U.S. patent application number 16/524446 was filed with the patent office on 2020-01-30 for chimeric immunogenic polypeptides.
The applicant listed for this patent is Research Development Foundation. Invention is credited to Jere W. McBRIDE, David H. WALKER.
Application Number | 20200031877 16/524446 |
Document ID | / |
Family ID | 69177593 |
Filed Date | 2020-01-30 |
United States Patent
Application |
20200031877 |
Kind Code |
A1 |
McBRIDE; Jere W. ; et
al. |
January 30, 2020 |
CHIMERIC IMMUNOGENIC POLYPEPTIDES
Abstract
Provided herein are chimeric polypeptides that may be used,
e.g., for the diagnosis of or vaccination against Ehrlichia
chaffeensis and/or Ehrlichia canis.
Inventors: |
McBRIDE; Jere W.;
(Galveston, TX) ; WALKER; David H.; (Galveston,
TX) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Research Development Foundation |
Carson City |
NV |
US |
|
|
Family ID: |
69177593 |
Appl. No.: |
16/524446 |
Filed: |
July 29, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62711005 |
Jul 27, 2018 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/70 20130101;
A61P 31/04 20180101; A61K 2039/552 20130101; A61K 39/0233 20130101;
G01N 33/56911 20130101; G01N 33/6854 20130101; C07K 2319/33
20130101; C07K 14/29 20130101; A61K 2039/6043 20130101 |
International
Class: |
C07K 14/29 20060101
C07K014/29; A61K 39/02 20060101 A61K039/02; G01N 33/68 20060101
G01N033/68; G01N 33/569 20060101 G01N033/569 |
Claims
1. An isolated polypeptide, wherein the isolated polypeptide
comprises: (i) at least two of the immunogenic sequences of Table
1, or a sequence at least 90% identical; and (ii) wherein at least
one of the immunogenic sequences is contiguously repeated in the
polypeptide.
2. The isolated polypeptide of claim 1, wherein each of the at
least two immunogenic sequences of Table 1, or a sequence at least
90% identical are contiguously repeated 1, 2, 3, 4, 5, 6, or 7
times in the polypeptide.
3. The isolated polypeptide of claim 1, wherein the isolated
polypeptide comprises one or more of (SEQ ID NOs:11-16 or 36-42),
wherein the one or more of (SEQ ID NOs:11-16 or 36-42) are
contiguously repeated 0, 1, 2, or 3 times.
4. The isolated polypeptide of claim 1, wherein each of the
immunogenic sequences are contiguously repeated from 1 to 3 times
in the polypeptide.
5. The isolated polypeptide of claim 4, wherein each of the
immunogenic sequences are contiguously repeated from 1 to 2 times
in the polypeptide.
6. The isolated peptide of claim 1, wherein the isolated
polypeptide comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or
all of the following immunogenic sequences: TRP120 (SEQ ID NO:22),
TRP140 (SEQ ID NO:23), A34N1 (SEQ ID NO:7), TRP63 (SEQ ID NO:18),
TRP47 (SEQ ID NO:17), TRP75 (SEQ ID NO:19), TRP28 (SEQ ID NO:2),
TRP36R1 (SEQ ID NO:3), TRP36R2 (SEQ ID NO:4), TRP36R3 (SEQ ID
NO:6), TRP36CO (SEQ ID NO:36), TRP19 (SEQ ID NO:1), HSP (SEQ ID
NO:24), or a sequence at least 90% identical; wherein each of the
immunogenic sequences are contiguously repeated from 1 to 7 times
in the polypeptide.
7. The polypeptide of claim 1, wherein the isolated polypeptide
comprises TRP36R1 and TRP140.
8. The polypeptide of claim 7, wherein the TRP36R1 is contiguously
repeated 4-8 times, and wherein the TRP140 is contiguously repeated
1-3 times.
9. The polypeptide of claim 8, wherein the polypeptide comprises or
consists of 8 repeats of TRP36R1 and 4 repeats of TRP140.
10. The polypeptide of claim 9, wherein the polypeptide comprises
or consists of SEQ ID NO:27.
11. The polypeptide of claim 7, wherein the polypeptide further
comprises TRP19.
12. The polypeptide of claim 11, wherein the polypeptide comprises
or consists of SEQ ID NO:26.
13. The polypeptide of claim 1, wherein the isolated polypeptide
comprises at least two, at least three, at least four, at least
five or all of the immunogenic sequences: TRP32, TRP120, TRP36
(such as TRP36R1, TRP36R2, TRP36R3, or TRP36CO), TRP140, TRP28,
and/or HSP.
14. The polypeptide of claim 13, wherein the TRP36R1 if present is
repeated 2-6 times, and wherein the other immunogenic sequences are
repeated 1-3 times.
15. The polypeptide of claim 1, wherein the polypeptide comprises
all of TRP32, TRP120, TRP36, TRP140, TRP28, and HSP.
16. The polypeptide of claim 15, wherein the polypeptide comprises
or consists of SEQ ID NO:28.
17. The polypeptide of claim 13, wherein the polypeptide comprises
TRP120, TRP36, TRP140, and TRP28.
18. The polypeptide of claim 17, wherein the polypeptide comprises
or consists of SEQ ID NO:29.
19. The polypeptide of claim 1, wherein the isolated polypeptide
comprises at least three, at least four, at least five or all of
TRP32R1, TRP32R2, TRP32R3, TRP32R4, TRP120, and A34N1.
20. The polypeptide of claim 19, wherein TRP120 and A34N1 are each
contiguously repeated 1-3 times.
21. The polypeptide of claim 20, wherein TRP120 and A34N1 are each
contiguously repeated 2 times.
22. The polypeptide of claim 21, wherein the polypeptide comprises
or consists of SEQ ID NO:25.
23-49. (canceled)
50. The polypeptide of claim 1, wherein the polypeptide comprises a
polypeptide of any one of SEQ ID NOs: 25-35.
51-58. (canceled)
59. The polypeptide of claim 1, wherein the different immunogenic
sequences are not separated by a linker or a spacer.
60. The polypeptide of claim 1, wherein the different immunogenic
sequences are separated by a linker or a spacer.
61. The polypeptide of claim 60, wherein the linker is a glycine
linker.
62. The polypeptide of claim 61, wherein the glycine linker has the
amino acid sequence -(G)x-, wherein X=3-5.
63. The polypeptide of claim 1, wherein the polypeptide is less
than 500, less than 450, less than 400, less than 350, less than
300, less than 250, less than 200, or less than 150 amino acids in
length.
64. The polypeptide of claim 1, wherein the polypeptide is
comprised in a pharmaceutical preparation.
65. The pharmaceutical preparation of claim 64, wherein the
pharmaceutical preparation is formulated for parenteral,
intravenous, subcutaneous, intranasal, sublingual, or intradermal
administration.
66. The polypeptide of claim 1, wherein the polypeptide is attached
to a solid support or is comprised in a diagnostic kit.
67. The polypeptide of claim 66, wherein the solid support is glass
or plastic.
68. The polypeptide of claim 66, wherein the solid support is
comprised in a lateral flow assay, or microfluidic device.
69. An isolated polypeptide of Formula I
(A.sub.s-B.sub.t-C.sub.u-D.sub.v-E.sub.w-F.sub.x-G.sub.y-H.sub.z).sub.n,
wherein each of A, B, C, D, E, F, G, and H is a peptide selected
from SEQ ID NOs:1-24 and 36-42, or a sequence at least 90%
identical to any one of (SEQ ID NOs:1-24 or 36-42), wherein s, t,
u, v, x, y, and z is an integer 0-8, wherein at least two of s-z
are .gtoreq.1 and at least one of s-z is .gtoreq.2, and wherein n
is an integer 1-5.
70-79. (canceled)
80. A pharmaceutical preparation comprising the polypeptide of
claim 1 and a pharmaceutically acceptable excipient.
81-112. (canceled)
113. A nucleic acid encoding the polypeptide of claim 1.
114-115. (canceled)
116. A host cell comprising the nucleic acid of claim 113.
117. (canceled)
118. A method of detecting antibodies that specifically bind an
Ehrlichia organism in a test sample, comprising: (a) contacting an
isolated polypeptide of claim 1; (b) detecting the peptide-antibody
complexes; wherein the detection of the peptide-antibody complexes
is an indication that antibodies specific for an Ehrlichia organism
are present in the test sample, and wherein the absence of the
peptide-antibody complexes is an indication that antibodies
specific an Ehrlichia organism are not present in the test
sample.
119-122. (canceled)
123. A method of identifying an Ehrlichia infection in a mammalian
subject comprising: (a) contacting a biological sample from the
subject with an isolated polypeptide of claim 1 under conditions
that allow peptide-antibody complexes to form; and (b) detecting
the peptide-antibody complexes; wherein the detection of the
peptide-antibody complexes is an indication that the subject has an
Ehrlichia infection.
124-126. (canceled)
127. A kit comprising: (a) the isolated polypeptide of claim 1, (b)
an anti-dog or anti-human secondary antibody linked to a reporter
molecule; and, (c) an appropriate reagent for detection of the
reporter molecule.
128-133. (canceled)
134. A method of inducing an immune response in a mammalian subject
comprising administering to the subject an effective amount of a
pharmaceutical preparation comprising the polypeptide of claim
1.
135-136. (canceled)
137. A method of treating an Ehrlichia chaffeensis or Ehrlichia
canis infection in a subject comprising: (a) contacting a
biological sample from the subject with an isolated polypeptide of
claim 1 under conditions that allow peptide-antibody complexes to
form; (b) detecting the peptide-antibody complexes; wherein the
detection of the peptide-antibody complexes is an indication that
the subject has an Ehrlichia chaffeensis or Ehrlichia canis
infection; and (c) administering a therapeutic compound to treat
Ehrlichia infection in the subject.
138-142. (canceled)
Description
[0001] This application claims the benefit of U.S. Provisional
Patent Application No. 62/711,005, filed Jul. 27, 2018, the
entirety of which is incorporated herein by reference.
BACKGROUND OF THE INVENTION
1. Field of the Invention
[0002] The present invention relates generally to the field of
molecular biology and medicine. More particularly, it concerns
chimeric polypeptides that may be used for diagnostic or
vaccination purposes.
2. Description of Related Art
[0003] Human monocytotropic ehrlichiosis (HME) is a group 1 NIAID
emerging disease, and the etiologic agent, E. chaffeensis, is
classified as a Category C priority pathogen. HME is an
undifferentiated febrile illness that is life-threatening, clinical
diagnosis is difficult, and definitive diagnosis is most often
retrospective (Walker and Dumler, 1997; Walker et al., 2004; Dumler
et al., 2007). Although well over 8,000 cases have been reported to
the Centers for Disease Control as of 2012, this number likely
underestimates the actual number of cases by 100-fold (Olano et
al., 2003). The disease is often undiagnosed due to the
non-specific symptoms associated with the onset, but it results in
patient hospitalization in 43-62% of cases (Fishbein et al., 1994).
Progression of the disease can result in a fatal outcome and often
involves multisystem failure, with acute respiratory distress
syndrome (ARDS) and meningoencephalitis being common in many fatal
cases (Fishbein et al., 1994; Paparone et al., 1995). The threat to
public health is increasing with newly emerging ehrlichial agents,
yet vaccines for human ehrlichioses are not available, and
therapeutic options are limited. New information and bioinformatics
prediction tools have been developed that make a genome-wide
identification of protective immunodiagnostic/vaccine candidates
feasible (He et al., 2010; Magnan et al., 2010)
[0004] Prospects for development of effective subunit vaccines and
immunodiagnostics for Ehrlichia have been limited due to many
factors, not the least of which is the small repertoire of
immunoreactive/protective proteins that have been molecularly
defined (McBride and Walker, 2010). The gaps in knowledge required
to address this problem for Ehrlichia chaffeensis have been
narrowed by progress in understanding of protective/pathologic
immune mechanisms (Feng and Walker 2004; Nandi et al., 2007;
Winslow et al., 2000), immunomolecular characterization of some
vaccine/diagnostic antigens (Kuriakose et al., 2012; Li et al.,
2002), genome, transcriptome and proteome profiles (Kuriakose et
al., 2011; Lin et al., 2011), new animal models (Winslow et al.,
1998; Sotomay et al., 2001), and other technological advances.
Studies utilizing low throughput approaches to define antigenic
components of E. chaffeensis have yielded a small group of
protective antigens that include a major outer membrane protein
(OMP), and a family of secreted tandem repeat protein (TRP)
effectors with major protective linear antibody epitopes (Kuriakose
et al., 2012; Li et al., 2001). Nevertheless, these antigens likely
represent a significant, but incomplete repertoire of
immunoreactive/protective proteins. In addition, it is well
established that antibody-mediated immunity is necessary for
protection against E. chaffeensis infection (Winslow et al., 2000;
Li et al., 2002; Kuriakose et al., 2012; Li et al., 2001; Racine et
al., 2011; Yager et al., 2005), and antibodies are the cornerstone
of the most effective vaccines for humans. Elimination of E.
chaffeensis occurs, at least in part, during the extracellular
stage of infection (Li and Winslow 2003); however, intracellular
immune mechanisms may also be important, and defining the
characteristics of antigens/antibodies that are protective in both
environments is critical for effective vaccine development.
Clearly, there is a need for new and improved methods for
diagnosing and vaccinating against E. chaffeensis and E. canis.
SUMMARY OF THE INVENTION
[0005] The present disclosure, in some aspects, provides methods
and compositions for the diagnosis of and vaccination against
Ehrlichia chaffeensis (E. chaffeensis) and/or Ehrlichia canis (E.
canis). In some embodiments, chimeric immunogenic peptides and
polypeptides are provided. In some aspects, it has been discovered
that contiguous repetition of different immunogenic sequences can
be used to generate peptides or polypeptides that display improved
properties for diagnosis and/or inducing immune responses against
E. chaffeensis and/or E. canis.
[0006] As shown in the below examples, immunoreactive E.
chaffeensis and E. canis peptides were used to produce chimeric
Ehrlichia polypeptides. Chimeric polypeptides included in Table 2
were verified to be immunoreactive using ELISA tests on human
monocytotropic ehrlichiosis (HME) positive human and canine sera.
ELISA testing using positive HME sera obtained from patients
revealed that the below constructs elicited significant responses,
indicating that peptides (e.g., of Table 1) can be used to produce
chimeric polypeptides (e.g., of Formula I or in Table 2) that may
be used in diagnostic methods to detect infection by E. chaffeensis
or E. canis, or may be used to induce an immune response in a
subject (e.g., a human or a dog) against E. chaffeensis or E.
canis.
[0007] An aspect of the present invention relates to an isolated
polypeptide, wherein the isolated polypeptide comprises: (i) at
least two of the immunogenic sequences of Table 1, or a sequence at
least 90% identical (preferably at least 95% identical); and (ii)
wherein at least one of the immunogenic sequences is contiguously
repeated in the polypeptide. For example, in some embodiments, at
least 2, 3, 4, 5, 6, or 7 immunogenic sequences are contiguously
repeated in the isolated polypeptide. In some embodiments, each of
the at least two immunogenic sequences of Table 1, or a sequence at
least 90% identical are contiguously repeated 1, 2, 3, 4, 5, 6, or
7 times in the polypeptide. In some embodiments, the isolated
polypeptide comprises one or more of (SEQ ID NOs:11-16 or 36-42),
wherein the one or more of (SEQ ID NOs:11-16 or 36-42) are
contiguously repeated 0, 1, 2, or 3 times. In some embodiments,
each of the immunogenic sequences are contiguously repeated from 1
to 3 times in the polypeptide. In some embodiments, each of the
immunogenic sequences are contiguously repeated from 1 to 2 times
in the polypeptide. In some embodiments, the isolated polypeptide
comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the
following immunogenic sequences: TRP120 (SEQ ID NO:22), TRP140 (SEQ
ID NO:23), A34N1 (SEQ ID NO:7), TRP63 (SEQ ID NO:18), TRP47 (SEQ ID
NO:17), TRP75 (SEQ ID NO:19), TRP28 (SEQ ID NO:2), TRP36R1 (SEQ ID
NO:3), TRP36R2 (SEQ ID NO:4), TRP36R3 (SEQ ID NO:6), TRP36CO (SEQ
ID NO:36), TRP19 (SEQ ID NO:1), HSP (SEQ ID NO:24), or a sequence
at least 90% identical (preferably at least 95% identical); wherein
each of the immunogenic sequences are contiguously repeated from 1
to 7 times in the polypeptide. The isolated polypeptide may
comprise TRP36R1 and TRP140. In some embodiments, the TRP36R1 is
contiguously repeated 4-8 times, and wherein the TRP140 is
contiguously repeated 1-3 times. The polypeptide may comprise or
consists of 8 repeats of TRP36R1 and 4 repeats of TRP140. The
polypeptide may comprise or consist of SEQ ID NO:27. The
polypeptide may further comprise TRP19. The polypeptide may
comprise or consist of SEQ ID NO:26. In some embodiments, the
isolated polypeptide comprises at least two, at least three, at
least four, at least five or all of the immunogenic sequences:
TRP32, TRP120, TRP36R1, TRP140, TRP28, and/or HSP. In some
embodiments, the TRP36R1 if present is repeated 2-6 times, and
wherein the other immunogenic sequences are repeated 1-3 times. In
some embodiments, the polypeptide comprises all of TRP32, TRP120,
TRP36 (such as TRP36R1, TRP36R2, TRP36R3, and/or TRP36CO), TRP140,
TRP28, and HSP. The polypeptide may comprise or consist of SEQ ID
NO:28. In some embodiments, the polypeptide comprises TRP120,
TRP36, TRP140, and TRP28. The polypeptide may comprise or consists
of SEQ ID NO:29. In some embodiments, the isolated polypeptide
comprises at least three, at least four, at least five or all of
TRP32R1, TRP32R2, TRP32R3, TRP32R4, TRP120, and A34N1. In some
embodiments, TRP120 and A34N1 are each contiguously repeated 1, 2,
or 3 times. The polypeptide may comprise or consist of SEQ ID
NO:25. The polypeptide may comprise at least two, at least three,
or all of A34N1, TRP63, TRP47, and/or TRP75. The polypeptide may
comprise A34N1 and TRP63. Each of the immunogenic sequences may be
contiguously repeated 1-2 times. The polypeptide may comprise
A34N1, TRP63, and TRP75. The polypeptide may comprise or consist of
SEQ ID NO:34. In some embodiments, the polypeptide comprises A34N1,
TRP63, and TRP47. The polypeptide may comprise or consist of SEQ ID
NO:33. In some embodiments, the polypeptide comprises at least two,
at least three, or all of A34N1, TRP63, TRP47, and/or TRP75. The
polypeptide may comprise A34N1 and TRP63. In some embodiments, each
of the immunogenic sequences are contiguously repeated 1-2 times.
The polypeptide may comprise A34N1, TRP63, and TRP75. The
polypeptide may comprise or consist of SEQ ID NO:34. The
polypeptide may comprise A34N1, TRP63, and TRP47. The polypeptide
may comprise or consist of SEQ ID NO:33. In some embodiments, the
polypeptide comprises at least two, at least three, or all of
TRP120, A34N1, TRP47, and/or TRP63. The polypeptide may comprise
A34N1 and TRP120. Each of the immunogenic sequences may be
contiguously repeated 1-2 times. The polypeptide may comprise
A34N1, TRP120, and TRP63. The polypeptide may comprise or consist
of SEQ ID NO:31. The polypeptide may comprise A34N1, TRP120, and
TRP47. The polypeptide may comprise or consist of SEQ ID NO:32. The
polypeptide may comprise A34N1, TRP120, TRP47, and TRP63. The
polypeptide may comprise or consist of SEQ ID NO:30. In some
embodiments, the polypeptide comprises at least two, at least
three, or all of TRP36R1, TRP140, TRP95R, and/or TRP95C. Each of
the immunogenic sequences may be contiguously repeated 1-2 times.
The polypeptide may comprise TRP36R1, TRP140, TRP95R, and TRP95C.
In some embodiments, the polypeptide comprises or consists of SEQ
ID NO:35. The polypeptide may comprise or consist of a polypeptide
of any one of (SEQ ID NOs: 25-35 or 43-44). The isolated
polypeptide may comprise 3, 4, 5, 6, 7, 8, 9, or all of the
following immunogenic sequences: TRP120, A34N1, TRP63, TRP47,
TRP75, TRP28, TRP36 (such as TRP36R1, TRP36R2, TRP36R3, and/or
TRP36CO), TRP19, TRP140, and/or HSP. In some embodiments, the
polypeptide further comprises at least two of TRP36R1, TRP36R2,
TRP36R3, and/or TRP36CO. The polypeptide may comprise TRP36R1,
TRP36R2, and TRP36R3. The TRP36R1, TRP36R2, and TRP36R3 sequences
may be separated by a linker. In some embodiments, the TRP36R1,
TRP36R2, and TRP36R3 sequences are not separated by a linker. The
polypeptide may comprise TRP36R1-R2-R3 (SEQ ID NO:11),
TRP36R1-R3-R2 (SEQ ID NO:12), TRP36R2-R1-R3 (SEQ ID NO:13),
TRP36R2-R3-R1 (SEQ ID NO:14), TRP36R3-R1-R2 (SEQ ID NO:15), or
TRP36R3-R2-R1 (SEQ ID NO:16). In some embodiments, each of the
immunogenic sequences in the polypeptide are contiguously repeated
1, 2, or 3 times. Each of the immunogenic sequences may be
contiguously repeated 1 or 2 times. In some embodiments, the
different immunogenic sequences are not separated by a linker or a
spacer. In some embodiments, the different immunogenic sequences
are separated by a linker or a spacer, such as for example a
glycine linker. The glycine linker may have the amino acid sequence
-(G)x-, wherein X=3-5. In some embodiments, the polypeptide is less
than 500, less than 450, less than 400, less than 350, less than
300, less than 250, less than 200, or less than 150 amino acids in
length.
[0008] In some embodiments, the polypeptide is comprised in a
pharmaceutical preparation. In some embodiments, the pharmaceutical
preparation is formulated for parenteral, intravenous,
subcutaneous, intranasal, sublingual, or intradermal
administration. In some embodiments, the polypeptide is attached to
a solid support (e.g., glass or plastic) or comprised in a
diagnostic kit. In some embodiments, the solid support is comprised
in a lateral flow assay, or microfluidic device.
[0009] Another aspect of the present invention relates to an
isolated polypeptide of Formula I
(A.sub.s-B.sub.t-C.sub.u-D.sub.v-E.sub.w-F.sub.x-G.sub.y-H.sub.z).sub.n,
wherein A, B, C, D, E, F, G, and H is a peptide selected from SEQ
ID NOs:1-24 and 36-42, or a sequence at least 90% identical
(preferably at least 95% identical) to any one of (SEQ ID NOs:1-24
or 36-42), wherein s, t, u, v, x, y, and z is an integer 0-8,
wherein at least two (e.g., 2, 3, 4, 5, 6, 7, or 8) of s-z are
.gtoreq.1 and at least one (e.g., 1, 2, 3, 4, 5, 6, 7, or 8) of s-z
is .gtoreq.2, and wherein n is an integer 1-5. In some embodiments,
A is SEQ ID NO:8 (TRP36R1) and B is SEQ ID NO:23 (TRP140). In some
embodiments, s is from 4 to 8, t is from 2 to 4, and n=1. In some
embodiments, u, v, x, y, and z are zero. In some embodiments,
wherein s=8 and t=4. The polypeptide may comprise or consist of SEQ
ID NO:27. In some embodiments, at least two, three, four, five or
six of s, t, u, v, x, y, and z are each 2-3; and wherein n=1. In
some embodiments, A is TRP32 (e.g., TRP32R3 of SEQ ID NO:5), B is
TRP120 (SEQ ID NO:22), C is TRP36R1 (SEQ ID NO:8), D is TRP140 (SEQ
ID NO:23), E is TRP28 (SEQ ID NO:2), and F is HSP (SEQ ID NO:24).
In some embodiments, z=0. The polypeptide may comprise or consist
of SEQ ID NO:28. In some embodiments, the polypeptide is a
polypeptide of Table 2 or any one of (SEQ ID NOs: 25-35 or
43-44).
[0010] Yet another aspect of the present invention relates to a
pharmaceutical preparation comprising a polypeptide disclosed
herein (e.g., of Formula I or in Table 2) or as described above,
and a pharmaceutically acceptable excipient. The pharmaceutical
preparation may be formulated for parenteral, intravenous,
subcutaneous, intranasal, sublingual, or intradermal
administration. The pharmaceutically acceptable excipient may
comprise or consists of an adjuvant. In some embodiments, the
adjuvant is an emulsion or liposomes, or wherein the adjuvant
comprises a lipid. The emulsion may be an oil-in-water (O/W)
emulsion or a water-in-oil (W/O) emulsion. In some embodiments, the
adjuvant comprises a triterpenoid, a sterol, an immunomodulator, a
polymer (e.g., diethyl-aminoethyl (DEAE)-dextran, polyethelyne
glycol, or polyacrylic acid), and/or an immunostimulatory
oligonucleotide (e.g., a CpG containing ODN). In some embodiments,
the adjuvant comprises DEAE Dextran, an immunostimulatory
oligonucleotide, and oil such as mineral oil, wherein the
immunostimulatory oligonucleotide is a CpG containing ODN, and
wherein the adjuvant formulation is a water-in-oil (W/O) emulsion.
In some embodiments, the adjuvant comprises a saponin, a sterol, a
quaternary ammonium compound, a polymer, and an ORN/ODN. In some
embodiments, the saponin is Quil A or a purified faction thereof,
the sterol is cholesterol, the quaternary ammonium compound is
dimethyl dioctadecyl ammonium bromide (DDA), the polymer is
polyacrylic acid, and the ORN/ODN is a CpG. In some embodiments,
the saponin is present in an amount of about 1 .mu.g to about 5,000
.mu.g per dose, the sterol is present in an amount of about 1 .mu.g
to about 5,000 .mu.g per dose, the quaternary ammonium compound is
present in an amount of about 1 .mu.g to about 5,000 .mu.g per
dose, and the polymer is present in an amount of about 0.0001% v/v
to about 75% v/v. In some embodiments, the adjuvant further
comprises a glycolipid such as, e.g.,
N-(2-deoxy-2-L-leucylamino-.beta.-D-glucopyranosyl)-N-octadecyldodecanami-
de acetate. In some embodiments, the adjuvant comprises a
triterpenoid saponin, a sterol, a quaternary ammonium compound, and
a polyacrylic acid polymer. In some embodiments, the saponin is
Quil A or a purified fraction thereof, the sterol is cholesterol,
and the quaternary ammonium compound is dimethyl dioctadecyl
ammonium bromide (DDA). In some embodiments, the saponin is present
in an amount of about 1 mg to about 5,000 mg per dose, the sterol
is present in an amount of about 1 mg to about 5,000 mg per dose,
the quaternary ammonium compound is present in an amount of about 1
mg to about 5,000 mg per dose, and the polyacrylic acid polymer is
present in an amount of about 0.0001% v/v to about 75% v/v. The
adjuvant may comprise a water-in-oil emulsion. The water-in-oil
emulsion may comprise an oily phase and an aqueous phase, a
polycationic carrier (e.g., DEAE dextran), and a CpG containing
immunostimulatory oligonucleotide. In some embodiments, the
composition further comprises an aluminum hydroxide gel. In some
embodiments, the polycationic carrier is DEAE dextran. The
composition may comprise an emulsion or an oil-in-water (O/W)
emulsion. In some embodiments, the emulsion comprises an aqueous
phase that comprises an alkyl-polyacrylic acid (alkyl-PAA) or both
an acrylic polymer and dimethyl dioctadecyl ammonium bromide (DDA).
In some embodiments, the aqueous phase of the oil-in-water emulsion
comprises dimethyl dioctadecyl ammonium bromide (DDA) and an
alkyl-polyacrylic acid (alkyl-PAA). In some embodiments, the
alkyl-PAA is decyl-PAA, octyl-PAA, butyl-PAA, or methyl-PA. In some
embodiments, the acrylic polymer is a polymer of acrylic acid
crosslinked with polyallyl sucrose. The composition may comprise a
water-in-oil (W/O) emulsion comprising a non-mineral oil and an
emulsifier (e.g., a mannide mono-oleate emulsifier). In some
embodiments, the adjuvant is MF59, AS01, AS02, AS03, AS04,
Virosomes, CAF01, CAF04, CAF05, an acrylic polymer/DDA emulsion, a
CpG/DEAE emulsion, a saponin/cholesterol/DDA adjuvant, or a
polyacrylic acid polymer emulsion. In some embodiments, the
composition further comprises an Ehrlichia bacterin. The bacterin
can be, e.g., a heat-inactivated E. canis, a chemically-inactivated
E. canis, a heat-inactivated E. chaffeensis or a
chemically-inactivated E. chaffeensis. In some embodiments, the
bacterin is a chemically-inactivated bacterin that has been
inactivated with formaldehyde, formalin, bi-ethylene amine,
radiation, ultraviolet light, beta-propiolactone treatment, or
formaldehyde.
[0011] Another aspect of the present invention relates to a nucleic
acid encoding a polypeptide provided herein (e.g., a polypeptide of
Formula 1 or in Table 2) or as described above. The nucleic acid
may be a DNA segment. The nucleic acid may be comprised in an
expression vector.
[0012] Yet another aspect of the present invention relates to a
host cell comprising a nucleic acid provided herein (e.g., a
polypeptide of Formula 1 or in Table 2) or as described above. In
some embodiments, the cell expresses the nucleic acid.
[0013] Another aspect of the present invention relates to a method
of detecting antibodies that specifically bind an Ehrlichia
organism in a test sample, comprising: (a) contacting an isolated
polypeptide provided herein (e.g., a polypeptide of Formula 1 or in
Table 2) or as described above; (b) detecting the peptide-antibody
complexes; wherein the detection of the peptide-antibody complexes
is an indication that antibodies specific for an Ehrlichia organism
are present in the test sample, and wherein the absence of the
peptide-antibody complexes is an indication that antibodies
specific an Ehrlichia organism are not present in the test sample.
The Ehrlichia organism may be an Ehrlichia chaffeensis organism or
an Ehrlichia canis organism. The step of detecting may comprise
performing an enzyme-linked immunoassay, a radioimmunoassay, an
immunoprecipitation, a fluorescence immunoassay, a chemiluminescent
assay, an immunoblot assay, a lateral flow assay, a flow cytometry
assay, a multiplex immunoassay, a mass spectrometry assay, or a
particulate-based assay. The step of detecting may comprise a
lateral flow assay or an enzyme-linked immunoassay, wherein the
enzyme-linked immunoassay is an ELISA.
[0014] Yet another aspect of the present invention relates to a
method of identifying an Ehrlichia infection in a mammalian subject
comprising: (a) contacting a biological sample from the subject
with an isolated polypeptide provided herein (e.g., a polypeptide
of Formula 1 or in Table 2) or as described above under conditions
that allow peptide-antibody complexes to form; and (b) detecting
the peptide-antibody complexes; wherein the detection of the
peptide-antibody complexes is an indication that the subject has an
Ehrlichia infection. The step of detecting may comprise performing
an enzyme-linked immunoassay, a radioimmunoassay, an
immunoprecipitation, a fluorescence immunoassay, a chemiluminescent
assay, an immunoblot assay, a lateral flow assay, a flow cytometry
assay, a multiplex immunoassay, a dipstick test, or a
particulate-based assay. In some embodiments, the subject is a
human or a dog.
[0015] Another aspect of the present invention relates to a kit
comprising: (a) an isolated polypeptide disclosed herein or as
described above (e.g., a polypeptide of Formula 1 or in Table 2),
(b) an anti-dog or anti-human secondary antibody linked to a
reporter molecule; and, (c) an appropriate reagent for detection of
the reporter molecule. The peptide may be immobilized on a membrane
or a microtiter plate. The reporter molecule may be selected from
the group consisting of luciferase, horseradish peroxidase, a
luminous nanoparticle, P-galactosidase, and a fluorescent label.
The luminous nanoparticle may be a strontium aluminate
nanoparticle. The kit may further comprise a dilution buffer for
dog or human serum. The kit may comprise a lateral flow immunoassay
or a lateral flow immunochromatographic assay. In some embodiments,
the kit comprises an enzyme-linked immunosorbent assay (ELISA).
[0016] Yet another aspect of the present invention relates to a
method of inducing an immune response in a mammalian subject
comprising administering to the subject an effective amount of a
pharmaceutical preparation comprising a polypeptide provided herein
(e.g., a polypeptide of Formula 1 or in Table 2) or a
pharmaceutical preparation as described above. The subject may be a
human or a dog. The pharmaceutical preparation may be administered
subcutaneously, intramuscularly, nasally, via inhalation or aerosol
delivery, or intradermally.
[0017] Another aspect of the present invention relates to a method
of treating an Ehrlichia chaffeensis or Ehrlichia canis infection
in a subject comprising: (a) contacting a biological sample from
the subject with an isolated polypeptide provided herein provided
herein (e.g., a polypeptide of Formula 1 or in Table 2) or as
described above under conditions that allow peptide-antibody
complexes to form; (b) detecting the peptide-antibody complexes;
wherein the detection of the peptide-antibody complexes is an
indication that the subject has an Ehrlichia chaffeensis or
Ehrlichia canis infection; and (c) administering a therapeutic
compound to treat Ehrlichia infection in the subject. The step of
detecting may comprise performing an enzyme-linked immunoassay, a
radioimmunoassay, an immunoprecipitation, a fluorescence
immunoassay, a chemiluminescent assay, an immunoblot assay, a
lateral flow assay, a flow cytometry assay, a multiplex
immunoassay, a dipstick test, or a particulate-based assay. The
subject may be a dog or a human. The therapeutic compound may be an
antibiotic (e.g., doxycycline).
[0018] As used herein, the term "contiguously repeated", when used
to describe a nucleic acid sequence or amino acid sequence,
indicates that the sequence is repeated in a polypeptide from an
N-terminus to C-terminus direction. For example, for amino acid
sequence -X.sub.1-, if the sequence is repeated zero times, then it
is included in the polypeptide without repetition as -X.sub.1-. If
the sequence -X.sub.1- is contiguously repeated once, then the
polypeptide contains -X.sub.1-X.sub.1-. If the sequence -X.sub.1-
is contiguously repeated twice then the polypeptide contains
-X.sub.1-X.sub.1-X.sub.1-. The number of contiguous repetitions of
the sequence -X.sub.1- may be described by the formula
-(X.sub.1).sub.(n+1)-, wherein (n+1) refers to the number of
contiguous repetitions. Preferably, the contiguously repeated
sequences are repeated without any linker or spacer sequence
separating the contiguously repeated sequences. Nonetheless, in
some embodiments, a spacer or linker (e.g., a glycine linker such
as -G-, -GG-, or -GGG-) may be used to separate the contiguously
repeated sequences. In some preferred embodiments, different
contiguously repeated sequences are separated by a spacer or linker
(e.g., a glycine linker such as -G-, -GG-, or -GGG-); for example,
in sequence -X.sub.1-X.sub.1-GG-X.sub.2-X.sub.2-X.sub.2-, sequence
-X.sub.1- is contiguously repeated once and sequence -X.sub.2- is
contiguously repeated twice, wherein the different contiguously
repeated sequences are separated by the glycine linker -GG-.
[0019] As used herein, the term "polypeptide" encompasses amino
acid chains comprising at least 50 amino acid residues, and more
preferably at least 100 amino acid residues, wherein the amino acid
residues are linked by covalent peptide bonds. As used herein, an
"antigenic polypeptide" or an "immunoreactive polypeptide" is a
polypeptide which, when introduced into a vertebrate, can stimulate
the production of antibodies in the vertebrate, i.e., is antigenic,
and wherein the antibody can selectively recognize and/or bind the
antigenic polypeptide. An antigenic polypeptide may comprise or
consist of an immunoreactive sequence(s) derived from an
immunoreactive Ehrlichia protein as described herein; for example,
polypeptides in Table 1, Table 2, and Formula I), and the
polypeptide may comprise one or more additional sequences. In some
embodiments, the additional sequences may be derived from a native
Ehrlichia antigen and may be heterologous, and such sequences may
(but need not) be immunogenic. In some embodiments, the antigenic
polypeptide or immunoreactive polypeptide may be covalently bound
to a solid substrate, e.g., in an immunoassay such as a lateral
flow test, etc.
[0020] Ehrlichia immunoreactive polypeptides as described herein
(e.g., in Table 2 or Formula I) may be a recombinant polypeptide,
synthetic polypeptide, purified polypeptide, immobilized
polypeptide, detectably labeled polypeptide, encapsulated
polypeptide, or a vector-expressed polypeptide. In various
embodiments, the Ehrlichia immunoreactive polypeptides provided
herein may be truncated or may comprise a deletion mutation,
without eliminating the immunoreactivity of the resulting peptide
or polypeptide. An immunoreactive peptide or polypeptide disclosed
herein may also be comprised in a pharmaceutical composition such
as, e.g., a vaccine composition that is formulated for
administration to a human or canine subject.
[0021] "Bacterin" as used herein refers to one or more killed
bacteria which may be used as a component of a vaccine or
immunogenic composition. The bacterin may be comprised in a
suspension. In some preferred embodiments, the bacterin is a
heat-inactivated Ehrlichia (e.g., a heat-inactivated E. canis) or a
chemically-inactivated Ehrlichia (e.g., a chemically-inactivated E.
Canis).
[0022] "Adjuvant" as used herein refers to any substance that
increases the humoral or cellular immune response to an antigen. In
some embodiments, Adjuvants be used to both allow for the
controlled release of antigens from the injection site of a vaccine
and stimulate the immune system of the subject receiving the
vaccine composition.
[0023] As used herein, "essentially free," in terms of a specified
component, is used herein to mean that none of the specified
component has been purposefully formulated into a composition
and/or is present only as a contaminant or in trace amounts. The
total amount of the specified component resulting from any
unintended contamination of a composition is preferably below
0.01%. Most preferred is a composition in which no amount of the
specified component can be detected with standard analytical
methods.
[0024] As used herein the specification, "a" or "an" may mean one
or more. As used herein in the claim(s), when used in conjunction
with the word "comprising", the words "a" or "an" may mean one or
more than one.
[0025] The use of the term "or" in the claims is used to mean
"and/or" unless explicitly indicated to refer to alternatives only
or the alternatives are mutually exclusive, although the disclosure
supports a definition that refers to only alternatives and
"and/or." As used herein "another" may mean at least a second or
more.
[0026] Throughout this application, the term "about" is used to
indicate that a value includes the inherent variation or error of
the device used determine the value, the method employed to
determine the value, or the variation that exists among the study
subjects or samples.
[0027] Other objects, features and advantages of the present
invention will become apparent from the following detailed
description. It should be understood, however, that the detailed
description and the specific examples, while indicating preferred
embodiments of the invention, are given by way of illustration
only, since various changes and modifications within the spirit and
scope of the invention will become apparent to those skilled in the
art from this detailed description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0028] The following drawings form part of the present
specification and are included to further demonstrate certain
aspects of the present invention. The invention may be better
understood by reference to one or more of these drawings in
combination with the detailed description of specific embodiments
presented herein.
[0029] FIG. 1: Purification and Characterization of E. chaffeensis
chimera TRP32/TRP120/A34 (Combined=SEQ ID NO: 25). TRP32R1=SEQ ID
NO: 3; TRP32R2=SEQ ID NO: 4; TRP32R3=SEQ ID NO: 5; TRP32R4=SEQ ID
NO: 6; TRP120=SEQ ID NO: 22; A34N1=SEQ ID NO: 7.
[0030] FIG. 2: Purification and Characterization of E. chaffeensis
chimera TRP140/TRP36/TRP19 (Combined=SEQ ID NO: 26). TRP19=SEQ ID
NO: 1; TRP36=SEQ ID NO: 8; TRP140=SEQ ID NO: 23.
[0031] FIG. 3: Purification and Characterization of E. canis
chimera TRP36/TRP140 (Combined=SEQ ID NO: 27). TRP36=SEQ ID NO: 8;
TRP140=SEQ ID NO: 23.
[0032] FIG. 4: Purification and Characterization of E. chaffeensis
and E. canis chimera TRP32/TRP120/TRP36/TRP140/HSP (Combined=SEQ ID
NO: 28). TRP32=SEQ ID NO: 5; TRP120=SEQ ID NO: 22; TRP36=SEQ ID NO:
8; TRP140=SEQ ID NO: 23; P28=SEQ ID NO: 2; HSP=SEQ ID NO: 24.
[0033] FIG. 5: Purification and Characterization of E. chaffeensis
and E. canis chimera TRP120/TRP140/TRP36/TRP28 (Combined=SEQ ID NO:
29). TRP120=SEQ ID NO: 22; TRP140=SEQ ID NO: 23; TRP36=SEQ ID NO:
8; P28=SEQ ID NO: 2.
[0034] FIG. 6: Additional Ehrlichia chimeric polypeptides.
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0035] In some embodiments, an immunoreactive polypeptide (e.g., a
polypeptide of Formula I or a polypeptide in Table 2) described
herein may be used as diagnostic or prophylactic tools for
detection of or immunization against Ehrlichia infection. In
particular embodiments, immunoreactive polypeptides disclosed
herein may be useful in solution-phase assays, or in assays in
which the isolated immunoreactive polypeptide is immobilized on a
surface of a support substrate. Alternatively, an immunoreactive
polypeptide described herein may be comprised in a vaccine
formulation to induce a protective immune response or an immune
response against E. chaffeensis in a subject. One or more
immunoreactive polypeptides as described herein may be immobilized
on a surface by covalent attachment, encapsulation, or adsorption
using methods generally known in the art, and may include the use
of cross-linkers, capture molecules and such like, to which
peptides may be coupled, conjugated, or cross-linked.
I. CHIMERIC POLYPEPTIDES
[0036] As described in the foregoing summary, certain aspects of
the present disclosure concern chimeric Ehrlichia polypeptides,
such as polypeptides comprising or consisting of at least two of
the peptides of Table 1 or a polypeptide of Table 2. The chimeric
polypeptides may be produced to comprise at least two of the
peptides of Table 1 which can be continuously repeated (e.g., from
2 to 8, preferably 2 to 6, or even more preferably 2 to 4 times) in
the polypeptide. The chimeric polypeptide can comprise 3, 4, 5 or
more of the above immunogenic peptides. Each of the immunogenic
peptides may be repeated 0, 1, 2, 3, 4, 5, 6, 7, or 8 times in the
chimeric polypeptide. Exemplary configurations include, but are not
limited to, 2.times.2, 2.times.2.times.2,
2.times.2.times.2.times.2, 3.times.2, 2.times.3, 3.times.2.times.2,
2.times.3.times.2, 2.times.2.times.3, 3.times.2.times.2.times.2,
2.times.3.times.2.times.2, 2.times.2.times.3.times.2,
2.times.2.times.2.times.3, 3.times.3, 3.times.3.times.3,
3.times.3.times.2, 2.times.2.times.3, 3.times.3.times.3.times.3,
3.times.3.times.3.times.6, and
2.times.2.times.4.times.2.times.2.times.2.
TABLE-US-00001 TABLE 1 Ehrlichia immunogenic peptides. Immunogenic
Peptide Sequence Species TRP19 HFTGPTSFEVNLSEEEKMELQEVS SEQ ID E.
canis NO: 1 P28 AKEEKNATAKTFQLKGDWDGA SEQ ID E. canis NO: 2 TRP32R1
SDLHESSFVELPGPSKEEVQFEDDAKNVVY SEQ ID E. NO: 3 chaffeensis TRP32R2
SDLHGSFSVELFDPSKEEVQLESDLQQSSN SEQ ID E. NO: 4 chaffeensis TRP32R3
SDLHGSFSVELFDPFKEAVQLGNDLQQSSD SEQ ID E. NO: 5 chaffeensis TRP32R4
SDSHEPSHLELPSLSEEVIQLESDLQQSSN SEQ ID E. NO: 6 chaffeensis A34N1
VRSITDPRIVVQQEADQQQEVQQQAD SEQ ID E. NO: 7 chaffeensis TRP36R1
TEDSVSAPA SEQ ID E. canis NO: 8 TRP36R2 ASVVPEAE SEQ ID E. canis
NO: 9 TRP36R3 TEDPVSATA SEQ ID E. canis NO: 10 TRP36R1- TEDSVSAPA
ASVVPEAE TEDPVSATA SEQ ID R2-R3 NO: 11 TRP36R1- TEDSVSAPA TEDPVSATA
ASVVPEAE SEQ ID R3-R2 NO: 12 TRP36R2- ASVVPEAE TEDSVSAPA TEDPVSATA
SEQ ID R1-R3 NO: 13 TRP36R2- ASVVPEAE TEDPVSATA TEDSVSAPA SEQ ID
R3-R1 NO: 14 TRP36R3- TEDPVSATA TEDSVSAPA ASVVPEAE SEQ ID R1-R2 NO:
15 TRP36R3- TEDPVSATA ASVVPEAE TEDSVSAPA SEQ ID R2-R1 NO: 16 TRP47
ASVSEGDAVVNAVSQETPA SEQ ID E. NO: 17 chaffeensis TRP63
SLFTEEEKILAILSARFICK SEQ ID E. NO: 18 chaffeensis TRP75
DVKDNKPSDVKLPVIKAE SEQ ID E. NO: 19 chaffeensis TRP95R
DDSKLPVIKVEDKSKLQDTKDKKR SEQ ID E. canis NO: 20 TRP95C
KKIKEYDEDYTITYYYDDD SEQ ID E. canis NO: 21 TRP120
SKVEQEETNPEVLIKDLQDVAS SEQ ID E. NO: 22 chaffeensis TRP140
EHSSSEVGEKVSETSKEENTPEVKA SEQ ID E. canis NO: 23 HSP
YGAPEITKDGYKVIKSIKPED SEQ ID E. NO: 24 chaffeensis TRP36CO
EASVVPAAEAPQPAQQTEDEFFSDGIEA SEQ ID E. canis NO: 36 TRP36CO-
EASVVPAAEAPQPAQQTEDEFFSDGIEA SEQ ID R1 TEDSVSAPA NO: 37 TRP36R1-
TEDSVSAPA SEQ ID CO EASVVPAAEAPQPAQQTEDEFFSDGIEA NO: 38 TRP36CO-
EASVVPAAEAPQPAQQTEDEFFSDGIEA SEQ ID R3 TEDPVSATA NO: 39 TRP36R3-
TEDPVSATA SEQ ID CO EASVVPAAEAPQPAQQTEDEFFSDGIEA NO: 40 TRP36R1-R3
TEDSVSAPA TEDPVSATA SEQ ID NO: 41 TRP36R3-R1 TEDPVSATA TEDSVSAPA
SEQ ID NO: 42
[0037] In some embodiments, it is anticipated that TRP36R1,
TRP36R2, and TRP36R3 may be switched within a chimeric polypeptide.
For example, in some embodiments, a TRP36R1 sequence in a chimeric
polypeptide may be switched for TRP36R2 or TRP36R3. In some
embodiments, a TRP36R1, TRP36R2, or TRP36R3 sequence in a chimeric
polypeptide may be switched for TRP36CO. In some embodiments, it
has been observed that TRP36R1, TRP36R2, TRP36R3, and/or TRP36CO
may be contiguously located in a chimeric polypeptide, e.g., as
shown in SEQ ID NOs:11-16 and 38-43. In some embodiments, 2, 3, or
all of TRP36R1, TRP36R2, TRP36R3, and/or TRP36CO may be
contiguously located in a chimeric polypeptide. Similarly, it is
anticipated that, in some embodiments, TRP32R1, TRP32R2, TRP32R3,
and TRP32R4 may be switched within a chimeric polypeptide. In some
embodiments, 2, 3, or all of TRP32R1, TRP32R2, TRP32R3, and/or
TRP32R4 may be contiguously located in a chimeric polypeptide
(e.g., wherein the polypeptide contains -TRP32R1-TRP32R2-TRP32R3-
or -TRP32R1-TRP32R2-TRP32R3-TRP32R4-, etc.).
[0038] The chimeric polypeptides may be produced to comprise at
least two of the above peptides which can be continuously repeated
(e.g., once, from 2 to 8, preferably 2 to 6, or even more
preferably 2 to 4, times) in the polypeptide. The chimeric
polypeptide can comprise 3, 4, 5 or more of the above immunogenic
peptides from Table 1. Each of the immunogenic peptides may be
repeated 1, 2, 3, 4, 5, 6, 7, or 8 times in the chimeric
polypeptide. The peptides within the polypeptide construct may be
separated by a linker. The linker can be a poly-glycine linker
(e.g., GG, GGG, GGGG, or GGGGG). The polypeptide constructs may
comprise a heat shock protein (HSP) sequence (SEQ ID NO:24).
Constructs were produced from the above immunogenic peptides as
listed below (e.g., Table 2) and exemplary chimeric polypeptides
are depicted in FIGS. 1-5.
[0039] In some embodiments, the chimeric polypeptide may comprise
at least two or three immunogenic peptide isoforms. For example,
the polypeptide may be produced by linking TRP36R1, TRP36R2,
TRP36R3, and/or TRP36CO in various configurations as listed in
Table 1 including TRP36R1-R2-R3, TRP36R1-R3-R2, TRP36R2-R1-R3,
TRP36R2-R3-R1, TRP36R3-R1-R2, TRP36R3-R2-R1, TRP36CO-R1,
TRP36R1-CO, TRP36CO-R3, TRP36R3-CO, TRP36R1-R3, and TRP36R3-R1. The
polypeptide may be produced by linking TRP95R and TRP95C as
TRP95R-C or TRP95C-R. In some embodiments, the polypeptide may be
produced by linking TRP32R1, TRP32R1, TRP32R3, and/or TRP32R4 in
various configurations.
[0040] In some embodiments, the chimeric construct may have a
sequence as described by Formula I, below:
(A.sub.s-B.sub.t-C.sub.u-D.sub.v-E.sub.w-F.sub.x-G.sub.y-H.sub.z).sub.n,
Formula I:
[0041] wherein A-H comprise a peptide selected from SEQ ID NOs:1-24
and 36-42, s-z is an integer 0-8, wherein at least two of s-z are
.gtoreq.1 and at least one of s-z is .gtoreq.2, and n is an integer
1-5. Peptides A-H may be each be independently selected from SEQ ID
NOs:1-24 and 36-42. Preferably, the chimeric construct may have a
sequence of Formula I, wherein at least two of s-z are .gtoreq.2.
The chimeric construct may comprise a linker or spacer to separate
the peptides A-H of Formula I.
[0042] Exemplary derivatives of Formula I may comprise, but are not
limited to:
[0043] A.sub.2-B.sub.2-C.sub.2;
[0044] A.sub.1-B.sub.3-C.sub.3;
[0045] A.sub.3-B.sub.3-C.sub.3;
[0046] A.sub.2-B.sub.2-C.sub.2-D.sub.2;
[0047] A.sub.3-B.sub.2-C.sub.2-D.sub.2;
[0048] A.sub.3-B.sub.3-C.sub.6-D.sub.3;
[0049] (A.sub.1-B.sub.2-C.sub.1).sub.3;
[0050] A.sub.8-B.sub.4; and
[0051] A.sub.2-B.sub.2-C.sub.4-D.sub.2-E.sub.2-F.sub.2.
In some embodiments, the polypeptide of Formula I comprises or
consists of any one of SEQ ID NOs: 11-16 or 38-42. In some
embodiments, the polypeptide of Formula I comprises or consists of
a polypeptide of Table 2.
TABLE-US-00002 TABLE 2 Chimeric Ehrlichia Polypeptides Construct
Sequence Species TRP32/TRP120/A34N1 SEQ ID NO: 25 E. chaffeensis
(32R1/32R2/32R3/32R4/3 .times. 120/3 .times. 43) TRP140/TRP36/TRP19
SEQ ID NO: 26 E. canis (19/2 .times. 36/140) .times. 3 TRP36/TRP140
SEQ ID NO: 27 E. canis (8 .times. 36/4 .times. 140)
TRP32/TRP120/TRP36/TRP140/TRP28/HSP SEQ ID NO: 28 E. chaffeensis
and (2 .times. 32/2 .times. 120/4 .times. 36/2 .times. 140/2
.times. 28/2 .times. HSP) E. canis TRP120/TRP140/TRP36/TRP28 SEQ ID
NO: 29 E. chaffeensis and (3 .times. 120/3 .times. 140/6 .times.
36/3 .times. 28) E. canis TRP120/A34N1/TRP63/TRP47 SEQ ID NO: 30 E.
chaffeensis (2 .times. 120/2 .times. 34/2 .times. 63/2 .times. 47)
TRP120/A34N1/TRP63 SEQ ID NO: 31 E. chaffeensis (2 .times. 120/2
.times. 34/2 .times. 63) TRP120/A34N1/TRP47 SEQ ID NO: 32 E.
chaffeensis (2 .times. 120/2 .times. 34/2 .times. 63/2 .times. 47)
A34N1/TRP63/TRP47 SEQ ID NO: 33 E. chaffeensis (2 .times. 34/2
.times. 63/2 .times. 47) A34N1/TRP63/TRP75 SEQ ID NO: 34 E.
chaffeensis (2 .times. 34/2 .times. 63/2 .times. 75)
TRP36/TRP140/TRP95R/TRP95C SEQ ID NO: 35 E. canis (2 .times. 36/2
.times. 140/2 .times. 95R/2 .times. 95C) TRP36R1/TRP36R2/TRP36CO
SEQ ID NO: 43 E. canis (2 .times. 36/2 .times. 36/2 .times. 36)
TRP36R1/TRP36R2 SEQ ID NO: 44 E. canis (2 .times. 36/2 .times.
36)
[0052] In some embodiments, it is anticipated that a polypeptide
having at least 90%, more preferably at least 95%, 97.5%, or at
least 99% sequence identity to a polypeptide of Table 2 or a
polypeptide of Formula I, that retains at least some of its
immunoreactivity may be used in various embodiments as described
herein (e.g., in a diagnostic test, or to induce an immune response
against Ehrlichia in a subject, for inclusion in a vaccine
composition). In some embodiments, the polypeptide may be used to
generate an antibody that selectively binds the protein, and the
antibody may be used, e.g., in a diagnostic assay; for example, in
some embodiments, the antibody is labelled or attached to a solid
substrate (e.g., in a lateral-flow test).
[0053] In some aspects, a contiguous repeat of a specific peptide
may comprise two or more isoforms of the immunogenic peptide. For
example, a contiguous repeat may comprise TRP32R1, TRP32R2,
TRP32R3, and/or TRP32R4. Another contiguous repeat can comprise
TRP95C and TRP95R or different isoforms of TRP36 including TRP36R1,
TRP36R2, TRP36R3, and/or TRP36CO. Thus, the same or different
isoforms of the protein may thus be contiguously repeated in some
embodiments without separation by a spacer or glycine spacer.
[0054] A variety of linkers or spacers can be used in chimeric
Ehrlichia polypeptides of the embodiments. In some embodiments, a
linker or spacer can be a random string of one or more amino acids
(e.g., 2, 3, 4, 5, 10, 15, or 20 amino acids). In other
embodiments, the linker has a particular sequence. For example, in
some embodiments, the linker or spacer can be a poly-glycine linker
(e.g., GG, GGG, or GGGG; also referred to as a glycine linker
herein). Other linkers or spacers that may be used in various
embodiments include, e.g., the 218 (GSTSGSGKPGSGEGSTKG; SEQ ID NO:
45), the HL (EAAAK; SEQ ID NO: 46), and the G.sub.4S (GGGGS; SEQ ID
NO: 47) linkers. In some preferred embodiments, groups of different
contiguously repeated sequences are separated in a polypeptide by a
linker or spacer such as, e.g., a glycine linker (e.g.,
-X.sub.1-X.sub.1-X.sub.1-GGG-X.sub.2-X.sub.2- shows amino sequence
-X.sub.1- contiguously repeated twice, amino acid sequence
-X.sub.2- is contiguously repeated once, and the different
contiguously repeated sequences are separated by the poly-glycine
linker -GGG-).
[0055] In some embodiments, an immunoreactive polypeptide provided
herein (e.g., derived from two or more peptides in Table 1 or a
polypeptide in Table 2) may be immobilized onto a surface of a
support or a solid substrate; for example, the immunoreactive
polypeptide may be immobilized directly or indirectly by coupling,
cross-linking, adsorption, encapsulation, or by any appropriate
method known in the art. By way of non-limiting example, binding of
an immunoreactive polypeptide disclosed herein by adsorption to a
well in a microtiter plate or to a membrane may be achieved by
contacting the peptide, in a suitable buffer, with the well surface
for a suitable amount of time. The contact time can vary with
temperature, but is typically between about 1 hour and 1 day when
using an amount of peptide ranging from about 50 ng to about 1 mg,
and preferably about 250-700 ng or about 450-550 ng.
[0056] In some embodiments, an immunoreactive polypeptide disclosed
herein is covalently attached to a support substrate by first
reacting the support with a reagent that will chemically react with
both the support and a functional group (i.e., crosslink), such as
a hydroxyl or amino group, on the peptide. For example, an
immunoreactive polypeptide may be crosslinked to a surface through
an amine or carboxylic group on either end of the peptide, and a
peptide may be crosslinked through a group on each end of the
polypeptide (i.e., head-to-tail crosslinked). Such peptomers (i.e.,
head-to-tail crosslinked or otherwise immobilized peptides) may be
used with both diagnostic and therapeutic methods of the present
disclosure.
[0057] In some embodiments, an isolated polypeptide comprising a
sequence of a polypeptide of Formula I or a polypeptide Table 2,
wherein the isolated peptide or polypeptide is immobilized on a
surface of a support substrate. In some embodiments, the
polypeptide is selected from the group consisting of Table 2.
Numerous support substrates for peptide immobilization are known in
the art which may be employed with an immunoreactive polypeptide
disclosed herein, formed from materials such as, for example,
latex, polystyrene, nylon, nitrocellulose, cellulose, silica,
agarose, inorganic polymers, lipids, proteins, sugars, or magnetic
resin. A person of ordinary skill in the art may select the support
substrate that is appropriate for a given application. In
particular embodiments, a support substrate may be a reaction
chamber, a microplate well, a membrane, a filter, a paper, an
emulsion, a bead, a microbead, a microsphere, a nanocrystal, a
nanosphere, a dipstick, a card, a glass slide, a microslide, a
lateral flow apparatus, a microchip, a comb, a silica particle, a
magnetic particle, a nanoparticle, or a self-assembling
monolayer.
II. DETECTABLY-LABELED IMMUNOREACTIVE POLYPEPTIDES
[0058] An immunoreactive polypeptide (e.g., comprising two or more
peptide of Table 1, or a polypeptide of Table 2) may be conjugated
to or attached to detectable label such as, for example, a
radioactive isotope, a non-radioactive isotope, a particulate
label, a fluorescent label, a chemiluminescent label, a
paramagnetic label, an enzyme label or a colorimetric label. The
detectably-labelled polypeptide may be used, e.g., in diagnostic or
prophylactic methods and compositions. In certain embodiments, the
polypeptide portion of the detectably labeled immunoreactive
polypeptide may be immobilized on a surface of a support substrate.
In other embodiments, the detectable label may be used to
immobilize the detectably labeled immunoreactive peptide to the
surface of a support substrate.
[0059] As used herein, "detectable label" is a compound and/or
element that can be detected due to its specific functional
properties, and/or chemical characteristics, the use of which
allows the peptide to which it is attached be detected, and/or
further quantified if desired.
[0060] In some embodiments, the probe is a photoluminescent probe,
such as a fluorophore or a nanoparticle, such as for example a
strontium aluminate nanoparticle (e.g., see Paterson et al., 2014).
Exemplary labels include, but are not limited to, a particulate
label such as colloidal gold, a radioactive isotope such as
astatine.sup.211, .sup.14carbon, .sup.51chromium, .sup.36chlorine,
.sup.57cobalt, .sup.58cobalt, copper.sup.67, .sup.152Eu,
gallium.sup.67, .sup.3hydrogen, iodine.sup.123, iodine.sup.125,
iodine.sup.131, indium.sup.111, .sup.59iron, .sup.32phosphorus,
rhenium186, rhenium188, .sup.75selenium, .sup.35sulphur,
technicium-99, technetium-99m or yttrium.sup.90, a colorimetric
label such as dinitrobenzene, dansyl chloride, dabsyl chloride, any
of the azo, cyanin or triazine dyes, or chromophores disclosed in
U.S. Pat. Nos. 5,470,932, 5,543,504, or 6,372,445, all of which are
incorporated herein by reference; a paramagnetic label such as
chromium (III), manganese (II), iron (III), iron (II), cobalt (II),
nickel (II), copper (II), neodymium (III), samarium (III),
ytterbium (III), gadolinium (III), vanadium (II), terbium (III),
dysprosium (III), holmium (III) or erbium (III), a fluorescent
label such as Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY
650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade
Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE,
Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue,
REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET,
Tetramethylrhodamine, and/or Texas Red, or Lucifer Yellow, an
enzyme label such as urease, luciferase, alkaline phosphatase,
(horseradish) hydrogen peroxidase, or glucose oxidase, or a
chemiluminescent label such as luminol, phthalazinedione, and
others disclosed in any of U.S. Pat. Nos. 4,373,932, 4,220,450,
5,470,723, and U.S. Patent Application 2007/0264664, all of which
are incorporated herein by reference.
III. METHODS OF PRODUCING AN IMMUNOREACTIVE POLYPEPTIDE
[0061] An immunoreactive polypeptide as described herein may be
produced using in vitro transcription and translation (IVTT)
methods, may be recombinantly produced using a variety of cell
types (e.g., bacterial cells, mammalian cells, E. coli, yeast, and
insect cells, etc.), or in some instances may be synthesized (e.g.,
using solid-phase synthesis). In some embodiments, IVTT and
synthetic methods can provide certain advantages over recombinant
approaches, since the resulting polypeptides can produced highly
pure forms without contaminating bacterial or other proteins that
might result in false positive reactions when utilizing recombinant
proteins. Thus, IVTT and synthetic methods have an advantage of
lacking many of the costly and laborious purification procedures
often associated with recombinant methodologies.
[0062] A variety of IVTT approaches are known in the art and may be
used in various embodiments. IVTT generally involves cell-free
methods for production or synthesis of a protein from DNA. The
cell-free system for protein production may use, e.g., E. coli
extract, protozoan extracts, yeast extracts, human cell extract,
wheat germ extract, mammalian extracts, extracts from cultured
human cell lines, rabbit reticulocyte lysate, insect cell extract,
or reconstituted and purified E. coli components. A variety of kits
are commercially available including, e.g., RTS (FivePrime, San
Francisco, Calif.), Expressway.TM. (Life Technologies); S30 T7 high
yield (Promega), One-step human IVT (Thermo Scientific), WEPRO.RTM.
(CellFree Sciences), TNT.RTM. coupled (Promega), RTS CECF (5
PRIME), TNT.RTM. Coupled (Promega), Retic lysate IVT.TM. (Life
Technologies); TNT.RTM. T7 (Promega), EasyXpress Insect
kit(Qiagen/RiN A), PURExpress.RTM. (New England Biolabs), and
PURESYSTEM.RTM. (BioComber). Such methods can be used to
incorporate unnatural amino acids into proteins, if desired.
Cell-free expression systems that may be used in various
embodiments are also described, e.g., in Zemella et al., 2015.
[0063] An isolated immunoreactive protein as disclosed herein may
be produced in some embodiments using an appropriate method known
in the organic chemistry arts. For example, peptides may be
produced using one of the established solid-phase peptide synthesis
techniques that are well known in the art. In some embodiments,
peptides may be synthesized using equipment for automated peptide
synthesis that is widely available from commercial suppliers such
as Perkin Elmer (Foster City, Calif.), or the peptide may be
chemically synthesized using solution-phase techniques such as
those described in Carpino et al., 2003 or U.S. Patent Application
2009/0005535. In some embodiments, the peptides or shorter proteins
may be synthesized, e.g., using solid-phase peptide synthesis
(SPPS), t-Boc solid-phase peptide synthesis, or Fmoc solid-phase
peptide synthesis.
[0064] In some embodiments, an immunoreactive protein as described
herein can be recombinantly prepared from a nucleic acid encoding
the peptide. Such a nucleic acid may be operably linked to an
expression vector. By way of nonlimiting example, an immunoreactive
protein may be expressed from a vector and isolated from the growth
media of a host cell comprising the vector. In some embodiments,
the immunoreactive protein may be produced in a cell-free system
from a nucleic acid encoding the peptide.
[0065] An immobilized immunoreactive protein as disclosed herein
may be conjugated, crosslinked, or adsorbed, either directly or
indirectly onto a surface of a support substrate. In some
embodiments, an immobilized immunoreactive protein or peptide may
be synthesized onto a support substrate.
[0066] It is anticipated that virtually any method of protein or
peptide immobilization known in the art which would not impact the
structure or function of the disclosed peptides may be used to
immobilize an immunoreactive protein or peptide as disclosed
herein. For example, peptide immobilization may be accomplished
using a crosslinking or conjugation agent such as
methyl-p-hydroxybenzimidate,
N-succinimidyl-3-(4-hydroxyphenyl)propionate, using
sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate
(sSMCC), N-[maleimidocaproyloxy] sulfosuccinimide ester (sEMCS),
N-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS),
glutaraldehyde, 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide
(EDCI), Bis-diazobenzidine (BDB), or N-acetyl homocysteine
thiolactone (NAHT), and others disclosed in any of U.S. Pat. Nos.
5,853,744, 5,891,506, 6,210,708, 6,617,142, 6,875,750, 6,951,765,
7,163,677, and 7,282,194, each incorporated herein by reference.
Immunoreactive proteins may be conjugated directly or indirectly to
any of the commercially available support substrates having a
surface coatings comprising crosslinkers, coupling agents, thiol or
hydroxyl derivatizing agents, carboxyl- or amine-reactive groups
such as of maleic anhydride (e.g., Pierce Immunotechnology Catalog
and Handbook, at A12-A13, 1991).
[0067] In some embodiments, a protein of the invention may also be
immobilized using metal chelate complexation, employing, for
example, an organic chelating agent such a
diethylenetriaminepentaacetic acid anhydride (DTPA); EDTA;
N-chloro-p-toluenesulfonamide; and/or
tetrachloro-3.alpha.-6.alpha.-diphenylglycouril-3 attached to the
antibody (U.S. Pat. Nos. 4,472,509 and 4,938,948, each incorporated
herein by reference). Proteins and peptides can also be immobilized
by coupling to other peptides or to condensation groups immobilized
on a surface or present in an immobilization buffer such as
glutaraldehyde or periodate. Conjugates with fluorescence markers
may also prepared in the presence of such agents or by reaction
with an isothiocyanate. A peptide may be attached to a surface by
conjugation, crosslinking or binding to an affinity binding agent
such as biotin, streptavidin, a polysaccharide such as an alginate,
a lectin, and the like.
[0068] In general, regardless of the method of preparation or
immobilization status, the immunoreactive proteins disclosed herein
are preferably prepared in a substantially pure form. Preferably,
the immunoreactive proteins are at least about 80% pure, more
preferably at least about 90% pure and most preferably at least
about 99% pure.
IV. BIOLOGICAL FUNCTIONAL EQUIVALENTS
[0069] Preferred immunoreactive polypeptides or analogs thereof
specifically or preferentially bind an E. chaffeensis or E. canis
specific antibody. Determining whether or to what degree a
particular immunoreactive polypeptide, or an analog thereof, can
bind an E chaffeensis or E. canis specific antibody can be assessed
using an in vitro assay such as, for example, an enzyme-linked
immunosorbent assay (ELISA), immunoblotting, immunoprecipitation,
radioimmunoas say (RIA), immunostaining, latex agglutination,
indirect hemagglutination assay (IHA), complement fixation,
indirect immnunofluorescent assay (FA), nephelometry, flow
cytometry assay, chemiluminescence assay, lateral flow immunoassay,
u-capture assay, mass spectrometry assay, particle-based assay,
inhibition assay and/or an avidity assay.
[0070] An immunoreactive polypeptide of the present disclosure may
be modified to contain amino acid substitutions, insertions and/or
deletions that do not alter their respective interactions with
anti-Ehrlichia antibody binding regions. Such a biologically
functional equivalent of an immunoreactive polypeptide derived from
an Ehrlichia protein could be a molecule having like or otherwise
desirable characteristics, i.e., binding of Ehrlichia specific
antibodies. As a nonlimiting example, certain amino acids may be
substituted for other amino acids in an immunoreactive polypeptide
disclosed herein without appreciable loss of interactive capacity,
as demonstrated by detectably unchanged antibody binding. It is
thus contemplated that an immunoreactive polypeptide disclosed
herein (or a nucleic acid encoding such a polypeptide) which is
modified in sequence and/or structure, but which is unchanged in
biological utility or activity, remains within the scope of the
present disclosure. The immunoreactive polypeptide may have, e.g.,
at least 90%, 95%, or 99% sequence identity with a wild-type E.
chaffeensis polypeptide, and in some embodiments the immunoreactive
protein may have 1, 2, 3, 4, 5, or more amino acid substitutions,
insertions and/or deletions as compared with the corresponding
wild-type E. chaffeensis polypeptide. In some embodiments, the
mutation is a conservative substitution.
[0071] It is also well understood by the skilled artisan that,
inherent in the definition of a biologically functional equivalent
peptide, is the concept that there is a limit to the number of
changes that may be made within a defined portion of the molecule
while still maintaining an acceptable level of equivalent
biological activity. Biologically functional equivalent
polypeptides are thus defined herein as those peptides in which
certain, not most or all, of the amino acids may be substituted. Of
course, a plurality of distinct peptides with different
substitutions may easily be made and used in accordance with the
invention.
[0072] The skilled artisan is also aware that where certain
residues are shown to be particularly important to the biological
or structural properties of a peptide, e.g., residues in specific
epitopes, such residues may not generally be exchanged. It is
anticipated that a mutation in an immunoreactive peptide or
polypeptide disclosed herein could result in a loss of
species-specificity and in turn, reduce the utility of the
resulting peptide for use in methods for generating an
anti-Ehrlichia immune response. Thus, polypeptides which are
antigenic (i.e., bind anti-Ehrlichia antibodies specifically) and
comprise conservative amino acid substitutions are understood to be
included in aspects of the present disclosure. Conservative
substitutions are least likely to drastically alter the activity of
a protein. A "conservative amino acid substitution" refers to
replacement of amino acid with a chemically similar amino acid,
i.e., replacing nonpolar amino acids with other nonpolar amino
acids; substitution of polar amino acids with other polar amino
acids, acidic residues with other acidic amino acids, etc.
[0073] Amino acid substitutions, such as those which might be
employed in modifying an immunoreactive polypeptide disclosed
herein are generally based on the relative similarity of the amino
acid side-chain substituents, for example, their hydrophobicity,
hydrophilicity, charge, size, and the like. An analysis of the
size, shape and type of the amino acid side-chain substituents
reveals that arginine, lysine and histidine are all positively
charged residues; that alanine, glycine and serine are all a
similar size; and that phenylalanine, tryptophan and tyrosine all
have a generally similar shape. Therefore, based upon these
considerations, arginine, lysine and histidine; alanine, glycine
and serine; and phenylalanine, tryptophan and tyrosine; are defined
herein as biologically functional equivalents.
[0074] The invention also contemplates isoforms of the E.
chaffeensis immunoreactive polypeptides disclosed herein. An
isoform contains the same number and kinds of amino acids as an E.
chaffeensis polypeptide as disclosed herein, but the isoform has a
different molecular structure. The isoforms contemplated by the
present disclosure are those having the same properties as a
peptide of the invention as described herein.
[0075] Nonstandard amino acids may be incorporated into proteins by
chemical modification of existing amino acids or by de novo
synthesis of a polypeptide disclosed herein. A nonstandard amino
acid refers to an amino acid that differs in chemical structure
from the twenty standard amino acids encoded by the genetic code,
and a variety of nonstandard amino acids are well known in the
art.
[0076] In select embodiments, the present disclosure contemplates a
chemical derivative of an immunoreactive polypeptide disclosed
herein. "Chemical derivative" refers to a peptide having one or
more residues chemically derivatized by reaction of a functional
side group, and retaining biological activity and utility. Such
derivatized polypeptides include, for example, those in which free
amino groups have been derivatized to form specific salts or
derivatized by alkylation and/or acylation, p-toluene sulfonyl
groups, carbobenzoxy groups, t-butylocycarbonyl groups,
chloroacetyl groups, formyl or acetyl groups among others. Free
carboxyl groups may be derivatized to form organic or inorganic
salts, methyl and ethyl esters or other types of esters or
hydrazides and preferably amides (primary or secondary). Chemical
derivatives may include polypeptides that comprise one or more
naturally occurring amino acids derivatives of the twenty standard
amino acids. For example, 4-hydroxyproline may be substituted for
serine; and ornithine may be substituted for lysine.
[0077] It should be noted that all amino-acid residue sequences are
represented herein by formulae whose left and right orientation is
in the conventional direction of amino-terminus to
carboxy-terminus. Furthermore, it should be noted that a dash at
the beginning or end of an amino acid residue sequence indicates a
peptide bond to a further sequence of one or more amino-acid
residues. The amino acids described herein are preferred to be in
the "L" isomeric form. However, residues in the "D" isomeric form
can be substituted for any L-amino acid residue, as long as the
desired functional properties set forth herein are retained by the
protein. In keeping with standard protein nomenclature,
abbreviations for amino acid residues are known in the art.
[0078] In addition to the biological functional equivalents
discussed above, it is contemplated that structurally similar
compounds may be formulated to mimic the key portions of an
immunoreactive peptide disclosed herein. Such compounds, which may
be termed peptidomimetics, may be used in the same manner as
immunoreactive peptides disclosed herein and, hence, also are
functional equivalents. Methods for generating specific structures
are disclosed, e.g., in Mizuno et al., 2017, as well as in U.S.
Pat. Nos. 5,446,128; 5,710,245; 5,840,833; 5,859,184; 5,440,013;
5,618,914; and 5,670,155.
V. METHODS OF DETECTING EHRLICHIA INFECTION
[0079] Ehrlichiosis in humans generally refers to infections caused
by obligate intracellular bacteria in the family Anaplasmataceae,
chiefly in the genera Ehrlichia and Anaplasma. The majority of
cases of human ehrlichiosis (HE) are caused by 3 distinct species:
Ehrlichia chaffeensis, chief among them (Dumler et al., 2007).
Ehrlichia infections in animals are also referred to as
Ehrlichiosis, along with a variety of diseases caused by a diverse
group of pathogens from genuses Ehrlichia, Anaplasma,
Neorickettsia, and Cowdria (Dumler et al., 2007). Ehrlichia
infections are sustained mostly in monocytes or granulocytes, and
studies have demonstrated that antibodies play an essential role in
the immune response to Ehrlichia infection (Feng and Walker, 2004;
Winslow et al., 2003; Winslow et al., 2000; Yager et al.,
2005).
[0080] Accordingly, select embodiments of the present disclosure
provide methods of detecting antibodies that specifically bind an
Ehrlichia organism in a sample. Such a method may involve
contacting an isolated ehrlichial immunoreactive polypeptide
comprising at least two peptides of Table 1 or a polypeptide of
Table 2, with the test sample, under conditions that allow
peptide-antibody complexes to form, and detecting the
peptide-antibody complexes. In these embodiments, the detection of
the peptide-antibody complexes is an indication that antibodies
specific for an Ehrlichia organism are present in the test sample,
and the absence of the peptide-antibody complexes is an indication
that antibodies specific an Ehrlichia organism are not present in
the test sample.
[0081] In multiple embodiments, the detection of an immunoreactive
polypeptide disclosed herein bound to an Ehrlichia specific
antibody (i.e., a peptide-antibody complex) may be accomplished
using an enzyme-linked immunoassay (e.g., a sandwich ELISA, or a
competitive ELISA), a radioimmunoassay, an immunoprecipitation, a
fluorescence immunoassay, a chemiluminescent assay, an immunoblot
assay, a lateral flow assay, a flow cytometry assay, a mass
spectrometry assay, latex agglutination, an indirect
hemagglutination assay (IHA), complement fixation, an inhibition
assay, an avidity assay, a dipstick test, or a particulate-based
assay. In some preferred embodiments, peptide-antibody complexes
described herein are detected using an enzyme-linked immunoassay, a
lateral flow assay, or a particle-based assay.
[0082] As used herein, a "sample" is any sample that comprises or
is suspected to comprise antibodies. Preferably, the sample is
whole blood, sputum, serum, plasma, saliva, cerebrospinal fluid or
urine. In some embodiments, the sample is a blood, serum or plasma
sample obtained from a subject or patient.
[0083] Ehrlichiosis caused by an E. chaffeensis infection in humans
presents with flu-like symptoms of fever, chills, headache, and
muscle aches. In more severe cases, nausea, loss of appetite,
weight loss, abdominal pain, cough, diarrhea and change in mental
status may also be observed. Ehrlichiosis in humans is potentially
fatal.
[0084] In dogs, ehrlichiosis is most often caused by either E.
chaffeensis or E. canis bacteria, and progresses in three phases:
an acute phase, a subclinical phase, and a chronic phase. The acute
phase normally extends weeks after infection and features symptoms
similar to those of human ehrlichiosis, such as fever, lethargy,
loss of appetite, shortness of breath, joint pain and stiffness,
and may also include more severe symptoms such as anemia,
depression, bruising, and enlarged lymph nodes, liver, and spleen.
The subclinical phase can persist for years and most often presents
no symptoms, although antibodies to Ehrlichia antigens may be
detectable. The chronic phase of Ehrlichia infection generally
features recurring symptoms of weight loss, anemia, neurological
dysfunction, bleeding, ocular inflammation, leg edema, and fever,
and presents a blood profile which often leads to a misdiagnosis of
leukemia. An Ehrlichia infection that progresses to the chronic
stage of disease is often fatal.
[0085] The nonspecific symptoms of an Ehrlichia infection and their
resemblance to mild and severe influenza symptoms makes diagnosis
of Ehrlichiosis difficult in humans and dogs. Diagnosis can be
further hampered by current laboratory testing procedures for
Ehrlichia infection which are not point-of-care tests, i.e., the
tests are not available in most hospitals, clinics, and physician
or veterinarian offices where a patient can receive treatment.
[0086] Accordingly, select embodiments of the present disclosure
provide methods of identifying an Ehrlichia infection in a
mammalian subject. Such a method may involve contacting a sample
from the subject with an isolated immunoreactive polypeptide
disclosed herein, e.g., comprising at least two peptides of Table
1, or more preferably a polypeptide of Table 2, under conditions
that allow peptide-antibody complexes to form, and detecting the
peptide-antibody complexes. In these embodiments, the detection of
the peptide-antibody complexes is an indication that the subject
has an Ehrlichia infection. The Ehrlichia organism may be an E.
chaffeensis organism or an E. canis organism. In some embodiments,
the subject is a human or a dog. As with other methods disclosed
herein, the detection step may be accomplished using any
appropriate type of assay known in the art, and may be preferrably
accomplished using a lateral flow assay or an ELISA.
[0087] The terms "subject" and "patient" are used interchangeably
herein, and may refer to a mammal, especially a human or a dog. In
certain embodiments, a "subject" or "patient" refers to a mammalian
Ehrlichia host (i.e., animal infected with an Ehrlichia organism).
An Ehrlichia host may be, for example, human or non-human primate,
bovine, canine, caprine, cavine, corvine, epine, equine, feline,
hircine, lapine, leporine, lupine, murine, ovine, porcine, racine,
vulpine, and the like, including livestock, zoological specimens,
exotics, as well as companion animals, pets, and any animal under
the care of a veterinary practitioner. A subject may be or may not
be infected with an Ehrlichia organism, and a subject may be a
mammal suspected of being infected with an Ehrlichia organism.
[0088] Without wishing to be bound by theory, the ehrlichial
immunoreactive polypeptides disclosed herein each comprise at least
a part of a major Ehrlichia epitope that accounts for a
species-specific immunogenicity in humans and animals. The term
"epitope" is used herein to indicate that portion of an immunogenic
substance that is specifically identified, recognized, and bound
by, an antibody or cell-surface receptor of a host immune system
that has mounted an immune response to the immunogenic substance as
determined by any method known in the art. (see, for example,
Geysen et al., 1984). Thus, an epitope that is "species-specific"
is an epitope that can be used to differentiate one species of the
Ehrlichia genus from another Ehrlichia species.
[0089] Particular embodiments relate to determining whether a
subject has been immunized against Ehrlichia or is actively
infected with an Ehrlichia organism. In these embodiments, the
method comprises contacting a sample from the subject with at least
one isolated immunoreactive peptides of Table 1, or more preferably
a polypeptide of Table 2, that is not a component of an Ehrlichia
vaccine, and detecting whether an antibody in the sample
specifically binds to the isolated ehrlichial immunoreactive
polypeptide. According to the method, if an antibody in the sample
specifically binds to the isolated ehrlichial immunoreactive
polypeptide, then the subject has an active Ehrlichia infection,
and if an antibody does not specifically bind to the isolated
ehrlichial immunoreactive peptide, then the subject is either
previously immunized with an Ehrlichia vaccine or is not infected
with an Ehrlichia organism. An Ehrlichia organism may be an E.
chaffeensis organism or an E. canis organism.
[0090] An ehrlichial immunoreactive polypeptide (e.g., comprising
at least two peptides of Table 1 or a polypeptide of Table 2) may
be used to bind an Ehrlichia-specific or E. chaffeensis-specific
antibody using a variety of methods or kits. The specific binding
between an antibody and an immunoreactive peptide of the present
disclosure may therefore be assessed by any appropriate method
known in the art including, but not limited to, an enzyme-linked
immunosorbent assay (ELISA), a sandwich ELISA, a competitive ELISA,
immunoblotting, immunoprecipitation, radioimmunoassay (RIA),
immunostaining, latex agglutination, indirect hemagglutination
assay (IHA), complement fixation, indirect immnunofluorescent assay
(FA), nephelometry, flow cytometry assay, chemiluminescence assay,
lateral flow immunoassay, u-capture assay, mass spectrometry assay,
particle-based assay, inhibition assay and avidity assay. Exemplary
methods of detecting the binding of an Ehrlichia-specific antibody
to an ehrlichial immunoreactive polypeptide as disclosed herein may
include, for example, an ELISA performed in a microplate, a lateral
flow test performed using a dipstick or lateral flow device, or a
particulate-based suspension array assay performed using the
Bio-Plex.RTM. system (Bio-Rad Laboratories, Hercules, Calif.,
USA).
[0091] A. ELISA
[0092] In certain embodiments, the detection of a peptide-antibody
complex described herein is accomplished using an enzyme linked
immunosorbent assay (ELISA). This assay may be performed by first
contacting an ehrlichial immunoreactive polypeptide (e.g.,
comprising at least two peptides of Table 1 or a polypeptide of
Table 2) that has been immobilized on a solid support, commonly the
well of a microtiter plate, with the sample, such that antibodies
specific for the peptide within the sample are allowed to bind to
the immobilized peptide. Unbound sample is then removed from the
immobilized peptide and a detection reagent capable of binding to
the immobilized antibody-polypeptide complex is added. The amount
of detection reagent that remains bound to the solid support is
then determined using a method appropriate for the specific
detection reagent.
[0093] In some embodiments, the detection reagent contains a
binding agent (such as, for example, Protein A, Protein G,
immunoglobulin, lectin or free antigen) conjugated or covalently
attached to a reporter group or label. Exemplary reporter groups or
labels include enzymes (such as horseradish peroxidase),
substrates, cofactors, inhibitors, dyes, radionuclides, luminescent
groups, fluorescent groups and biotin. The conjugation of binding
agent to reporter group or label may be achieved using standard
methods known to those of ordinary skill in the art. Common binding
agents may also be purchased conjugated to a variety of reporter
groups from many commercial sources (e.g., Zymed Laboratories, San
Francisco, Calif.; and Pierce, Rockford, Ill.).
[0094] In an aspect of the present disclosure, the presence or
absence of Ehrlichia specific antibodies may be determined in the
sample by comparing the level of a signal detected from a reporter
group or label in the sample with the level of a signal that
corresponds to a control sample or predetermined cut-off value. In
certain embodiments, the cut-off value may be the average mean
signal obtained when the immobilized ehrlichial immunoreactive
peptide is incubated with samples from an uninfected subject. The
cut-off value may be determined using a statistical method or
computer program.
[0095] B. Lateral Flow Tests
[0096] Lateral flow tests may also be referred to as
immunochromatographic strip (ICS) tests or simply strip-tests. In
general, a lateral flow test is a form of assay in which the test
sample flows laterally along a solid substrate via capillary
action, or alternatively, under fluidic control. Such tests are
often inexpensive, require a very small amount (e.g., one drop) of
sample, and can typically be performed reproducibly with minimal
training. The economical simplicity and robustness of many lateral
flow assay formats makes these types of tests ideal for identifying
an Ehrlichia (e.g., E. chaffeensis or E. canis) infection at the
point of care, which can be particularly important when the subject
is, for example, a human or dog exhibiting detectable antibodies
during the treatable acute phase of infection.
[0097] Exemplary lateral flow device formats include, but are not
limited to, a dipstick, a card, a chip, a microslide, and a
cassette, and it is widely demonstrated in the art that the choice
of format is largely dependent upon the features of a particular
assay. Accordingly, lateral flow devices are now ubiquitous in
human and veterinarian medicine and quite varied, providing many
options to the ordinarily skilled artisan for detecting a
peptide-antibody complex in a sample using a lateral flow assay
(See any of U.S. Pat. Nos. 7,344,893, 7,371,582, 6,136,610, and
U.S. Patent Applications, 2005/0250141 and 2005/0047972, or Koczula
et al. (2016) each incorporated herein by reference.) By way of a
nonlimiting example, a sample from a subject suspected of having an
Ehrlichia infection is applied to a lateral flow device comprising
at least a sample zone and a binding zone. The sample may be a
serum sample, and may be drawn laterally from the sample zone to
the binding zone which comprises an ehrlichial immunoreactive
polypeptide disclosed herein (e.g., comprising at least two
peptides of Table 1 or a polypeptide of Table 2) immobilized to a
surface of the lateral flow device. In this example, the binding of
the immobilized ehrlichial immunoreactive polypeptide on the
lateral flow device is an indication that Ehrlichia specific
antibodies are present in the sample from the subject, indicating
an Ehrlichia infection in the subject, such as an E. chaffeensis
infection in the subject.
[0098] In related embodiments, an ELISA assay as described above
may be performed in a rapid flow-through, lateral flow, or strip
test format, wherein the antigen is immobilized on a membrane, such
as a nitrocellulose membrane. In this flow-through test, Ehrlichia
antibodies within the sample bind to the immobilized ehrlichial
immunoreactive peptide as the sample passes through the membrane. A
detection reagent, such as protein A labeled with gold, a
fluorophore, or a chromophore, binds to the peptide-antibody
complex as the solution containing the detection reagent flows
through the membrane. Peptide-antibody complexes bound to detection
reagent may then be detected, as appropriate for the detection
reagent used (e.g., based on the presence or absence of a visibly
detectable color or fluorescent label, a nanoparticle, a
luminescent rare earth nanoparticle, a luminous nanoparticle, a
strontium aluminate nanoparticle (e.g., see Paterson et al., 2014;
and Wang et al., 2017, etc.).
[0099] In an aspect, a flow-through format ELISA may be performed
in which one end of the membrane to which an ehrlichial
immunoreactive peptide (e.g., comprising at least two peptides of
Table 1 or a polypeptide of Table 2) is immobilized may be immersed
in a solution containing the sample, or the sample may be added to
an area (i.e., a sample zone) at one end of the membrane. The
sample migrates along the membrane through a region (i.e., a
labeling zone) comprising the detection reagent, and flows to the
area (i.e., a binding zone) comprising the immobilized ehrlichial
immunoreactive peptide. An accumulation of detection reagent at the
binding zone indicates the presence of Ehrlichia specific
antibodies in the sample.
[0100] Typically, a flow-through ELISA may feature a detection
reagent applied to a test strip in a pattern, such as a line, that
can be read visually. As with other lateral flow tests, the absence
of such a pattern typically indicates a negative result. It is
within the ability of an ordinarily skilled artisan to select an
amount of the ehrlichial immunoreactive polypeptide for
immobilization on the membrane that can generate a visually
discernible pattern when the biological sample contains a level of
antibodies that would be sufficient to generate a positive signal
in a standard format ELISA. Preferably, the amount of peptide
immobilized on the membrane ranges from about 25 ng to about 1
mg.
[0101] C. Particulate-Based Assays
[0102] In general, particle-based assays use a capture-binding
partner, such as an antibody or an antigen in the case of an
immunoassay, coated on the surface of particles, such as
microbeads, crystals, chips, or nanoparticles. Particle-based
assays may be effectively multi-plexed or modified to assay
numerous variables of interest by incorporating fluorescently
labeled particles or particles of different sizes in a single
assay, each coated or conjugated to one or more labeled
capture-binding partners. The use of sensitive detection and
amplification technologies with particle-based assay platforms
known in the art has resulted in numerous flexible and sensitive
assay systems to choose from in performing a method described
herein. For example, a multiplex particle-based assay such as the
suspension array Bio-Plex.RTM. assay system available from Bio-Rad
Laboratories, Inc. (Hercules, Calif.) and Luminex, Inc. (Austin,
Tex.) may be useful in identifying Ehrlichia antibodies in a
sample.
[0103] In an aspect, the present disclosure contemplates the
immobilization of an isolated ehrlichial immunoreactive polypeptide
(e.g., comprising at least two peptides of Table 1 or a polypeptide
of Table 2) on a surface of a particle for use in a particle-based
immunoassay. As described herein, methods of peptide immobilization
onto support surfaces is well known in the art. In a preferred
embodiment, a labeled her immunoreactive polypeptide disclosed
herein is immobilized onto a surface of a particle and the
peptide-particle complex is employed in an ELISA or in a flow
cytometry assay according to established protocols.
VI. EHRLICHIA VACCINE AND IMMUNOGENIC COMPOSITIONS
[0104] Previous work has shown that Ehrlichial proteins that induce
antibody responses can provide protective immune responses; thus,
in some embodiments an ehrlichial protein provided herein (e.g., a
polypeptide of Formula I or a polypeptide of Table 2) may be
included in a pharmaceutical composition such as a vaccine
composition for administration to a mammalian or human subject. For
example, protection against E. chaffeensis infection has been
demonstrated with epitope-specific antibodies directed at OMP and
TRPs in in vitro models and in animal models (Kuriakose et al.,
2012; Li et al., 2002; Li et al., 2001), demonstrating that
ehrlichial proteins that elicit strong antibody responses to linear
epitopes are protective.
[0105] In select embodiments, it is contemplated that an ehrlichial
immunoreactive polypeptide of Formula I or a polypeptide of Table 2
may be comprised in a vaccine composition and administered to a
subject (e.g., a human or dog) to induce a protective immune
response in the subject that may substantially prevent or
ameliorate infection in the subject by an Ehrlichia organism such
as Ehrlichia chaffeensis or Ehrlichia canis. A vaccine composition
for pharmaceutical use in a subject may comprise an immunoreactive
polypeptide of Formula I or a polypeptide of Table 2 and a
pharmaceutically acceptable carrier.
[0106] The phrases "pharmaceutical," "pharmaceutically acceptable,"
or "pharmacologically acceptable" refers to molecular entities and
compositions that do not produce an adverse, allergic or other
untoward reaction when administered to an animal, such as, for
example, a human, as appropriate. As used herein, "pharmaceutically
acceptable carrier" includes any and all solvents, dispersion
media, coatings, surfactants, antioxidants, preservatives (e.g.,
antibacterial agents, antifungal agents), isotonic agents,
absorption delaying agents, salts, preservatives, drugs, drug
stabilizers, gels, binders, excipients, disintegration agents,
lubricants, sweetening agents, flavoring agents, dyes, such like
materials and combinations thereof, as would be known to one of
ordinary skill in the art (see, for example, Remington's
Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1289-1329,
1990, incorporated herein by reference). Except insofar as any
conventional carrier is incompatible with the active ingredient,
its use in the vaccine compositions of the present disclosure is
contemplated.
[0107] As used herein, a "protective immune response" refers to a
response by the immune system of a mammalian host to an Ehrlichia
antigen which results in increased recognition of the antigen and
antibody production by the immune system of the mammalian host upon
subsequent exposure to an Ehrlichia pathogen. A protective immune
response may substantially reduce or prevent symptoms as a result
of a subsequent exposure to Ehrlichia chaffeensis or Ehrlichia
canis.
[0108] In some embodiments, a vaccine composition of the present
disclosure may comprise an immunoreactive polypeptide (e.g., having
a sequence that has at least about 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, or 100% sequence identity to a polypeptide of
Formula I or a polypeptide of Table 2). In some embodiments, a
vaccine composition comprising the immunoreactive polypeptide may
be used to induce a protective immune response against Ehrlichia
chaffeensis (e.g., in a human or dog subject).
[0109] A person having ordinary skill in the medical arts will
appreciate that the actual dosage amount of a vaccine composition
administered to an animal or human patient can be determined by
physical and physiological factors such as body weight, severity of
condition, the type of disease being treated, previous or
concurrent therapeutic interventions, idiopathy of the patient and
on the route of administration. The practitioner responsible for
administration will, in any event, determine the concentration of
active ingredient(s) in a composition and appropriate dose(s) for
the individual subject.
[0110] In certain embodiments, vaccine compositions may comprise,
for example, at least about 0.1% of an ehrlichial immunoreactive
polypeptide comprising or consisting of a polypeptide of Formula I
or Table 2. In other embodiments, the active compound may comprise
between about 2% to about 75% of the weight of the unit, or between
about 25% to about 60%, for example, and any range derivable
therein. As with many vaccine compositions, frequency of
administration, as well as dosage, will vary among members of a
population of animals or humans in ways that are predictable by one
skilled in the art of immunology. By way of nonlimiting example,
the pharmaceutical compositions and vaccines may be administered by
injection (e.g., intracutaneous, intramuscular, intravenous or
subcutaneous), intranasally (e.g., by aspiration) or orally.
Between 1 and 3 doses may be administered over a 1-36 week period.
In some embodiments, 3 doses are administered, at intervals of 3-4
months, and booster vaccinations may be given periodically
thereafter.
[0111] In some embodiments, a "suitable dose" is an amount of an
immunoreactive polypeptide that, when administered as described
above, is capable of raising an immune response in an immunized
patient sufficient to protect the subject from an Ehrlichia
infection in subsequent exposures to Ehrlichia organisms. In
general, the amount of peptide present in a suitable dose (or
produced in situ by the nucleic acid in a dose) may range from
about 1 pg to about 500 mg per kg of host, typically from about 10
pg to about 10 mg, preferably from about 100 pg to about 1 mg and
more preferably from about 100 pg to about 100 microgram.
[0112] A vaccine composition of the present disclosure may comprise
different types of carriers depending on whether it is to be
administered in solid, liquid or aerosol form, and whether it needs
to be sterile for such routes of administration as injection. A
vaccine composition disclosed herein can be administered
intramuscularly, intradermally, subcutaneously, intravenously,
intraarterially, intraperitoneally, intralesionally,
intracranially, intraarticularly, intraprostaticaly,
intrapleurally, intratracheally, intranasally, intravitreally,
intravaginally, intrarectally, topically, intratumorally,
intramuscularly, intraperitoneally, subconjunctivally,
intravesicularly, mucosally, intrapericardially, locally, orally,
intranasally, or by inhalation, injection, infusion, continuous
infusion, lavage, or localized perfusion. A vaccine composition may
also be administered to a subject via a catheter, in cremes, in
lipid compositions, by ballistic particulate delivery, or by other
method or any combination of the forgoing as would be known to one
of ordinary skill in the art (see, for example, Remington: The
Science and Practice of Pharmacy, 21.sup.st Ed. Lippincott Williams
and Wilkins, 2005, incorporated herein by reference).
[0113] While any suitable carrier known to those of ordinary skill
in the art may be employed in the vaccine compositions of this
invention, the type of carrier will vary depending on the mode of
administration. For parenteral administration, such as subcutaneous
injection, the carrier preferably comprises water, saline, alcohol,
a fat, a wax or a buffer. For oral administration, any of the above
carriers or a solid carrier, such as mannitol, lactose, starch,
magnesium stearate, sodium saccharine, talcum, cellulose, glucose,
sucrose, and magnesium carbonate, may be employed. Biodegradable
microspheres (e.g., polylactic galactide) may also be employed as
carriers for the pharmaceutical compositions of this invention.
Suitable biodegradable microspheres are disclosed, for example, in
U.S. Pat. Nos. 4,897,268 and 5,075,109.
[0114] Of particular interest, in some embodiments, is a vaccine
composition that may be administered by microstructured transdermal
or ballistic particulate delivery. Microstructures as carriers for
vaccine formulation are a desirable configuration for vaccine
applications and are widely known in the art (e.g., U.S. Pat. Nos.
5,797,898, 5,770,219 and 5,783,208, and U.S. Patent Application
2005/0065463). Such a vaccine composition formulated for ballistic
particulate delivery may comprise an isolated immunoreactive
polypeptide of Table 1, 2, or 3 immobilized on a surface of a
support substrate. In these embodiments, a support substrate can
include, but is not limited to, a microcapsule, a microparticle, a
microsphere, a nanocapsule, a nanoparticle, a nanosphere, or a
combination thereof.
[0115] Microstructures or ballistic particles that serve as a
support substrate for an ehrlichial immunoreactive polypeptide
disclosed herein may be comprised of biodegradable material and
non-biodegradable material, and such support substrates may be
comprised of synthetic polymers, silica, lipids, carbohydrates,
proteins, lectins, ionic agents, crosslinkers, and other
microstructure components available in the art. Protocols and
reagents for the immobilization of a peptide of the invention to a
support substrate composed of such materials are widely available
commercially and in the art.
[0116] In other embodiments, a vaccine composition comprises an
immobilized or encapsulated immunoreactive polypeptide of Formula I
or a polypeptide of Table 2 and a support substrate. In these
embodiments, a support substrate can include, but is not limited
to, a lipid microsphere, a lipid nanoparticle, an ethosome, a
liposome, a niosome, a phospholipid, a sphingosome, a surfactant, a
transferosome, an emulsion, or a combination thereof. The formation
and use of liposomes and other lipid nano- and microcarrier
formulations is generally known to those of ordinary skill in the
art, and the use of liposomes, microparticles, nanocapsules and the
like have gained widespread use in delivery of therapeutics (e.g.,
U.S. Pat. No. 5,741,516, specifically incorporated herein in its
entirety by reference). Numerous methods of liposome and
liposome-like preparations as potential drug carriers, including
encapsulation of peptides, have been reviewed (U.S. Pat. Nos.
5,567,434; 5,552,157; 5,565,213; 5,738,868 and 5,795,587, each of
which is specifically incorporated in its entirety by
reference).
[0117] In addition to the methods of delivery described herein, a
number of alternative techniques are also contemplated for
administering the disclosed vaccine compositions. By way of
nonlimiting example, a vaccine composition may be administered by
sonophoresis (i.e., ultrasound) which has been used and described
in U.S. Pat. No. 5,656,016 for enhancing the rate and efficacy of
drug permeation into and through the circulatory system;
intraosseous injection (U.S. Pat. No. 5,779,708), or
feedback-controlled delivery (U.S. Pat. No. 5,697,899), and each of
the patents in this paragraph is specifically incorporated herein
in its entirety by reference.
[0118] Any of a variety of adjuvants may be employed in the
vaccines of this invention to nonspecifically enhance the immune
response. Most adjuvants contain a substance designed to protect
the antigen from rapid catabolism, such as aluminum hydroxide or
mineral oil, and a nonspecific stimulator of immune responses, such
as lipid A, Bortadella pertussis or Mycobacterium tuberculosis.
Suitable adjuvants are commercially available as, for example,
Freund's Incomplete Adjuvant and Freund's Complete Adjuvant (Difco
Laboratories, Detroit, Mich.) and Merck Adjuvant 65 (Merck and
Company, Inc., Rahway, N.J.). Other suitable adjuvants include
alum, biodegradable microspheres, monophosphoryl lipid A and quil
A.
[0119] A polypeptide may be formulated into a composition in a
neutral or salt form. Pharmaceutically acceptable salts, include
the acid addition salts (formed with the free amino groups of the
protein) and which are formed with inorganic acids such as, for
example, hydrochloric or phosphoric acids, or such organic acids
such as acetic, oxalic, tartaric, mandelic, and the like. Salts
formed with the free carboxyl groups can also be derived from
inorganic bases such as, for example, sodium, potassium, ammonium,
calcium, or ferric hydroxides, and such organic bases as
isopropylamine, trimethylamine, histidine, procaine and the
like.
[0120] In any case, the composition may comprise various
antioxidants to retard oxidation of one or more component.
Additionally, the prevention of the action of microorganisms can be
brought about by preservatives such as various antibacterial and
antifungal agents, including but not limited to parabens (e.g.,
methylparabens, propylparabens), chlorobutanol, phenol, sorbic
acid, thimerosal or combinations thereof.
[0121] Sterile injectable solutions are prepared by incorporating
the active peptides in the required amount in the appropriate
solvent with various of the other ingredients enumerated above, as
required, followed by filtered sterilization. Generally,
dispersions are prepared by incorporating the various sterilized
active ingredients into a sterile vehicle that contains the basic
dispersion medium and/or the other ingredients. In the case of
sterile powders for the preparation of sterile injectable
solutions, suspensions or emulsion, the preferred methods of
preparation are vacuum-drying or freeze-drying techniques which
yield a powder of the active ingredient plus any additional desired
ingredient from a previously sterile-filtered liquid medium
thereof. The liquid medium should be suitably buffered if necessary
and the liquid diluent first rendered isotonic prior to injection
with sufficient saline or glucose. The preparation of highly
concentrated compositions for direct injection is also
contemplated, where the use of DMSO as solvent is envisioned to
result in extremely rapid penetration, delivering high
concentrations of the active agents to a small area.
[0122] The composition must be stable under the conditions of
manufacture and storage, and preserved against the contaminating
action of microorganisms, such as bacteria and fungi. It will be
appreciated that endotoxin contamination should be kept minimally
at a safe level, for example, less than 0.5 ng/mg protein.
[0123] In particular embodiments, prolonged absorption of an
injectable composition can be brought about by the use in the
compositions of agents delaying absorption, such as, for example,
aluminum monostearate, gelatin or combinations thereof.
[0124] A. Ehrlichia Bacterin
[0125] In some embodiments, an immunogenic or vaccine composition
as disclosed herein comprises an Ehrlichia bacterin, such as an E.
canis bacterin or an E. chaffeensis bacterin. E Canis bacterin may
be prepared by heat-inactivating or chemically-inactivating the
Ehrlichia bacteria.
[0126] A variety of methods may be used to generate an E.
chaffeensis or E. canis bacterin. For example, the bacteria may be
inactivated by heat or psoralen in the presence of ultraviolet
light to produce the bacterin. The effective immunizing amount of
the inactivated Ehrlichia bacterin can vary depending upon the
chosen strain or strains. It is anticipated that any amount of an
Ehrlichia bacterin, alone or in combination with (i) chimeric
polypeptide as disclosed herein (e.g., a polypeptide of Formula I
or of Table 2), and/or (ii) adjuvant(s), sufficient to evoke a
protective immune response may be used in various embodiments
(e.g., to induce a protective immune response in a subject). In
some embodiments, a dosage unit comprising at least about
1.times.10.sup.4 TCID.sub.50 inactivated E. chaffeensis and/or E.
canis bacterin can be used. Additional methods that may be used to
generate an Ehrlichia bacterin include, but are not limited to,
treatment of an E. chaffeensis or E. canis with heat, formaldehyde,
formalin, bi-ethylene amine, radiation, and/or beta-propiolactone
treatment. It is anticipated that the bacterin may be inactivated
by any suitable method available. Additional methods that may be
used to generate an Ehrlichia or E. canis bacterin include those
described, e.g., in WO2005087803, EP2433646, Vega et al., 2007; or
Stuen et al., 2015.
[0127] In some embodiments, the Ehrlichia bacterin comprises
inactivated crude antigen based on inactivated E. chaffeensis
and/or E. canis bacteria. For example, in some embodiments, frozen
buffy coat (e.g., 10 ml frozen buffy coat) containing E.
chaffeensis or E. Canis may be obtained, and the material was
inactivated using 0.3% formaldehyde for 48 h at room temperature.
Thereafter, the material can tested for lack of infectivity by in
vitro methods or by using an in vivo animal model. Methods for
inactivating bacteria using formaldehyde are further described in
Tollersrud et al., 2001. The resulting Ehrlichia bacterin can be
included with (i) 1, 2, 3, or more chimeric immunogenic proteins or
peptides as described herein (e.g., as described in Table 2) and/or
(ii) an adjuvant, to form an immunogenic or vaccine composition.
For example, the inactivated E. canis bacterin may be prepared as a
suspension and then included in an emulsion adjuvant, e.g., as
described below.
[0128] B. Adjuvants
[0129] In some aspects, an immunogenic composition comprising one
or more chimeric polypeptide as disclosed herein (e.g., a
polypeptide of Formula I or of Table 2) also contains an adjuvant.
In some embodiments, the composition is a pharmaceutical
preparation or a vaccine composition. A variety of adjuvants are
known that can be included. For example, adjuvants such as MF59,
AS01, AS02, AS03, AS04, Virosomes, CAF01, CAF04, CAF05, Montanide
ISA.TM. 720, or Montanide ISA.TM. 51 (e.g., Bonam et al., 2017) can
be used in some embodiments.
[0130] In some embodiments, the immunogenic or vaccine composition
includes an adjuvant comprising a triterpenoid, sterol,
immunomodulator, polymer, and/or Th2 stimulator. For example, in
some embodiments the adjuvant comprises DEAE Dextran, an
immunostimulatory oligonucleotide, and oil (e.g., a light mineral
oil), wherein the immunostimulatory oligonucleotide is a CpG
containing ODN, and wherein the adjuvant formulation is a
water-in-oil (W/O) emulsion. The vaccine adjuvant may optionally
comprise an Ehrlichia bacterin (such as a heat-inactivated E. Canis
or E. chaffeensis) and/or a chimeric peptide as disclosed herein
(e.g., of Formula I or Table 2). In some embodiments, the
immunogenic or vaccine composition includes an antigen component
and an adjuvant formulation comprising a saponin (e.g., present in
an amount of about 1 .mu.g to about 5,000 .mu.g per dose), a sterol
(e.g., present in an amount of about 1 .mu.g to about 5,000 .mu.g
per dose), a quaternary ammonium compound (e.g., present in an
amount of about 1 .mu.g to about 5,000 .mu.g per dose), a polymer
(e.g., present in an amount of about 0.0001% v/v to about 75%
v/v.), and an ORN/ODN; the saponin may be Quil A or a purified
faction thereof, the sterol may be cholesterol, the quaternary
ammonium compound may be dimethyl dioctadecyl ammonium bromide
(DDA), the polymer may be polyacrylic acid, and the ORN/ODN may be
a CpG. The adjuvant may comprise a glycolipid, such
N-(2-deoxy-2-L-leucylamino-.beta.-D-glucopyranosyl)-N-octadecyldodecanami-
de acetate. The adjuvant may comprise an immunostimulatory
oligonucleotide, a polyacrylic acid polymer and at least two of the
following: (a) dimethyl dioctadecyl ammonium bromide (DDA); (b) a
sterol; and/or (c)
N-(2-deoxy-2-L-leucylamino-.beta.-D-glucopyranosyl)-N-octadecyldodecanami-
de acetate. For example, the vaccine composition may comprise an
adjuvant as described, e.g., in U.S. Pat. Nos. 10,238,736,
8,580,280, or US Publication 2019/0008953.
[0131] In some embodiments, immunogenic or vaccine composition
includes an antigen component and an adjuvant formulation
comprising a triterpenoid saponin, a sterol, a quaternary ammonium
compound, and a polyacrylic acid polymer, wherein the antigen
component comprises or consists of a Ehrlichia bacterin (such as a
heat-inactivated E. canis) and/or a chimeric polypeptide as
disclosed herein (e.g., a polypeptide of Formula I or of Table 2).
In some embodiments, the saponin is present in an amount of about 1
mg to about 5,000 mg per dose, the sterol is present in an amount
of about 1 mg to about 5,000 mg per dose, the quaternary ammonium
compound is present in an amount of about 1 mg to about 5,000 mg
per dose, and the polyacrylic acid polymer is present in an amount
of about 0.0001% v/v to about 75% v/v. For example, the vaccine
composition may comprise an adjuvant as described, e.g., in U.S.
Pat. No. 9,662,385.
[0132] In some aspects, an immunogenic or vaccine composition as
disclosed herein comprises an oil-based adjuvant comprising an
Ehrlichia bacterin (such as a heat-inactivated E. canis or E.
chaffensis) and/or one or more chimeric polypeptide as disclosed
herein (e.g., a polypeptide of Formula I or of Table 2). For
example, the adjuvant formulation may comprise an oily phase and an
aqueous phase, a polycationic carrier (e.g., DEAE dextran), and a
CpG containing immunostimulatory oligonucleotide, wherein the
vaccine is a water-in-oil emulsion. The adjuvant may optionally
further comprise an aluminum hydroxide gel. In some embodiments,
the CpG containing immunostimulatory oligonucleotide is present in
the amount of about 50 to about 400 .mu.g per dose and DEAE Dextran
is present in the amount of about 10 to about 300 mg per dose. The
adjuvant formulation may comprise an immunostimulating
oligonucleotide, polycationic carrier, sterol, saponin, quaternary
amine, TLR-3 agonist, glycolipid, and/or MPL-A (or an analog
thereof) in an oil emulsion. For example, the vaccine composition
may comprise an adjuvant as described, e.g., in U.S. Pat. No.
10,117,921 or US 2019/0038737.
[0133] In some embodiments, the immunogenic composition is an
emulsion comprising (i) an Ehrlichia bacterin (such as a
heat-inactivated E. canis or E. chaffeensis), and/or (ii) one or
more chimeric polypeptide as disclosed herein (e.g., a polypeptide
of Formula I or of Table 2). For example, the emulsion composition
may comprise an adjuvant, such as acrylic polymer and/or dimethyl
dioctadecyl ammonium bromide (DDA), in the aqueous phase. The
emulsion can be prepared, in some embodiments, by mixing an aqueous
phase containing the antigen (e.g., an E. canis bacterin such as a
heat-inactivated E. canis, and/or one or more chimeric polypeptide
(e.g., a polypeptide of Formula I or of Table 2)) and adjuvant with
an oil phase in the presence of an emulsifier. In some embodiments,
the adjuvant component comprises an oil-in-water emulsion, wherein
the aqueous phase of the oil-in-water emulsion comprises dimethyl
dioctadecyl ammonium bromide (DDA) and/or an alkyl-polyacrylic acid
(alkyl-PAA). In some embodiments, the oil in the oil-in-water
emulsion is mineral oil, a terpene oil, soybean oil, olive oil, or
a propylene glycol derivative. The adjuvant may further comprise
the adjuvant component further comprises CpG DNA, a
lipopolysaccharide, and/or monophosphoryl lipid A. The vaccine may
further comprise one or more emulsifiers. For example, the vaccine
composition may comprise an adjuvant as described, e.g., in U.S.
Pat. No. 9,545,439 or 8,980,288.
[0134] The adjuvant may be a liposome or emulsion formulation. The
liposomes may be unilamellar, multilamellar, or multivesicular. In
some embodiments, the an immunogenic or vaccine composition
comprises a lipid or lipid-containing adjuvant. In some
embodiments, the liposomes are cationic liposomes. In various
embodiments, adjuvants such as MF59 (e.g., Calabro et al. (2013)
Vaccine 31: 3363-3369), AS01 (Didierlaurent, et al. (2014) J.
Immunol. 193, 1920-1930), AS02 (Garcon and Van Mechelen (2011)
Expert Rev. Vaccines 10, 471-486), AS03 (Morel, S. et al. (2011)
Vaccine 29, 2461-2473), AS04 (Didierlaurent, et al. (2009) J.
Immunol. 183: 6186-6197.), Virosomes (Kunzi, et al. (2009) Vaccine
27, 3561-3567), CAF01 (Tandrup Schmidt, et al. (2016) Pharmaceutics
8, 7.), CAF04 (Billeskov, et al. (2016) PLoS One 11, e0161217),
CAF05 (Billeskov, et al. (2016) PLoS One 11, e0161217), Montanide
ISA.TM. 720 (Aucouturier, et al. (2002) Expert Rev. Vaccines 1,
111-118), or Montanide ISA.TM. 51 (Aucouturier, et al. (2002)
Expert Rev. Vaccines 1, 111-118) can be used. Table 3 provides a
listing of example adjuvant containing formulations that can be
used in various embodiments.
TABLE-US-00003 TABLE 3 Example adjuvant containing formulations
Adjuvant Composition MF59 Squalene, Span 85, Tween 80, and citrate
buffer AS01 Liposomes containing 3-O-desacyl-4'- monophosphoryl
lipid A (MPLA) and QS21 AS02 Oil-in-water (O/W) emulsion containing
MPLA and the saponin QS21 AS03 .alpha.-tocopherol, squalene,
polysorbate 80, and PBS AS04 Contains MPLA adsorbed onto a
particulate form of aluminum salt Virosomes Contain inactivated
virus CAF01 Cationic liposomal vehicle containing dimethyl
dioctadecyl-ammonium (DDA) with a glycolipid immunostimulator (TDB)
CAF04 Cationic liposomal vehicle containing DDA with monomycoloyl
glycerol analog (MMG) CAF05 Cationic liposomal vehicle containing
DDA with the immunostimulators TDB and poly(I:C) Montanide
Water-in-oil (W/O) emulsion containing non- ISA .TM. 720 mineral
oil with mannide mono-oleate family emulsifier Montanide W/O
emulsion containing mineral oil with ISA .TM. 51 mannide
mono-oleate family emulsifier Acrylic polymer/ Oil-in-water
emulsion comprises dimethyl DDA emulsions dioctadecyl ammonium
bromide (DDA) and/or an alkyl-polyacrylic acid (alkyl-PAA); e.g.,
see U.S. Pat. No. 9,545,439 or U.S. Pat. No. 8,980,288. CpG/DEAE
Emulsions comprising a polycationic carrier emulsions (e.g., DEAE
dextran) and a CpG containing immunostimulatory oligonucleotide;
e.g., see U.S. Pat. No. 10,117,921 or US 2019/0038737.
Saponin/cholesterol/ Saponin (e.g., Quil A), cholesterol, DDA, a
DDA adjuvants polyacrylic acid; e.g., a triterpenoid saponin, a
sterol, a quaternary ammonium compound, and a polyacrylic acid
polymer; e.g., see U.S. Pat. No. 9,662,385. Polyacrylic acid
Water-in-oil (W/O) emulsions, DEAE Dextran, polymer emulsions
immunostimulatory oligonucleotide (e.g., a CpG containing ODN), a
sterol, N-(2-deoxy-2-L- leucylamino-.beta.-D-glucopyranosyl)-N-
octadecyldodecanamide acetate, and/or a polyacrylic acid polymer;
e.g., see U.S. Pat. No. 10,238,736, U.S. Pat. No. 8,580,280, or US
Publication 2019/0008953.
VII. EHRLICHIA DETECTION AND VACCINATION KITS
[0135] Various embodiments of the present disclosure are concerned
with kits for the detection of antibodies in a sample that
specifically bind an Ehrlichia organism, such as E. chaffeensis or
E canis. The kits may thus be used for the diagnosis or
identification of an Ehrlichia infection in a subject. In other
embodiments, the invention provides kits for determining whether a
subject has been immunized against Ehrlichia or is actively
infected with an Ehrlichia organism. In still other embodiments,
kits are provided for vaccination of a subject against E.
chaffeensis infection, and in some embodiments it is anticipated
that the composition may be used to provide a protective immune
response against an E. canis infection.
[0136] In select embodiments, a kit of the present disclosure may
be used to perform a method disclosed herein. For example, a kit
may be suitable for detecting Ehrlichia antibodies in a sample, for
identifying an Ehrlichia infection individual, for determining
whether a subject has been immunized against Ehrlichia or is
actively infected with an Ehrlichia organism, or for vaccinating a
subject against an Ehrlichia organism. In these embodiments, one or
more immunoreactive peptide (e.g., comprising a polypeptide of
Formula I or a polypeptide of Table 2, or a polypeptide having at
least about 95% or more sequence identity with a polypeptide of
Formula I or a polypeptide of Table 2) may be comprised in the kit.
The ehrlichial immunoreactive polypeptide in the kit may be
detectably labeled or immobilized on a surface of a support
substrate also comprised in the kit. The immunoreactive
polypeptide(s) may, for example, be provided in the kit in a
suitable form, such as sterile, lyophilized, or both.
[0137] The support substrate comprised in a kit of the invention
may be selected based on the method to be performed. By way of
nonlimiting example, a support substrate may be a multi-well plate
or microplate, a membrane, a filter, a paper, an emulsion, a bead,
a microbead, a microsphere, a nanobead, a nanosphere, a
nanoparticle, an ethosome, a liposome, a niosome, a transferosome,
a dipstick, a card, a celluloid strip, a glass slide, a microslide,
a biosensor, a lateral flow apparatus, a microchip, a comb, a
silica particle, a magnetic particle, or a self-assembling
monolayer.
[0138] As appropriate to the method being performed, a kit may
further comprise one or more apparatuses for delivery of a
composition to a subject or for otherwise handling a composition of
the invention. By way of nonlimiting example, a kit may include an
apparatus that is a syringe, an eye dropper, a ballistic particle
applicator (e.g., applicators disclosed in U.S. Pat. Nos.
5,797,898, 5,770,219 and 5,783,208, and U.S. Patent Application
2005/0065463), a scoopula, a microslide cover, a test strip holder
or cover, and such like.
[0139] A detection reagent for labeling a component of the kit may
optionally be comprised in a kit for performing a method of the
present disclosure. In particular embodiments, the labeling or
detection reagent is selected from a group comprising reagents used
commonly in the art and including, without limitation, radioactive
elements, enzymes, molecules which absorb light in the UV range,
and fluorophores such as fluorescein, rhodamine, auramine, Texas
Red, AMCA blue and Lucifer Yellow. In other embodiments, a kit is
provided comprising one or more container means and a BST protein
agent already labeled with a detection reagent selected from a
group comprising a radioactive element, an enzyme, a molecule which
absorbs light in the UV range, and a fluorophore.
[0140] In particular embodiments, the present disclosure provides a
kit for detecting anti-Ehrlichia antibodies in a sample which may
also be used for identification of an Ehrlichia infection in a
subject, and/or for determining whether a subject has been
immunized against Ehrlichia or is actively infected with an
Ehrlichia organism. Such a kit may comprise one or more
immunoreactive polypeptides (e.g., comprising a polypeptide of
Formula I or a polypeptide of Table 2, or having at least about 95%
or more sequence identity with a polypeptide comprising a
polypeptide of Formula I or a polypeptide of Table 2), and the
peptides may be detectably labeled and immobilized to one or more
support substrates comprised in the kit.
[0141] In some embodiments, a kit comprises an immunoreactive
polypeptide comprising a polypeptide of Formula I or a polypeptide
of Table 2 or having about 95% or more sequence identity with
polypeptide comprising a polypeptide of Formula I or a polypeptide
of Table 2. The peptides may be immobilized to one or more separate
lateral flow assay devices, such as a nitrocellulose test strips.
In these embodiments, each of the test strips may further comprises
a detection reagent, for example, a chromophore-labeled protein A.
Such a kit may further comprise one or more containers for sample
material, one or more diluents for sample dilution, and one or more
control indicator strips for comparison.
[0142] When reagents and/or components comprising a kit are
provided in a lyophilized form (lyophilisate) or as a dry powder,
the lyophilisate or powder can be reconstituted by the addition of
a suitable solvent. In particular embodiments, the solvent may be a
sterile, pharmaceutically acceptable buffer and/or other diluent.
It is envisioned that such a solvent may also be provided as part
of a kit.
[0143] When the components of a kit are provided in one and/or more
liquid solutions, the liquid solution may be, by way of
non-limiting example, a sterile, aqueous solution. The compositions
may also be formulated into an administrative composition. In this
case, the container means may itself be a syringe, pipette, topical
applicator or the like, from which the formulation may be applied
to an affected area of the body, injected into a subject, and/or
applied to or mixed with the other components of the kit.
IV. EXAMPLES
[0144] The following examples are included to demonstrate preferred
embodiments of the invention. It should be appreciated by those of
skill in the art that the techniques disclosed in the examples
which follow represent techniques discovered by the inventor to
function well in the practice of the invention, and thus can be
considered to constitute preferred modes for its practice. However,
those of skill in the art should, in light of the present
disclosure, appreciate that many changes can be made in the
specific embodiments which are disclosed and still obtain a like or
similar result without departing from the spirit and scope of the
invention.
Example 1
Methods
[0145] Chimera Construction and Cloning
[0146] Sequences representing five Ehrlichia epitope chimeras were
synthesized commercially (GenScript). The chimeric sequences were
cloned into pET-14 and the recombinant chimeric protein expressed
in E. coli BL21 (DE) or BL21-AI (Invitrogen) (Table 1).
TABLE-US-00004 TABLE 1 Ehrlichia chimeras Expression Chimera Name
MW pl Vector cell Tag Solubility E. chaff TRP32/TRP120/A34 30.8 KD
3.79 pET-14b BL21-(DE3) His Soluble E. canis TRP140/TRP36/TRP19
22.8 KD 3.94 pET-14b BL21-(DE3) His Soluble E. canis TRP36/TRP140
17.8 KD 3.93 pET-14b BL21-Al His Soluble Ehrlichia TRP32/TRP120/
31.4 KD 4.13 pET-14b BL21-(DE3) His Soluble TRP36/TRP140/P28/HSP
Ehrlichia TRP120/TRP140/ 27.9 KD 4.09 pET-14b BL21-Al His Soluble
TRP36/P28
[0147] Chimera Expression and Purification
[0148] Ehrlichia chimera recombinant proteins were purified under
native conditions using Roche cOmplete.TM. His-Tag Protein
Purification Protocol. Briefly, E. coli cell pellets were
resuspended in lysis buffer (50 mM Tris-HCl, 150 mM NaCl, 2 mMDTT,
2 mM MgCl2, 5 mM EDTA and 5 mM Imidazole) and sonicated on ice for
5 min, then lysates were cleared by centrifugation for 1 h at
12,000.times.g at 4.degree. C. His-tagged proteins were purified by
incubating for 30 min with his-resin, and washed 3 times with wash
buffer (10 mM Imidazole in lysis buffer), and protein was eluted
with elution buffer (250 mM Imidazole in lysis buffer).
[0149] Western Blot
[0150] Protein samples for Western immunoblot analysis were
resolved by SDS-PAGE, transferred to nitrocellulose membrane,
blocked in Tris-buffered saline (TBS) containing 5% non-fat dry
milk. Proteins were reacted with dog anti-E. canis or anti-E.
chaffeensis serum (1:500). Blots were incubated with
phosphatase-labeled goat anti-dog IgG diluted in TBS (1:5000)
(Kirkegaard & Perry, Gaithersburg, Mass.) and proteins
reactivity visualized after addition of alkaline phosphatase
substrate (Kirkegaard & Perry).
[0151] ELISA
[0152] Sera from human patients infected with E. chaffeensis and
dogs infected with E. canis were used to evaluate Ehrlichia chimera
immunoreactivity. An ELISA was performed by incubating 50 ng/well
of chimeric protein diluted in PBS in 96-well ELISA plates
(PolySorp, Nunc) and incubated overnight at 4 C. The plates were
washed 3.times. with 0.2% Tween 20 in TBS (TBST) and blocked 100 ul
of blocking buffer (10% horse serum in TBST) and incubated at room
temperature for 1 h with shaking. Plates were washed 3.times. with
TBST, and 50 ul of primary antibody diluted 1:100 in blocking
buffer was incubated at room temperature for 1 h with shaking.
Plates were washed 3.times. with TBST, add 50 ul of secondary
antibody AP-conjugate diluted in blocking buffer and incubate at
room temperature for 1 h with shaking. Substrate was added and
incubated at room temperature for 30 min with shaking in the dark
and OD was determined using an ELISA plate reader @650 nm.
[0153] Results
[0154] Five Ehrlichia chimeric constructs were expressed in E. coli
and the recombinant protein purified (FIGS. 1-5). Purified E. canis
or E. chaffeensis specific chimeric proteins reacted with
antibodies in dog anti-E. canis or anti-E. chaffeensis (FIGS. 1-3).
Similarly, E. canis/E. chaffeensis combination chimeric proteins
reacted strongly with both anti-E. canis and anti-E. chaffeensis
dog sera demonstrating functionality of species specific epitopes
represented in the chimera (FIG. 4 and FIG. 5). ELISA was performed
with a panel of convalescent anti-E. chaffeensis patient sera to
demonstrate immunoreactivity of chimeric proteins with antibodies.
The E. chaffeensis TRP32/TRP120/A34 chimera reacted strongly with
10 HME patient sera demonstrating high immunoreactivity with all
HME patient sera (FIG. 1). Two E. canis specifc chimeras
(TRP140/TRP36/TRP19 and TRP36/TRP140) were reacted with 10 sera
from dogs naturally infected with E. canis. All sera from E.
canis-infected dogs reacted strongly with the chimeric constructs
(FIG. 2 and FIG. 3). The E. chaffeensis/E. canis combination
chimeras immunoreactivity were tested with dog-anti-E. canis sera
and human anti-E. chaffeensis patient sera. Both chimeras reacted
strongly with anti-E. canis and anti-E. chaffeensis antibodies
demonstrating the functionality of the species-specific epitopes
represented within the chimera with E. canis and E. chaffeensis
antibodies (FIG. 4 and FIG. 5).
[0155] All of the methods disclosed and claimed herein can be made
and executed without undue experimentation in light of the present
disclosure. While the compositions and methods of this invention
have been described in terms of preferred embodiments, it will be
apparent to those of skill in the art that variations may be
applied to the methods and in the steps or in the sequence of steps
of the method described herein without departing from the concept,
spirit and scope of the invention. More specifically, it will be
apparent that certain agents which are both chemically and
physiologically related may be substituted for the agents described
herein while the same or similar results would be achieved. All
such similar substitutes and modifications apparent to those
skilled in the art are deemed to be within the spirit, scope and
concept of the invention as defined by the appended claims.
REFERENCES
[0156] The following references, to the extent that they provide
exemplary procedural or other details supplementary to those set
forth herein, are specifically incorporated herein by reference.
[0157] U.S. Pat. No. 9,545,439 [0158] U.S. Pat. No. 9,545,439
[0159] U.S. Pat. No. 10,117,921 [0160] U.S. Pat. No. 10,117,921
[0161] U.S. Pat. No. 10,117,921 [0162] U.S. Pat. No. 10,238,736
[0163] U.S. Pat. No. 4,220,450 [0164] U.S. Pat. No. 4,373,932
[0165] U.S. Pat. No. 4,472,509 [0166] U.S. Pat. No. 4,897,268
[0167] U.S. Pat. No. 4,938,948 [0168] U.S. Pat. No. 5,075,109
[0169] U.S. Pat. No. 5,440,013 [0170] U.S. Pat. No. 5,446,128
[0171] U.S. Pat. No. 5,470,723 [0172] U.S. Pat. No. 5,470,932
[0173] U.S. Pat. No. 5,543,504 [0174] U.S. Pat. No. 5,552,157
[0175] U.S. Pat. No. 5,565,213 [0176] U.S. Pat. No. 5,567,434
[0177] U.S. Pat. No. 5,618,914 [0178] U.S. Pat. No. 5,656,016
[0179] U.S. Pat. No. 5,670,155 [0180] U.S. Pat. No. 5,697,899
[0181] U.S. Pat. No. 5,738,868 [0182] U.S. Pat. No. 5,741,516
[0183] U.S. Pat. No. 5,770,219 [0184] U.S. Pat. No. 5,779,708
[0185] U.S. Pat. No. 5,783,208 [0186] U.S. Pat. No. 5,795,587
[0187] U.S. Pat. No. 5,797,898 [0188] U.S. Pat. No. 5,840,833
[0189] U.S. Pat. No. 5,853,744 [0190] U.S. Pat. No. 5,859,184
[0191] U.S. Pat. No. 5,891,506 [0192] U.S. Pat. No. 5,929,237
[0193] U.S. Pat. No. 6,136,610 [0194] U.S. Pat. No. 6,210,708
[0195] U.S. Pat. No. 6,372,445 [0196] U.S. Pat. No. 6,617,142
[0197] U.S. Pat. No. 6,875,750 [0198] U.S. Pat. No. 6,951,765
[0199] U.S. Pat. No. 7,163,677 [0200] U.S. Pat. No. 7,282,194
[0201] U.S. Pat. No. 7,344,893 [0202] U.S. Pat. No. 7,371,582
[0203] U.S. Pat. No. 8,580,280 [0204] U.S. Pat. No. 8,980,288
[0205] U.S. Pat. No. 8,980,288 [0206] U.S. Pat. No. 9,662,385.
[0207] U.S. Patent Appln. 2005/0047972 [0208] U.S. Patent Appln.
2005/0065463 [0209] U.S. Patent Appln. 2005/0250141 [0210] U.S.
Patent Appln. 2007/0264664 [0211] U.S. Patent Appln. 2009/0005535
[0212] U.S. Patent Appln. 2019/0008953 [0213] U.S. Patent Appln.
2019/0038737 [0214] EP2433646 [0215] WO2005087803 [0216]
Aucouturier, et al., Expert Rev. Vaccines, 1, 111-118, 2002. [0217]
Billeskov, et al., PLoS One 11, e0161217, 2016. [0218] Bonam et
al., Trends in Pharmacological Sciences, 38(9): 771-778, 2017.
[0219] Calabro et al., Vaccine, 31: 3363-3369, 2013. [0220] Carpino
et al., Org. Proc. Res. Dev., 7(1)28-37, 2003. [0221]
Didierlaurent, et al., J. Immunol., 183: 6186-6197, 2009. [0222]
Didierlaurent, et al., J. Immunol., 193, 1920-1930, 2013 [0223]
Dumler et al., Clin. Infect. Dis., 45:S45-S51, 2007. [0224] Feng
and Walker, Infect. Immun., 72:966-971, 2004. [0225] Fishbein et
al., Human ehrlichiosis in the United States, 1985 to 1990.
AnnInternMed 120:736-743, 1994. [0226] Garcon and Van Mechelen,
Expert Rev. Vaccines, 10, 471-486, 2011. [0227] Geysen et al.,
Proc. Natl. Acad. Sci. USA, 81(13):3998-4002, 1984. [0228] He et
al., Vaxign: the first web-based vaccine design program for reverse
vaccinology and applications for vaccine development. J Biomed
Biotechnol 2010:297505, 2010. [0229] Koczula et al., 2016. [0230]
Kunzi, et al., Vaccine, 27, 3561-3567, 2009. [0231] Kuriakose et
al., Ehrlichia chaffeensis transcriptome in mammalian and arthropod
hosts reveals differential gene expression and post transcriptional
regulation. PLoS One 6:e24136, 2011. [0232] Kuriakose et al.,
Molecular basis of antibody mediated immunity against Ehrlichia
chaffeensis involves species-specific linear epitopes in tandem
repeat proteins. Microbes Infect 14:1054-1063, 2012. [0233] Li and
Winslow, Survival, replication, and antibody susceptibility of
Ehrlichia chaffeensis outside of host cells. InfectImmun
71:4229-4237, 2003. [0234] Li et al., Antibodies highly effective
in SCID mice during infection by the intracellular bacterium
Ehrlichia chaffeensis are of picomolar affinity and exhibit
preferential epitope and isotype utilization. J Immunol
169:1419-1425, 2002. [0235] Li et al., Outer membrane
protein-specific monoclonal antibodies protect SCID mice from fatal
infection by the obligate intracellular bacterial pathogen
Ehrlichia chaffeensis. J Immunol 166:1855-1862, 2001. [0236] Lin et
al., Global proteomic analysis of two tick-borne emerging zoonotic
agents: Anaplasma phagocytophilum and Ehrlichia chaffeensis. Front
Microbiol 2:24, 2011. [0237] Magnan et al., High-throughput
prediction of protein antigenicity using protein microarray data.
Bioinformatics 26:2936-2943, 2010. [0238] McBride and Walker,
Progress and obstacles in vaccine development for the ehrlichioses.
Expert Rev Vaccines 9:1071-1082, 2010. [0239] Mizuno et al.,
Chemistry. 23(58):14394-14409, Oct. 17 2017. [0240] Morel, S. et
al., Vaccine, 29, 2461-2473, 2011. [0241] Nandi et al., CD4 T-cell
epitopes associated with protective immunity induced following
vaccination of mice with an ehrlichial variable outer membrane
protein. InfectImmun 75:5453-5459, 2007. [0242] Olano et al., Human
monocytotropic ehrlichiosis, Missouri. EmergInfectDis 9:1579-1586,
2003. [0243] Paparone et al., Ehrlichiosis with pancytopenia and
ARDS. New Jersey Med 92:381-385, 1995. [0244] Paterson et al., Anal
Chem. 86(19):9481-8, October 7; 2014. [0245] Pierce
Immunotechnology Catalog and Handbook, at A12-A13, 1991 [0246]
Racine et al., IgM production by bone marrow plasmablasts
contributes to long-term protection against intracellular bacterial
infection. J Immunol 186:1011-1021, 2011. [0247] Remington's
Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1289-1329,
1990. [0248] Sotomay et al., Animal model of fatal human
monocytotropic ehrlichiosis. AmJPath 158:757-769, 2001. [0249]
Stuen et al., Acta Vet Scand., 57:40, 2015. [0250] Tandrup Schmidt,
et al., Pharmaceutics, 8, 7, 2016. [0251] The Science and Practice
of Pharmacy, 21.sup.st Ed. Lippincott Williams and Wilkins, 2005.
[0252] Tollersrud et al., Vaccine, 19:3896-3903, 2001. [0253] Vega
et al., Vaccine, 25:519-525, 2007. [0254] Walker and Dumler, Human
monocytic and granulocytic ehrlichioses. Discovery and diagnosis of
emerging tick-borne infections and the critical role of the
pathologist. [Review] [50 refs]. Archives of Pathology &
Laboratory Medicine 121:785-791, 1997. [0255] Walker et al.,
Ehrlichia chaffeensis: a prevalent, life-threatening, emerging
pathogen. Trans Am Clin Climatol Assoc 115:375-382; discussion
382-374, 2004. [0256] Wang et al., 2017. [0257] Winslow et al.,
Ann. NY Acad. Sci., 990:435-443, 2003. [0258] Winslow et al.,
Infect. Immun., 68:2187-2195, 2000. [0259] Winslow et al.,
Infection of the laboratory mouse with the intracellular pathogen
Ehrlichia chaffeensis. InfectImmun 66:3892-3899, 1998. [0260] Yager
et al., Infect. Immun., 73:8009-8016, 2005. [0261] Zemella et al.,
Cell-Free Protein Synthesis: Pros and Cons of Prokaryotic and
Eukaryotic Systems. Chembiochem.; 16(17):2420-2431, 2015.
Sequence CWU 1
1
47124PRTEhrlichia canis 1His Phe Thr Gly Pro Thr Ser Phe Glu Val
Asn Leu Ser Glu Glu Glu1 5 10 15Lys Met Glu Leu Gln Glu Val Ser
20221PRTEhrlichia canis 2Ala Lys Glu Glu Lys Asn Ala Thr Ala Lys
Thr Phe Gln Leu Lys Gly1 5 10 15Asp Trp Asp Gly Ala
20330PRTEhrlichia chaffeensis 3Ser Asp Leu His Glu Ser Ser Phe Val
Glu Leu Pro Gly Pro Ser Lys1 5 10 15Glu Glu Val Gln Phe Glu Asp Asp
Ala Lys Asn Val Val Tyr 20 25 30430PRTEhrlichia chaffeensis 4Ser
Asp Leu His Gly Ser Phe Ser Val Glu Leu Phe Asp Pro Ser Lys1 5 10
15Glu Glu Val Gln Leu Glu Ser Asp Leu Gln Gln Ser Ser Asn 20 25
30530PRTEhrlichia chaffeensis 5Ser Asp Leu His Gly Ser Phe Ser Val
Glu Leu Phe Asp Pro Phe Lys1 5 10 15Glu Ala Val Gln Leu Gly Asn Asp
Leu Gln Gln Ser Ser Asp 20 25 30630PRTEhrlichia chaffeensis 6Ser
Asp Ser His Glu Pro Ser His Leu Glu Leu Pro Ser Leu Ser Glu1 5 10
15Glu Val Ile Gln Leu Glu Ser Asp Leu Gln Gln Ser Ser Asn 20 25
30726PRTEhrlichia chaffeensis 7Val Arg Ser Ile Thr Asp Pro Arg Ile
Val Val Gln Gln Glu Ala Asp1 5 10 15Gln Gln Gln Glu Val Gln Gln Gln
Ala Asp 20 2589PRTEhrlichia canis 8Thr Glu Asp Ser Val Ser Ala Pro
Ala1 598PRTEhrlichia canis 9Ala Ser Val Val Pro Glu Ala Glu1
5109PRTEhrlichia canis 10Thr Glu Asp Pro Val Ser Ala Thr Ala1
51126PRTArtificial sequenceSynthetic peptide 11Thr Glu Asp Ser Val
Ser Ala Pro Ala Ala Ser Val Val Pro Glu Ala1 5 10 15Glu Thr Glu Asp
Pro Val Ser Ala Thr Ala 20 251226PRTArtificial sequenceSynthetic
peptide 12Thr Glu Asp Ser Val Ser Ala Pro Ala Thr Glu Asp Pro Val
Ser Ala1 5 10 15Thr Ala Ala Ser Val Val Pro Glu Ala Glu 20
251326PRTArtificial sequenceSynthetic peptide 13Ala Ser Val Val Pro
Glu Ala Glu Thr Glu Asp Ser Val Ser Ala Pro1 5 10 15Ala Thr Glu Asp
Pro Val Ser Ala Thr Ala 20 251426PRTArtificial sequenceSynthetic
peptide 14Ala Ser Val Val Pro Glu Ala Glu Thr Glu Asp Pro Val Ser
Ala Thr1 5 10 15Ala Thr Glu Asp Ser Val Ser Ala Pro Ala 20
251526PRTArtificial sequenceSynthetic peptide 15Thr Glu Asp Pro Val
Ser Ala Thr Ala Thr Glu Asp Ser Val Ser Ala1 5 10 15Pro Ala Ala Ser
Val Val Pro Glu Ala Glu 20 251626PRTArtificial sequenceSynthetic
peptide 16Thr Glu Asp Pro Val Ser Ala Thr Ala Ala Ser Val Val Pro
Glu Ala1 5 10 15Glu Thr Glu Asp Ser Val Ser Ala Pro Ala 20
251719PRTEhrlichia chaffeensis 17Ala Ser Val Ser Glu Gly Asp Ala
Val Val Asn Ala Val Ser Gln Glu1 5 10 15Thr Pro Ala1820PRTEhrlichia
chaffeensis 18Ser Leu Phe Thr Glu Glu Glu Lys Ile Leu Ala Ile Leu
Ser Ala Arg1 5 10 15Phe Ile Cys Lys 201918PRTEhrlichia chaffeensis
19Asp Val Lys Asp Asn Lys Pro Ser Asp Val Lys Leu Pro Val Ile Lys1
5 10 15Ala Glu2024PRTEhrlichia canis 20Asp Asp Ser Lys Leu Pro Val
Ile Lys Val Glu Asp Lys Ser Lys Leu1 5 10 15Gln Asp Thr Lys Asp Lys
Lys Arg 202119PRTEhrlichia canis 21Lys Lys Ile Lys Glu Tyr Asp Glu
Asp Tyr Thr Ile Thr Tyr Tyr Tyr1 5 10 15Asp Asp Asp2222PRTEhrlichia
chaffeensis 22Ser Lys Val Glu Gln Glu Glu Thr Asn Pro Glu Val Leu
Ile Lys Asp1 5 10 15Leu Gln Asp Val Ala Ser 202325PRTEhrlichia
canis 23Glu His Ser Ser Ser Glu Val Gly Glu Lys Val Ser Glu Thr Ser
Lys1 5 10 15Glu Glu Asn Thr Pro Glu Val Lys Ala 20
252421PRTEhrlichia chaffeensis 24Tyr Gly Ala Pro Glu Ile Thr Lys
Asp Gly Tyr Lys Val Ile Lys Ser1 5 10 15Ile Lys Pro Glu Asp
2025264PRTEhrlichia chaffeensis 25Ser Asp Leu His Glu Ser Ser Phe
Val Glu Leu Pro Gly Pro Ser Lys1 5 10 15Glu Glu Val Gln Phe Glu Asp
Asp Ala Lys Asn Val Val Tyr Ser Asp 20 25 30Leu His Gly Ser Phe Ser
Val Glu Leu Phe Asp Pro Ser Lys Glu Glu 35 40 45Val Gln Leu Glu Ser
Asp Leu Gln Gln Ser Ser Asn Ser Asp Leu His 50 55 60Gly Ser Phe Ser
Val Glu Leu Phe Asp Pro Phe Lys Glu Ala Val Gln65 70 75 80Leu Gly
Asn Asp Leu Gln Gln Ser Ser Asp Ser Asp Ser His Glu Pro 85 90 95Ser
His Leu Glu Leu Pro Ser Leu Ser Glu Glu Val Ile Gln Leu Glu 100 105
110Ser Asp Leu Gln Gln Ser Ser Asn Ser Lys Val Glu Gln Glu Glu Thr
115 120 125Asn Pro Glu Val Leu Ile Lys Asp Leu Gln Asp Val Ala Ser
Lys Val 130 135 140Glu Gln Glu Glu Thr Asn Pro Glu Val Leu Ile Lys
Asp Leu Gln Asp145 150 155 160Val Ala Ser Lys Val Glu Gln Glu Glu
Thr Asn Pro Glu Val Leu Ile 165 170 175Lys Asp Leu Gln Asp Val Ala
Ser Val Arg Ser Ile Thr Asp Pro Arg 180 185 190Ile Val Val Gln Gln
Glu Ala Asp Gln Gln Gln Glu Val Gln Gln Gln 195 200 205Ala Asp Ser
Val Arg Ser Ile Thr Asp Pro Arg Ile Val Val Gln Gln 210 215 220Glu
Ala Asp Gln Gln Gln Glu Val Gln Gln Gln Ala Asp Ser Val Arg225 230
235 240Ser Ile Thr Asp Pro Arg Ile Val Val Gln Gln Glu Ala Asp Gln
Gln 245 250 255Gln Glu Val Gln Gln Gln Ala Asp 26026201PRTEhrlichia
canis 26His Phe Thr Gly Pro Thr Ser Phe Glu Val Asn Leu Ser Glu Glu
Glu1 5 10 15Lys Met Glu Leu Gln Glu Val Ser Thr Glu Asp Ser Val Ser
Ala Pro 20 25 30Ala Thr Glu Asp Ser Val Ser Ala Pro Ala Glu His Ser
Ser Ser Glu 35 40 45Val Gly Glu Lys Val Ser Glu Thr Ser Lys Glu Glu
Asn Thr Pro Glu 50 55 60Val Lys Ala His Phe Thr Gly Pro Thr Ser Phe
Glu Val Asn Leu Ser65 70 75 80Glu Glu Glu Lys Met Glu Leu Gln Glu
Val Ser Thr Glu Asp Ser Val 85 90 95Ser Ala Pro Ala Thr Glu Asp Ser
Val Ser Ala Pro Ala Glu His Ser 100 105 110Ser Ser Glu Val Gly Glu
Lys Val Ser Glu Thr Ser Lys Glu Glu Asn 115 120 125Thr Pro Glu Val
Lys Ala His Phe Thr Gly Pro Thr Ser Phe Glu Val 130 135 140Asn Leu
Ser Glu Glu Glu Lys Met Glu Leu Gln Glu Val Ser Thr Glu145 150 155
160Asp Ser Val Ser Ala Pro Ala Thr Glu Asp Ser Val Ser Ala Pro Ala
165 170 175Glu His Ser Ser Ser Glu Val Gly Glu Lys Val Ser Glu Thr
Ser Lys 180 185 190Glu Glu Asn Thr Pro Glu Val Lys Ala 195
20027172PRTEhrlichia canis 27Thr Glu Asp Ser Val Ser Ala Pro Ala
Thr Glu Asp Ser Val Ser Ala1 5 10 15Pro Ala Thr Glu Asp Ser Val Ser
Ala Pro Ala Thr Glu Asp Ser Val 20 25 30Ser Ala Pro Ala Thr Glu Asp
Ser Val Ser Ala Pro Ala Thr Glu Asp 35 40 45Ser Val Ser Ala Pro Ala
Thr Glu Asp Ser Val Ser Ala Pro Ala Thr 50 55 60Glu Asp Ser Val Ser
Ala Pro Ala Glu His Ser Ser Ser Glu Val Gly65 70 75 80Glu Lys Val
Ser Glu Thr Ser Lys Glu Glu Asn Thr Pro Glu Val Lys 85 90 95Ala Glu
His Ser Ser Ser Glu Val Gly Glu Lys Val Ser Glu Thr Ser 100 105
110Lys Glu Glu Asn Thr Pro Glu Val Lys Ala Glu His Ser Ser Ser Glu
115 120 125Val Gly Glu Lys Val Ser Glu Thr Ser Lys Glu Glu Asn Thr
Pro Glu 130 135 140Val Lys Ala Glu His Ser Ser Ser Glu Val Gly Glu
Lys Val Ser Glu145 150 155 160Thr Ser Lys Glu Glu Asn Thr Pro Glu
Val Lys Ala 165 17028274PRTArtificial sequenceSynthetic peptide
28Ser Asp Leu His Gly Ser Phe Ser Val Glu Leu Phe Asp Pro Phe Lys1
5 10 15Glu Ala Val Gln Leu Gly Asn Asp Leu Gln Gln Ser Ser Asp Ser
Asp 20 25 30Leu His Gly Ser Phe Ser Val Glu Leu Phe Asp Pro Phe Lys
Glu Ala 35 40 45Val Gln Leu Gly Asn Asp Leu Gln Gln Ser Ser Asp Ser
Lys Val Glu 50 55 60Gln Glu Glu Thr Asn Pro Glu Val Leu Ile Lys Asp
Leu Gln Asp Val65 70 75 80Ala Ser Ser Lys Val Glu Gln Glu Glu Thr
Asn Pro Glu Val Leu Ile 85 90 95Lys Asp Leu Gln Asp Val Ala Ser Thr
Glu Asp Ser Val Ser Ala Pro 100 105 110Ala Thr Glu Asp Ser Val Ser
Ala Pro Ala Thr Glu Asp Ser Val Ser 115 120 125Ala Pro Ala Thr Glu
Asp Ser Val Ser Ala Pro Ala Glu His Ser Ser 130 135 140Ser Glu Val
Gly Glu Lys Val Ser Glu Thr Ser Lys Glu Glu Asn Thr145 150 155
160Pro Glu Val Lys Ala Glu His Ser Ser Ser Glu Val Gly Glu Lys Val
165 170 175Ser Glu Thr Ser Lys Glu Glu Asn Thr Pro Glu Val Lys Ala
Ala Lys 180 185 190Glu Glu Lys Asn Ala Thr Ala Lys Thr Phe Gln Leu
Lys Gly Asp Trp 195 200 205Asp Gly Ala Ala Lys Glu Glu Lys Asn Ala
Thr Ala Lys Thr Phe Gln 210 215 220Leu Lys Gly Asp Trp Asp Gly Ala
Tyr Gly Ala Pro Glu Ile Thr Lys225 230 235 240Asp Gly Tyr Lys Val
Ile Lys Ser Ile Lys Pro Glu Asp Tyr Gly Ala 245 250 255Pro Glu Ile
Thr Lys Asp Gly Tyr Lys Val Ile Lys Ser Ile Lys Pro 260 265 270Glu
Asp29258PRTArtificial sequenceSynthetic peptide 29Ser Lys Val Glu
Gln Glu Glu Thr Asn Pro Glu Val Leu Ile Lys Asp1 5 10 15Leu Gln Asp
Val Ala Ser Ser Lys Val Glu Gln Glu Glu Thr Asn Pro 20 25 30Glu Val
Leu Ile Lys Asp Leu Gln Asp Val Ala Ser Ser Lys Val Glu 35 40 45Gln
Glu Glu Thr Asn Pro Glu Val Leu Ile Lys Asp Leu Gln Asp Val 50 55
60Ala Ser Glu His Ser Ser Ser Glu Val Gly Glu Lys Val Ser Glu Thr65
70 75 80Ser Lys Glu Glu Asn Thr Pro Glu Val Lys Ala Glu His Ser Ser
Ser 85 90 95Glu Val Gly Glu Lys Val Ser Glu Thr Ser Lys Glu Glu Asn
Thr Pro 100 105 110Glu Val Lys Ala Glu His Ser Ser Ser Glu Val Gly
Glu Lys Val Ser 115 120 125Glu Thr Ser Lys Glu Glu Asn Thr Pro Glu
Val Lys Ala Thr Glu Asp 130 135 140Ser Val Ser Ala Pro Ala Thr Glu
Asp Ser Val Ser Ala Pro Ala Thr145 150 155 160Glu Asp Ser Val Ser
Ala Pro Ala Thr Glu Asp Ser Val Ser Ala Pro 165 170 175Ala Thr Glu
Asp Ser Val Ser Ala Pro Ala Thr Glu Asp Ser Val Ser 180 185 190Ala
Pro Ala Ala Lys Glu Glu Lys Asn Ala Thr Ala Lys Thr Phe Gln 195 200
205Leu Lys Gly Asp Trp Asp Gly Ala Ala Lys Glu Glu Lys Asn Ala Thr
210 215 220Ala Lys Thr Phe Gln Leu Lys Gly Asp Trp Asp Gly Ala Ala
Lys Glu225 230 235 240Glu Lys Asn Ala Thr Ala Lys Thr Phe Gln Leu
Lys Gly Asp Trp Asp 245 250 255Gly Ala30183PRTEhrlichia chaffeensis
30Ser Lys Val Glu Gln Glu Glu Thr Asn Pro Glu Val Leu Ile Lys Asp1
5 10 15Leu Gln Asp Val Ala Ser Ser Lys Val Glu Gln Glu Glu Thr Asn
Pro 20 25 30Glu Val Leu Ile Lys Asp Leu Gln Asp Val Ala Ser Gly Gly
Gly Val 35 40 45Arg Ser Ile Thr Asp Pro Arg Ile Val Val Gln Gln Glu
Ala Asp Gln 50 55 60Gln Gln Glu Val Gln Gln Gln Ala Asp Val Arg Ser
Ile Thr Asp Pro65 70 75 80Arg Ile Val Val Gln Gln Glu Ala Asp Gln
Gln Gln Glu Val Gln Gln 85 90 95Gln Ala Asp Gly Gly Gly Ser Leu Phe
Thr Glu Glu Glu Lys Ile Leu 100 105 110Ala Ile Leu Ser Ala Arg Phe
Ile Cys Lys Ser Leu Phe Thr Glu Glu 115 120 125Glu Lys Ile Leu Ala
Ile Leu Ser Ala Arg Phe Ile Cys Lys Gly Gly 130 135 140Gly Ala Ser
Val Ser Glu Gly Asp Ala Val Val Asn Ala Val Ser Gln145 150 155
160Glu Thr Pro Ala Ala Ser Val Ser Glu Gly Asp Ala Val Val Asn Ala
165 170 175Val Ser Gln Glu Thr Pro Ala 18031142PRTEhrlichia
chaffeensis 31Ser Lys Val Glu Gln Glu Glu Thr Asn Pro Glu Val Leu
Ile Lys Asp1 5 10 15Leu Gln Asp Val Ala Ser Ser Lys Val Glu Gln Glu
Glu Thr Asn Pro 20 25 30Glu Val Leu Ile Lys Asp Leu Gln Asp Val Ala
Ser Gly Gly Gly Val 35 40 45Arg Ser Ile Thr Asp Pro Arg Ile Val Val
Gln Gln Glu Ala Asp Gln 50 55 60Gln Gln Glu Val Gln Gln Gln Ala Asp
Val Arg Ser Ile Thr Asp Pro65 70 75 80Arg Ile Val Val Gln Gln Glu
Ala Asp Gln Gln Gln Glu Val Gln Gln 85 90 95Gln Ala Asp Gly Gly Gly
Ser Leu Phe Thr Glu Glu Glu Lys Ile Leu 100 105 110Ala Ile Leu Ser
Ala Arg Phe Ile Cys Lys Ser Leu Phe Thr Glu Glu 115 120 125Glu Lys
Ile Leu Ala Ile Leu Ser Ala Arg Phe Ile Cys Lys 130 135
14032140PRTEhrlichia chaffeensis 32Ser Lys Val Glu Gln Glu Glu Thr
Asn Pro Glu Val Leu Ile Lys Asp1 5 10 15Leu Gln Asp Val Ala Ser Ser
Lys Val Glu Gln Glu Glu Thr Asn Pro 20 25 30Glu Val Leu Ile Lys Asp
Leu Gln Asp Val Ala Ser Gly Gly Gly Val 35 40 45Arg Ser Ile Thr Asp
Pro Arg Ile Val Val Gln Gln Glu Ala Asp Gln 50 55 60Gln Gln Glu Val
Gln Gln Gln Ala Asp Val Arg Ser Ile Thr Asp Pro65 70 75 80Arg Ile
Val Val Gln Gln Glu Ala Asp Gln Gln Gln Glu Val Gln Gln 85 90 95Gln
Ala Asp Gly Gly Gly Ala Ser Val Ser Glu Gly Asp Ala Val Val 100 105
110Asn Ala Val Ser Gln Glu Thr Pro Ala Ala Ser Val Ser Glu Gly Asp
115 120 125Ala Val Val Asn Ala Val Ser Gln Glu Thr Pro Ala 130 135
14033136PRTEhrlichia chaffeensis 33Val Arg Ser Ile Thr Asp Pro Arg
Ile Val Val Gln Gln Glu Ala Asp1 5 10 15Gln Gln Gln Glu Val Gln Gln
Gln Ala Asp Val Arg Ser Ile Thr Asp 20 25 30Pro Arg Ile Val Val Gln
Gln Glu Ala Asp Gln Gln Gln Glu Val Gln 35 40 45Gln Gln Ala Asp Gly
Gly Gly Ser Leu Phe Thr Glu Glu Glu Lys Ile 50 55 60Leu Ala Ile Leu
Ser Ala Arg Phe Ile Cys Lys Ser Leu Phe Thr Glu65 70 75 80Glu Glu
Lys Ile Leu Ala Ile Leu Ser Ala Arg Phe Ile Cys Lys Gly 85 90 95Gly
Gly Ala Ser Val Ser Glu Gly Asp Ala Val Val Asn Ala Val Ser 100 105
110Gln Glu Thr Pro Ala Ala Ser Val Ser Glu Gly Asp Ala Val Val Asn
115 120 125Ala Val Ser Gln Glu Thr Pro Ala 130 13534134PRTEhrlichia
chaffeensis 34Val Arg Ser Ile Thr Asp Pro Arg Ile Val Val Gln Gln
Glu Ala Asp1 5 10
15Gln Gln Gln Glu Val Gln Gln Gln Ala Asp Val Arg Ser Ile Thr Asp
20 25 30Pro Arg Ile Val Val Gln Gln Glu Ala Asp Gln Gln Gln Glu Val
Gln 35 40 45Gln Gln Ala Asp Gly Gly Gly Ser Leu Phe Thr Glu Glu Glu
Lys Ile 50 55 60Leu Ala Ile Leu Ser Ala Arg Phe Ile Cys Lys Ser Leu
Phe Thr Glu65 70 75 80Glu Glu Lys Ile Leu Ala Ile Leu Ser Ala Arg
Phe Ile Cys Lys Gly 85 90 95Gly Gly Asp Val Lys Asp Asn Lys Pro Ser
Asp Val Lys Leu Pro Val 100 105 110Ile Lys Ala Glu Asp Val Lys Asp
Asn Lys Pro Ser Asp Val Lys Leu 115 120 125Pro Val Ile Lys Ala Glu
13035163PRTEhrlichia canis 35Thr Glu Asp Ser Val Ser Ala Pro Ala
Thr Glu Asp Ser Val Ser Ala1 5 10 15Pro Ala Gly Gly Gly Glu His Ser
Ser Ser Glu Val Gly Glu Lys Val 20 25 30Ser Glu Thr Ser Lys Glu Glu
Asn Thr Pro Glu Val Lys Ala Glu His 35 40 45Ser Ser Ser Glu Val Gly
Glu Lys Val Ser Glu Thr Ser Lys Glu Glu 50 55 60Asn Thr Pro Glu Val
Lys Ala Gly Gly Gly Asp Asp Ser Lys Leu Pro65 70 75 80Val Ile Lys
Val Glu Asp Lys Ser Lys Leu Gln Asp Thr Lys Asp Lys 85 90 95Lys Arg
Asp Asp Ser Lys Leu Pro Val Ile Lys Val Glu Asp Lys Ser 100 105
110Lys Leu Gln Asp Thr Lys Asp Lys Lys Arg Gly Gly Gly Lys Lys Ile
115 120 125Lys Glu Tyr Asp Glu Asp Tyr Thr Ile Thr Tyr Tyr Tyr Asp
Asp Asp 130 135 140Lys Lys Ile Lys Glu Tyr Asp Glu Asp Tyr Thr Ile
Thr Tyr Tyr Tyr145 150 155 160Asp Asp Asp3628PRTEhrlichia canis
36Glu Ala Ser Val Val Pro Ala Ala Glu Ala Pro Gln Pro Ala Gln Gln1
5 10 15Thr Glu Asp Glu Phe Phe Ser Asp Gly Ile Glu Ala 20
253737PRTArtificial sequenceSynthetic peptide 37Glu Ala Ser Val Val
Pro Ala Ala Glu Ala Pro Gln Pro Ala Gln Gln1 5 10 15Thr Glu Asp Glu
Phe Phe Ser Asp Gly Ile Glu Ala Thr Glu Asp Ser 20 25 30Val Ser Ala
Pro Ala 353837PRTArtificial sequenceSynthetic peptide 38Thr Glu Asp
Ser Val Ser Ala Pro Ala Glu Ala Ser Val Val Pro Ala1 5 10 15Ala Glu
Ala Pro Gln Pro Ala Gln Gln Thr Glu Asp Glu Phe Phe Ser 20 25 30Asp
Gly Ile Glu Ala 353937PRTArtificial sequenceSynthetic peptide 39Glu
Ala Ser Val Val Pro Ala Ala Glu Ala Pro Gln Pro Ala Gln Gln1 5 10
15Thr Glu Asp Glu Phe Phe Ser Asp Gly Ile Glu Ala Thr Glu Asp Pro
20 25 30Val Ser Ala Thr Ala 354037PRTArtificial sequenceSynthetic
peptide 40Thr Glu Asp Pro Val Ser Ala Thr Ala Glu Ala Ser Val Val
Pro Ala1 5 10 15Ala Glu Ala Pro Gln Pro Ala Gln Gln Thr Glu Asp Glu
Phe Phe Ser 20 25 30Asp Gly Ile Glu Ala 354118PRTArtificial
sequenceSynthetic peptide 41Thr Glu Asp Ser Val Ser Ala Pro Ala Thr
Glu Asp Pro Val Ser Ala1 5 10 15Thr Ala4218PRTArtificial
sequenceSynthetic peptide 42Thr Glu Asp Pro Val Ser Ala Thr Ala Thr
Glu Asp Ser Val Ser Ala1 5 10 15Pro Ala4396PRTEhrlichia canis 43Thr
Glu Asp Ser Val Ser Ala Pro Ala Thr Glu Asp Ser Val Ser Ala1 5 10
15Pro Ala Gly Gly Gly Ala Ser Val Val Pro Glu Ala Glu Ala Ser Val
20 25 30Val Pro Glu Ala Glu Gly Gly Gly Glu Ala Ser Val Val Pro Ala
Ala 35 40 45Glu Ala Pro Gln Pro Ala Gln Gln Thr Glu Asp Glu Phe Phe
Ser Asp 50 55 60Gly Ile Glu Ala Glu Ala Ser Val Val Pro Ala Ala Glu
Ala Pro Gln65 70 75 80Pro Ala Gln Gln Thr Glu Asp Glu Phe Phe Ser
Asp Gly Ile Glu Ala 85 90 954439PRTEhrlichia canis 44Thr Glu Asp
Ser Val Ser Ala Pro Ala Thr Glu Asp Ser Val Ser Ala1 5 10 15Pro Ala
Gly Gly Gly Thr Glu Asp Ser Pro Ser Ala Thr Ala Thr Glu 20 25 30Asp
Ser Pro Ser Ala Thr Ala 354518PRTArtificial SequenceSynthetic
linker 45Gly Ser Thr Ser Gly Ser Gly Lys Pro Gly Ser Gly Glu Gly
Ser Thr1 5 10 15Lys Gly465PRTArtificial SequenceSynthetic linker
46Glu Ala Ala Ala Lys1 5475PRTArtificial SequenceSynthetic linker
47Gly Gly Gly Gly Ser1 5
* * * * *