds were administrated
subcutaneously (1-4 ml/kg) in appropriate buffered solution.
Changes in food intake were measured for 7 days using automatic
food monitoring systems (BioDAQ system and HM2 system for rat). In
the BioDAQ system animals were single housed; and in the HM2 system
animals were in group housed with up to 3 animals per cage. On day
8, a tail blood sample was collected 2-3 hrs after administration
of compound, and this sample was used for measuring plasma
concentrations of administrated compounds. Each compound was tested
in n=4-8 animals. Animals were acclimatized for at least 7 days
prior to the experiment. Collected food intake data are expressed
as daily food intake (24 hour food intake) measured from the onset
of each daily 12 hour dark phase to the next day dark phase. Daily
changes in food intake in response to administrated compound were
calculated by subtracting the average daily food intake of the
vehicle group from the average daily food intake of the treatment
group. Changes were considered significant if p<0.1 using a
two-tailed student's t-test. Results are expressed as the "maximum
reduction" in food intake compared with vehicle (buffer solution,
percentage) recorded during the study period. Data are also
expressed as the "accumulated reduction" in food intake which as
the sum of significant (p<0.1) daily reductions in food intake
(percentage) during the study period. The body weight of the
animals was measured at the day of study termination using a
calibrated scale. The effect of treatment on the body weight was
calculated as the percentage difference in body weight between
compound treated animals compared with vehicle treated animals at
study termination (Table 21).
TABLE-US-00021 TABLE 21 Food intake and body weight reduction in SD
rats Food intake reduction Max efficacy @ Acc efficacy, 8 nmol/kg
[% 7 days [% Body weight reduction reduction reduction [% Compound
No/ compared to compared to compared with SEQ ID NO vehicle]
vehicle] vehicle] SEQ ID NO: 1 67 391 18.4 Compound 12 66 342 18.5
SEQ ID NO: 300 87 431 23.5 SEQ ID NO: 299 92 453 26.0 SEQ ID NO:
298 83 446 24.2 SEQ ID NO: 297 92 495 26.6 SEQ ID NO: 296 86 427
22.6 SEQ ID NO: 295 92 533 29.5 SEQ ID NO: 311 77 420 23.4 Compound
13 75 431 25.2 Compound 14 89 484 26.1 SEQ ID NO: 164 71 408 23.3
Compound 09 54 283 16.5 Compound 10 61 288 18.4 Compound 02 86 470
27.2 Compound 03 86 458 27.4 Compound 04 79 497 30.2 Compound 07 77
375 20.0 Compound 08 70 353 17.7 Compound 05 75 405 19.9 Compound
01 77 426 23.4 Compound 11 58 287 17.5 Compound 17 63 371 18.6
Compound 18 72 384 21.2 Compound 19 68 398 23.5 Compound 20 69 374
22.5 Compound 21 73 394 23.1
[0474] It is shown from the experimental data of Table 21 that
MIC-1 compounds with or without protractors has an equivalent or
better in vivo efficacy in rats when compared with wild type MIC-1
polypeptide. The data also show that these protractors don't have a
negative impact on the in vivo efficacy of MIC-1 compounds.
Example 15: Pharmacodynamic (PD) Study in Pigs
[0475] The purpose of this experiment was to investigate the effect
of the MIC-1 compounds on food intake and body weight in pigs. This
was done in a pharmacodynamic (PD) study as described below, in
which food intake was measured from 1 to 21 days after
administration of a single dose of the MIC-1 compound, as compared
to a vehicle-treated control group.
[0476] Female Landrace Yorkshire Duroc (LYD) pigs approximately 3
months of age, weighing approximately 30-35 kg were used (n=4-6 per
group). The animals were housed in a group for approximately 1 week
during acclimatisation to the animal facilities. During the last
part of the acclimatisation period the animals were placed in
individual pens (2 weeks before dosing) and during the entire
experiment for measurement of individual food intake. The food
intake measured the last three days before dosing served as
baseline.
[0477] The animals were fed ad libitum with pig fodder (Svinefoder
Danish Top SI 611+3', Danish Agro) at all times both during the
acclimatisation and the experimental period. Food intake was
monitored on line by logging the weight of fodder continuously
using the HMview system (Ellegaard Systems, Faaborg, Denmark). Any
notable spillage was collected and weighed, and the automatically
measured food intake was corrected for this amount.
[0478] Body weight was measured once or twice weekly during the
study. The MIC-1 compounds were dissolved in an appropriate buffer
at concentrations of approximately 25 or 100 nmol/ml corresponding
to doses of 1 or 9 nmol/kg. The buffer solution also served as
vehicle.
[0479] Animals were dosed with a single subcutaneous dose of the
MIC-1 compounds or vehicle on the morning of day 1, and food intake
was measured for 21 days after dosing.
[0480] At the end of the study the animals were euthanised with an
i.v. overdose of Euthasol administered through the ear vein
catheter.
[0481] Food intake was calculated in 24 h intervals (0-24 h, 24-48
h, 48-72 h, 72-96 h up to 20-21 days). In Table 22, the resulting
mean food intake is presented as percentage of the mean food intake
of the vehicle group in the same time interval.
TABLE-US-00022 TABLE 22 Effect on food intake in pigs PD in pig,
food intake (% of vehicle) at indicated time intervals Time
interval (days) MIC-1 compound 6-7 13-14 20-21 Vehicle 100 100 100
Compound 05 (1 nmol/kg) 88 100 117 Compound 05 (9 nmol/kg) 36 38 65
Compound 01 (1 nmol/kg) 49 86 103 Compound 01 (9 nmol/kg) 29 22
23
[0482] The data shows that a single s.c. injection of the tested
compounds in pigs caused a reduced food intake for up to and even
more than 21 days after the injection (for the 9 nmol/kg doses of
Compound 01).
[0483] Body weight was measured during the study and the pigs
gained less weight in the groups treated with MIC-1 compounds
(Table 23, FIG. 6).
TABLE-US-00023 TABLE 23 Change in body weight gain relative to
vehicle group PD in pig, .DELTA.body weight (relative to vehicle
(%)) Time (days) MIC-1 compounds 7 14 21 Vehicle 0 0 0 Compound 05
(1 nmol/kg) -5.7 -5.7 -1.1 Compound 05 (9 nmol/kg) -15.7 -26.5
-22.0 Compound 01 (1 nmol/kg) -9.8 -9.1 -6.6 Compound 01 (9
nmol/kg) -18.4 -26.9 -29.4
Example 16: Pharmacokinetic Study in Lean SD Rats
[0484] The purpose of this study is to determine the terminal
half-life (T1/2), the mean residence time (MRT), the time for
maximal plasma levels (Tmax) and the bioavailability (F) time in
vivo of the MIC-1 compounds after intravenous and subcutaneous
administration to lean Sprague Dawley rats This is done in a
pharmacokinetic (PK) study, where the PK parameters of the MIC-1
compounds in question are determined. By T1/2 is generally meant
the period of time it takes to halve a certain plasma
concentration, measured after the initial distribution phase with
intravenous dosing. By MRT is in general meant the average amount
of time that the compound in question stays in the body. By Tmax is
in general meant the point in time after subcutaneous
administration of the compound in question when the compound in
question reaches the highest concentration in the blood plasma
during. By F is in general meant the fraction of subcutaneously
administrated compound which appears in the blood plasma. The
aforementioned PK parameters were measured in 300 g-500 g lean SD
rats by injecting the compound into either the tail vein or to the
subcutis of the neck followed by collection of blood plasma samples
at various time points for exposure analysis. Compounds (4-5
nmol/kg body weight) were administered intravenously (1 ml/kg) in
an appropriate buffer solution. The group size of the intravenous
group was typically 4 and the groups size of the subcutaneous group
was typically 5. The rats were awake during the whole experiment
and have access to food and water.
[0485] For compounds with a T1/2 of less than 12 hrs blood samples
were collected from the tongue typically at time 5 min, 15 min, 30
min, 60 min, 90 min, 2 h, 3 h, 4 h, 5 h, 6 h, 8 h, 12 h, 14 h, 22
h, 30 h, 48 h after dosing or at times 0 min, 15 min, 30 min, 60
min, 90 min, 2 h, 21/2 h, 3 h, 4 h, 5 h, 6 h, 8 h, 24 h, 30 h, 48 h
after dosing. For compounds with a T1/2 of more than 24 hrs blood
samples were typically collected from the tongue at time 5 min, 15
min, 30 min, 60 min, 120 min, 360 min, 720 min, 24 h, 30 h, 48 h,
54 h, 72 h, 96 h, 168 h, 216 h, 264 h, 336 h after dosing, 200
.mu.l of blood was collected into EDTA tubes and stored on ice for
up to 20 minutes. Plasma samples were generated by centrifuging
blood samples for 5 minutes at 10000 G at 4.degree. C. The sample
was subsequent pipetted into Micronic tubes on dry ice, and kept at
-20.degree. C. until analysed for plasma concentration of the
respective MIC-1 compound using LOCI or a similar antibody based
assay such as ELISA. The individual plasma concentration-time
profiles were analysed by a non-compartmental model in Phoenix v.
6.4 software (Pharsight Inc., Mountain View, Calif., USA), and the
resulting T1/2, MRT, Tmax and F determined (Table 24).
TABLE-US-00024 TABLE 24 Pharmacokinetic profiles of MIC-1
compounds/polypeptides with N- terminal extension Compound MRT Tmax
No/SEQ T.sup.1/2 hrs hrs hrs BA % ID NO Dose ROA (mean) (mean)
(mean) (mean) SEQ ID 4 nmol/kg IV 1.7 0.53 NA NA NO: 1 SEQ 4
nmol/kg IV 3.9 2.2 NA NA NO: 92 SEQ 4 nmol/kg IV 4.0 3.0 NA NA NO:
100 SEQ 4 nmol/kg IV 3.8 3.2 NA NA NO: 104 SEQ 4 nmol/kg IV 3.4 2.1
NA NA NO: 105 SEQ 4 nmol/kg IV 3.4 1.7 NA NA NO: 106 SEQ 4 nmol/kg
IV 2.8 1.4 NA NA NO: 107 SEQ 4 nmol/kg IV 3.8 3.8 NA NA NO: 108 SEQ
4 nmol/kg IV 2.9 1.5 NA NA NO: 294 SEQ 4 nmol/kg SC 1.9 4.1 2.2 70
NO: 1 SEQ 4 nmol/kg SC 3.3 6.7 3.0 88 NO: 106 SEQ 4 nmol/kg SC 3.4
6.8 2.8 82 NO: 107 SEQ 4 nmol/kg SC 4.1 8.6 3.0 90.+-. NO: 108 SEQ
4 nmol/kg SC 2.8 6.2 3.0 67 NO: 294 Compound 5 nmol/kg IV 26.3 33.1
NA NA 13 Compound 5 nmol/kg IV 42.1 54.8 NA NA 12 Compound 5
nmol/kg IV 2.9 2.1 NA NA 14 Compound 4 nmol/kg IV 37.0 45.7 NA NA
10 Compound 4 nmol/kg IV 73.8 106.2. NA NA 02 Compound 4 nmol/kg IV
62.4 89.3 NA NA 03 Compound 4 nmol/kg IV 15.6 16.8 NA NA 04
Compound 4 nmol/kg IV 46.6 63.8 NA NA 06 SEQ ID 4 nmol/kg IV 5.1
2.8 NA NA NO: 289 Compound 4 nmol/kg IV 58 82 NA NA 01 Compound 4
nmol/kg IV 53 71 NA NA 05 Compound 4 nmol/kg IV 50 72 NA NA 11
Compound 4 nmol/kg SC 56 114 50 36 01 Compound 4 nmol/kg SC 53 106
50 35 05 Compound 4 nmol/kg SC 57 116 50 52 11 Compound 4 nmol/kg
SC 55.8 57.2 55.5 42.3 17 Compound 4 nmol/kg SC 52.9 53.1 54.0 38.2
18 Compound 4 nmol/kg IV 68.5 90.1 NA NA 17 Compound 4 nmol/kg IV
50.8 67.4 NA NA 18
[0486] It can be seen that MIC-1 compounds with protractors have
much longer T1/2, MRT and Tmax compared to their non-protracted
MIC-1 polypeptides with N-extensions. Protraction of pharmaceutical
biological compounds with comparable fatty acid protractors in
general results in a terminal half-life rarely exceeding 12 hours
in rat. The finding of terminal half-lives of more than 48 hours is
unexpected and surprising.
Example 17: Pharmacokinetic Study in Mini Pigs
[0487] The purpose of this study was to determine the protraction
in vivo of the MIC-1 compound after i.v. administration to
minipigs, i.e. the prolongation of their time in the body and
thereby their time of action. This was done in pharmacokinetic (PK)
studies, where the terminal half-life of the compound in question
was determined. By terminal half-life is meant the time it takes to
halve a certain plasma concentration in the terminal elimination
phase.
[0488] Female Gottingen minipigs were obtained from Ellegaard
Gottingen Minipigs (Dalmose, Denmark) approximately 8 months of age
and weighing approximately 23-25 kg were used in the studies. The
minipigs were housed individually (pigs with permanent catheters)
in pens with straw as bedding and fed restrictedly once daily with
Altromin 9030 minipig diet (Altromin Spezialfutter GmbH & Co.
KG).
[0489] After three weeks of acclimatisation two permanent central
venous catheters were implanted in vena cava caudalis in each
animal. The animals were allowed 1 week recovery after the surgery,
and were then used for repeated pharmacokinetic studies with a
suitable wash-out period between successive dosing.
[0490] Intravenous injections (the volume corresponding to 0.17
ml/kg) of the compound was given through one catheter, and blood
was sampled at predefined time points for up till 12 days post
dosing (preferably from the other catheter).
[0491] Blood samples (for example 0.8 ml) were collected in EDTA (8
mM) coated tubes and then centrifuged at 4.degree. C. and 1942 g
for 10 minutes. Blood samples were collected at predefined
timepoints. In example blood samples were collected at t=predose,
0.0833, 0.25, 0.5, 0.75, 1, 1.5, 2, 3, 4, 6, 8, 10, 12, 24, 30, 48,
72, 96, 120, 168, 192, 216, 240, 264, and 288 hours after dose.
[0492] Plasma was pipetted into Micronic tubes on dry ice, and kept
at -20.degree. C. until analysed for plasma concentration of the
MIC-1 compound using LOCI. Individual plasma concentration-time
profiles were analysed by a non-compartmental pharmacokinetic
method in Phoenix v. 6.4 (Pharsight Inc., Mountain View, Calif.,
USA), and the resulting terminal half-lives (harmonic mean)
determined.
Results
[0493] The following result was obtained (Table 25).
TABLE-US-00025 TABLE 25 In vivo study in Gottingen minipigs after
intravenous administration Minipig iv PK t1/2 MRT Compound no.
(hours) (hours) Compound 02 338 487 Compound 05 290 420 Compound 11
347 489 Terminal half-life (t1/2) is harmonic mean, n = 3
[0494] Protraction of pharmaceutical biological compounds with
comparable fatty acid protractors in general results in a terminal
half-life rarely exceeding 100 hours in mini pig. The finding of a
terminal half-life of more than 300 hours is unexpected and
surprising.
Sequence CWU 1
1
3171112PRTHomo Sapiens 1Ala Arg Asn Gly Asp His Cys Pro Leu Gly Pro
Gly Arg Cys Cys Arg1 5 10 15Leu His Thr Val Arg Ala Ser Leu Glu Asp
Leu Gly Trp Ala Asp Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val
Thr Met Cys Ile Gly Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn
Met His Ala Gln Ile Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro
Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr
Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
1102111PRTArtificial SequenceMIC-1 des-N3 2Ala Arg Gly Asp His Cys
Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu1 5 10 15His Thr Val Arg Ala
Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val 20 25 30Leu Ser Pro Arg
Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro 35 40 45Ser Gln Phe
Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu 50 55 60His Arg
Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala65 70 75
80Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser
85 90 95Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile
100 105 1103109PRTArtificial SequenceMIC-1-Del (1-3) 3Gly Asp His
Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr1 5 10 15Val Arg
Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser 20 25 30Pro
Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln 35 40
45Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His Arg
50 55 60Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser
Tyr65 70 75 80Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val
Ser Leu Gln 85 90 95Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys
Ile 100 10546PRTArtificial SequenceN-terminal extension 4Ser Pro
Ala Gly Ser Pro1 556PRTArtificial SequenceN-terminal extension 5Thr
Ser Glu Ser Ala Thr1 566PRTArtificial SequenceN-terminal extension
6Thr Ser Thr Glu Pro Glu1 576PRTArtificial SequenceN-terminal
extension 7Ser Glu Pro Ala Thr Ser1 586PRTArtificial
SequenceN-terminal extension 8Thr Ser Thr Glu Glu Gly1
596PRTArtificial SequenceN-terminal extension 9Pro Glu Ser Gly Pro
Gly1 5106PRTArtificial SequenceN-terminal extension 10Ser Gly Ser
Ala Pro Gly1 5116PRTArtificial SequenceN-terminal extension 11Gly
Ser Glu Thr Pro Gly1 51224PRTArtificial SequenceN-terminal
extension 12Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro
Ala Gly1 5 10 15Ser Pro Thr Ser Thr Glu Glu Gly 201324PRTArtificial
SequenceN-terminal extension 13Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
201424PRTArtificial SequenceN-terminal extension 14Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly 201530PRTArtificial SequenceN-terminal
extension 15Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro
Ala Gly1 5 10 15Ser Pro Thr Ser Thr Glu Glu Gly Ser Pro Ala Gly Ser
Pro 20 25 301630PRTArtificial SequenceN-terminal extension 16Ser
Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10
15Ala Thr Pro Glu Ser Gly Pro Gly Ser Pro Ala Gly Ser Pro 20 25
301730PRTArtificial SequenceN-terminal extension 17Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Ser Pro Ala Gly Ser Pro 20 25
301830PRTArtificial SequenceN-terminal extension 18Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Thr Ser Glu Ser Ala Thr 20 25
301930PRTArtificial SequenceN-terminal extension 19Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Thr Ser Glu Ser Ala Thr 20 25
302030PRTArtificial SequenceN-terminal extension 20Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Thr Ser Glu Ser Ala Thr 20 25
302130PRTArtificial SequenceN-terminal extension 21Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Thr Ser Thr Glu Pro Glu 20 25
302230PRTArtificial SequenceN-terminal extension 22Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Glu 20 25
302330PRTArtificial SequenceN-terminal extension 23Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Thr Ser Thr Glu Pro Glu 20 25
302430PRTArtificial SequenceN-terminal extension 24Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Ser Glu Pro Ala Thr Ser 20 25
302530PRTArtificial SequenceN-terminal extension 25Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Ser Glu Pro Ala Thr Ser 20 25
302630PRTArtificial SequenceN-terminal extension 26Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Ser Glu Pro Ala Thr Ser 20 25
302730PRTArtificial SequenceN-terminal extension 27Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Thr Ser Thr Glu Glu Gly 20 25
302830PRTArtificial SequenceN-terminal extension 28Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Thr Ser Thr Glu Glu Gly 20 25
302930PRTArtificial SequenceN-terminal extension 29Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Thr Ser Thr Glu Glu Gly 20 25
303030PRTArtificial SequenceN-terminal extension 30Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Pro Glu Ser Gly Pro Gly 20 25
303130PRTArtificial SequenceN-terminal extension 31Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Pro Glu Ser Gly Pro Gly 20 25
303230PRTArtificial SequenceN-terminal extension 32Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Pro Glu Ser Gly Pro Gly 20 25
303330PRTArtificial SequenceN-terminal extension 33Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Ser Gly Ser Ala Pro Gly 20 25
303430PRTArtificial SequenceN-terminal extension 34Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Ser Gly Ser Ala Pro Gly 20 25
303530PRTArtificial SequenceN-terminal extension 35Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Ser Gly Ser Ala Pro Gly 20 25
303630PRTArtificial SequenceN-terminal extension 36Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Gly Ser Glu Thr Pro Gly 20 25
303730PRTArtificial SequenceN-terminal extension 37Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Gly Ser Glu Thr Pro Gly 20 25
303830PRTArtificial SequenceN-terminal extension 38Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Gly Ser Glu Thr Pro Gly 20 25
303936PRTArtificial SequenceN-terminal extension 39Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly Thr Ser Glu Ser Ala Thr Pro Glu 20 25 30Ser Gly
Pro Gly 354036PRTArtificial SequenceN-terminal extension 40Ser Glu
Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1 5 10 15Ser
Pro Thr Ser Thr Glu Glu Gly Ser Pro Ala Gly Ser Pro Thr Ser 20 25
30Thr Glu Glu Gly 354136PRTArtificial SequenceN-terminal extension
41Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly1
5 10 15Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Thr Glu Pro Glu Ser
Gly 20 25 30Ser Ala Pro Gly 354236PRTArtificial SequenceN-terminal
extension 42Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser
Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Ser Pro Ala Gly Ser
Pro Thr Ser 20 25 30Thr Glu Glu Gly 354336PRTArtificial
SequenceN-terminal extension 43Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Thr Ser Glu Ser Ala Thr Pro Glu 20 25 30Ser Gly Pro Gly
354436PRTArtificial SequenceN-terminal extension 44Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Glu Ser Gly 20 25 30Ser Ala
Pro Gly 354536PRTArtificial SequenceN-terminal extension 45Ser Glu
Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala
Thr Pro Glu Ser Gly Pro Gly Ser Glu Pro Ala Thr Ser Gly Ser 20 25
30Glu Thr Pro Gly 354636PRTArtificial SequenceN-terminal extension
46Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1
5 10 15Pro Glu Ser Gly Ser Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr
Ser 20 25 30Thr Glu Glu Gly 354736PRTArtificial SequenceN-terminal
extension 47Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser
Thr Glu1 5 10 15Pro Glu Ser Gly Ser Ala Pro Gly Thr Ser Glu Ser Ala
Thr Pro Glu 20 25 30Ser Gly Pro Gly 354836PRTArtificial
SequenceN-terminal extension 48Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser Gly Ser Ala Pro Gly
Thr Ser Thr Glu Pro Glu Ser Gly 20 25 30Ser Ala Pro Gly
354936PRTArtificial SequenceN-terminal extension 49Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu Ser
Gly Ser Ala Pro Gly Ser Glu Pro Ala Thr Ser Gly Ser 20 25 30Glu Thr
Pro Gly 355036PRTArtificial SequenceN-terminal extension 50Ser Glu
Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr
Ser Gly Ser Glu Thr Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser 20 25
30Thr Glu Glu Gly 355136PRTArtificial SequenceN-terminal extension
51Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1
5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro
Glu 20 25 30Ser Gly Pro Gly 355236PRTArtificial SequenceN-terminal
extension 52Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu
Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu Pro
Glu Ser Gly 20 25 30Ser Ala Pro Gly 355336PRTArtificial
SequenceN-terminal extension 53Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Ser Glu Pro Ala Thr Ser Gly Ser 20 25 30Glu Thr Pro Gly
35546PRTArtificial SequenceN-terminal extension 54Ala Glu Glu Ala
Glu Ser1 5554PRTArtificial SequenceN-terminal extension 55Ala Glu
Ser Met1569PRTArtificial SequenceN-terminal extension 56Ala Glu Glu
Ala Glu Glu Ala Glu Ser1 55720PRTArtificial SequenceN-terminal
extension 57Gly Glu Pro Ser Gly Glu Pro Ser Gly Glu Pro Ser Gly Glu
Pro Ser1 5 10 15Gly Glu Pro Ser 205824PRTArtificial
SequenceN-terminal extension 58Ser Pro Ala Gly Ser Pro Thr Ser Thr
Glu Glu Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
205921PRTArtificial SequenceN-terminal extension 59Ala Glu Glu Ala
Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala1 5 10 15Glu Glu Ala
Glu Ser 206018PRTArtificial SequenceN-terminal extension 60Ala Glu
Glu Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala1 5 10 15Glu
Ser6112PRTArtificial SequenceN-terminal extension 61Ala Glu Glu Ala
Glu Glu Ala Glu Glu Ala Glu Ser1 5 106226PRTArtificial
SequenceN-terminal extension 62Ala Ala Ser Pro Ala Gly Ser Pro Thr
Ser Thr Glu Glu Gly Thr Ser1 5 10 15Glu Ser Ala Thr Pro Glu Ser Gly
Pro Gly 20 256324PRTArtificial SequenceN-terminal extension 63Thr
Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Glu Ser1 5 10
15Ala Thr Pro Glu Ser Gly Pro Gly 206426PRTArtificial
SequenceN-terminal extension 64Ala Ala Ser Pro Ala Gly Ser Pro Thr
Ser Thr Glu Glu Gly Thr Ser1 5 10 15Glu Ser Ala Thr Pro Glu Ser Gly
Pro Gly 20 256522PRTArtificial SequenceN-terminal extension 65Ala
Ala Pro Glu Asp Glu Glu Thr Pro Glu Gln Glu Gly Ser Gly Ser1 5 10
15Gly Ser Gly Ser Gly Ser 206612PRTArtificial SequenceN-terminal
extension 66Ala Ala Pro Glu Asp Glu Glu Thr Pro Glu Gln Glu1 5
106722PRTArtificial SequenceN-terminal extension 67Ala Ala Pro Asp
Glu Gly Thr Glu Glu Glu Thr Glu Gly Ser Gly Ser1 5 10 15Gly Ser Gly
Ser Gly Ser 206824PRTArtificial SequenceN-terminal extension 68Ser
Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5
10 15Thr Ser Gly Ser Glu Thr Pro Gly 206925PRTArtificial
SequenceN-terminal extension 69Ala Gly Pro Glu Gln Gly Gln Glu Pro
Gly Pro Glu Gln Gly Gln Glu1 5 10 15Pro Gly Pro Glu Gln Gly Gln Glu
Pro 20 257030PRTArtificial SequenceN-terminal extension 70Ser Glu
Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala
Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser 20 25
307132PRTArtificial SequenceN-terminal extension 71Ser Glu Pro Ala
Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro
Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
307224PRTArtificial SequenceN-terminal extension 72Gly Glu Pro Ser
Gly Glu Pro Ser Gly Glu Pro Ser Gly Glu Pro Ser1 5 10 15Gly Glu Pro
Ser Gly Glu Pro Ser 2073112PRTArtificial SequenceMIC-1 polypeptide
73Ala Ala Glu Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1
5 10 15Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile
Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 100 105 11074112PRTArtificial
SequenceMIC-1 polypeptide 74Ala Ala Glu Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro Ser Gln Phe Arg Glu Ala
Asn Met His Ala Gln Ile Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro
Asp Thr Val Pro Ala Pro Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn
Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
11075112PRTArtificial SequenceMIC-1 polypeptide 75Ala Ala Glu Gly
Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr
Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu
Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro
Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser 50 55
60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro65
70 75 80Glu Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His
Cys Ile 100 105 11076112PRTArtificial SequenceMIC-1 polypeptide
76Ala Ala Glu Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1
5 10 15Leu Glu Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile
Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 100 105 11077112PRTArtificial
SequenceMIC-1 polypeptide 77Ala Ala Glu Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala
Asn Met His Ala Gln Ile Lys Thr Ser 50 55 60Leu His Arg Leu Glu Pro
Asp Thr Val Pro Ala Pro Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn
Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
11078112PRTArtificial SequenceMIC-1 polypeptide 78Ala Ala Glu Gly
Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr
Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu
Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro
Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser 50 55
60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro65
70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Glu Asp Cys His
Cys Ile 100 105 11079112PRTArtificial SequenceMIC-1 polypeptide
79Ala Ala Glu Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1
5 10 15Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile
Lys Thr Ser 50 55 60Leu His Arg Glu Lys Pro Asp Thr Val Pro Ala Pro
Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 100 105 11080112PRTArtificial
SequenceMIC-1 polypeptide 80Ala Ala Glu Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln
Val Thr Met Cys Ile Gly Glu Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala
Asn Met His Ala Gln Ile Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro
Asp Thr Val Pro Ala Pro Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn
Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
11081112PRTArtificial SequenceMIC-1 polypeptide 81Ala Ala Glu Gly
Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr
Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu
Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro
Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser 50 55
60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro65
70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Glu Ala Lys Asp Cys His
Cys Ile 100 105 11082112PRTArtificial SequenceMIC-1 polypeptide
82Ala Ala Glu Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1
5 10 15Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn Glu His Ala Gln Ile
Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 100 105 11083112PRTArtificial
SequenceMIC-1 polypeptide 83Ala Ala Glu Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala
Asn Met His Ala Gln Ile Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro
Asp Thr Val Pro Ala Pro Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn
Glu Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
11084112PRTArtificial SequenceMIC-1 polypeptide 84Ala Ala Glu Gly
Asp His Cys Pro Leu Gly Glu Gly Arg Cys Cys Arg1 5 10 15Leu His Thr
Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu
Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro
Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser 50 55
60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro65
70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His
Cys Ile 100 105 11085112PRTArtificial SequenceMIC-1 polypeptide
85Ala Ala Glu Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1
5 10 15Leu His Thr Val Glu Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile
Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 100 105 11086112PRTArtificial
SequenceMIC-1 polypeptide 86Ala Ala Glu Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro Ser Gln Phe Glu Ala Ala
Asn Met His Ala Gln Ile Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro
Asp Thr Val Pro Ala Pro Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn
Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
11087112PRTArtificial SequenceMIC-1 polypeptide 87Ala Ala Glu Gly
Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1 5 10 15Leu His Thr
Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp 20 25 30Val Leu
Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys 35 40 45Pro
Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser 50 55
60Leu His Glu Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro65
70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His
Cys Ile 100 105 11088112PRTArtificial SequenceMIC-1 polypeptide
88Ala Ala Glu Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1
5 10 15Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Glu Asp
Trp 20 25 30Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys 35 40 45Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile
Lys Thr Ser 50 55 60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
Cys Cys Val Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 100 105 11089115PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 89Ala Glu Glu
Ala Glu Ser Gly Asp His Cys Pro Leu Gly Pro Gly Arg1 5 10 15Cys Cys
Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp 20 25 30Ala
Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile 35 40
45Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile
50 55 60Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
Cys65 70 75 80Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys Thr Asp 85 90 95Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys 100 105 110His Cys Ile 11590112PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 90Ala Glu Ser
Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg1 5 10 15Leu His
Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp 20 25 30Val
Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys 35 40
45Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser
50 55 60Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val
Pro65 70 75 80Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp
Thr Gly Val 85 90 95Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp
Cys His Cys Ile 100 105 11091118PRTArtificial SequenceMIC-1
polypeptide with N-terminal extension 91Ala Glu Glu Ala Glu Glu Ala
Glu Ser Gly Asp His Cys Pro Leu Gly1 5 10 15Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg Ala Ser Leu Glu Asp 20 25 30Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr 35 40 45Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His 50 55 60Ala Gln Ile
Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val Pro65 70 75 80Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln 85 90
95Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala
100 105 110Lys Asp Cys His Cys Ile 11592132PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 92Gly Glu Pro
Ser Gly Glu Pro Ser Gly Glu Pro Ser Gly Glu Pro Ser1 5 10 15Gly Glu
Pro Ser Ala Arg Asn Gly Asp His Cys Pro Leu Gly Pro Gly 20 25 30Arg
Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly 35 40
45Trp Ala Asp
Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys 50 55 60Ile Gly
Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln65 70 75
80Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro
85 90 95Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys
Thr 100 105 110Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp 115 120 125Cys His Cys Ile 13093136PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 93Ser Pro Ala
Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Ala Arg Asn Gly Asp His Cys Pro 20 25 30Leu
Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu 35 40
45Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln
50 55 60Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala
Asn65 70 75 80Met His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys
Pro Asp Thr 85 90 95Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn
Pro Met Val Leu 100 105 110Ile Gln Lys Thr Asp Thr Gly Val Ser Leu
Gln Thr Tyr Asp Asp Leu 115 120 125Leu Ala Lys Asp Cys His Cys Ile
130 13594130PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 94Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu
Glu Ala1 5 10 15Glu Glu Ala Glu Ser Gly Asp His Cys Pro Leu Gly Pro
Gly Arg Cys 20 25 30Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp
Leu Gly Trp Ala 35 40 45Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val
Thr Met Cys Ile Gly 50 55 60Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn
Met His Ala Gln Ile Lys65 70 75 80Thr Ser Leu His Arg Leu Lys Pro
Asp Thr Val Pro Ala Pro Cys Cys 85 90 95Val Pro Ala Ser Tyr Asn Pro
Met Val Leu Ile Gln Lys Thr Asp Thr 100 105 110Gly Val Ser Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His 115 120 125Cys Ile
13095127PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 95Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu
Glu Ala1 5 10 15Glu Ser Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys
Cys Arg Leu 20 25 30His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp
Ala Asp Trp Val 35 40 45Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys
Ile Gly Ala Cys Pro 50 55 60Ser Gln Phe Arg Ala Ala Asn Met His Ala
Gln Ile Lys Thr Ser Leu65 70 75 80His Arg Leu Lys Pro Asp Thr Val
Pro Ala Pro Cys Cys Val Pro Ala 85 90 95Ser Tyr Asn Pro Met Val Leu
Ile Gln Lys Thr Asp Thr Gly Val Ser 100 105 110Leu Gln Thr Tyr Asp
Asp Leu Leu Ala Lys Asp Cys His Cys Ile 115 120
12596121PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 96Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu Ser Gly Asp
His Cys1 5 10 15Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val
Arg Ala Ser 20 25 30Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser
Pro Arg Glu Val 35 40 45Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser
Gln Phe Arg Ala Ala 50 55 60Asn Met His Ala Gln Ile Lys Thr Ser Leu
His Arg Leu Lys Pro Asp65 70 75 80Thr Val Pro Ala Pro Cys Cys Val
Pro Ala Ser Tyr Asn Pro Met Val 85 90 95Leu Ile Gln Lys Thr Asp Thr
Gly Val Ser Leu Gln Thr Tyr Asp Asp 100 105 110Leu Leu Ala Lys Asp
Cys His Cys Ile 115 12097138PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 97Ala Ala Ser Pro Ala Gly Ser Pro Thr Ser
Thr Glu Glu Gly Thr Ser1 5 10 15Glu Ser Ala Thr Pro Glu Ser Gly Pro
Gly Ala Arg Asn Gly Asp His 20 25 30Cys Pro Leu Gly Pro Gly Arg Cys
Cys Arg Leu His Thr Val Arg Ala 35 40 45Ser Leu Glu Asp Leu Gly Trp
Ala Asp Trp Val Leu Ser Pro Arg Glu 50 55 60Val Gln Val Thr Met Cys
Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala65 70 75 80Ala Asn Met His
Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro 85 90 95Asp Thr Val
Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met 100 105 110Val
Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp 115 120
125Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
13598136PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 98Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser
Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Ala Ala Glu Gly Asp
His Cys Pro 20 25 30Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val
Arg Ala Ser Leu 35 40 45Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser
Pro Arg Glu Val Gln 50 55 60Val Thr Met Cys Ile Gly Ala Cys Pro Ser
Gln Phe Arg Ala Ala Asn65 70 75 80Met His Ala Gln Ile Lys Thr Ser
Leu His Arg Leu Lys Pro Asp Thr 85 90 95Val Pro Ala Pro Cys Cys Val
Pro Ala Ser Tyr Asn Pro Met Val Leu 100 105 110Ile Gln Lys Thr Asp
Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu 115 120 125Leu Ala Lys
Asp Cys His Cys Ile 130 13599135PRTArtificial SequenceMIC-1
polypeptide with N-terminal extension 99Ala Ala Ser Pro Ala Gly Ser
Pro Thr Ser Thr Glu Glu Gly Thr Ser1 5 10 15Glu Ser Ala Thr Pro Glu
Ser Gly Pro Gly Gly Asp His Cys Pro Leu 20 25 30Gly Pro Gly Arg Cys
Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu 35 40 45Asp Leu Gly Trp
Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val 50 55 60Thr Met Cys
Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met65 70 75 80His
Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val 85 90
95Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile
100 105 110Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp
Leu Leu 115 120 125Ala Lys Asp Cys His Cys Ile 130
135100131PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 100Ala Ala Pro Glu Asp Glu Glu Thr Pro Glu Gln Glu Gly
Ser Gly Ser1 5 10 15Gly Ser Gly Ser Gly Ser Gly Asp His Cys Pro Leu
Gly Pro Gly Arg 20 25 30Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu
Glu Asp Leu Gly Trp 35 40 45Ala Asp Trp Val Leu Ser Pro Arg Glu Val
Gln Val Thr Met Cys Ile 50 55 60Gly Ala Cys Pro Ser Gln Phe Arg Ala
Ala Asn Met His Ala Gln Ile65 70 75 80Lys Thr Ser Leu His Arg Leu
Lys Pro Asp Thr Val Pro Ala Pro Cys 85 90 95Cys Val Pro Ala Ser Tyr
Asn Pro Met Val Leu Ile Gln Lys Thr Asp 100 105 110Thr Gly Val Ser
Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys 115 120 125His Cys
Ile 130101121PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 101Ala Ala Pro Glu Asp Glu Glu Thr Pro Glu Gln
Glu Gly Asp His Cys1 5 10 15Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu
His Thr Val Arg Ala Ser 20 25 30Leu Glu Asp Leu Gly Trp Ala Asp Trp
Val Leu Ser Pro Arg Glu Val 35 40 45Gln Val Thr Met Cys Ile Gly Ala
Cys Pro Ser Gln Phe Arg Ala Ala 50 55 60Asn Met His Ala Gln Ile Lys
Thr Ser Leu His Arg Leu Lys Pro Asp65 70 75 80Thr Val Pro Ala Pro
Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val 85 90 95Leu Ile Gln Lys
Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp 100 105 110Leu Leu
Ala Lys Asp Cys His Cys Ile 115 120102131PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 102Ala Ala Pro
Asp Glu Gly Thr Glu Glu Glu Thr Glu Gly Ser Gly Ser1 5 10 15Gly Ser
Gly Ser Gly Ser Gly Asp His Cys Pro Leu Gly Pro Gly Arg 20 25 30Cys
Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp 35 40
45Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile
50 55 60Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln
Ile65 70 75 80Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val Pro
Ala Pro Cys 85 90 95Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile
Gln Lys Thr Asp 100 105 110Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp
Leu Leu Ala Lys Asp Cys 115 120 125His Cys Ile
130103133PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 103Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly Gly Asp His Cys
Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys Arg Leu His Thr Val Arg Ala
Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
Glu Val Gln Val Thr Met 50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg Ala Ala Asn Met His Ala65 70 75 80Gln Ile Lys Thr Ser Leu His
Arg Leu Lys Pro Asp Thr Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro Met Val Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys
His Cys Ile 130104133PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 104Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Gly Asp
His Cys Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys Arg Leu His Thr Val
Arg Ala Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala Asp Trp Val Leu Ser
Pro Arg Glu Val Gln Val Thr Met 50 55 60Cys Ile Gly Ala Cys Pro Ser
Gln Phe Arg Ala Ala Asn Met His Ala65 70 75 80Gln Ile Lys Thr Ser
Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala 85 90 95Pro Cys Cys Val
Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys 100 105 110Thr Asp
Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys 115 120
125Asp Cys His Cys Ile 130105133PRTArtificial SequenceMIC-1
polypeptide with N-terminal extension 105Ser Glu Pro Ala Thr Ser
Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu
Thr Pro Gly Gly Asp His Cys Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys
Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala
Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met 50 55 60Cys Ile
Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Glu His Ala65 70 75
80Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala
85 90 95Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys 100 105 110Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu
Leu Ala Lys 115 120 125Asp Cys His Cys Ile 130106133PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 106Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser
Gly Ser Glu Thr Pro Gly Gly Asp His Cys Pro Leu Gly Pro 20 25 30Gly
Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu 35 40
45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met
50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Leu His
Ala65 70 75 80Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr
Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val
Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys His Cys Ile
130107134PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 107Ala Gly Pro Glu Gln Gly Gln Glu Pro Gly Pro Glu Gln
Gly Gln Glu1 5 10 15Pro Gly Pro Glu Gln Gly Gln Glu Pro Gly Asp His
Cys Pro Leu Gly 20 25 30Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg
Ala Ser Leu Glu Asp 35 40 45Leu Gly Trp Ala Asp Trp Val Leu Ser Pro
Arg Glu Val Gln Val Thr 50 55 60Met Cys Ile Gly Ala Cys Pro Ser Gln
Phe Arg Ala Ala Asn Met His65 70 75 80Ala Gln Ile Lys Thr Ser Leu
His Arg Leu Lys Pro Asp Thr Val Pro 85 90 95Ala Pro Cys Cys Val Pro
Ala Ser Tyr Asn Pro Met Val Leu Ile Gln 100 105 110Lys Thr Asp Thr
Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala 115 120 125Lys Asp
Cys His Cys Ile 130108139PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 108Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Thr Ser Thr Glu Pro Ser Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn
Met His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105
110Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
115 120 125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135109141PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 109Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu
Pro Ser Glu Gly 20 25 30Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys
Cys Arg Leu His Thr 35 40 45Val Arg Ala Ser Leu Glu Asp Leu Gly Trp
Ala Asp Trp Val Leu Ser 50 55 60Pro Arg Glu Val Gln Val Thr Met Cys
Ile Gly Ala Cys Pro Ser Gln65 70 75 80Phe Arg Ala Ala Asn Met His
Ala Gln Ile Lys Thr Ser Leu His Arg 85 90 95Leu Lys Pro Asp Thr Val
Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr 100 105 110Asn Pro Met Val
Leu Ile Gln Lys Thr
Asp Thr Gly Val Ser Leu Gln 115 120 125Thr Tyr Asp Asp Leu Leu Ala
Lys Asp Cys His Cys Ile 130 135 140110133PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 110Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser
Gly Ser Glu Thr Pro Gly Gly Asp His Cys Pro Leu Gly Pro 20 25 30Gly
Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu 35 40
45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met
50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His
Ala65 70 75 80Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr
Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Leu Val
Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys His Cys Ile
130111133PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 111Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser
Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Gly Asp His Cys
Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys Arg Leu His Thr Val Arg Ala
Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
Glu Val Gln Val Thr Met 50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg Ala Ala Asn Leu His Ala65 70 75 80Gln Ile Lys Thr Ser Leu His
Arg Leu Lys Pro Asp Thr Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro Leu Val Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys
His Cys Ile 130112133PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 112Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Gly Asp
His Cys Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys Arg Leu His Thr Val
Arg Ala Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala Asp Trp Val Leu Ser
Pro Arg Glu Val Gln Val Thr Met 50 55 60Cys Ile Gly Ala Cys Pro Ser
Gln Phe Arg Ala Ala Asn Glu His Ala65 70 75 80Gln Ile Lys Thr Ser
Leu Glu Arg Leu Lys Pro Asp Thr Val Pro Ala 85 90 95Pro Cys Cys Val
Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln Lys 100 105 110Thr Asp
Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys 115 120
125Asp Cys His Cys Ile 130113133PRTArtificial SequenceMIC-1
polypeptide with N-terminal extension 113Ser Glu Pro Ala Thr Ser
Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu
Thr Pro Gly Gly Asp His Cys Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys
Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala
Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met 50 55 60Cys Ile
Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Glu His Ala65 70 75
80Gln Ile Lys Thr Ser Leu His Glu Leu Lys Pro Asp Thr Val Pro Ala
85 90 95Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys 100 105 110Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu
Leu Ala Lys 115 120 125Asp Cys His Cys Ile 130114133PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 114Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser
Gly Ser Glu Thr Pro Gly Gly Asp His Cys Pro Leu Gly Pro 20 25 30Gly
Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu 35 40
45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met
50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Glu His
Ala65 70 75 80Gln Ile Lys Thr Ser Leu His Glu Leu Lys Pro Asp Thr
Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Leu Val
Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys His Cys Ile
130115140PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 115Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu
Pro Ser Gly Gly 20 25 30Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys
Arg Leu His Thr Val 35 40 45Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala
Asp Trp Val Leu Ser Pro 50 55 60Arg Glu Val Gln Val Thr Met Cys Ile
Gly Ala Cys Pro Ser Gln Phe65 70 75 80Arg Ala Ala Asn Leu His Ala
Gln Ile Lys Thr Ser Leu His Arg Leu 85 90 95Lys Pro Asp Thr Val Pro
Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn 100 105 110Pro Leu Val Leu
Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr 115 120 125Tyr Asp
Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130 135
140116133PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 116Gly Glu Pro Ser Gly Glu Pro Ser Gly Glu Pro Ser Gly
Glu Pro Ser1 5 10 15Gly Glu Pro Ser Gly Glu Pro Ser Gly Asp His Cys
Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys Arg Leu His Thr Val Arg Ala
Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
Glu Val Gln Val Thr Met 50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg Ala Ala Asn Met His Ala65 70 75 80Gln Ile Lys Thr Ser Leu His
Arg Leu Lys Pro Asp Thr Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro Met Val Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys
His Cys Ile 130117135PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 117Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Ala Arg
Gly Asp His Cys Pro Leu 20 25 30Gly Pro Gly Arg Cys Cys Arg Leu His
Thr Val Arg Ala Ser Leu Glu 35 40 45Asp Leu Gly Trp Ala Asp Trp Val
Leu Ser Pro Arg Glu Val Gln Val 50 55 60Thr Met Cys Ile Gly Ala Cys
Pro Ser Gln Phe Arg Ala Ala Asn Met65 70 75 80His Ala Gln Ile Lys
Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val 85 90 95Pro Ala Pro Cys
Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile 100 105 110Gln Lys
Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu 115 120
125Ala Lys Asp Cys His Cys Ile 130 1351184PRTArtificial
SequenceN-terminal extension 118Gly Glu Pro Ser11194PRTArtificial
SequenceN-terminal extension 119Gly Pro Ser Glu11204PRTArtificial
SequenceN-terminal extension 120Gly Pro Glu Ser11214PRTArtificial
SequenceN-terminal extension 121Gly Ser Pro Glu11224PRTArtificial
SequenceN-terminal extension 122Gly Ser Glu Pro11234PRTArtificial
SequenceN-terminal extension 123Gly Glu Pro Gln11244PRTArtificial
SequenceN-terminal extension 124Gly Glu Gln Pro11254PRTArtificial
SequenceN-terminal extension 125Gly Pro Glu Gln11264PRTArtificial
SequenceN-terminal extension 126Gly Pro Gln Glu11274PRTArtificial
SequenceN-terminal extension 127Gly Gln Glu Pro11284PRTArtificial
SequenceN-terminal extension 128Gly Gln Pro Glu112910PRTArtificial
SequenceN-terminal extension 129Pro Glu Asp Glu Glu Thr Pro Glu Gln
Glu1 5 1013010PRTArtificial SequenceN-terminal extension 130Pro Asp
Glu Gly Thr Glu Glu Glu Thr Glu1 5 1013110PRTArtificial
SequenceN-terminal extension 131Pro Ala Ala Glu Glu Glu Asp Asp Pro
Asp1 5 1013211PRTArtificial SequenceN-terminal extension 132Ala Glu
Pro Asp Glu Asp Pro Gln Ser Glu Asp1 5 1013310PRTArtificial
SequenceN-terminal extension 133Ala Glu Pro Asp Glu Asp Pro Gln Ser
Glu1 5 101349PRTArtificial SequenceN-terminal extension 134Ala Glu
Pro Glu Glu Gln Glu Glu Asp1 51358PRTArtificial SequenceN-terminal
extension 135Ala Glu Pro Glu Glu Gln Glu Glu1 51364PRTArtificial
SequenceN-terminal extension 136Gly Gly Gly Ser11374PRTArtificial
SequenceN-terminal extension 137Gly Ser Gly Ser11384PRTArtificial
SequenceN-terminal extension 138Gly Gly Ser Ser11394PRTArtificial
SequenceN-terminal extension 139Ser Ser Ser Gly114020PRTArtificial
SequenceN-terminal extension 140Gly Glu Pro Ser Gly Glu Pro Ser Gly
Glu Pro Ser Gly Glu Pro Ser1 5 10 15Gly Glu Pro Ser
2014120PRTArtificial SequenceN-terminal extension 141Gly Pro Ser
Glu Gly Pro Ser Glu Gly Pro Ser Glu Gly Pro Ser Glu1 5 10 15Gly Pro
Ser Glu 2014220PRTArtificial SequenceN-terminal extension 142Gly
Pro Glu Ser Gly Pro Glu Ser Gly Pro Glu Ser Gly Pro Glu Ser1 5 10
15Gly Pro Glu Ser 2014320PRTArtificial SequenceN-terminal extension
143Gly Ser Pro Glu Gly Ser Pro Glu Gly Ser Pro Glu Gly Ser Pro Glu1
5 10 15Gly Ser Pro Glu 2014420PRTArtificial SequenceN-terminal
extension 144Gly Ser Glu Pro Gly Ser Glu Pro Gly Ser Glu Pro Gly
Ser Glu Pro1 5 10 15Gly Ser Glu Pro 2014520PRTArtificial
SequenceN-terminal extension 145Gly Glu Pro Gln Gly Glu Pro Gln Gly
Glu Pro Gln Gly Glu Pro Gln1 5 10 15Gly Glu Pro Gln
2014620PRTArtificial SequenceN-terminal extension 146Gly Glu Gln
Pro Gly Glu Gln Pro Gly Glu Gln Pro Gly Glu Gln Pro1 5 10 15Gly Glu
Gln Pro 2014720PRTArtificial SequenceN-terminal extension 147Gly
Pro Glu Gln Gly Pro Glu Gln Gly Pro Glu Gln Gly Pro Glu Gln1 5 10
15Gly Pro Glu Gln 2014820PRTArtificial SequenceN-terminal extension
148Gly Pro Gln Glu Gly Pro Gln Glu Gly Pro Gln Glu Gly Pro Gln Glu1
5 10 15Gly Pro Gln Glu 2014920PRTArtificial SequenceN-terminal
extension 149Gly Gln Glu Pro Gly Gln Glu Pro Gly Gln Glu Pro Gly
Gln Glu Pro1 5 10 15Gly Gln Glu Pro 2015020PRTArtificial
SequenceN-terminal extension 150Gly Gln Pro Glu Gly Gln Pro Glu Gly
Gln Pro Glu Gly Gln Pro Glu1 5 10 15Gly Gln Pro Glu
2015115PRTArtificial SequenceN-terminal extension 151Ala Glu Glu
Ala Glu Glu Ala Glu Glu Ala Glu Glu Ala Glu Glu1 5 10
151527PRTArtificial SequenceLinker 152Gly Gly Ser Ser Ser Gly Ser1
515331PRTArtificial SequenceLinker 153Pro Thr Pro Thr Pro Thr Pro
Thr Pro Thr Pro Thr Pro Thr Pro Thr1 5 10 15Pro Thr Pro Thr Pro Thr
Pro Thr Pro Thr Pro Thr Pro Thr Pro 20 25 30154111PRTArtificial
SequenceMIC-1 polypeptide 154Ala Arg Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg Leu1 5 10 15His Thr Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp Val 20 25 30Leu Ser Pro Arg Glu Val Gln
Val Thr Leu Cys Ile Gly Ala Cys Pro 35 40 45Ser Gln Phe Arg Ala Ala
Asn Met His Ala Gln Ile Lys Thr Ser Leu 50 55 60His Arg Leu Lys Pro
Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala65 70 75 80Ser Tyr Asn
Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser 85 90 95Leu Gln
Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100 105
110155109PRTArtificial SequenceMIC-1 polypeptide 155Gly Asp His Cys
Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr1 5 10 15Val Arg Ala
Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser 20 25 30Pro Arg
Glu Val Gln Val Thr Leu Cys Ile Gly Ala Cys Pro Ser Gln 35 40 45Phe
Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His Arg 50 55
60Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr65
70 75 80Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu
Gln 85 90 95Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 100
105156111PRTArtificial SequenceMIC-1 polypeptide 156Ala Arg Gly Asp
His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu1 5 10 15His Thr Val
Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val 20 25 30Leu Ser
Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro 35 40 45Ser
Gln Phe Arg Ala Ala Asn Glu His Ala Gln Ile Lys Thr Ser Leu 50 55
60Glu Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala65
70 75 80Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val
Ser 85 90 95Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys
Ile 100 105 110157109PRTArtificial SequenceMIC-1 polypeptide 157Gly
Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr1 5 10
15Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser
20 25 30Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser
Gln 35 40 45Phe Arg Ala Ala Asn Leu His Ala Gln Ile Lys Thr Ser Leu
His Arg 50 55 60Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro
Ala Ser Tyr65 70 75 80Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr
Gly Val Ser Leu Gln 85 90 95Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys
His Cys Ile 100 105158111PRTArtificial SequenceMIC-1 polypeptide
158Ala Arg Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu1
5 10 15His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp
Val 20 25 30Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala
Cys Pro 35 40 45Ser Gln Phe Arg Ala Ala Asn Leu His Ala Gln Ile Lys
Thr Ser Leu 50 55 60His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys
Cys Val Pro Ala65 70 75 80Ser Tyr Asn Pro Met Val Leu Ile Gln Lys
Thr Asp Thr Gly Val Ser 85 90 95Leu Gln Thr Tyr Asp Asp Leu Leu Ala
Lys Asp Cys His Cys Ile 100 105 110159109PRTArtificial
SequenceMIC-1 polypeptide 159Gly Asp His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr1 5 10 15Val Arg Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser 20 25 30Pro Arg Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln
35 40 45Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His
Arg 50 55 60Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala
Ser Tyr65 70 75 80Asn Pro Leu Val Leu Ile Gln Lys Thr Asp Thr Gly
Val Ser Leu Gln 85 90 95Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His
Cys Ile 100 105160111PRTArtificial SequenceMIC-1 polypeptide 160Ala
Arg Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu1 5 10
15His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val
20 25 30Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys
Pro 35 40 45Ser Gln Phe Arg Ala Ala Asn Met His Ala Gln Ile Lys Thr
Ser Leu 50 55 60His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys
Val Pro Ala65 70 75 80Ser Tyr Asn Pro Leu Val Leu Ile Gln Lys Thr
Asp Thr Gly Val Ser 85 90 95Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys
Asp Cys His Cys Ile 100 105 11016136PRTArtificial
SequenceN-terminal extension 161Gly Glu Pro Ser Gly Glu Pro Ser Gly
Glu Pro Ser Gly Glu Pro Ser1 5 10 15Gly Glu Pro Ser Gly Glu Pro Ser
Gly Glu Pro Ser Gly Glu Pro Ser 20 25 30Gly Glu Pro Ser
3516236PRTArtificial SequenceN-terminal extension 162Gly Glu Pro
Gln Gly Glu Pro Gln Gly Glu Pro Gln Gly Glu Pro Gln1 5 10 15Gly Glu
Pro Gln Gly Glu Pro Gln Gly Glu Pro Gln Gly Glu Pro Gln 20 25 30Gly
Glu Pro Gln 3516325PRTArtificial SequenceN-terminal extension
163Ala Gly Pro Glu Gln Gly Gln Glu Pro Gly Glu Pro Gln Gly Gln Glu1
5 10 15Pro Gln Pro Gly Glu Pro Glu Gly Gln 20 25164143PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 164Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25 30Ala
Arg Gly Asp His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu 35 40
45His Thr Val Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val
50 55 60Leu Ser Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys
Pro65 70 75 80Ser Gln Phe Arg Ala Ala Asn Leu His Ala Gln Ile Lys
Thr Ser Leu 85 90 95His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys
Cys Val Pro Ala 100 105 110Ser Tyr Asn Pro Leu Val Leu Ile Gln Lys
Thr Asp Thr Gly Val Ser 115 120 125Leu Gln Thr Tyr Asp Asp Leu Leu
Ala Lys Asp Cys His Cys Ile 130 135 140165134PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 165Ala Gly Pro
Glu Gln Gly Gln Glu Pro Gly Glu Pro Gln Gly Gln Glu1 5 10 15Pro Gln
Pro Gly Glu Pro Glu Gly Gln Gly Asp His Cys Pro Leu Gly 20 25 30Pro
Gly Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp 35 40
45Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr
50 55 60Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met
His65 70 75 80Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp
Thr Val Pro 85 90 95Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met
Val Leu Ile Gln 100 105 110Lys Thr Asp Thr Gly Val Ser Leu Gln Thr
Tyr Asp Asp Leu Leu Ala 115 120 125Lys Asp Cys His Cys Ile
13016612PRTArtificial SequenceN-terminal extension 166Ser Pro Ala
Gly Ser Pro Thr Ser Thr Glu Glu Gly1 5 1016712PRTArtificial
SequenceN-terminal extension 167Thr Ser Glu Ser Ala Thr Pro Glu Ser
Gly Pro Gly1 5 1016812PRTArtificial SequenceN-terminal extension
168Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly1 5
1016912PRTArtificial SequenceN-terminal extension 169Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly1 5 1017024PRTArtificial
SequenceN-terminal extension 170Ser Pro Ala Gly Ser Pro Thr Ser Thr
Glu Glu Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr Ser Thr Glu Glu Gly
2017124PRTArtificial SequenceN-terminal extension 171Ser Pro Ala
Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Thr Glu1 5 10 15Pro Ser
Glu Gly Ser Ala Pro Gly 2017224PRTArtificial SequenceN-terminal
extension 172Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly Ser
Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
2017324PRTArtificial SequenceN-teminal extension 173Thr Ser Glu Ser
Ala Thr Pro Glu Ser Gly Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro Thr
Ser Thr Glu Glu Gly 2017424PRTArtificial SequenceN-external
extension 174Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
2017524PRTArtificial SequenceN-terminal extension 175Thr Ser Glu
Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser
Glu Gly Ser Ala Pro Gly 2017624PRTArtificial SequenceN-terminal
extension 176Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Ser
Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
2017724PRTArtificial SequenceN-terminal extension 177Thr Ser Thr
Glu Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala Gly1 5 10 15Ser Pro
Thr Ser Thr Glu Glu Gly 2017824PRTArtificial SequenceN-terminal
extension 178Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
2017924PRTArtificial SequenceN-terminal extension 179Thr Ser Thr
Glu Pro Glu Ser Gly Ser Ala Pro Gly Thr Ser Thr Glu1 5 10 15Pro Glu
Ser Gly Ser Ala Pro Gly 2018024PRTArtificial SequenceN-terminal
extension 180Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly Ser
Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
2018124PRTArtificial SequenceN-terminal extension 181Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser
Gly Ser Glu Thr Pro Gly 20182133PRTArtificial SequenceMIC-1
polypeptide plus N-terminal extension 182Ser Glu Pro Ala Thr Ser
Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser
Gly Pro Gly Gly Asp His Cys Pro Leu Gly Pro 20 25 30Gly Arg Cys Cys
Arg Leu His Thr Val Arg Ala Ser Leu Glu Asp Leu 35 40 45Gly Trp Ala
Asp Trp Val Leu Ser Pro Arg Glu Val Gln Val Thr Met 50 55 60Cys Ile
Gly Ala Cys Pro Ser Gln Phe Arg Ala Ala Asn Met His Ala65 70 75
80Gln Ile Lys Thr Ser Leu His Arg Leu Lys Pro Asp Thr Val Pro Ala
85 90 95Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro Met Val Leu Ile Gln
Lys 100 105 110Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr Asp Asp Leu
Leu Ala Lys 115 120 125Asp Cys His Cys Ile 13018330PRTArtificial
SequenceN-terminal extension 183Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Glu Ser Ala Thr Pro Glu 20 25 3018430PRTArtificial
SequenceN-terminal extension 184Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Ser Thr Glu Pro Ser Glu 20 25 3018530PRTArtificial
SequenceN-terminal extension 185Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly
Thr Ser Thr Glu Glu Gly 20 25 3018630PRTArtificial
SequenceN-terminal extension 186Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly
Thr Ser Glu Ser Ala Thr 20 25 3018730PRTArtificial
SequenceN-terminal extension 187Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly
Thr Ser Thr Glu Pro Ser 20 25 3018830PRTArtificial
SequenceN-terminal extension 188Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly
Ser Glu Pro Ala Thr Ser 20 25 3018930PRTArtificial
SequenceN-terminal extension 189Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Thr Ser Thr Glu Glu Gly 20 25 3019030PRTArtificial
SequenceN-terminal extension 190Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Thr Ser Glu Ser Ala Thr 20 25 3019130PRTArtificial
SequenceN-terminal extension 191Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Glu Ser Ala Thr Pro Glu 20 25 3019230PRTArtificial
SequenceN-terminal extension 192Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Thr Ser Thr Glu Pro Ser 20 25 3019330PRTArtificial
SequenceN-terminal extension 193Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Ser Thr Glu Pro Ser Glu 20 25 3019430PRTArtificial
SequenceN-terminal extension 194Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Ser Glu Pro Ala Thr Ser 20 25 3019532PRTArtificial
SequenceN-terminal extension 195Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Gly Pro Glu Gln Gly Pro Glu Gln 20 25 3019632PRTArtificial
SequenceN-terminal extension 196Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Gly Glu Pro Ser Gly Glu Pro Ser 20 25 3019736PRTArtificial
SequenceN-terminal extension 197Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Thr Ser Thr Glu Pro Ser Glu Gly 20 25 30Ser Ala Pro Gly
3519848PRTArtificial SequenceN-terminal extension 198Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25 30Ser
Ala Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 35 40
4519960PRTArtificial SequenceN-terminal extension 199Ser Pro Ala
Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25 30Ser
Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 35 40
45Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 50 55
60200139PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 200Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu
Glu Gly Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Met His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val Leu Ile
Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp
Leu Leu Ala Lys Asp Cys His Cys Ile 130 135201139PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 201Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Glu Ser Ala Thr Gly Asp 20 25 30His
Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg 35 40
45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
50 55 60Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg65 70 75 80Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His
Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro 100 105 110Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp Leu Leu Ala Lys Asp Cys
His Cys Ile 130 135202139PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 202Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Glu Ser Ala Thr Pro Glu Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn
Met His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105
110Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
115 120 125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135203139PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 203Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Ser Thr Glu Pro
Ser Glu Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Met His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val Leu Ile
Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120
125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135204139PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 204Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Ser Glu Pro Ala
Thr Ser Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Met His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val Leu Ile
Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp
Leu Leu Ala Lys Asp Cys His Cys Ile 130 135205139PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 205Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser
Glu Gly Ser Ala Pro Gly Thr Ser Thr Glu Glu Gly Gly Asp 20 25 30His
Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg 35 40
45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
50 55 60Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg65 70 75 80Ala Ala Asn Leu His Ala Gln Ile Lys Thr Ser Leu His
Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro 100 105 110Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp Leu Leu Ala Lys Asp Cys
His Cys Ile 130 135206139PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 206Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly
Thr Ser Glu Ser Ala Thr Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn
Leu His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105
110Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
115 120 125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135207139PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 207Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Thr Glu1 5 10 15Pro Ser Glu Gly Ser Ala Pro Gly Thr Ser Thr Glu
Pro Ser Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Leu His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val Leu Ile
Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp
Leu Leu Ala Lys Asp Cys His Cys Ile 130 135208139PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 208Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Thr Glu1 5 10 15Pro Ser
Glu Gly Ser Ala Pro Gly Ser Glu Pro Ala Thr Ser Gly Asp 20 25 30His
Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg 35 40
45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
50 55 60Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg65 70 75 80Ala Ala Asn Leu His Ala Gln Ile Lys Thr Ser Leu His
Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro 100 105 110Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp Leu Leu Ala Lys Asp Cys
His Cys Ile 130 135209139PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 209Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Thr Ser Thr Glu Glu Gly Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn
Leu His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105
110Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
115 120 125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135210139PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 210Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser
Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser
Ala Thr Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Met His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val Leu Ile
Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp
Leu Leu Ala Lys Asp Cys His Cys Ile 130 135211139PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 211Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser
Gly Ser Glu Thr Pro Gly Glu Ser Ala Thr Pro Glu Gly Asp 20 25 30His
Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg 35 40
45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
50 55 60Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg65 70 75 80Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His
Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro 100 105 110Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp Leu Leu Ala Lys Asp Cys
His Cys Ile 130 135212139PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 212Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly
Thr Ser Thr Glu Pro Ser Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn
Leu His Ala Gln Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105
110Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr
115 120 125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135213139PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 213Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser
Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Ser Thr Glu Pro
Ser Glu Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg
Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp
Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys Ile Gly
Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Met His Ala Gln
Ile Lys Thr Ser Leu His Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala
Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val Leu Ile
Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp
Leu Leu Ala Lys Asp Cys His Cys Ile 130 135214139PRTArtificial
SequenceMIC-1 polypeptide with N-terminal extension 214Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala1 5 10 15Thr Ser
Gly Ser Glu Thr Pro Gly Ser Glu Pro Ala Thr Ser Gly Asp 20 25 30His
Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu His Thr Val Arg 35 40
45Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro Arg
50 55 60Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe
Arg65 70 75 80Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His
Arg Leu Lys 85 90 95Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala
Ser Tyr Asn Pro 100 105 110Met Val Leu Ile Gln Lys Thr Asp Thr Gly
Val Ser Leu Gln Thr Tyr 115 120 125Asp Asp Leu Leu Ala Lys Asp Cys
His Cys Ile 130 135215141PRTArtificial SequenceMIC-1 polypeptide
with N-terminal extension 215Ser Glu Pro Ala Thr Ser Gly Ser Glu
Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly
Gly Pro Glu Gln Gly Pro Glu Gln 20 25 30Gly Asp His Cys Pro Leu Gly
Pro Gly Arg Cys Cys Arg Leu His Thr 35 40 45Val Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp Val Leu Ser 50 55 60Pro Arg Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln65 70 75 80Phe Arg Ala
Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His Arg 85 90 95Leu Lys
Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr 100 105
110Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln
115 120 125Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135 140216141PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 216Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Gly Glu
Pro Ser Gly Glu Pro Ser 20 25 30Gly Asp His Cys Pro Leu Gly Pro Gly
Arg Cys Cys Arg Leu His Thr 35 40 45Val Arg Ala Ser Leu Glu Asp Leu
Gly Trp Ala Asp Trp Val Leu Ser 50 55 60Pro Arg Glu Val Gln Val Thr
Met Cys Ile Gly Ala Cys Pro Ser Gln65 70 75 80Phe Arg Ala Ala Asn
Met His Ala Gln Ile Lys Thr Ser Leu His Arg 85 90 95Leu Lys Pro Asp
Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr 100 105 110Asn Pro
Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln 115 120
125Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130 135
140217147PRTArtificial SequenceMIC-1 polypeptide with N-terminal
extension 217Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr
Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu
Pro Ser Glu Gly 20 25 30Ser Ala Pro Gly Ala Arg Gly Asp His Cys Pro
Leu Gly Pro Gly Arg 35 40 45Cys Cys Arg Leu His Thr Val Arg Ala Ser
Leu Glu Asp Leu Gly Trp 50 55 60Ala Asp Trp Val Leu Ser Pro Arg Glu
Val Gln Val Thr Met Cys Ile65 70 75 80Gly Ala Cys Pro Ser Gln Phe
Arg Ala Ala Asn Met His Ala Gln Ile 85 90 95Lys Thr Ser Leu His Arg
Leu Lys Pro Asp Thr Val Pro Ala Pro Cys 100 105 110Cys Val Pro Ala
Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp 115 120 125Thr Gly
Val Ser Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys 130 135
140His Cys Ile145218159PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 218Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser
Thr Glu Pro Ser Glu Gly 20 25 30Ser Ala Pro Gly Thr Ser Thr Glu Pro
Ser Glu Gly Ser Ala Pro Gly 35 40 45Ala Arg Gly Asp His Cys Pro Leu
Gly Pro Gly Arg Cys Cys Arg Leu 50 55 60His Thr Val Arg Ala Ser Leu
Glu Asp Leu Gly Trp Ala Asp Trp Val65 70 75 80Leu Ser Pro Arg Glu
Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro 85 90 95Ser Gln Phe Arg
Ala Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu 100 105 110His Arg
Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala 115 120
125Ser Tyr Asn Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser
130 135 140Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys
Ile145 150 155219172PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 219Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu
Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser
Thr Glu Pro Ser Glu Gly 20 25 30Ser Ala Pro Gly Ser Pro Ala Gly Ser
Pro Thr Ser Thr Glu Glu Gly 35 40 45Thr Ser Thr Glu Pro Ser Glu Gly
Ser Ala Pro Gly Ala Arg Asn Gly 50 55 60Asp His Cys Pro Leu Gly Pro
Gly Arg Cys Cys Arg Leu His Thr Val65 70 75 80Arg Ala Ser Leu Glu
Asp Leu Gly Trp Ala Asp Trp Val Leu Ser Pro 85 90 95Arg Glu Val Gln
Val Thr Met Cys Ile Gly Ala Cys Pro Ser Gln Phe 100 105 110Arg Ala
Ala Asn Met His Ala Gln Ile Lys Thr Ser Leu His Arg Leu 115 120
125Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn
130 135 140Pro Met Val Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu
Gln Thr145 150 155 160Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys
Ile 165 170220133PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 220Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Ser Glu Pro Ala1 5 10 15Thr Ser Gly Ser Glu Thr Pro Gly Gly Asp
His Cys Pro Leu
Gly Pro 20 25 30Gly Arg Cys Cys Arg Leu His Thr Val Arg Ala Ser Leu
Glu Asp Leu 35 40 45Gly Trp Ala Asp Trp Val Leu Ser Pro Arg Glu Val
Gln Val Thr Met 50 55 60Cys Ile Gly Ala Cys Pro Ser Gln Phe Arg Ala
Ala Asn Glu His Ala65 70 75 80Gln Ile Lys Thr Ser Leu Glu Glu Leu
Lys Pro Asp Thr Val Pro Ala 85 90 95Pro Cys Cys Val Pro Ala Ser Tyr
Asn Pro Met Val Leu Ile Gln Lys 100 105 110Thr Asp Thr Gly Val Ser
Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys 115 120 125Asp Cys His Cys
Ile 130221139PRTArtificial SequenceMIC-1 polypeptide with
N-terminal extension 221Ser Glu Pro Ala Thr Ser Gly Ser Glu Thr Pro
Gly Thr Ser Glu Ser1 5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser
Thr Glu Pro Ser Gly Asp 20 25 30His Cys Pro Leu Gly Pro Gly Arg Cys
Cys Arg Leu His Thr Val Arg 35 40 45Ala Ser Leu Glu Asp Leu Gly Trp
Ala Asp Trp Val Leu Ser Pro Arg 50 55 60Glu Val Gln Val Thr Met Cys
Ile Gly Ala Cys Pro Ser Gln Phe Arg65 70 75 80Ala Ala Asn Glu His
Ala Gln Ile Lys Thr Ser Leu His Glu Leu Lys 85 90 95Pro Asp Thr Val
Pro Ala Pro Cys Cys Val Pro Ala Ser Tyr Asn Pro 100 105 110Met Val
Leu Ile Gln Lys Thr Asp Thr Gly Val Ser Leu Gln Thr Tyr 115 120
125Asp Asp Leu Leu Ala Lys Asp Cys His Cys Ile 130
135222111PRTArtificial SequenceMIC-1 polypeptide 222Ala Arg Gly Asp
His Cys Pro Leu Gly Pro Gly Arg Cys Cys Arg Leu1 5 10 15His Thr Val
Arg Ala Ser Leu Glu Asp Leu Gly Trp Ala Asp Trp Val 20 25 30Leu Ser
Pro Arg Glu Val Gln Val Thr Met Cys Ile Gly Ala Cys Pro 35 40 45Ser
Gln Phe Arg Ala Ala Asn Leu His Ala Gln Ile Lys Thr Ser Leu 50 55
60His Arg Leu Lys Pro Asp Thr Val Pro Ala Pro Cys Cys Val Pro Ala65
70 75 80Ser Tyr Asn Pro Leu Val Leu Ile Gln Lys Thr Asp Thr Gly Val
Ser 85 90 95Leu Gln Thr Tyr Asp Asp Leu Leu Ala Lys Asp Cys His Cys
Ile 100 105 11022330PRTArtificial SequenceN-terminal extension
223Ser Glu Pro Ala Thr Cys Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1
5 10 15Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser 20
25 3022430PRTArtificial SequenceN-terminal extension 224Ser Glu Pro
Ala Thr Ser Gly Cys Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser 20 25
3022532PRTArtificial SequenceN-terminal extension 225Ser Glu Pro
Cys Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3022632PRTArtificial SequenceN-terminal extension 226Ser Glu Pro
Ala Thr Cys Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3022732PRTArtificial SequenceN-terminal extension 227Ser Glu Pro
Ala Thr Ser Cys Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3022832PRTArtificial SequenceN-terminal extension 228Ser Glu Pro
Cys Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3022932PRTArtificial SequenceN-terminal extension 229Ser Glu Pro
Ala Cys Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023032PRTArtificial SequenceN-terminal extension 230Ser Glu Pro
Ala Thr Ser Gly Cys Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023132PRTArtificial SequenceN-terminal extension 231Ser Glu Pro
Ala Thr Ser Gly Ser Glu Cys Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023232PRTArtificial SequenceN-terminal extension 232Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Cys Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023332PRTArtificial SequenceN-terminal extension 233Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Cys Glu Ser1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023432PRTArtificial SequenceN-terminal extension 234Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Cys1 5 10 15Ala Thr
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023532PRTArtificial SequenceN-terminal extension 235Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Cys
Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023632PRTArtificial SequenceN-terminal extension 236Ser Glu Pro
Ala Thr Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser1 5 10 15Ala Thr
Pro Glu Cys Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly 20 25
3023732PRTArtificial Sequence