U.S. patent application number 16/450852 was filed with the patent office on 2019-12-19 for novel crispr enzymes and systems.
The applicant listed for this patent is The Broad Institute, Inc., Massachusetts Institute of Technology, President and Fellows of Harvard College, Rutgers, The State University of New Jersey, Skolkovo Institute of Science and Technology, The United States of America, as Represented by the Secretary, Dept. of Health and Human Services. Invention is credited to Omar O. Abudayyeh, Jonathan S. Gootenberg, Julia Joung, Silvana Konermann, Eugene Koonin, Eric S. Lander, Kira S. Makarova, Leonid Minakhin, Ekaterina Semenova, Konstantin Severinov, Sergey Shmakov, Yuri I. Wolf, Feng Zhang.
Application Number | 20190382801 16/450852 |
Document ID | / |
Family ID | 56550310 |
Filed Date | 2019-12-19 |
View All Diagrams
United States Patent
Application |
20190382801 |
Kind Code |
A1 |
Severinov; Konstantin ; et
al. |
December 19, 2019 |
NOVEL CRISPR ENZYMES AND SYSTEMS
Abstract
The invention provides for systems, methods, and compositions
for targeting nucleic acids. In particular, the invention provides
non-naturally occurring or engineered RNA-targeting systems
comprising a novel RNA-targeting CRISPR effector protein and at
least one targeting nucleic acid component like a guide RNA.
Inventors: |
Severinov; Konstantin; (New
Brunswick, NJ) ; Zhang; Feng; (Cambridge, MA)
; Wolf; Yuri I.; (Bethesda, MD) ; Shmakov;
Sergey; (Moscow, RU) ; Semenova; Ekaterina;
(New Brunswick, NJ) ; Minakhin; Leonid; (New
Brunswick, NJ) ; Makarova; Kira S.; (Bethesda,
MD) ; Koonin; Eugene; (Bethesda, MD) ;
Konermann; Silvana; (Cambridge, MA) ; Joung;
Julia; (Cambridge, MA) ; Gootenberg; Jonathan S.;
(Cambridge, MA) ; Abudayyeh; Omar O.; (Cambridge,
MA) ; Lander; Eric S.; (Cambridge, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Broad Institute, Inc.
Massachusetts Institute of Technology
President and Fellows of Harvard College
Rutgers, The State University of New Jersey
Skolkovo Institute of Science and Technology
The United States of America, as Represented by the Secretary,
Dept. of Health and Human Services |
Cambridge
Cambridge
Cambridge
New Brunswick
Moscow
Bethesda |
MA
MA
MA
NJ
MD |
US
US
US
US
RU
US |
|
|
Family ID: |
56550310 |
Appl. No.: |
16/450852 |
Filed: |
June 24, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15482603 |
Apr 7, 2017 |
|
|
|
16450852 |
|
|
|
|
PCT/US2016/038258 |
Jun 17, 2016 |
|
|
|
15482603 |
|
|
|
|
62320231 |
Apr 8, 2016 |
|
|
|
62296522 |
Feb 17, 2016 |
|
|
|
62285349 |
Oct 22, 2015 |
|
|
|
62181675 |
Jun 18, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12N 2800/22 20130101;
C12N 2310/111 20130101; C12N 15/907 20130101; C12N 9/22 20130101;
C12N 15/85 20130101; C12N 15/113 20130101; C12N 2310/20 20170501;
C12N 15/102 20130101; C12N 15/63 20130101; C12N 15/8201 20130101;
C12N 15/111 20130101 |
International
Class: |
C12N 15/90 20060101
C12N015/90; C12N 15/10 20060101 C12N015/10; C12N 9/22 20060101
C12N009/22; C12N 15/11 20060101 C12N015/11; C12N 15/82 20060101
C12N015/82; C12N 15/85 20060101 C12N015/85; C12N 15/113 20060101
C12N015/113 |
Goverment Interests
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
[0003] This invention was made with government support under grant
numbers MH100706, MH110049, DK097768 and GM010407 awarded by the
National Institutes of Health. The government has certain rights in
the invention.
Claims
1. An in vitro method for targeting a target RNA in a sample
comprising target RNA and non-target RNA, comprising contacting
said target RNA with a CRISPR-Cas protein and a guide RNA, wherein
the effector protein forms a complex with the guide RNA, and
wherein the guide RNA directs the complex to bind the target
RNA.
2. The method of claim 1, wherein the CRISPR-Cas protein is a type
VI effector protein.
3. The method of claim 1, wherein the CRISPR-Cas protein comprises
at least one HEPN domain.
4. The method of claim 1, wherein the CRISPR-Cas protein comprises
two HEPN domains.
5. The method of claim 1, wherein the CRISPR-Cas protein is a C2c2
protein.
6. The method of claim 5, wherein the C2c2 protein is from a
bacteria belonging to a genus selected from the group consisting
of: Corynebacter, Sutterella, Legionella, Treponema, Filifactor,
Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides,
Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum,
Gluconacetobacter, Neisseria, Roseburia, Parvibaculum,
Staphylococcus, Nitratifactor, Mycoplasma, Camplyobacter,
Leptotrichia, Rhodobacter, Lachnospiraceae, Carnobacterium, and
Paludibacter.
7. The method of claim 5, wherein the C2c2 protein is an orthologue
comprising 80% sequence identity to an orthologue selected from the
group consisting of Leptotrichia shahii DSM 19757 C2c2: Rhodobacter
capsulatus SB 1003 (RcS); Rhodobacter capsulatus R121 (RcR);
Rhodobacter capsulatus DE442 (RcD); Lachnospiraceae bacterium
MA2020 (Lb(X)); Lachnospiraceae bacterium NK4A179 (Lb(X);
[Clostridium] aminophilum DSM_10710 (CaC); Lachnospiraceae
bacterium NK4A144 (Lb(X); Leptotrichia wadei F0279 (Lew);
Leptotrichia wadei F0279 (Lew); Carnobacterium gallinarum DSM 4847
(Cg); Carnobacterium gallinarum DSM 4847 (Cg); Paludibacter
propionicigenes WB4 (Pp); Listeria seeligeri serovar 1/2b (Ls);
Listeria weihenstephanensis FSL R9-0317 (Liw); and Listeria
bacterium FSL M6-0635 (Lib).
8. The method of claim 5, wherein the C2c2 protein is an orthologue
selected from the group consisting of Leptotrichia shahii DSM 19757
C2c2: Rhodobacter capsulatus SB 1003 (RcS); Rhodobacter capsulatus
R121 (RcR); Rhodobacter capsulatus DE442 (RcD); Lachnospiraceae
bacterium MA2020 (Lb(X)); Lachnospiraceae bacterium NK4A179 (Lb(X);
[Clostridium] aminophilum DSM_10710 (CaC); Lachnospiraceae
bacterium NK4A144 (Lb(X); Leptotrichia wadei F0279 (Lew);
Leptotrichia wadei F0279 (Lew); Carnobacterium gallinarum DSM 4847
(Cg); Carnobacterium gallinarum DSM 4847 (Cg); Paludibacter
propionicigenes WB4 (Pp); Listeria seeligeri serovar 1/2b (Ls);
Listeria weihenstephanensis FSL R9-0317 (Liw); and Listeria
bacterium FSL M6-0635 (Lib).
9. The method of claim 1, wherein the CRISPR-Cas protein cleaves
the target RNA and non-target RNA as a result of collateral effects
of said CRISPR-Cas protein in said sample.
10. The method of claim 9, wherein said non-target RNA is labelled,
preferably fluorescently labelled.
11. The method of claim 10, wherein the method further comprises
detecting the cleavage of the labelled non-target RNA.
12. The method of claim 11, wherein the method further comprises
comparing the detection of the cleavage of the labelled non-target
RNA in the absence of the target RNA.
13. The method of claim 5, wherein the C2c2 effector protein is
LshC2c2.
14. The method of claim 5, wherein the guide RNA does not comprise
a tracr sequence.
15. The method of claim 1, wherein the target RNA is a disease
associated RNA.
16. A non-naturally occurring or engineered composition comprising
a CRISPR-Cas effector protein and a nucleic acid component, wherein
the protein forms a complex with the nucleic acid component, said
nucleic acid component capable of binding with a target nucleic
acid sequence and direct sequence-specific binding of said complex
to the target nucleic acid sequence; and a non-target sequence
comprising a detectable label.
17. The composition of claim 16, wherein the detectable label is a
fluorescent label.
18. The composition of claim 16, wherein the CRISPR-Cas protein
comprises at least one HEPN domain.
19. The composition of claim 16, wherein the CRISPR-Cas protein is
a Type VI CRISPR protein comprising two HEPN domains.
20. The composition of claim 16, wherein the CRISPR-Cas effector
protein is a C2c2 protein.
21. The composition of claim 20, wherein the C2c2 protein is from a
bacteria belonging to a genus selected from the group consisting
of: Corynebacter, Sutterella, Legionella, Treponema, Filifactor,
Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides,
Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum,
Gluconacetobacter, Neisseria, Roseburia, Parvibaculum,
Staphylococcus, Nitratifactor, Mycoplasma, Camplyobacter,
Leptotrichia, Rhodobacter, Lachnospiraceae, Carnobacterium, and
Paludibacter.
22. The composition of claim 20, wherein the C2c2 protein is an
orthologue comprising 80% sequence identity to an orthologue
selected from the group consisting of Leptotrichia shahii DSM 19757
C2c2: Rhodobacter capsulatus SB 1003 (RcS); Rhodobacter capsulatus
R121 (RcR); Rhodobacter capsulatus DE442 (RcD); Lachnospiraceae
bacterium MA2020 (Lb(X)); Lachnospiraceae bacterium NK4A179 (Lb(X);
[Clostridium] aminophilum DSM_10710 (CaC); Lachnospiraceae
bacterium NK4A144 (Lb(X); Leptotrichia wadei F0279 (Lew);
Leptotrichia wadei F0279 (Lew); Carnobacterium gallinarum DSM 4847
(Cg); Carnobacterium gallinarum DSM 4847 (Cg); Paludibacter
propionicigenes WB4 (Pp); Listeria seeligeri serovar 1/2b (Ls);
Listeria weihenstephanensis FSL R9-0317 (Liw); and Listeria
bacterium FSL M6-0635 (Lib).
23. The composition of claim 20, wherein the C2c2 protein is an
orthologue selected from the group consisting of Leptotrichia
shahii DSM 19757 C2c2: Rhodobacter capsulatus SB 1003 (RcS);
Rhodobacter capsulatus R121 (RcR); Rhodobacter capsulatus DE442
(RcD); Lachnospiraceae bacterium MA2020 (Lb(X)); Lachnospiraceae
bacterium NK4A179 (Lb(X); [Clostridium] aminophilum DSM_10710
(CaC); Lachnospiraceae bacterium NK4A144 (Lb(X); Leptotrichia wadei
F0279 (Lew); Leptotrichia wadei F0279 (Lew); Carnobacterium
gallinarum DSM 4847 (Cg); Carnobacterium gallinarum DSM 4847 (Cg);
Paludibacter propionicigenes WB4 (Pp); Listeria seeligeri serovar
1/2b (Ls); Listeria weihenstephanensis FSL R9-0317 (Liw); and
Listeria bacterium FSL M6-0635 (Lib).
Description
RELATED APPLICATIONS AND INCORPORATION BY REFERENCE
[0001] This application is a continuation application of U.S. Ser.
No. 15/482,603, filed Apr. 7, 2017, which is a continuation-in-part
of International Application PCT/US2016/038258 filed Jun. 17, 2016
and published as Publication No. WO2016/205764 on Dec. 22, 2016,
and claims the benefit of U.S. Provisional Patent Application Nos.
62/320,231, filed Apr. 8, 2016, 62/181,675, filed Jun. 18, 2015,
62/285,349, filed Oct. 22, 2015, 62/296,522, filed Feb. 17,
2016.
[0002] All documents cited or referenced in herein cited documents,
together with any manufacturer's instructions, descriptions,
product specifications, and product sheets for any products
mentioned herein or in any document incorporated by reference
herein, are hereby incorporated herein by reference, and may be
employed in the practice of the invention. More specifically, all
referenced documents are incorporated by reference to the same
extent as if each individual document was specifically and
individually indicated to be incorporated by reference.
SEQUENCE LISTING
[0004] The instant application contains a "lengthy" Sequence
Listing which has been submitted electronically in ASCII format and
is hereby incorporated by reference in its entirety. Said ASCII
copy, created on Jun. 24, 2019, is named Sequence.txt and is 1.2 MB
in size.
FIELD OF THE INVENTION
[0005] The present invention generally relates to systems, methods
and compositions used for the control of gene expression involving
sequence targeting, such as perturbation of gene transcripts or
nucleic acid editing, that may use vector systems related to
Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)
and components thereof.
BACKGROUND OF THE INVENTION
[0006] Recent advances in genome sequencing techniques and analysis
methods have significantly accelerated the ability to catalog and
map genetic factors associated with a diverse range of biological
functions and diseases. Precise genome targeting technologies are
needed to enable systematic reverse engineering of causal genetic
variations by allowing selective perturbation of individual genetic
elements, as well as to advance synthetic biology,
biotechnological, and medical applications. Although genome-editing
techniques such as designer zinc fingers, transcription
activator-like effectors (TALEs), or homing meganucleases are
available for producing targeted genome perturbations, there
remains a need for new genome and transcriptome engineering
technologies that employ novel strategies and molecular mechanisms
and are affordable, easy to set up, scalable, and amenable to
targeting multiple positions within the eukaryotic genome and
transcriptome. This would provide a major resource for new
applications in genome engineering and biotechnology.
[0007] The CRISPR-Cas systems of bacterial and archaeal adaptive
immunity show extreme diversity of protein composition and genomic
loci architecture. The CRISPR-Cas system loci has more than 50 gene
families and there is no strictly universal genes indicating fast
evolution and extreme diversity of loci architecture. So far,
adopting a multi-pronged approach, there is comprehensive cas gene
identification of about 395 profiles for 93 Cas proteins.
Classification includes signature gene profiles plus signatures of
locus architecture. A new classification of CRISPR-Cas systems is
proposed in which these systems are broadly divided into two
classes, Class 1 with multisubunit effector complexes and Class 2
with single-subunit effector modules exemplified by the Cas9
protein (FIGS. 1A and 1B). Novel effector proteins associated with
Class 2 CRISPR-Cas systems may be developed as powerful genome
engineering tools and the prediction of putative novel effector
proteins and their engineering and optimization is important.
[0008] Citation or identification of any document in this
application is not an admission that such document is available as
prior art to the present invention.
SUMMARY OF THE INVENTION
[0009] The CRISPR-Cas adaptive immune system defends microbes
against foreign genetic elements via DNA or RNA-DNA interference.
Here, we interrogate the Class 2 type VI single-component
CRISPR-Cas effector C2c2 and characterize it as an RNA-guided
RNase. We demonstrate that C2c2 (e.g. from Leptotrichia shahii)
provides robust interference against RNA phage infection. Through
in vitro biochemical analysis and in vivo assays, we show that C2c2
can be programmed to cleave ssRNA targets carrying protospacers
flanked by a 3' H (non-G) PAM. Cleavage is mediated by catalytic
residues in the two conserved HEPN domains of C2c2, mutations in
which generate a catalytically inactive RNA-binding protein. C2c2
is guided by a single crRNA and can be re-programmed to deplete
specific mRNAs in vivo. We show that LshC2c2 can be targeted to a
specific site of interest and can carry out non-specific RNase
activity once primed with the cognate target RNA. These results
broaden our understanding of CRISPR-Cas systems and demonstrate the
possibility of harnessing C2c2 to develop a broad set of
RNA-targeting tools.
[0010] There exists a pressing need for alternative and robust
systems and techniques for targeting nucleic acids or
polynucleotides (e.g. DNA or RNA or any hybrid or derivative
thereof) with a wide array of applications. This invention
addresses this need and provides related advantages. Adding the
novel DNA or RNA-targeting systems of the present application to
the repertoire of genomic and epigenomic targeting technologies may
transform the study and perturbation or editing of specific target
sites through direct detection, analysis and manipulation. To
utilize the DNA or RNA-targeting systems of the present application
effectively for genomic or epigenomic targeting without deleterious
effects, it is critical to understand aspects of engineering and
optimization of these DNA or RNA targeting tools.
[0011] The Class 2 type VI effector protein C2c2 is a RNA-guided
RNase that can be efficiently programmed to degrade ssRNA. C2c2
achieves RNA cleavage through conserved basic residues within its
two HEPN domains, in contrast to the catalytic mechanisms of other
known RNases found in CRISPR-Cas systems. Mutation of the HEPN
domain, such as (e.g. alanine) substitution, of any of the four
predicted HEPN domain catalytic residues converted C2c2 into an
inactive programmable RNA-binding protein (dC2c2, analogous to
dCas9).
[0012] The ability of dC2c2 to bind to specified sequences could be
used in several aspects according to the invention to (i) bring
effector modules to specific transcripts to modulate the function
or translation, which could be used for large-scale screening,
construction of synthetic regulatory circuits and other purposes;
(ii) fluorescently tag specific RNAs to visualize their trafficking
and/or localization; (iii) alter RNA localization through domains
with affinity for specific subcellular compartments; and (iv)
capture specific transcripts (through direct pull down of dC2c2 or
use of dC2c2 to localize biotin ligase activity to specific
transcripts) to enrich for proximal molecular partners, including
RNAs and proteins.
[0013] Active C2c2 should also have many applications. An aspect of
the invention involves targeting a specific transcript for
destruction, as with RFP here. In addition, C2c2, once primed by
the cognate target, can cleave other (non-complementary) RNA
molecules in vitro and can inhibit cell growth in vivo.
Biologically, this promiscuous RNase activity may reflect a
programmed cell death/dormancy (PCD/D)-based protection mechanism
of the type VI CRISPR-Cas systems. Accordingly, in an aspect of the
invention, it might be used to trigger PCD or dormancy in specific
cells--for example, cancer cells expressing a particular
transcript, neurons of a given class, cells infected by a specific
pathogen, or other aberrant cells or cells the presence of which is
otherwise undesirable.
[0014] The invention provides a method of modifying nucleic acid
sequences associated with or at a target locus of interest, the
method comprising delivering to said locus a non-naturally
occurring or engineered composition comprising a Type VI CRISPR-Cas
loci effector protein and one or more nucleic acid components,
wherein the effector protein forms a complex with the one or more
nucleic acid components and upon binding of the said complex to the
locus of interest the effector protein induces the modification of
the sequences associated with or at the target locus of interest.
In a preferred embodiment, the modification is the introduction of
a strand break. In a preferred embodiment, the sequences associated
with or at the target locus of interest comprises RNA or DNA and
the effector protein is encoded by a type VI CRISPR-Cas loci.
[0015] It will be appreciated that the terms Cas enzyme, CRISPR
enzyme, CRISPR protein, Cas protein and CRISPR Cas are generally
used interchangeably and at all points of reference herein refer by
analogy to novel CRISPR effector proteins further described in this
application, unless otherwise apparent, such as by specific
reference to Cas9. The CRISPR effector proteins described herein
are preferably C2c2 effector proteins.
[0016] The invention provides a method of modifying sequences
associated with or at a target locus of interest, the method
comprising delivering to said sequences associated with or at the
locus a non-naturally occurring or engineered composition
comprising a C2c2 loci effector protein and one or more nucleic
acid components, wherein the C2c2 effector protein forms a complex
with the one or more nucleic acid components and upon binding of
the said complex to the locus of interest the effector protein
induces the modification of sequences associated with or at the
target locus of interest. In a preferred embodiment, the
modification is the introduction of a strand break. In a preferred
embodiment the C2c2 effector protein forms a complex with one
nucleic acid component; advantageously an engineered or
non-naturally occurring nucleic acid component. The induction of
modification of sequences associated with or at the target locus of
interest can be C2c2 effector protein-nucleic acid guided. In a
preferred embodiment the one nucleic acid component is a CRISPR RNA
(crRNA). In a preferred embodiment the one nucleic acid component
is a mature crRNA or guide RNA, wherein the mature crRNA or guide
RNA comprises a spacer sequence (or guide sequence) and a direct
repeat sequence or derivatives thereof. In a preferred embodiment
the spacer sequence or the derivative thereof comprises a seed
sequence, wherein the seed sequence is critical for recognition
and/or hybridization to the sequence at the target locus. In a
preferred embodiment, the sequences associated with or at the
target locus of interest comprise linear or super coiled DNA.
[0017] Aspects of the invention relate to C2c2 effector protein
complexes having one or more non-naturally occurring or engineered
or modified or optimized nucleic acid components. In a preferred
embodiment the nucleic acid component of the complex may comprise a
guide sequence linked to a direct repeat sequence, wherein the
direct repeat sequence comprises one or more stem loops or
optimized secondary structures. In certain embodiments, the direct
repeat has a minimum length of 16 nts, such as at least 28 nt, and
a single stem loop. In further embodiments the direct repeat has a
length longer than 16 nts, preferably more than 17 nts, such as at
least 28 nt, and has more than one stem loop or optimized secondary
structures. In particular embodiments, the direct repeat has 25 or
more nts, such as 26 nt, 27 nt, 28 nt or more, and one or more stem
loop structures. In a preferred embodiment the direct repeat may be
modified to comprise one or more protein-binding RNA aptamers. In a
preferred embodiment, one or more aptamers may be included such as
part of optimized secondary structure. Such aptamers may be capable
of binding a bacteriophage coat protein. The bacteriophage coat
protein may be selected from the group comprising Q.beta., F2, GA,
fr, JP501, MS2, M12, R17, BZ13, JP34, JP500, KU1, M11, MX1, TW18,
VK, SP, FI, ID2, NL95, TW19, AP205, .PHI.Cb5, .PHI.Cb8r,
.PHI.Cb12r, .PHI.Cb23r, 7s and PRR1. In a preferred embodiment the
bacteriophage coat protein is MS2. The invention also provides for
the nucleic acid component of the complex being 30 or more, 40 or
more or 50 or more nucleotides in length.
[0018] The invention provides methods of genome editing and
transcriptome perturbation wherein the method comprises two or more
rounds of C2c2 effector protein targeting and cleavage. In certain
embodiments, a first round comprises the C2c2 effector protein
cleaving sequences associated with a target locus far away from the
seed sequence and a second round comprises the C2c2 effector
protein cleaving sequences at the target locus. In certain such
embodiments of the invention, a first round of targeting by a C2c2
effector protein results in a strand break and a second round of
targeting by the C2c2 effector protein results in a second strand
break. In an embodiment of the invention, one or more rounds of
targeting by a C2c2 effector protein results in staggered cleavage
that may be repaired.
[0019] The invention also provides a method of modifying a target
locus of interest, the method comprising delivering to said locus a
non-naturally occurring or engineered composition comprising a C2c2
loci effector protein and one or more nucleic acid components,
wherein the C2c2 effector protein forms a complex with the one or
more nucleic acid components and upon binding of the said complex
to the locus of interest the effector protein induces the
modification of the target locus of interest. In a preferred
embodiment, the modification is the introduction of a strand
break.
[0020] In such methods the target locus of interest may be
comprised within an RNA molecule. Also, the target locus of
interest may be comprised within a DNA molecule, and in certain
embodiments, within a transcribed DNA molecule. In such methods the
target locus of interest may be comprised in a nucleic acid
molecule in vitro.
[0021] In such methods the target locus of interest may be
comprised in a nucleic acid molecule within a cell. The cell may be
a prokaryotic cell or a eukaryotic cell. The cell may be a
mammalian cell. The mammalian cell many be a non-human primate,
bovine, porcine, rodent or mouse cell. The cell may be a
non-mammalian eukaryotic cell such as poultry, fish or shrimp. The
cell may also be a plant cell. The plant cell may be of a crop
plant such as cassava, corn, sorghum, wheat, or rice. The plant
cell may also be of an algae, tree or vegetable. The modification
introduced to the cell by the present invention may be such that
the cell and progeny of the cell are altered for improved
production of biologic products such as an antibody, starch,
alcohol or other desired cellular output. The modification
introduced to the cell by the present invention may be such that
the cell and progeny of the cell include an alteration that changes
the biologic product produced.
[0022] The mammalian cell many be a non-human mammal, e.g.,
primate, bovine, ovine, porcine, canine, rodent, Leporidae such as
monkey, cow, sheep, pig, dog, rabbit, rat or mouse cell. The cell
may be a non-mammalian eukaryotic cell such as poultry bird (e.g.,
chicken), vertebrate fish (e.g., salmon) or shellfish (e.g.,
oyster, claim, lobster, shrimp) cell. The cell may also be a plant
cell. The plant cell may be of a monocot or dicot or of a crop or
grain plant such as cassava, corn, sorghum, soybean, wheat, oat or
rice. The plant cell may also be of an algae, tree or production
plant, fruit or vegetable (e.g., trees such as citrus trees, e.g.,
orange, grapefruit or lemon trees; peach or nectarine trees; apple
or pear trees; nut trees such as almond or walnut or pistachio
trees; nightshade plants; plants of the genus Brassica; plants of
the genus Lactuca; plants of the genus Spinacia; plants of the
genus Capsicum; cotton, tobacco, asparagus, carrot, cabbage,
broccoli, cauliflower, tomato, eggplant, pepper, lettuce, spinach,
strawberry, blueberry, raspberry, blackberry, grape, coffee, cocoa,
etc).
[0023] The invention provides a method of modifying a target locus
of interest, the method comprising delivering to said locus a
non-naturally occurring or engineered composition comprising a Type
VI CRISPR-Cas loci effector protein and one or more nucleic acid
components, wherein the effector protein forms a complex with the
one or more nucleic acid components and upon binding of the said
complex to the locus of interest the effector protein induces the
modification of the target locus of interest. In a preferred
embodiment, the modification is the introduction of a strand
break.
[0024] In such methods the target locus of interest may be
comprised within a DNA molecule or within an RNA molecule. In a
preferred embodiment, the target locus of interest comprises
RNA.
[0025] The invention also provides a method of modifying a target
locus of interest, the method comprising delivering to said locus a
non-naturally occurring or engineered composition comprising a C2c2
loci effector protein and one or more nucleic acid components,
wherein the C2c2 effector protein forms a complex with the one or
more nucleic acid components and upon binding of the said complex
to the locus of interest the effector protein induces the
modification of the target locus of interest. In a preferred
embodiment, the modification is the introduction of a strand
break.
[0026] In such methods the target locus of interest may be
comprised in a nucleic acid molecule in vitro. In such methods the
target locus of interest may be comprised in a nucleic acid
molecule within a cell. Preferably, in such methods the target
locus of interest may be comprised in a RNA molecule in vitro. Also
preferably, in such methods the target locus of interest may be
comprised in a RNA molecule within a cell. The cell may be a
prokaryotic cell or a eukaryotic cell. The cell may be a mammalian
cell. The cell may be a rodent cell. The cell may be a mouse
cell.
[0027] In any of the described methods the target locus of interest
may be a genomic or epigenomic locus of interest. In any of the
described methods the complex may be delivered with multiple guides
for multiplexed use. In any of the described methods more than one
protein(s) may be used.
[0028] In further aspects of the invention the nucleic acid
components may comprise a putative CRISPR RNA (crRNA) sequence.
Without limitation, the Applicants hypothesize that in such
instances, the pre-crRNA may comprise secondary structure that is
sufficient for processing to yield the mature crRNA as well as
crRNA loading onto the effector protein. By means of example and
not limitation, such secondary structure may comprise, consist
essentially of or consist of a stem loop within the pre-crRNA, more
particularly within the direct repeat.
[0029] In any of the described methods the effector protein and
nucleic acid components may be provided via one or more
polynucleotide molecules encoding the protein and/or nucleic acid
component(s), and wherein the one or more polynucleotide molecules
are operably configured to express the protein and/or the nucleic
acid component(s). The one or more polynucleotide molecules may
comprise one or more regulatory elements operably configured to
express the protein and/or the nucleic acid component(s). The one
or more polynucleotide molecules may be comprised within one or
more vectors. In any of the described methods the target locus of
interest may be a genomic or epigenomic locus of interest. In any
of the described methods the complex may be delivered with multiple
guides for multiplexed use. In any of the described methods more
than one protein(s) may be used.
[0030] In any of the described methods the strand break may be a
single strand break or a double strand break.
[0031] Regulatory elements may comprise inducible promotors.
Polynucleotides and/or vector systems may comprise inducible
systems.
[0032] In any of the described methods the one or more
polynucleotide molecules may be comprised in a delivery system, or
the one or more vectors may be comprised in a delivery system.
[0033] In any of the described methods the non-naturally occurring
or engineered composition may be delivered via liposomes, particles
including nanoparticles, exosomes, microvesicles, a gene-gun or one
or more viral vectors.
[0034] The invention also provides a non-naturally occurring or
engineered composition which is a composition having the
characteristics as discussed herein or defined in any of the herein
described methods.
[0035] In certain embodiments, the invention thus provides a
non-naturally occurring or engineered composition, such as
particularly a composition capable of or configured to modify a
target locus of interest, said composition comprising a Type VI
CRISPR-Cas loci effector protein and one or more nucleic acid
components, wherein the effector protein forms a complex with the
one or more nucleic acid components and upon binding of the said
complex to the locus of interest the effector protein induces the
modification of the target locus of interest. In certain
embodiments, the effector protein may be a C2c2 loci effector
protein.
[0036] The invention also provides in a further aspect a
non-naturally occurring or engineered composition, such as
particularly a composition capable of or configured to modify a
target locus of interest, said composition comprising: (a) a guide
RNA molecule (or a combination of guide RNA molecules, e.g., a
first guide RNA molecule and a second guide RNA molecule) or a
nucleic acid encoding the guide RNA molecule (or one or more
nucleic acids encoding the combination of guide RNA molecules); (b)
a Type VI CRISPR-Cas loci effector protein or a nucleic acid
encoding the Type VI CRISPR-Cas loci effector protein. In certain
embodiments, the effector protein may be a C2c2 loci effector
protein.
[0037] The invention also provides in a further aspect a
non-naturally occurring or engineered composition comprising: (a) a
guide RNA molecule (or a combination of guide RNA molecules, e.g.,
a first guide RNA molecule and a second guide RNA molecule) or a
nucleic acid encoding the guide RNA molecule (or one or more
nucleic acids encoding the combination of guide RNA molecules); (b)
be a C2c2 loci effector protein.
[0038] The invention also provides a vector system comprising one
or more vectors, the one or more vectors comprising one or more
polynucleotide molecules encoding components of a non-naturally
occurring or engineered composition which is a composition having
the characteristics as defined in any of the herein described
methods.
[0039] The invention also provides a delivery system comprising one
or more vectors or one or more polynucleotide molecules, the one or
more vectors or polynucleotide molecules comprising one or more
polynucleotide molecules encoding components of a non-naturally
occurring or engineered composition which is a composition having
the characteristics discussed herein or as defined in any of the
herein described methods.
[0040] The invention also provides a non-naturally occurring or
engineered composition, or one or more polynucleotides encoding
components of said composition, or vector or delivery systems
comprising one or more polynucleotides encoding components of said
composition for use in a therapeutic method of treatment. The
therapeutic method of treatment may comprise gene or transcriptome
editing, or gene therapy.
[0041] The invention also encompasses computational methods and
algorithms to predict new Class 2 CRISPR-Cas systems and identify
the components therein.
[0042] The invention also provides for methods and compositions
wherein one or more amino acid residues of the effector protein may
be modified e.g., an engineered or non-naturally-occurring effector
protein or C2c2. In an embodiment, the modification may comprise
mutation of one or more amino acid residues of the effector
protein. The one or more mutations may be in one or more
catalytically active domains of the effector protein. The effector
protein may have reduced or abolished nuclease activity compared
with an effector protein lacking said one or more mutations. The
effector protein may not direct cleavage of one or other DNA or RNA
strand at the target locus of interest. The effector protein may
not direct cleavage of either DNA or RNA strand at the target locus
of interest. In a preferred embodiment, the one or more mutations
may comprise two mutations. In a preferred embodiment the one or
more amino acid residues are modified in a C2c2 effector protein,
e.g., an engineered or non-naturally-occurring effector protein or
C2c2. In particular embodiments, the one or more modified of
mutated amino acid residues are one or more of those in C2c2
corresponding to R597, H602, R1278 and H1283 (referenced to Lsh
C2c2 amino acids and C2c2 consensus numbering), such as mutations
R597A, H602A, R1278A and H1283A, or the corresponding amino acid
residues in Lsh C2c2 orthologues.
[0043] In particular embodiments, the one or more modified of
mutated amino acid residues are one or more of those in C2c2
corresponding to K2, K39, V40, E479, L514, V518, N524, G534, K535,
E580, L597, V602, D630, F676, L709, I713, R717 (HEPN), N718, H722
(HEPN), E773, P823, V828, I879, Y880, F884, Y997, L1001, F1009,
L1013, Y1093, L1099, L1111, Y1114, L1203, D1222, Y1244, L1250,
L1253, K1261, I1334, L1355, L1359, R1362, Y1366, E1371, R1372,
D1373, R1509 (HEPN), H1514 (HEPN), Y1543, D1544, K1546, K1548,
V1551, I1558, according to C2c2 consensus numbering. In certain
embodiments, the one or more modified of mutated amino acid
residues are one or more of those in C2c2 corresponding to R717 and
R1509. In certain embodiments, the one or more modified of mutated
amino acid residues are one or more of those in C2c2 corresponding
to K2, K39, K535, K1261, R1362, R1372, K1546 and K1548. In certain
embodiments, said mutations result in a protein having an altered
or modified activity. In certain embodiments, said mutations result
in a protein having an increased activity, such as an increased
specificity. In certain embodiments, said mutations result in a
protein having a reduced activity, such as reduced specificity. In
certain embodiments, said mutations result in a protein having no
catalytic activity (i.e. "dead" C2c2). In an embodiment, said amino
acid residues correspond to Lsh C2c2 amino acid residues, or the
corresponding amino acid residues of a C2c2 protein from a
different species.
[0044] The invention also provides for the one or more mutations or
the two or more mutations to be in a catalytically active domain of
the effector protein. In some embodiments of the invention the
catalytically active domain may comprise a RuvCI, RuvCII or RuvCIII
domain, or a catalytically active domain which is homologous to a
RuvCI, RuvCII or RuvCIII domain etc or to any relevant domain as
described in any of the herein described methods. In certain
embodiments, the one or more mutations or the two or more mutations
may be in a catalytically active domain of the effector protein
comprising a HEPN domain, or a catalytically active domain which is
homologous to a HEPN domain. The effector protein may comprise one
or more heterologous functional domains. The one or more
heterologous functional domains may comprise one or more nuclear
localization signal (NLS) domains. The one or more heterologous
functional domains may comprise at least two or more NLS domains.
The one or more NLS domain(s) may be positioned at or near or in
proximity to a terminus of the effector protein (e.g., C2c2) and if
two or more NLSs, each of the two may be positioned at or near or
in proximity to a terminus of the effector protein (e.g., C2c2).
The one or more heterologous functional domains may comprise one or
more translational activation domains. In other embodiments the
functional domain may comprise a transcriptional activation domain,
for example VP64. The one or more heterologous functional domains
may comprise one or more transcriptional repression domains. In
certain embodiments the transcriptional repression domain comprises
a KRAB domain or a SID domain (e.g. SID4X). The one or more
heterologous functional domains may comprise one or more nuclease
domains. In a preferred embodiment a nuclease domain comprises
Fok1.
[0045] The invention also provides for the one or more heterologous
functional domains to have one or more of the following activities:
methylase activity, demethylase activity, transcription activation
activity, transcription repression activity, transcription release
factor activity, histone modification activity, nuclease activity,
single-strand RNA cleavage activity, double-strand RNA cleavage
activity, single-strand DNA cleavage activity, double-strand DNA
cleavage activity and nucleic acid binding activity. At least one
or more heterologous functional domains may be at or near the
amino-terminus of the effector protein and/or wherein at least one
or more heterologous functional domains is at or near the
carboxy-terminus of the effector protein. The one or more
heterologous functional domains may be fused to the effector
protein. The one or more heterologous functional domains may be
tethered to the effector protein. The one or more heterologous
functional domains may be linked to the effector protein by a
linker moiety.
[0046] The invention also provides for the effector protein
comprising an effector protein from an organism from a genus
comprising Streptococcus, Campylobacter, Nitratifractor,
Staphylococcus, Parvibaculum, Roseburia, Neisseria,
Gluconacetobacter, Azospirillum, Sphaerochaeta, Lactobacillus,
Eubacterium, Corynebacter, Carnobacterium, Rhodobacter, Listeria,
Paludibacter, Clostridium, Lachnospiraceae, Clostridiaridium,
Leptotrichia, Francisella, Legionella, Alicyclobacillus,
Methanomethyophilus, Porphyromonas, Prevotella, Bacteroidetes,
Helcococcus, Letospira, Desulfovibrio, Desulfonatronum,
Opitutaceae, Tuberibacillus, Bacillus, Brevibacilus,
Methylobacterium or Acidaminococcus. The effector protein may
comprise a chimeric effector protein comprising a first fragment
from a first effector protein ortholog and a second fragment from a
second effector protein ortholog, and wherein the first and second
effector protein orthologs are different. At least one of the first
and second effector protein orthologs may comprise an effector
protein from an organism comprising Streptococcus, Campylobacter,
Nitratifractor, Staphylococcus, Parvibaculum, Roseburia, Neisseria,
Gluconacetobacter, Azospirillum, Sphaerochaeta, Lactobacillus,
Eubacterium, Corynebacter, Carnobacterium, Rhodobacter, Listeria,
Paludibacter, Clostridium, Lachnospiraceae, Clostridiaridium,
Leptotrichia, Francisella, Legionella, Alicyclobacillus,
Methanomethyophilus, Porphyromonas, Prevotella, Bacteroidetes,
Helcococcus, Letospira, Desulfovibrio, Desulfonatronum,
Opitutaceae, Tuberibacillus, Bacillus, Brevibacilus,
Methylobacterium or Acidaminococcus.
[0047] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-B loci
effector protein, even more particularly a C2c1p, may originate
from, may be isolated from or may be derived from a bacterial
species belonging to the taxa Bacilli, Verrucomicrobia,
alpha-proteobacteria or delta-proteobacteria. In certain
embodiments, the effector protein, particularly a Type V loci
effector protein, more particularly a Type V-B loci effector
protein, even more particularly a C2c1p, may originate from, may be
isolated from or may be derived from a bacterial species belonging
to a genus selected from the group consisting of Alicyclobacillus,
Desulfovibrio, Desulfonatronum, Opitutaceae, Tuberibacillus,
Bacillus, Brevibacillus, Desulfatirhabdium, Citrobacter, and
Methylobacterium. In certain embodiments, the effector protein,
particularly a Type V loci effector protein, more particularly a
Type V-B loci effector protein, even more particularly a C2c1p, may
originate, may be isolated or may be derived from a bacterial
species selected from the group consisting of Alicyclobacillus
acidoterrestris (e.g., ATCC 49025), Alicyclobacillus contaminans
(e.g., DSM 17975), Desulfovibrio inopinatus (e.g., DSM 10711),
Desulfonatronum thiodismutans (e.g., strain MLF-1), Opitutaceae
bacterium TAV5, Tuberibacillus calidus (e.g., DSM 17572), Bacillus
thermoamylovorans (e.g., strain B4166), Brevibacillus sp. CF112,
Bacillus sp. NSP2.1, Desulfatirhabdium butyrativorans (e.g., DSM
18734), Alicyclobacillus herbarius (e.g., DSM 13609), Citrobacter
feundii (e.g., ATCC 8090), Brevibacillus agri (e.g., BAB-2500),
Methylobacterium nodulans (e.g., ORS 2060). In certain embodiments,
the effector protein, particularly a Type V loci effector protein,
more particularly a Type V-B loci effector protein, even more
particularly a C2c1p, may originate, may be isolated or may be
derived from a bacterial species selected from the group consisting
of the bacterial species listed in the Table in FIG. 41A-B.
[0048] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-B loci
effector protein, even more particularly a C2c1p, may comprise,
consist essentially of or consist of an amino acid sequence
selected from the group consisting of amino acid sequences shown in
the multiple sequence alignment in FIG. 13D-H.
[0049] In certain embodiments, a Type V-B locus as intended herein
may encode a Cas1-Cas4 fusion, Cas2, and the C2c1p effector
protein. In certain embodiments, a Type V-B locus as intended
herein may be adjacent to a CRISPR array. See FIG. 9 and FIG. 41A-B
for illustration of representative Type V-B loci organization.
[0050] In certain embodiments, a Cas1 protein encoded by a Type V-B
locus as intended herein may cluster with Type I-U system. See
FIGS. 10A and 10B and FIG. 10C-V illustrating a Cas1 tree including
Cas1 encoded by representative Type V-B loci.
[0051] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-B loci
effector protein, even more particularly a C2c1p, such as a native
C2c1p, may be about 1100 to about 1500 amino acids long, e.g.,
about 1100 to about 1200 amino acids long, or about 1200 to about
1300 amino acids long, or about 1300 to about 1400 amino acids
long, or about 1400 to about 1500 amino acids long, e.g., about
1100, about 1200, about 1300, about 1400 or about 1500 amino acids
long.
[0052] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-B loci
effector protein, even more particularly a C2c1p, and preferably
the C-terminal portion of said effector protein, comprises the
three catalytic motifs of the RuvC-like nuclease (i.e., RuvCI,
RuvCII and RuvCIII). In certain embodiments, said effector protein,
and preferably the C-terminal portion of said effector protein, may
further comprise a region corresponding to the bridge helix (also
known as arginine-rich cluster) that in Cas9 protein is involved in
crRNA-binding. In certain embodiments, said effector protein, and
preferably the C-terminal portion of said effector protein, may
further comprise a Zn finger region, which may be inactive (i.e.,
which does not bind zinc, e.g., in which the Zn-binding cysteine
residue(s) are missing). In certain embodiments, said effector
protein, and preferably the C-terminal portion of said effector
protein, may comprise the three catalytic motifs of the RuvC-like
nuclease (i.e., RuvCI, RuvCII and RuvCIII), the region
corresponding to the bridge helix, and the Zn finger region,
preferably in the following order, from N to C terminus:
RuvCI-bridge helix-RuvCII-Zinc finger-RuvCIII. See FIG. 11, FIG. 12
and FIGS. 13A and 13C for illustration of representative Type V-B
effector proteins domain architecture.
[0053] In certain embodiments, Type V-B loci as intended herein may
comprise CRISPR repeats between 30 and 40 bp long, more typically
between 34 and 38 bp long, even more typically between 36 and 37 bp
long, e.g., 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 bp
long.
[0054] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-C loci
effector protein, even more particularly a C2c3p, may originate,
may be isolated or may be derived from a bacterial metagenome
selected from the group consisting of the bacterial metagenomes
listed in the Table in FIG. 43A-B.
[0055] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-C loci
effector protein, even more particularly a C2c3p, may comprise,
consist essentially of or consist of an amino acid sequence
selected from the group consisting of amino acid sequences shown in
the multiple sequence alignment in FIG. 13I.
[0056] In certain embodiments, a Type V-C locus as intended herein
may encode Cas1 and the C2c3p effector protein. See FIG. 14 and
FIG. 43A-B for illustration of representative Type V-C loci
organization.
[0057] In certain embodiments, a Cas1 protein encoded by a Type V-C
locus as intended herein may cluster with Type I-B system. See
FIGS. 10A and 10B and FIG. 10C-W illustrating a Cas1 tree including
Cas1 encoded by representative Type V-C loci.
[0058] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-C loci
effector protein, even more particularly a C2c3p, such as a native
C2c3p, may be about 1100 to about 1500 amino acids long, e.g.,
about 1100 to about 1200 amino acids long, or about 1200 to about
1300 amino acids long, or about 1300 to about 1400 amino acids
long, or about 1400 to about 1500 amino acids long, e.g., about
1100, about 1200, about 1300, about 1400 or about 1500 amino acids
long, or at least about 1100, at least about 1200, at least about
1300, at least about 1400 or at least about 1500 amino acids
long.
[0059] In certain embodiments, the effector protein, particularly a
Type V loci effector protein, more particularly a Type V-C loci
effector protein, even more particularly a C2c3p, and preferably
the C-terminal portion of said effector protein, comprises the
three catalytic motifs of the RuvC-like nuclease (i.e., RuvCI,
RuvCII and RuvCIII). In certain embodiments, said effector protein,
and preferably the C-terminal portion of said effector protein, may
further comprise a region corresponding to the bridge helix (also
known as arginine-rich cluster) that in Cas9 protein is involved in
crRNA-binding. In certain embodiments, said effector protein, and
preferably the C-terminal portion of said effector protein, may
further comprise a Zn finger region. Preferably, the Zn-binding
cysteine residue(s) may be conserved in C2c3p. In certain
embodiments, said effector protein, and preferably the C-terminal
portion of said effector protein, may comprise the three catalytic
motifs of the RuvC-like nuclease (i.e., RuvCI, RuvCII and RuvCIII),
the region corresponding to the bridge helix, and the Zn finger
region, preferably in the following order, from N to C terminus:
RuvCI-bridge helix-RuvCII-Zinc finger-RuvCIII. See FIGS. 13A and
13C for illustration of representative Type V-C effector proteins
domain architecture. In particular embodiments, said effector
protein may comprise two HEPN catalytic motifs as illustrated in
FIG. 97(A).
[0060] In certain embodiments, Type V-C loci as intended herein may
comprise CRISPR repeats between 20 and 30 bp long, more typically
between 22 and 27 bp long, yet more typically 25 bp long, e.g., 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 bp long.
[0061] In certain embodiments, the effector protein, particularly a
Type VI loci effector protein, more particularly a C2c2p, may
originate from, may be isolated from, or may be derived from a
bacterial species belonging to the taxa alpha-proteobacteria,
Bacilli, Clostridia, Fusobacteria and Bacteroidetes. In certain
embodiments, the effector protein, particularly a Type VI loci
effector protein, more particularly a C2c2p, may originate from,
may be isolated from, or may be derived from a bacterial species
belonging to a genus selected from the group consisting of
Lachnospiraceae, Clostridium, Carnobacterium, Paludibacter,
Listeria, Leptotrichia, and Rhodobacter. In certain embodiments,
the effector protein, particularly a Type VI loci effector protein,
more particularly a C2c2p may originate from, may be isolated from
or may be derived from a bacterial species selected from the group
consisting of Lachnospiraceae bacterium MA2020, Lachnospiraceae
bacterium NK4A179, Clostridium aminophilum (e.g., DSM 10710),
Lachnospiraceae bacterium NK4A144, Carnobacterium gallinarum (e.g.,
DSM 4847 strain MT44), Paludibacter propionicigenes (e.g., WB4),
Listeria seeligeri (e.g., serovar 1/2b str. SLCC3954), Listeria
weihenstephanensis (e.g., FSL R9-0317 c4), Listeria newyorkensis
(e.g., strain FSL M6-0635), Leptotrichia wadei (e.g., F0279),
Leptotrichia buccalis (e.g., DSM 1135), Leptotrichia sp. Oral taxon
225 (e.g., str. F0581), Leptotrichia sp. Oral taxon 879 (e.g.,
strain F0557), Leptotrichia shahii (e.g., DSM 19757), Rhodobacter
capsulatus (e.g., SB 1003, R121, or DE442). In certain embodiments,
the effector protein, particularly a Type VI loci effector protein,
more particularly a C2c2p may originate from, may be isolated from
or may be derived from a bacterial species selected from the group
consisting of the bacterial species listed in the Table in FIG.
42A-B. In particular embodiments, the C2c2 protein originates from
Leptotrichia shahii (e.g., DSM 19757).
[0062] In certain embodiments, the effector protein, particularly a
Type VI loci effector protein, more particularly a C2c2p, may
comprise, consist essentially of or consist of an amino acid
sequence selected from the group consisting of amino acid sequences
shown in the multiple sequence alignment in FIG. 13J-N or more
particularly from the group consisting of amino acid sequences
shown in the sequence alignment in FIG. 110.
[0063] In certain embodiments, a Type VI locus as intended herein
may encode Cas1, Cas2, and the C2c2p effector protein. In certain
embodiments, a Type V-C locus as intended herein may comprise a
CRISPR array. In certain embodiments, a Type V-C locus as intended
herein may comprise the c2c2 gene and a CRISPR array, and not
comprise cas1 and cas2 genes. See FIG. 15 and FIG. 42A-B for
illustration of representative Type VI loci organization.
[0064] In certain embodiments, a Cas1 protein encoded by a Type VI
locus as intended herein may cluster within the Type II subtree
along with a small Type III-A branch, or within Type III-A system.
See FIGS. 10A and 10B and FIG. 10C-W illustrating a Cas1 tree
including Cas1 encoded by representative Type VI loci.
[0065] In certain embodiments, the effector protein, particularly a
Type VI loci effector protein, more particularly a C2c2p, such as a
native C2c2p, may be about 1000 to about 1500 amino acids long,
such as about 1100 to about 1400 amino acids long, e.g., about 1000
to about 1100, about 1100 to about 1200 amino acids long, or about
1200 to about 1300 amino acids long, or about 1300 to about 1400
amino acids long, or about 1400 to about 1500 amino acids long,
e.g., about 1000, about 1100, about 1200, about 1300, about 1400 or
about 1500 amino acids long.
[0066] In certain embodiments, the effector protein, particularly a
Type VI loci effector protein, more particularly a C2c2p, comprises
at least one and preferably at least two, such as more preferably
exactly two, conserved RxxxxH motifs. Catalytic RxxxxH motifs are
are characteristic of HEPN (Higher Eukaryotes and Prokaryotes
Nucleotide-binding) domains. Hence, in certain embodiments, the
effector protein, particularly a Type VI loci effector protein,
more particularly a C2c2p, comprises at least one and preferably at
least two, such as more preferably exactly two, HEPN domains. See
FIG. 11 and FIG. 13B and FIG. 110A for illustration of
representative Type VI effector proteins domain architecture. In
certain embodiments, the HEPN domains may possess RNAse activity.
In other embodiments, the HEPN domains may possess DNAse
activity.
[0067] In certain embodiments, Type VI loci as intended herein may
comprise CRISPR repeats between 30 and 40 bp long, more typically
between 35 and 39 bp long, e.g., 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, or 40 bp long. In particular embodiments, the direct repeat
is at least 25 nt long.
[0068] In certain embodiments, a protospacer adjacent motif (PAM)
or PAM-like motif directs binding of the effector protein complex
as disclosed herein to the target locus of interest. In some
embodiments, the PAM may be a 5' PAM (i.e., located upstream of the
5' end of the protospacer). In other embodiments, the PAM may be a
3' PAM (i.e., located downstream of the 5' end of the protospacer).
The term "PAM" may be used interchangeably with the term "PFS" or
"protospacer flanking site" or "protospacer flanking sequence".
[0069] In a preferred embodiment, the effector protein,
particularly a Type V loci effector protein, more particularly a
Type V-B loci effector protein, even more particularly a C2c1p, may
recognize a 5' PAM. In certain embodiments, the effector protein,
particularly a Type V loci effector protein, more particularly a
Type V-B loci effector protein, even more particularly a C2c1p, may
recognize a 5' PAM which is 5' TTN or 5' ATTN, where N is A, C, G
or T. In certain preferred embodiments, the effector protein may be
Alicyclobacillus acidoterrestris C2c1p, more preferably
Alicyclobacillus acidoterrestris ATCC 49025 C2c1p, and the 5' PAM
is 5' TTN, where N is A, C, G or T, more preferably where N is A, G
or T. In other preferred embodiments, the effector protein is
Bacillus thermoamylovorans C2c1p, more preferably Bacillus
thermoamylovorans strain B4166 C2c1p, and the 5' PAM is 5' ATTN,
where N is A, C, G or T.
[0070] In a preferred embodiment, the effector protein,
particularly a Type VI loci effector protein, more particularly a
C2c2p, may recognize a 3' PAM. In certain embodiments, the effector
protein, particularly a Type VI loci effector protein, more
particularly a C2c2p, may recognize a 3' PAM which is 5'H, wherein
H is A, C or U. In certain preferred embodiments, the effector
protein may be Leptotrichia shahii C2c2p, more preferably
Leptotrichia shahii DSM 19757 C2c2, and the 5' PAM is a 5' H.
[0071] In certain embodiments, the CRISPR enzyme is engineered and
can comprise one or more mutations that reduce or eliminate a
nuclease activity. Mutations can also be made at neighboring
residues, e.g., at amino acids near those indicated above that
participate in the nuclease activity. In some embodiments, only one
HEPN domain is inactivated, and in other embodiments, a second HEPN
domain is inactivated.
[0072] In certain embodiments of the invention, the guide RNA or
mature crRNA comprises, consists essentially of, or consists of a
direct repeat sequence and a guide sequence or spacer sequence. In
certain embodiments, the guide RNA or mature crRNA comprises,
consists essentially of, or consists of a direct repeat sequence
linked to a guide sequence or spacer sequence. In certain
embodiments the guide RNA or mature crRNA comprises 19 nts of
partial direct repeat followed by 18, 19, 20, 21, 22, 23, 24, 25,
or more nt of guide sequence, such as 18-25, 19-25, 20-25, 21-25,
22-25, or 23-25 nt of guide sequence or spacer sequence. In certain
embodiments, the effector protein is a C2c2 effector protein and
requires at least 16 nt of guide sequence to achieve detectable DNA
cleavage and a minimum of 17 nt of guide sequence to achieve
efficient DNA cleavage in vitro. In particular embodiments, the
effector protein is a C2c2 protein and requires at least 19 nt of
guide sequence to achieve detectable RNA cleavage. In certain
embodiments, the direct repeat sequence is located upstream (i.e.,
5') from the guide sequence or spacer sequence. In a preferred
embodiment the seed sequence (i.e. the sequence essential critical
for recognition and/or hybridization to the sequence at the target
locus) of the C2c2 guide RNA is approximately within the first 5 nt
on the 5' end of the guide sequence or spacer sequence.
[0073] In preferred embodiments of the invention, the mature crRNA
comprises a stem loop or an optimized stem loop structure or an
optimized secondary structure. In preferred embodiments the mature
crRNA comprises a stem loop or an optimized stem loop structure in
the direct repeat sequence, wherein the stem loop or optimized stem
loop structure is important for cleavage activity. In certain
embodiments, the mature crRNA preferably comprises a single stem
loop. In certain embodiments, the direct repeat sequence preferably
comprises a single stem loop. In certain embodiments, the cleavage
activity of the effector protein complex is modified by introducing
mutations that affect the stem loop RNA duplex structure. In
preferred embodiments, mutations which maintain the RNA duplex of
the stem loop may be introduced, whereby the cleavage activity of
the effector protein complex is maintained. In other preferred
embodiments, mutations which disrupt the RNA duplex structure of
the stem loop may be introduced, whereby the cleavage activity of
the effector protein complex is completely abolished.
[0074] In particular embodiments, the C2c2 protein is an Lsh C2c2
effector protein and the mature crRNA comprises a stem loop or an
optimized stem loop structure. In particular embodiments, the
direct repeat of the crRNA comprises at least 25 nucleotides
comprising a stem loop. In particular embodiments, the the stem is
amenable to individual base swaps but activity is disrupted by most
secondary structure changes or truncation of the crRNA. Examples of
disrupting mutations include swapping of more than two of the stem
nucleotides, addition of a non-pairing nucleotide in the stem,
shortening of the stem (by removal of one of the pairing
nucleotides) or extending the stem (by addition of one set of
pairing nucleotides). However, the crRNA may be amenable to 5'
and/or 3' extensions to include non-functional RNA sequences as
envisaged for particular applications described herein.
[0075] The invention also provides for the nucleotide sequence
encoding the effector protein being codon optimized for expression
in a eukaryote or eukaryotic cell in any of the herein described
methods or compositions. In an embodiment of the invention, the
codon optimized nucleotide sequence encoding the effector protein
encodes any C2c2 discussed herein and is codon optimized for
operability in a eukaryotic cell or organism, e.g., such cell or
organism as elsewhere herein mentioned, for instance, without
limitation, a yeast cell, or a mammalian cell or organism,
including a mouse cell, a rat cell, and a human cell or non-human
eukaryote organism, e.g., plant.
[0076] In certain embodiments of the invention, at least one
nuclear localization signal (NLS) is attached to the nucleic acid
sequences encoding the C2c2 effector proteins. In preferred
embodiments at least one or more C-terminal or N-terminal NLSs are
attached (and hence nucleic acid molecule(s) coding for the C2c2
effector protein can include coding for NLS(s) so that the
expressed product has the NLS(s) attached or connected). In certain
embodiments of the invention, at least one nuclear export signal
(NES) is attached to the nucleic acid sequences encoding the C2c2
effector proteins. In preferred embodiments at least one or more
C-terminal or N-terminal NESs are attached (and hence nucleic acid
molecule(s) coding for the C2c2 effector protein can include coding
for NES(s) so that the expressed product has the NES(s) attached or
connected). In a preferred embodiment a C-terminal and/or
N-terminal NLS or NES is attached for optimal expression and
nuclear targeting in eukaryotic cells, preferably human cells. In a
preferred embodiment, the codon optimized effector protein is C2c2
and the spacer length of the guide RNA is from 15 to 35 nt. In
certain embodiments, the spacer length of the guide RNA is at least
16 nucleotides, such as at least 17 nucleotides, preferably at
least 18 nt, such as preferably at least 19 nt, at least 20 nt, at
least 21 nt, or at least 22 nt. In certain embodiments, the spacer
length is from 15 to 17 nt, from 17 to 20 nt, from 20 to 24 nt, eg.
20, 21, 22, 23, or 24 nt, from 23 to 25 nt, e.g., 23, 24, or 25 nt,
from 24 to 27 nt, from 27-30 nt, from 30-35 nt, or 35 nt or longer.
In certain embodiments of the invention, the codon optimized
effector protein is C2c2 and the direct repeat length of the guide
RNA is at least 16 nucleotides. In certain embodiments, the codon
optimized effector protein is C2c2 and the direct repeat length of
the guide RNA is from 16 to 20 nt, e.g., 16, 17, 18, 19, or 20
nucleotides. In certain preferred embodiments, the direct repeat
length of the guide RNA is 19 nucleotides.
[0077] The invention also encompasses methods for delivering
multiple nucleic acid components, wherein each nucleic acid
component is specific for a different target locus of interest
thereby modifying multiple target loci of interest. The nucleic
acid component of the complex may comprise one or more
protein-binding RNA aptamers. The one or more aptamers may be
capable of binding a bacteriophage coat protein. The bacteriophage
coat protein may be selected from the group comprising Q.beta., F2,
GA, fr, JP501, MS2, M12, R17, BZ13, JP34, JP500, KU1, M11, MX1,
TW18, VK, SP, FI, ID2, NL95, TW19, AP205, .PHI.Cb5, .PHI.Cb8r,
.PHI.Cb12r, .PHI.Cb23r, 7s and PRR1. In a preferred embodiment the
bacteriophage coat protein is MS2. The invention also provides for
the nucleic acid component of the complex being 30 or more, 40 or
more or 50 or more nucleotides in length.
[0078] Accordingly, it is an object of the invention not to
encompass within the invention any previously known product,
process of making the product, or method of using the product such
that Applicants reserve the right and hereby disclose a disclaimer
of any previously known product, process, or method. It is further
noted that the invention does not intend to encompass within the
scope of the invention any product, process, or making of the
product or method of using the product, which does not meet the
written description and enablement requirements of the USPTO (35
U.S.C. .sctn. 112, first paragraph) or the EPO (Article 83 of the
EPC), such that Applicants reserve the right and hereby disclose a
disclaimer of any previously described product, process of making
the product, or method of using the product. It may be advantageous
in the practice of the invention to be in compliance with Art.
53(c) EPC and Rule 28(b) and (c) EPC. Nothing herein is to be
construed as a promise.
[0079] It is noted that in this disclosure and particularly in the
claims and/or paragraphs, terms such as "comprises", "comprised",
"comprising" and the like can have the meaning attributed to it in
U.S. Patent law; e.g., they can mean "includes", "included",
"including", and the like; and that terms such as "consisting
essentially of" and "consists essentially of" have the meaning
ascribed to them in U.S. Patent law, e.g., they allow for elements
not explicitly recited, but exclude elements that are found in the
prior art or that affect a basic or novel characteristic of the
invention.
[0080] In a further aspect, the invention provides a eukaryotic
cell comprising a nucleotide sequence encoding the CRISPR system
described herein which ensures the generation of a modified target
locus of interest, wherein the target locus of interest is modified
according to in any of the herein described methods. A further
aspect provides a cell line of said cell. Another aspect provides a
multicellular organism comprising one or more said cells.
[0081] In certain embodiments, the modification of the target locus
of interest may result in: the eukaryotic cell comprising altered
expression of at least one gene product; the eukaryotic cell
comprising altered expression of at least one gene product, wherein
the expression of the at least one gene product is increased; the
eukaryotic cell comprising altered expression of at least one gene
product, wherein the expression of the at least one gene product is
decreased; or the eukaryotic cell comprising an edited genome.
[0082] In certain embodiments, the eukaryotic cell may be a
mammalian cell or a human cell.
[0083] In further embodiments, the non-naturally occurring or
engineered compositions, the vector systems, or the delivery
systems as described in the present specification may be used for
RNA sequence-specific interference, RNA sequence specific
modulation of expression (including isoform specific expression),
stability, localization, functionality (e.g. ribosomal RNAs or
miRNAs), etc; or multiplexing of such processes.
[0084] In further embodiments, the the non-naturally occurring or
engineered compositions, the vector systems, or the delivery
systems as described in the present specification may be used for
RNA detection and/or quantification within a cell.
[0085] In further embodiments, the the non-naturally occurring or
engineered compositions, the vector systems, or the delivery
systems as described in the present specification may be used for
generating disease models and/or screening systems.
[0086] In further embodiments, the non-naturally occurring or
engineered compositions, the vector systems, or the delivery
systems as described in the present specification may be used for:
site-specific transcriptome editing or purturbation; nucleic acid
sequence-specific interference; or multiplexed genome
engineering.
[0087] Also provided is a gene product from the cell, the cell
line, or the organism as described herein. In certain embodiments,
the amount of gene product expressed may be greater than or less
than the amount of gene product from a cell that does not have
altered expression or edited genome. In certain embodiments, the
gene product may be altered in comparison with the gene product
from a cell that does not have altered expression or edited
genome.
[0088] These and other embodiments are disclosed or are obvious
from and encompassed by, the following Detailed Description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0089] The novel features of the invention are set forth with
particularity in the appended claims. A better understanding of the
features and advantages of the present invention will be obtained
by reference to the following detailed description that sets forth
illustrative embodiments, in which the principles of the invention
are utilized, and the accompanying drawings of which:
[0090] FIGS. 1A-1B depicts a new classification of CRISPR-Cas
systems. Class 1 includes multisubunit crRNA-effector complexes
(Cascade) and Class 2 includes Single-subunit crRNA-effector
complexes (Cas9-like). FIG. 1B provides another depiction of the
new classification of CRISPR-Cas systems.
[0091] FIG. 2 provides a molecular organization of CRISPR-Cas.
[0092] FIGS. 3A-3D provides structures of Type I and III effector
complexes: common architecture/common ancestry despite extensive
sequence divergence.
[0093] FIG. 4 shows CRISPR-Cas as a RNA recognition motif
(RRM)-centered system.
[0094] FIG. 5 shows a Cas1 phylogeny where recombination of
adaptation and crRNA-effector modules show a major aspect of
CRISPR-Cas evolution.
[0095] FIG. 6 shows a CRISPR-Cas census, specifically a
distribution of CRISPR-Cas types/subtypes among archaea and
bacteria.
[0096] FIG. 7 depicts a pipeline for identifying Cas
candidates.
[0097] FIGS. 8A-8B depicts an organization of complete loci of
Class 2 CRISPR-Cas systems. The three subtypes of type II and
subtypes V-A, V--B and V-C, and type VI are indicated. Subfamilies
based on Cas1 are also indicated. The schematics include only the
common genes represented in each subtype; the additional genes
present in some variants are omitted. The red rectangle shows the
degenerate repeat. The gray arrows show the direction of CRISPR
array transcription. PreFran, Prevotella-Francisella. FIG. 8B
provides another depiction of an organization of complete loci of
several Class 2 CRISPR-Cas systems.
[0098] FIG. 9 depicts C2c1 neighborhoods, i.e., genomic
architecture of the C2c1 CRISPR-Cas loci. The number of repeats in
CRISPR arrays is indicated. For each genomic contig, Genbank
numeric ID and the coordinates of the locus are indicated.
[0099] FIGS. 10A-10B. FIGS. 10A and 10B depict representations of a
Cas1 tree. The tree in FIG. 10B was constructed from a multiple
alignment of 1498 Cas1 sequences which contained 304
phylogenetically informative positions. Branches, corresponding to
Class 2 systems are highlighted: cyan, type II; orange, subtype
V-A; red, subtype V-B; brown, subtype V-C; purple, type VI. Insets
show the expanded branches of the novel (sub)types. The bootstrap
support values are given as percentage points and shown only for
few relevant branches.
[0100] FIGS. 10C1-10W. FIGS. 10C-10W provide the complete Cas1
tree, which is schematically shown in FIG. 10B, in Newick format
with species names and bootstrap support values. The tree was
reconstructed by FastTree program ("-gamma-wag" options). A
multiple alignment of Cas1 sequences was filtered with homogeneity
threshold of 0.1 and gap occurrence threshold of 0.5, prior to tree
reconstruction.
[0101] FIG. 11 depicts a domain organization of class 2
families.
[0102] FIG. 12-1 to 12-2 depicts TnpB homology regions in Class 2
proteins. Figure discloses SEQ ID NOS 202-384, respectively, in
order of appearance.
[0103] FIGS. 13A-1 to 13N-4. FIGS. 13A and 13B provide another
depiction of domain architectures and conserved motifs of the Class
2 effector proteins. FIG. 13A illustrates Types II and V:
TnpB-derived nucleases. The top panel shows the RuvC nuclease from
Thermos thermophilus (PDB ID: 4EP5) with the catalytic amino acid
residues denoted. Underneath each domain architecture, an alignment
of the conserved motifs in selected representatives of the
respective protein family (a single sequence for RuvC) is shown.
The catalytic residues are shown by white letters on a black
background; conserved hydrophobic residues are highlighted in
yellow; conserved small residues are highlighted in green; in the
bridge helix alignment, positively charged residues are in red.
Secondary structure prediction is shown underneath the aligned
sequences: H denotes ca-helix and E denotes extended conformation
(.beta.-strand). The poorly conserved spacers between the alignment
blocks are shown by numbers. FIG. 13B illustrates Type VI: proteins
containing two HEPN domains, which may display RNAse activity. The
top alignment blocks include selected HEPN domains described
previously and the bottom blocks include the catalytic motifs from
the type VI effector proteins. The designations are as in FIG. 13A.
FIG. 13C shows the closest homologs of the new type V effector
proteins among the transposon-encoded proteins: non-overlapping
sets of homologs. FIG. 13D-H shows multiple alignment of C2c1
protein family. The alignment was built using MUSCLE program and
modified manually on the basis of local PSI-BLAST pairwise
alignments. Each sequence is labelled with GenBank Identifier (GI)
number and systematic name of an organism. Secondary structure was
predicted by Jpred and shown underneath the sequence which was used
as a query (designations: H-alpha helix, E-beta strand). CONSENSUS
was calculated for each alignment column by scaling the
sum-of-pairs score within the column between those of a homogeneous
column (the same residue in all aligned sequences) and a random
column with homogeneity cutoff 0.8. Active site motifs of RuvC-like
domain are shown below alignment. FIG. 13I shows multiple alignment
of C2c3 protein family. The alignment was built using MUSCLE
program. Each sequence is labelled with local assigned number and
the Genbank ID for metagenomics contig coding for respective C2c3
protein. Secondary structure was predicted by Jpred and shown
underneath the alignment (designations: H-alpha helix, E-beta
strand). CONSENSUS was calculated for each alignment column by
scaling the sum-of-pairs score within the column between those of a
homogeneous column (the same residue in all aligned sequences) and
a random column with homogeneity cutoff 0.8. Active site motifs of
RuvC-like domain are shown below alignment for the C-terminal
domain. FIG. 13J-N shows multiple alignment of C2c2 protein family.
The alignment was built using MUSCLE program and modified manually
on the basis of local PSIBLAST pairwise alignments. Each sequence
is labelled with GenBank Identifier (GI) number and systematic name
of an organism. Secondary structure was predicted by Jpred and
shown underneath the sequence which was used as a query
(designations: H-alpha helix, E-beta strand). CONSENSUS was
calculated for each alignment column by scaling the sum-of-pairs
score within the column between those of a homogeneous column (the
same residue in all aligned sequences) and a random column with
homogeneity cutoff 0.8. Active site motifs of HEPN domain are shown
below alignment. FIG. 13A discloses SEQ ID NOS 385-503,
respectively, in order of appearance. FIG. 13B discloses SEQ ID NOS
504-547, respectively, in order of appearance. FIGS. 13D-H disclose
SEQ ID NOS 548-567, respectively, in order of appearance. FIG. 13I
discloses SEQ ID NOS 568, 569 & 1786, and 570-572,
respectively, in order of appearance. FIGS. 13J-N disclose SEQ ID
NOS 573-591, respectively, in order of appearance.
[0104] FIG. 14 depicts C2c3 neighborhoods, i.e., genomic
architecture of the C2c3 CRISPR-Cas loci. The number of repeats in
CRISPR arrays is indicated. For each genomic contig, Genbank
numeric ID and the coordinates of the locus are indicated.
[0105] FIG. 15 depicts C2c2 neighborhoods.
[0106] FIG. 16-1 to 16-8 depicts HEPN RxxxxH motif in C2c2 family.
Figure discloses SEQ ID NOS 592-1195, respectively, in order of
appearance.
[0107] FIG. 17 depicts C2C1: 1. Alicyclobacillus acidoterrestris
ATCC 49025 Figure discloses SEQ ID NOS 1196-1199, respectively, in
order of appearance.
[0108] FIG. 18 depicts C2C1: 4. Desulfonatronum thiodismutans
strain MLF-1 Figure discloses SEQ ID NOS 1200-1203, respectively,
in order of appearance.
[0109] FIG. 19 depicts C2C1: 5. Opitutaceae bacterium TAV5 Figure
discloses SEQ ID NOS 1204-1207, respectively, in order of
appearance.
[0110] FIG. 20 depicts C2C1: 7. Bacillus thermoamylovorans strain
B4166 Figure discloses SEQ ID NOS 1208-1211, respectively, in order
of appearance.
[0111] FIG. 21 depicts C2C1: 9. Bacillus sp. NSP2.1 Figure
discloses SEQ ID NOS 1212-1215, respectively, in order of
appearance.
[0112] FIG. 22 depicts C2C2: 1. Lachnospiraceae bacterium MA2020
Figure discloses SEQ ID NOS 1216-1219, respectively, in order of
appearance.
[0113] FIG. 23-1 to 23-2 depicts C2C2: 2. Lachnospiraceae bacterium
NK4A179 Figure discloses SEQ ID NOS 1220-1226, respectively, in
order of appearance.
[0114] FIG. 24 depicts C2C2: 3. [Clostridium] aminophilum DSM 10710
Figure discloses SEQ ID NOS 1227-1230, respectively, in order of
appearance.
[0115] FIG. 25 depicts C2C2: 4. Lachnospiraceae bacterium NK4A144
Figure discloses SEQ ID NOS 1231-1232, respectively, in order of
appearance.
[0116] FIG. 26 depicts C2C2: 5. Carnobacterium gallinarum DSM 4847
Figure discloses SEQ ID NOS 1233-1236, respectively, in order of
appearance.
[0117] FIG. 27-1 to 27-2 depicts C2C2: 6. Carnobacterium gallinarum
DSM 4847 Figure discloses SEQ ID NOS 1237-1243, respectively, in
order of appearance.
[0118] FIG. 28 depicts C2C2: 7. Paludibacter propionicigenes WB4
Figure discloses SEQ ID NO: 1244.
[0119] FIG. 29 depicts C2C2: 8. Listeria seeligeri serovar 1/2b
Figure discloses SEQ ID NOS 1245-1248, respectively, in order of
appearance.
[0120] FIG. 30 depicts C2C2: 9. Listeria weihenstephanensis FSL
R9-0317 Figure discloses SEQ ID NO: 1249.
[0121] FIG. 31-1 to 31-2 depicts C2C2: 10. Listeria bacterium FSL
M6-0635 Figure discloses SEQ ID NOS 1250-1253, respectively, in
order of appearance.
[0122] FIG. 32 depicts C2C2: 11. Leptotrichia wadei F0279 Figure
discloses SEQ ID NO: 1254.
[0123] FIG. 33-1 to 33-2 depicts C2C2: 12. Leptotrichia wadei F0279
Figure discloses SEQ ID NOS 1255-1261, respectively, in order of
appearance.
[0124] FIG. 34 depicts C2C2: 14. Leptotrichia shahii DSM 19757
Figure discloses SEQ ID NOS 1262-1265, respectively, in order of
appearance.
[0125] FIG. 35 depicts C2C2: 15. Rhodobacter capsulatus SB 1003
Figure discloses SEQ ID NOS 1266-1267, respectively, in order of
appearance.
[0126] FIG. 36 depicts C2C2: 16. Rhodobacter capsulatus R121 Figure
discloses SEQ ID NOS 1268-1269, respectively, in order of
appearance.
[0127] FIG. 37 depicts C2C2: 17. Rhodobacter capsulatus DE442
Figure discloses SEQ ID NOS 1270-1271, respectively, in order of
appearance.
[0128] FIG. 38 depicts a tree of DRs
[0129] FIG. 39 depicts a tree of C2c2s
[0130] FIGS. 40A-40D shows the Table listing 63 large
protein-coding genes identified using the computational pipeline
disclosed herein in the vicinity of cas1 genes. Representatives of
the new subtypes disclosed herein (V-B, V-C, VI) are colored.
Protein sequences for AUXO014641567.1, AUXO011689375.1,
AUXO011689375.1, AUXO011277409.1, AUXO014986615.1 coding
representatives of Type V-B and Type IV were not analyzed, since
species affiliation cannot be assigned to these sequences.
[0131] FIGS. 41A-41M-2. FIGS. 41A-B shows the Table presenting the
analysis of Type V-B (C2c1 protein-encoding) loci. * cas1cas4--gene
containing cas4 and cas1 domains; CRISPR--CRISPR repeat; SOS--SOS
response gene; unk--hypothetical protein; >--direction of gene
coding sequence; [D]--degenerate repeat (defined where it was
possible); [T]--tracrRNA. FIG. 41C-J shows CRISPR arrays analysis
of Type V-B (C2c1 protein-encoding) loci as disclosed herein
(CRISPR section is basic output of pilercr (see pilercr site for
description of output: www.drive5.com/pilercr/); repeat folding was
done with mfold (see mfold site for description of output:
mfold.rna.albany.edu/?q=mfold/DNA-Folding-Form); repeat folding and
CRISPRS array are placed after detailed description of each case;
for CRISPR location see link in the Table in FIG. 41A-B). FIG. 41K
shows CRISPRmap classification of CRISPR repeats of Type V-B (C2c1
protein-encoding) loci as disclosed herein using CRISPRmap (see
rna.informatik.uni-freiburg.de/CRISPRmap/Input.jsp for details).
FIG. 41L shows degenerate repeats of Type V-B (C2c1
protein-encoding) loci as disclosed herein found using CRISPRs
finder (crispr.upsud.fr/Server/). Normal repeat column contains
normal repeat, spacer--the last spacer, downstream--downstream
region starting from degenerate repeat (250 bp); array number
corresponds to the number of CRISPR array in the respective locus
(see the Table in FIG. 41A-B); region highlighted in yellow has a
perfect match between normal repeat and degenerate repeat (other
part of degenerate repeat does not match). FIG. 41M shows predicted
structures of tracrRNAs base-paired with the repeats. TracrRNA for
Alicyclobacillus acidoterrestric was identified using RNAseq. For
the remaining loci, putative tracrRNAs were identified based on
presence of an anti-direct repeat (DR) sequence. Anti-DRs were
identified using Geneious (www.geneious.com) by searching for
sequences within each respective CRISPR locus that are highly
homologus to DR. The 5' and 3' ends of each putative tracrRNA was
determined though computational prediction of bacterial
transcription start and termination sites using BPROM
(www.softberry.com) and ARNOLD
(rna.ig-mors.u-psud.fr/toolbox/arnold/) respectively. Co-folding
predictions were generated using Geneious. 5' ends are colored blue
and 3' ends are colored orange. FIG. 41C discloses SEQ ID NOS
1272-1311, respectively, in order of appearance. FIG. 41D discloses
SEQ ID NOS 1312-1319, respectively, in order of appearance. FIG.
41E discloses SEQ ID NOS 1320-1326, respectively, in order of
appearance. FIG. 41F discloses SEQ ID NOS 1327-1367, respectively,
in order of appearance. FIG. 41G discloses SEQ ID NOS 1368-1406,
respectively, in order of appearance. FIG. 41H discloses SEQ ID NOS
1407-1424, respectively, in order of appearance. FIG. 41I discloses
SEQ ID NOS 1425-1460, respectively, in order of appearance. FIG.
41J discloses SEQ ID NOS 1461-1471, respectively, in order of
appearance. FIG. 41K discloses SEQ ID NOS 1472-1489, respectively,
in order of appearance. FIG. 41L discloses the "Repeat" sequences
as SEQ ID NOS 1490-1499, the "Spacer" sequences as SEQ ID NOS
1500-1509, and the "Downstream" sequences as SEQ ID NOS 1510-1519,
all respectively, in order of appearance. FIG. 41L also discloses
SEQ ID NO: 1520 below the table. FIG. 41M discloses SEQ ID NOS
1521-1528, respectively, in order of appearance.
[0132] FIGS. 42A-42N-2. FIG. 42A-B shows the Table presenting the
analysis of Type VI (C2c2 protein-encoding) loci. * CRISPR--CRISPR
repeat; unk--hypothetical protein; >--direction of gene coding
sequence; [D]--degenerate repeat (defined where it was possible);
[T]--tracrRNA. FIG. 42C-I shows CRISPR arrays analysis of Type VI
(C2c2 protein-encoding) loci as disclosed herein (CRISPR section is
basic output of pilercr (see pilercr site for description of
output: www.drive5.com/pilercr/); repeat folding was done with
mfold (see mfold site for description of output:
mfold.rna.albany.edu/?q=mfold/DNA-Folding-Form); repeat folding and
CRISPRS array are placed after detailed description of each case;
for CRISPR location see link in the Table in FIG. 42A-B). FIG. 42J
shows CRISPRmap classification of CRISPR repeats of Type VI (C2c2
protein-encoding) loci as disclosed herein using CRISPRmap (see
rna.informatik.uni-freiburg.de/CRISPRmap/Input.jsp for details).
FIG. 42K-L shows degenerate repeats of Type VI (C2c2
protein-encoding) loci as disclosed herein found using CRISPRs
finder (crispr.upsud.fr/Server/). Normal repeat column contains
normal repeat, spacer--the last spacer, downstream--downstream
region starting from degenerate repeat (250 bp); array number
corresponds to the number of CRISPR array in the respective locus
(see the Table in FIG. 42A-B); region highlighted in yellow has a
perfect match between normal repeat and degenerate repeat (other
part of degenerate repeat does not match). FIG. 42M-N shows
predicted structures of tracrRNAs base-paired with the repeats.
Putative tracrRNAs were identified based on presence of an
anti-direct repeat (DR) sequence. Anti-DRs were identified using
Geneious (www.geneious.com) by searching for sequences within each
respective CRISPR locus that are highly homologus to DR. The 5' and
3' ends of each putative tracrRNA was determined though
computational prediction of bacterial transcription start and
termination sites using BPROM (www.softberry.com) and ARNOLD
(rna.ig-mors.u-psud.fr/toolbox/arnold/) respectively. Co-folding
predictions were generated using Geneious. 5' ends are colored blue
and 3' ends are colored orange. FIG. 42C discloses SEQ ID NOS
1529-1557, respectively, in order of appearance. FIG. 42D discloses
SEQ ID NOS 1558-1583, respectively, in order of appearance. FIG.
42E discloses SEQ ID NOS 1584-1623, respectively, in order of
appearance. FIG. 42F discloses SEQ ID NOS 1624-1645, respectively,
in order of appearance. FIG. 42G discloses SEQ ID NOS 1646-1660,
respectively, in order of appearance. FIG. 42H discloses SEQ ID NOS
1661-1678, respectively, in order of appearance. FIG. 42I discloses
SEQ ID NOS 1679-1689, respectively, in order of appearance. FIG.
42J discloses SEQ ID NOS 1690-1719, respectively, in order of
appearance. FIGS. 42K-L disclose "Normal Repeat" sequences as SEQ
ID NOS 1720-1735, "Spacer" sequences as SEQ ID NOS 1736-1751, and
"Downstream" sequences as 1752-1767, all respectively, in order of
appearance. FIG. 42M discloses SEQ ID NOS 1768-1771, respectively,
in order of appearance. FIG. 42N discloses SEQ ID NOS 1772-1775,
respectively, in order of appearance.
[0133] FIGS. 43A-43F. FIG. 43A-B shows the Table presenting the
analysis of Type V-C (C2c3 protein-encoding) loci. * CRISPR--CRISPR
repeat; unk--hypothetical protein; >--direction of gene coding
sequence; [D]--degenerate repeat (defined where it was possible).
FIG. 43C--shows CRISPR arrays analysis of Type V-C (C2c3
protein-encoding) loci as disclosed herein (CRISPR section is basic
output of CRISPRfinder (see for description:
crispr.u-psud.fr/Server/); repeat folding was done with mfold (see
mfold site for description of output:
mfold.rna.albany.edu/?q=mfold/DNA-Folding-Form); repeat folding and
CRISPRS array are placed after detailed description of each case;
for CRISPR location see link in the Table in FIG. 43A-B).
Statistically significant spacer's blast hits in prokaryotes or
their viruses are shown. FIG. 43E shows CRISPRmap classification of
CRISPR repeats of Type V-C (C2c3 protein-encoding) loci as
disclosed herein using CRISPRmap (see
rna.informatik.uni-freiburg.de/CRISPRmap/Input.jsp for details).
FIG. 43F shows degenerate repeats of Type V-C (C2c3
protein-encoding) loci as disclosed herein found using CRISPRs
finder (crispr.upsud.fr/Server/). Normal repeat column contains
normal repeat, spacer--the last spacer, downstream--downstream
region starting from degenerate repeat (250 bp); array number
corresponds to the number of CRISPR array in the respective locus
(see the Table in FIG. 43A-B); region highlighted in yellow has a
perfect match between normal repeat and degenerate repeat (other
part of degenerate repeat does not match). FIG. 43C discloses SEQ
ID NOS 1776-1807, respectively, in order of appearance. FIG. 43D
discloses SEQ ID NOS 1808-1828, respectively, in order of
appearance. FIG. 43E discloses SEQ ID NOS 1829-1834, respectively,
in order of appearance. FIG. 43F discloses SEQ ID NOS 1835-1837,
respectively, in order of appearance.
[0134] FIGS. 44A-44E-2 provides complete list of CRISPR-Cas loci in
the genomes where C2c1 or C2c2 proteins were found. Genes for C2c1
and C2c2 proteins are highlighted in yellow. FIGS. 44A-44E disclose
SEQ ID NOS 1838-1886, respectively, in order of appearance.
[0135] FIGS. 45A-45C shows alignment of Listeria loci encoding
putative Type VI CRISPR-Cas system. The aligned syntenic region
corresponds to Listeria weihenstephanensis FSL R9-0317 contig
AODJ01000004.1, coordinates 42281-46274 and Listeria newyorkensis
strain FSL M6-0635 contig JNFB01000012.1, coordinates
169489-173541. Color coding: C2c2 gene is highlighted by blue
CRISPR repeats--red, degenerated repeat--magenta, spacers--bold.
FIGS. 45A-45C disclose SEQ ID NOS 1887-1888, respectively, in order
of appearance.
[0136] FIG. 46 shows the two C2c2 loci of Carnobacterium
gallinarum.
[0137] FIG. 47 shows a schematic indicating the expression level of
two CRISPR arrays in the direction of the C2c2 gene at the first
C2c2 locus. Figure discloses SEQ ID NOS 1889-1890, respectively, in
order of appearance.
[0138] FIG. 48 shows a schematic indicating the expression level of
CRISPR arrays with direction of transcription in the direction of
the C2c2 gene at the second C2c2 locus. Figure discloses SEQ ID NOS
1891-1892, respectively, in order of appearance.
[0139] FIGS. 49A-49B. FIGS. 49A-49B shows expression and processing
of C2c2 loci. FIG. 49A: RNA-sequencing of the Listeria seeligeria
serovar 1/2b str. SLCC3954 C2c2 locus expressed in E. coli. The
locus is highly expressed with a processed crRNA showing a 5' 29-nt
DR and 15-18nt spacer. The putative tracrRNA shows no expression.
In silico RNA-folding of the processed crRNA direct repeat shows a
strong hairpin. FIG. 49B: Northern blot analysis of the
Leptotrichia shahii DSM 19757 expressed in E. coli shows processed
crRNAs with a 5' DR. Arrows indicate the probe positions and their
directionality. FIG. 49A discloses SEQ ID NOS 1893-1894,
respectively, in order of appearance.
[0140] FIGS. 50A-50C. FIGS. 50A-C shows expression and processing
of the Leptotrichia shahii DSM 19757 C2c2 locus. FIG. 50A:
RNA-sequencing of the Leptotrichia shahii DSM 19757 locus expressed
in E. coli shows processing of the CRISPR array in the 3' to 5'
direction (direction of the locus). crRNAs are processed to have a
5' DR that is 28nt in length and spacers with lengths 14-28nt. FIG.
50B RNA-sequencing of the endogenous Leptotrichia shahii DSM 19757
C2c2 locus shows similar results to FIG. 50A. FIG. 50C: In silico
folding of the L. shahii crRNA DR predicts stable secondary
structure. FIG. 50A discloses SEQ ID NO: 1895. FIG. 50B discloses
SEQ ID NO: 1896. FIG. 50C discloses SEQ ID NO: 1897.
[0141] FIG. 51 shows evolutionary scenario for the CRISPR-Cas
systems. The Cas8 protein is hypothesized to have evolved by
inactivation of Cas10 (shown by the white X) which was accompanied
by a major acceleration of evolution. Abbreviations: TR, terminal
repeats; TS, terminal sequences; HD, HD family endonuclease; HNH,
HNH family endonuclease; RuvC, RuvC family endonuclease; HEPN,
putative endoribonuclease of HEPN superfamily. Genes and protein
regions shown in gray denote sequences that were encoded in the
respective mobile elements but were eliminated in the course of
evolution of CRISPR-Cas systems.
[0142] FIG. 52 depicts arrangement of C2c2 gene locus, including
domains belonging to the HEPN domain superfamily. The majority of
HEPN domains contain conserved motifs and constitute
metal-independent endoRNases.
[0143] FIG. 53 depicts RNAseq analysis of an endogenous locus from
Leptotrichia shahii DSM 19757. Figure discloses SEQ ID NO:
1898.
[0144] FIG. 54 is a cartoon depicting in vivo experiment using E.
coli expressing LshC2c2 to identify depleted sequence motifs. A PAM
library conferring ampicillin resistance is transferred into E.
coli. Plasmids carrying sequence motifs containing a PAM
determinant are lost and unable to confer ampicillin resistance.
PAM sequence motifs are identified by their depletion..
[0145] FIG. 55 Identification of PAM sequence. Depleted sequences
identify the 5' PAM nucleotides
[0146] FIG. 56 depicts targeting of an endogenous target in E.
coli. Interference is indicated by a reduction in colony forming
units (cfu) pre 20 ng of plasmid. Interference was observed in E.
coli carrying LshC2C but not with a control pACYC 184. Increased
interference is associated with a transcribed target.
[0147] FIG. 57 depicts purification of C2c2 by His-Tag purification
followed by one round (left) or three rounds (middle) of gel
filtration, and a single 168 kD band by coomassie stain
(right).
[0148] FIG. 58 depicts components of in vitro experiments with
purified Lsh C2c2 and FPLC purified RNA target. Component "166"
indicates a non-complementary target. "E" indicate EDTA. Cleavage
of crRNA is observed when present with C2c2.
[0149] FIG. 59 depicts in vitro experiments with purified C2c2, RNA
target and crRNAs with spacer lengths of 12-26 nucleotides.
Cleavage of crRNAs with 28 or 24 nt spacers is observed.
[0150] FIG. 60 depicts an electrophoretic mobility shift assay
(EMSA) useful to detect protein complexes with nucleic acids.
[0151] FIG. 61 depicts targeting in vivo of transcribed red
fluorescent protein (RFP) using RFP spacers matching or
complementary to RNA. Spacers targeting transcribed RFP were cloned
into the Lsh C2c2 locus followed by expression in E. coli carrying
a plasmid expressing RFP or a pUC19 plasmid control. Interference
was determined on the basis of colony forming units (cfu) per 20 ng
of transformed plasmid.
[0152] FIG. 62 depicts strand-dependent interference with plasmid
carrying an RFP target. Interference was measured as colony forming
units (cfu) for 6 RFP targets (left panel). Interference was
observed to depend on the strand targeted and the PAM nucleotide
present. Interference with non-targeted pUC19 control plasmid was
not observed (right panel).
[0153] FIGS. 63A-63C. FIG. 63 depicts effect on RFP expression of
C2c2 with targeting RNA complementary or non-complementary to
expressed RNA. A Schematic of RFP targeting in heterologous E. coli
system. LshC2c2 loci harboring spacers targeting RFP at various
PAMs were introduced into RFP-expressing E. coli. B Quantitation of
RFP targeting in E. coli for multiple spacers targeting A, C, or U
PAMs. RFP expression was measured by flow cytometry. C Quantitation
of RFP targeting in E. coli. Spacers with various PAMs targeting
either the non-coding strand ("DNA") or coding strand ("RNA") of
the RFP gene were introduced and RFP expression was measured by
flow cytometry. FIG. 63A discloses SEQ ID NO: 1899.
[0154] FIG. 64 depicts processing of direct repeat (DR) sequences
by LshC2c2. LshC2c2 processes the DR on the 5' end. Figure
discloses SEQ ID NO: 1900.
[0155] FIG. 65 depicts strategy for investigating target site
selection. Target 1 (T1) contains a G PAM, Target 3 (T3) contains a
C PAM.
[0156] FIG. 66 depicts results of a C2c2 RNA cleavage reaction
targeted to T3 (see FIG. 65). Reaction components are
indicated.
[0157] FIG. 67 depicts results of a C2c2 RNA cleavage reaction
targeted to T1 (see FIG. 65). Reaction components are
indicated..
[0158] FIG. 68 depicts C2c2-mediated cleavage directed to RNA
expressed from a DNA template in vitro. Reaction components are
indicated. Lanes 2-8: C2c2-mediated cleavage is targeted to T1 (see
FIG. 65). Lanes 9-15: C2c2-mediated cleavage is targeted to the
reverse complement of T1.
[0159] FIG. 69 depicts C2c2-mediated cleavage directed to RNA
expressed from a DNA template in vitro. Reaction components are
indicated. Lanes 2-8: C2c2-mediated cleavage is targeted to T3 (see
FIG. 65).
[0160] FIG. 70 depicts RNA fragment sizes observed for
C2c2-mediated cleavage targeted to T1 or T3 (see FIG. 65).
[0161] FIG. 71 depicts C2c2 mediated RNA cleavage of targets T1 and
T3. There are multiple cleavage products and significant reduction
in intensity of the target band. Buffer 1: 40 mM Tris-HCl (pH 7.9),
6 mM MgCL.sub.2, 83 mM NaCl, 1 mM DTT, rNTPs, T7 polymerase. Buffer
2: 25 mM Tris-HCl (pH 7.5), 10 mM MgCL.sub.2, 83 mM NaCl, 5 mM DTT.
Buffer 2 replicates reaction conditions without DNA template.
[0162] FIG. 72 shows mutation of either HEPN domain abolishes RNA
targeting.
[0163] FIG. 73 shows a schematic overview of an RNA PAM screen
using MS2 phage interference. A library consisting of spacers
targeting all possible sequences in the MS2 RNA genome was cloned
into the LshC2c2 CRISPR array. Cells with this library population
were then treated with phage and plated, and surviving cells were
harvested. Frequency of spacers were compared to an phage-untreated
control, and phage-enriched spacers were used for generation of
sequence logos.
[0164] FIG. 74 indicates that RNA phage interference screen shows
both strong enrichment and depletion of LshC2c2 spacers by RNA PAM
screen using MS2 phage interference.
[0165] FIGS. 75A-75J. FIGS. 75A-C shows identification of a single
base right PAM for LshC2c2 by RNA PAM screen using MS2 phage
interference. More particularly it shows the presence of a right H
PAM (not G). FIG. 75C shows the quantitation of MS2 plaque assay
validating the presence of the PAM. Multiple spacers targeting each
PAM were cloned into the LshC2c2 locus. Phage dilutions were
spotted on bacteria plates and interference was quantified by
highest dilution without plaques. FIG. 75D shows representative
images from validation of MS2 plaque assay showing reduced plaque
formation in H PAM spacers, but not in G PAM spacers. FIG. 75E
shows nuclease activity with G PAM spacers and resistance with H
PAM spacers. FIG. 75 F shows a schematic of the RNA target, showing
the protospacer region and the corresponding crRNA. FIG. 75 G shows
denaturing gel demonstrating ssRNA cleavage activity of LshC2c2
using an RNA target that is 5' labeled with IRDye 800 and 3'
labeled with Cy5. Four independent cleavage sites are observed.
FIG. 75 H shows a denaturing gel demonstrating the H PAM (not G).
ssRNA cleavage activity is dependent on the nucleotide immediately
3' of the target site. The PAM was tested by mutating this adjacent
nucleotide and using the same crRNA/target site. FIG. 75 I is a
schematic showing the positions of tiled crRNAs to demonstrate
retargeting of LshC2c2 and the H PAM (top panel) and the
corresponding denaturing gel (bottom panel). Five different crRNAs
were tested for each possible nucleotide. Also shown is a
denaturing gel demonstrating the H PAM using different crRNAs tiled
along the length of the ssRNA target. Five different crRNAs were
tested for each possible nucleotide. FIG. 75J shows a denaturing
gel testing the presence of a spacer motif. Three crRNAs with every
possible last nucleotide as the last base of the spacer sequence
were tested. FIG. 75D discloses SEQ ID NOS 1901-1904, respectively,
in order of appearance. FIG. 75F discloses SEQ ID NOS 1905-1906,
respectively, in order of appearance. FIG. 75I discloses SEQ ID NOS
1907-1910, respectively, in order of appearance.
[0166] FIG. 76 shows for LshC2c2 RNA phage MS2 restriction. Cloned
spacers targeting each of the four MS2 genes, with C and G PAMs. G
PAMs require higher phage concentrations for plaque
development.
[0167] FIG. 77 shows that targeting of RFP transcripts in bacteria
slows growth rate.
[0168] FIGS. 78A-78D. FIGS. 78 A-B demonstrates that LshC2c2
efficiently cleaves RNA. Mini gel readout; non fluorescence. FIG.
78C demonstrates ssRNA cleavage by LshC2c2 using a 5' labeled and
3' labeled target were assayed at the indicated time points. FIG.
78D shows the quantitation of data of FIG. 78B.
[0169] FIG. 79. LshC2c2 protein and crRNA were incubated and
serially diluted. ssRNA cleavage was assayed using the indicated
complex concentrations.
[0170] FIG. 80 demonstrates that LshC2c2 efficiently cleaves RNA.
20 cm gel readout; 700 nm fluorescent imaging. Cleavage is observed
just with a smaller 85nt RNA target instead of the usual 173nt
target.
[0171] FIG. 81 shows mapping of cleavage fragments.
[0172] FIG. 82 shows RNA-sequencing of in vitro nuclease
reaction
[0173] FIG. 83 demonstrates that LshC2c2 does not cleave
untranscribed or transcribed DNA in an E. coli RNAP in vitro assay.
Assay set-up as described in Samai et al. (Cell, 2015). 200 bp
target is used (corresponding to RNA target of FIG. 82). 1 h
incubation at 37.degree. C. for concurrent transcription and
cleavage after open complex formation.
[0174] FIG. 84 demonstrates that LshC2c2 does not cleave ssDNA in
vitro. 1 h incubation at 37.degree. C., ssDNA version of t3 G-PAM
and its reverse complement (RC).
[0175] FIGS. 85A-85B. FIG. 85 demonstrates that C2c2 does not
cleave dsDNA (A) and ssDNA (B). Band gel extracted and prepared for
next generation sequencing by Illumina MiSeq.
[0176] FIG. 86 demonstrates that LshC2c2 has a 3' G PAM for RNA
cleavage. Same target with varying PAMs. (PAM sequence shown is on
reverse complement, such that 5' C corresponds to 3'G).
[0177] FIG. 87 demonstrates that LshC2c2 does not require the small
RNA for RNA cleavage.
[0178] FIG. 88 demonstrates that LshC2c2 is reprogrammable and PAM
sensitive.
[0179] FIG. 89 demonstrates that LshC2c2 is reprogrammable and PAM
sensitive.
[0180] FIGS. 90A-90B. FIGS. 90A and B demonstrate ssRNA cleavage
was assayed using crRNAs of varied spacer length. FIG. 90B
discloses SEQ ID NOS 1911-1914, respectively, in order of
appearance.
[0181] FIGS. 91A-91C. FIGS. 91 A, B, and C demonstrates ssRNA
cleavage was assayed using crRNAs of varied DR length. RNA cleavage
is crRNA length dependent (FIG. 91A, B). RNA cleavage is DR length
dependent FIG. 91C-E). FIG. 91A discloses SEQ ID NO: 1915. FIG. 91B
discloses SEQ ID NO: 1916. FIG. 91C discloses SEQ ID NO: 1917.
[0182] FIGS. 92A-92D. FIGS. 92 A, B, C, and D show LshC2c2 cr Stem
Modifications and demonstrates that Stem is amenable to individual
base swaps but activity is disrupted by most secondary structure
changes. DR Truncation experiments also indicate that disruption of
the stem abolishes cleavage. FIG. 92A discloses SEQ ID NOS
1918-1927, respectively, in order of appearance. FIG. 92D discloses
SEQ ID NOS 1928-1937, top to bottom, left to right, respectively,
in order of appearance.
[0183] FIGS. 93A-93D. FIGS. 93 A, B, C, and D shows LshC2c2 cr loop
Modifications and demonstrates that the crRNA loop is amenable to
base changes and extension but not truncation. FIG. 93A discloses
SEQ ID NOS 1938-1947, respectively, in order of appearance.
[0184] FIG. 93D discloses SEQ ID NOS 1948-1956, respectively, in
order of appearance.
[0185] FIG. 94 demonstrates that C2c2 processes its own array . . .
Buffer 1: 40 mM Tris-HCl (pH 7.9), 6 mM MgCl2, 70 mM NaCl, 1 mM
DTT. Buffer 2: 40 mM Tris-HCl (pH 7.3), 6 mM MgCl2, 70 mM NaCl, 1
mM DTT, Murine RNAse inhibitor. LshC2c2 cleaves both array 1 and
array 2 (arrays of different lengths) in both buffers tested.
Cleavage is evident by generation of lower bands
[0186] FIG. 95 demonstrates that HEPN mutants still process the
c2c2 CRISPR array.
[0187] FIG. 96 demonstrates that processing of the C2c2 array in E.
coli requires the C2c2 protein.
[0188] FIGS. 97A-97D. FIG. 97 A schematic shows different HEPN
mutations in C2c2. Schematic of locus and LshC2c2 protein, showing
conserved residues in HEPN domains. FIGS. 97 B and C demonstrate
that each of the HEPN mutants significantly lack activity. C top
panel: Denaturing gel showing conserved residues of the HEPN motif
are necessary for ssRNA cleavage. C bottom panel: Quantitation of
MS2 plaque assay with HEPN catalytic residue mutants. Loci with
mutant LshC2c2 were unable to protect against phage. D.
Quantitation of RFP targeting in E. coli with arginine HEPN
catalytic residue mutants. Loci with mutant LshC2c2 were unable to
knock down RFP. FIG. 97C discloses SEQ ID NOS 1957-1958,
respectively, in order of appearance. FIG. 97D discloses SEQ ID NO:
1959.
[0189] FIG. 98 shows bystander effect. Once active, C2c2 seems to
become active and degrade other RNAs in the sample. Top panel:
L=long target, small=small target, LC=long target with C PAM.
Bottom panel: effect of presence or absence of activator target on
cleavage of different bystander targets.
[0190] FIGS. 99A-99C. FIGS. 99 A demonstratres that the C2c2 HEPN
mutant still binds the crRNA. Figures B and C demonstrate the
influence of secondary structure of the RNA on cleavage product of
the target RNA. FIG. 99B discloses SEQ ID NOS 2225-2228,
respectively, in order of appearance.
[0191] FIGS. 100A-100B. FIG. 100 A shows the effect of different
divalent cations on C2c2 activity. FIG. 100 B shows the effect of
crRNA titration in the presence or absence of magnesium.
[0192] FIG. 101 shows a denaturing gel demonstrating ssRNA cleavage
activity of LshC2c2 using an RNA target that is 5' labeled with
IRDye 800 and 3' labeled with Cy5. Four independent cleavage sites
are observed. This figures also shows the effect of Mg++ chelation
on ssRNA cleavage activity.
[0193] FIG. 102 demonstrates that C2c2 cuts 3' of the target
site.
[0194] FIG. 103 demonstrates that C2c2 cuts 3' of target site.
Figure discloses SEQ ID NO: 1960.
[0195] FIG. 104 shows C2c2 reprogramming with crRNAs. Figure
discloses SEQ ID NO: 1961.
[0196] FIG. 105 shows C2c2 reprogramming with crRNAs.
[0197] FIG. 106 shows C2c2 reprogramming with crRNAs.
[0198] FIG. 107 shows IVC (in vitro nuclease reaction) of a long
target.
[0199] FIG. 108 shows bystander effect. Reduced cleavage is
observed in absence of magnesium.
[0200] FIG. 109-1 to 109-2 illustrates the sequences alignment of
the following orthologs of the Leptotrichia shahii DSM 19757 C2c2:
Rhodobacter capsulatus SB 1003 (RcS); Rhodobacter capsulatus R121
(RcR); Rhodobacter capsulatus DE442 (RcD); Lachnospiraceae
bacterium MA2020 (Lb(X)); Lachnospiraceae bacterium NK4A179 (Lb(X);
[Clostridium] aminophilum DSM 10710 (CaC); Lachnospiraceae
bacterium NK4A144 (Lb(X); Leptotrichia wadei F0279 (Lew);
Leptotrichia wadei F0279 (Lew); Carnobacterium gallinarum DSM 4847
(Cg); Carnobacterium gallinarum DSM 4847 (Cg); Paludibacter
propionicigenes WB4 (Pp); Listeria seeligeri serovar 1/2b (Ls);
Listeria weihenstephanensis FSL R9-0317 (Liw); and Listeria
bacterium FSL M6-0635 (Lib).
[0201] FIG. 110 depicts conserved HEPN domains of C2c2 proteins.
Figure discloses SEQ ID NOS 1962-2057, respectively, in order of
appearance.
[0202] FIG. 111. Demonstrates that C2c2 HEPN mutants retain
targeted binding activity. Top panels: electrophoretic mobility
shift assay with wild type LshC2c2-crRNA complex against on-target
ssRNA and non-targeting complementary ssRNA. Bottom panels:
electrophoretic mobility shift assay with HEPN mutant R1278A
LshC2c2-crRNA complex against on-target ssRNA and non-targeting
complementary ssRNA.
[0203] FIGS. 112A-112D. FIG. 112 Effect of RNA target-crRNA
mismatches on LshC2c2 RNAse activity. A. Quantitation of MS2 plaque
assay testing single mismatches at various positions in the spacer.
Single mismatches have minimal effect on phage interference.
Locations of mismatches are shown in red; all mismatches are
transversions. B. Quantitation of MS2 plaque assay testing double
mismatches at various positions in the spacer. Consecutive double
mismatches in the middle of the spacer eliminate phage
interference. Locations of mismatches are shown in red; all
mismatches are transversions. C. in vitro Lshc2c2 cleavage assaying
single mismatches in the crRNA. Single mismatches have minimal
effect on ssRNA cleavage. Locations of mismatches are shown in red;
all mismatches are transversions. D. in vitro Lshc2c2 cleavage
assaying double mismatches in the crRNA. Consecutive double
mismatches in the middle of the crRNA abrogate LshC2c2 activity.
Locations of mismatches are shown in red; all mismatches are
transversions. FIG. 112A discloses SEQ ID NO: 2058. FIG. 112B
discloses SEQ ID NO: 2059. FIG. 112C discloses SEQ ID NO: 2060.
FIG. 112D discloses SEQ ID NO: 2061.
[0204] FIG. 113-1 to 113-3. Cleavage of three ssRNA targets that
have the same crRNA target sequence flanked by different sequences.
The secondary structure and sequence of each of the three targets
is shown (top) and the cleavage patterns of each target by C2c2 are
shown using a 10% PAGE gel (bottom). Figure discloses SEQ ID NOS
2062-2067, respectively, in order of appearance.
[0205] FIGS. 114A-114B-2. Mapping of C2c2 cleavage sites by RNA
sequencing A by position; B by secondary structure. A Plots of the
frequency of cleavage ends observed in RNA-sequencing data for 5'
anchored fragments. This data is projected onto secondary structure
in (B). B The cleavage sites of targets 1 and 3 were mapped using
RNA-sequencing of the cleavage reaction. The frequency of ends of
each fragment (anchored at the 5' end) are mapped to z-scores and
projected onto the secondary structure of the target. FIG. 114B
discloses SEQ ID NOS 2068-2071, respectively, in order of
appearance.
[0206] FIGS. 115A-115I shows further target environment secondary
structures useful for evaluation of C2c2 cleavage efficiency and
cleavage site mapping.
[0207] FIGS. 116A-116E. Heterologous expression of the Leptotrichia
shahii C2c2 locus mediates robust interference of RNA phage in
Escherichia coli. (A) Schematic for the MS2 bacteriophage
interference screen. A library consisting of spacers targeting all
possible sequences in the MS2 RNA genome was cloned into the
LshC2c2 CRISPR array. Cells transformed with the MS2-targeting
spacer library were then treated with phage and plated, and
surviving cells were harvested. The frequency of spacers was
compared to an untreated control (no phage), and enriched spacers
from the phage-treated condition were used for the generation of
PAM sequence logos. (B) Box plot showing the distribution of
normalized crRNA frequencies for the phage-treated condition and
control screen biological replicates (n=2). The box extends from
the first to third quartile with whiskers denoting the 1st and 99th
percentiles. The mean is indicated by the red horizontal bar. (C)
Sequence logo generated from sequences flanking the 3' end of
protospacers corresponding to enriched spacers, revealing the
presence of a 3' H PAM (not G). (D) Plaque assay used to validate
the functional significance of the H PAM in MS2 interference. All
protospacers flanked by non-G PAMs exhibited robust phage
interference. Spacer were designed to target the MS2 mat gene and
their sequences are shown above the plaque images; the spacer used
in the non-targeting control is not complementary to any sequence
in either the E. coli or MS2 genome. Phage spots were applied as
series of half-log dilutions. (E) Quantitation of MS2 plaque assay
validating the H (non-G) PAM requirement. 4 MS2-targeting spacers
were designed for each PAM. Phage dilutions were spotted onto
bacterial plates as series of half-log dilutions and interference
was estimated based on the highest dilution without plaques. Each
point on the scatter plot represents the average of three
biological replicates and corresponds to a single spacer. Bars
indicate the mean of 4 spacers for each PAM and errors are shown as
the s.e.m. FIG. 116A discloses SEQ ID NOS 2072-2076, respectively,
in order of appearance. FIG. 116D discloses SEQ ID NOS 2077-2080,
respectively, in order of appearance.
[0208] FIGS. 117A-117D. LshC2c2 and crRNA mediate RNA-guided ssRNA
cleavage. (A) Schematic of the ssRNA substrate being targeted by
the crRNA. The protospacer region is highlighted in blue and the
PAM is indicated by the magenta bar. (B) A denaturing gel
demonstrating crRNA-mediated ssRNA cleavage by LshC2c2. The ssRNA
target is either 5' labeled with IRDye 800 or 3' labeled with Cy5.
Cleavage requires the presence of the crRNA and is abolished by
addition of EDTA. Four cleavage sites are observed. (C) A
denaturing gel demonstrating the requirement for an H PAM (not G).
Four ssRNA substrates that are identical except for the PAM base
(indicated by the magenta X in the schematic) were used for the in
vitro cleavage reactions. ssRNA cleavage activity is dependent on
the nucleotide immediately 3' of the target site. (D) Schematic
showing five protospacers for each PAM on the ssRNA target (top).
Denaturing gel showing crRNA-guided ssRNA cleavage activity. crRNAs
correspond to protospacer numbering. FIG. 117A discloses SEQ ID NOS
2081-2082, respectively, in order of appearance. FIG. 117D
discloses SEQ ID NO: 2083.
[0209] FIGS. 118A-118I. C2c2 cleavage sites are determined by
secondary structure and sequence of the target RNA. (A) Schematic
of homopolymer ssRNA targets. The protospacer is indicated by the
light blue bar. Homopolymer stretches of A (green) and U (red)
bases are interspaced by individual bases of G (orange) and C
(purple). (B) Denaturing gel showing C2c2-crRNA-mediated cleavage
patterns of each homopolymer. (C) Denaturing gel showing
C2c2-crRNA-mediated cleavage of three non-homopolymeric ssRNA
targets (1, 4, 5) that share the same protospacer but are flanked
by different sequences. Despite identical protospacers, different
flanking sequences resulted in different cleavage patterns. (D, F,
and H) The cleavage sites of non-homopolymer ssRNA targets 1(D), 4
(F), and 5 (H) were mapped using RNA-sequencing of the cleavage
products. The frequency of cleavage at each base is colored
according to the z-score and shown on the predicted crRNA-ssRNA
co-fold secondary structure. Fragments used to generate the
frequency analysis contained the complete 5' end. The 5' and 3' end
of the ssRNA target are indicated by blue and red outlines
respectively. The 5' and 3' end of the spacer (outlined in yellow)
is indicated by blue and orange highlights respectively. (E, G, and
I) Plots of the frequencies of cleavage sites for each position of
ssRNA targets 1, 4, and 5 for all reads that begin at the 5' end.
The protospacer is indicated by the blue highlighted region. FIG.
118D discloses SEQ ID NOS 2084-2085, respectively, in order of
appearance. FIG. 118F discloses SEQ ID NOS 2086-2087, respectively,
in order of appearance. FIG. 118H discloses SEQ ID NOS 2088-2089,
respectively, in order of appearance.
[0210] FIGS. 119A-119E. The two HEPN domains of C2c2 are necessary
for crRNA-guided ssRNA cleavage but not for crRNA-guided
ssRNA-binding. (A) Schematic of the LshC2c2 locus and the domain
organization of the LshC2c2 protein, showing conserved residues in
HEPN domains. (B) Quantification of MS2 plaque assay with HEPN
catalytic residue mutants. For each mutant, the same crRNA
targeting protospacer 35 was used. (C) Denaturing gel showing
conserved residues of the HEPN motif are necessary for crRNA-guided
ssRNA cleavage. (D) Electrophoretic mobility shift assay (EMSA)
evaluating affinity of the wild type LshC2c2-crRNA complex against
a targeted (left) and a non-targeted (right) ssRNA substrate. The
non-targeted ssRNA substrate is the reverse-complement of the
targeted ssRNA. EDTA is supplemented to reaction condition to
reduce any cleavage activity. (E) Electrophoretic mobility shift
assay with LshC2c2(R1278A)-crRNA complex against on-target ssRNA
and non-targeting complementary ssRNA (same substrate sequences as
in D). FIG. 119B discloses SEQ ID NOS 2090-2091, respectively, in
order of appearance.
[0211] FIGS. 120A-120B. RNA-guided RNase activity of LshC2c2 is
dependent on spacer and direct repeat lengths. (A) Denaturing gel
showing crRNA-guided cleavage of ssRNA 1 as a function of spacer
length.. (B) Denaturing gel showing crRNA-guided cleavage of ssRNA
1 as a function of the direct repeat length. FIG. 120A discloses
SEQ ID NOS 2092-2095, respectively, in order of appearance. FIG.
120B discloses SEQ ID NO: 2096.
[0212] FIGS. 121A-121B. RNA-guided RNase activity of LshC2c2 is
dependent on direct repeat structure and sequence. (A) Schematic
showing modifications to the crRNA direct repeat stem (top).
Altered bases are shown in red. Denaturing gel showing crRNA-guided
cleavage of ssRNA 1 by each modified crRNA (bottom). (B) Schematic
showing modifications to the loop region of the crRNA direct repeat
(top). Altered bases are shown in red and deletion lengths are
indicated by arrows. Denaturing gel showing crRNA-guided cleavage
of ssRNA 1 by each modified crRNA (bottom). FIG. 121A discloses SEQ
ID NOS 2097-2106, top to bottom, left to right, respectively, in
order of appearance. FIG. 121B discloses SEQ ID NOS 2107-2115,
respectively, in order of appearance.
[0213] FIGS. 122A-122D. Effect of RNA target-crRNA mismatches on
LshC2c2 RNase activity. (A) Quantification of MS2 plaque assays
testing single mismatches at various positions in the spacer.
Single mismatches have minimal effect on phage interference.
Locations and identity of mismatches are shown in red. (B)
Quantification of MS2 plaque assays testing double mismatches at
various positions in the spacer. Consecutive double mismatches in
the middle of the spacer eliminate phage interference. Locations
and identity of mismatches are shown in red. (C) Schematic showing
the position and identity of mismatches (red) in the crRNA spacer
(top). Denaturing gel showing cleavage of ssRNA 1 guided by crRNAs
with single mismatches in the spacer (bottom). (D) Schematic
showing the position and identity of pairs of mismatches (red) in
the crRNA spacer (top). Denaturing gel showing cleavage of ssRNA 1
guided by crRNAs with pairs of mismatches in the spacer (bottom).
FIG. 122A discloses SEQ ID NOS 2116-2123, respectively, in order of
appearance. FIG. 122B discloses SEQ ID NOS 2124-2129, respectively,
in order of appearance. FIG. 122C discloses SEQ ID NOS 2130-2138,
respectively, in order of appearance. FIG. 122D discloses SEQ ID
NOS 2139-2145, respectively, in order of appearance.
[0214] FIGS. 123A-123E. RFP mRNA knockdown by retargeting LshC2c2.
(A) Schematic showing crRNA-guided knockdown of RFP in E. coli
heterologously expressing the LshC2c2 locus. Three RFP-targeting
spacers were selected for each non-G PAM and each protospacer on
the RFP mRNA is numbered. (B) RFP mRNA-targeting spacers effected
RFP knockdown whereas DNA-targeting spacers (coding strand of the
RFP gene on the expression plasmid, indicated as "rc" spacers) did
not affect RFP expression. n=3 biological replicates. (C)
Quantification of RFP knockdown in E. coli. Three spacers each
targeting C, U, or A PAM-flanking protospacers (9 spacers, numbered
5-13 as indicated in panel (A)) in the RFP mRNA were introduced and
RFP expression was measured by flow cytometry. Each point on the
scatter plot represents the average of three biological replicates
and corresponds to a single spacer. Bars indicate the mean of 4
spacers for each PAM and errors are shown as the s.e.m. (D)
Timeline of E. coli growth assay. (E) Effect of RFP mRNA targeting
on the growth rate of E. coli transformed with an inducible RFP
expression plasmid as well as the LshC2c2 locus with non-targeting,
RNA targeting (spacer complementary to RFP gene non-coding strand),
and DNA targeting (spacer complementary to RFP gene coding strand)
spacers. FIG. 123A discloses SEQ ID NOS 2146-2148, respectively, in
order of appearance.
[0215] FIGS. 124A-124B. crRNA-guided target ssRNA cleavage
activates non-specific RNase activity of LshC2c2. (A) Schematic of
the biochemical assay for assaying non-specific RNase activity on
non-crRNA-targeted collateral RNA molecules. In addition to the
unlabeled crRNA-targeted ssRNA substrate, a second ssRNA with 3'
fluorescent labeling is added to the same reaction to readout
non-specific RNase activity. (B) Denaturing gel showing
non-specific RNase activity against non-targeted ssRNA substrates
in the presence of target RNA. The non-targeted ssRNA substrate is
not cleaved in the absence of the crRNA-targeted ssRNA
substrate.
[0216] FIG. 125. C2c2 is an RNA adaptive immune system with
possible involvement in abortive infection via programmed cell
death or dormancy induction.
[0217] FIG. 126. RNA-sequencing of the Leptotrichia shahii locus
heterologously expressed in E. coli and spacer analysis. Adapted
from S. Shmakov et al., Discovery and Functional Characterization
of Diverse Class 2 CRISPR-Cas Systems. Mol Cell 60, 385-397 (2015).
Heterologous expression of the LshC2c2 locus reveals processing of
the array. Insert: In silico co-folding analysis of a mature direct
repeat. Figure discloses SEQ ID NOS 2149-2150, respectively, in
order of appearance.
[0218] FIGS. 127A-127D. MS2 phage screen replicates show agreement
and do not have a 5' PAM. (A) Comparison of control (no phage)
replicates show agreement and lack of enrichment or depletion. (B)
Comparison of phage replicates reveals both substantial depletion
as well as an enriched population shared between both replicates.
(C) Sequence logo of 5' sequence from enriched spacers admits no
PAM. (D) Base frequency of 5' sequence from enriched spacers admits
no 5' PAM.
[0219] FIGS. 128A-128G. MS2 phage screen spacer representation
across each PAM. (A) Box plot showing the distribution of spacer
frequencies with spacers grouped by their 3' PAM for phage treated
conditions. Box extends from the first to third quartile with the
whiskers denoting the 1st percentile and 99th percentile. ****,
p<0.0001. (B) Multiple comparison test (ANOVA with Tukey
correction) between all possible PAM pairs for the phage treated
spacer distributions. Plotted are the confidence intervals for
difference in means between the compared PAM pairs. (C) Box plot
showing the distribution of spacer frequencies with spacers grouped
by their 3' PAM for non-phage treated conditions. Box extends from
the first to third quartile with the whiskers denoting the 1st
percentile and 99th percentile. ****, p<0.0001. (D) Multiple
comparison test (ANOVA with Tukey correction) between all possible
PAM pairs for the non-phage treated spacer distributions. Plotted
are the confidence intervals for difference in means between the
compared PAM pairs. (E) Cumulative frequency plots for the log 2
normalized spacer counts. Spacers are separated by respective PAM
to show the enrichment differences between each PAM distribution.
(F) The average cumulative frequency difference between the phage
and no phage cumulative frequency curves. The differences are shown
for each PAM distribution. (G) A zoomed in plot of the dotted box
in (F) to highlight the variation in enrichment between the
different PAMs.
[0220] FIGS. 129A-129B. Top hits from MS2 phage screen show
interference in plaque assay. (A) Images from validation of MS2
screen by plaque assay showing reduced plaque formation in top
hits. Phage dilutions were spotted on bacteria plates at decreasing
numbers of plaque forming units (PFU). Spacer targets are shown
above images; biological replicates are labeled BR1, BR2, or BR3.
Non-targeting control is the native LshC2c2 locus. (B) Quantitation
of MS2 plaque assay demonstrating interference by top hits.
Interference was quantified by highest dilution without plaques.
FIG. 129A discloses SEQ ID NOS 2151-2154, respectively, in order of
appearance.
[0221] FIG. 130-1 to 130-2. MS2 plaque assay validates the 3' H
PAM. Four spacers for each possible 3' PAM (A, G, C, and U) are
cloned into the pLshC2c2 vector and tested for MS2 phage
restriction in a plaque forming assay. The images show
significantly reduced plaque formation for A, C, and U PAMs, and
less restriction for the G PAM. Phage dilutions were spotted on
bacteria plates at decreasing numbers of plaque forming units
(PFU). Spacer targets are shown above images; three biological
replicates are vertically stacked under each protospacer sequence.
Non-targeting controls are the native LshC2c2 locus and the
pACYC184 backbone. Figure discloses SEQ ID NOS 2155-2170,
respectively, in order of appearance.
[0222] FIGS. 131A-131D. Protein purification of LshC2c2. (A)
Coomassie blue stained acrylamide gel of purified LshC2c2 stepwise
purification. A strong band just above 150 kD is consistent with
the size of LshC2c2 (171 kD). (B) Size exclusion gel filtration of
LshC2c2. LshC2c2 eluted at a size approximately >160 kD (62.9
mL). (C) Protein standards used to calibrate the Superdex 200
column. BDex=Blue Dextran (void volume), Ald=Aldolase (158 kD),
Ov=Ovalbumin (44 kD), RibA=Ribonuclease A (13.7 kD), Apr=Aprotinin
(6.5 kD). (D) Calibration curve of the Superdex 200 column. Kav is
calculated as (elution volume-void volume)/(geometric column
volume-void volume). Standards were plotted and fit to a
logarithmic curve.
[0223] FIGS. 132A-132B. Further in vitro characterization of the
RNA cleavage kinetics of LshC2c2. (A) A time series of LshC2c2
ssRNA cleavage using a 5'- and 3-end-labeled target 1. (B)
RNA-cleavage of 5'- and 3-end-labeled target 1 using LshC2c2-crRNA
complex that is serially diluted in half-log steps.
[0224] FIG. 133. Characterization of the metal dependence of
LshC2c2 RNA cleavage. A variety of divalent metal cations are
supplemented for the LshC2c2 cleavage reaction using 5'-end-labeled
target 1. Significant cleavage is only observed for Mg+2. Weak
cleavage is observed for Ca+2 and Mn+2.
[0225] FIGS. 134A-134D. LshC2c2 has no observable cleavage activity
when using dsRNA, dsDNA, or ssDNA substrates. (A) A schematic of
the partial dsRNA target. 5'-end-labeled target 1 is annealed to
two shorter RNAs that are complementary to the regions flanking the
protospacer site. This partial dsRNA is a more stringent test for
dsRNA cutting since it should still allow for LshC2c2 complex
binding to ssRNA. (B) LshC2c2 cleavage activity of a dsRNA target
shown in (A) compared to the ssRNA target 1. No cleavage is
observed when using the dsRNA substrate. (C) LshC2c2 cleavage of a
dsDNA plasmid library. A plasmid library was generated to have
seven randomized nucleotides 5' of protospacer 14 to account for
any sequence requirements for dsDNA cleavage. No cleavage is
observed for this dsDNA library. (D) A ssDNA version of target 1 is
tested for cleavage by LshC2c2. No cleavage is observed.
[0226] FIGS. 135A-135B. LshC2c2 has no observable cleavage activity
on dsDNA targets in a co-transcriptional cleavage assay. (A)
Schematic of co-transcriptional cleavage assay. C2c2 was incubated
with E. coli RNA polymerase (RNAP) elongation complexes and rNTP as
previously described (P. Samai et al., Co-transcriptional DNA and
RNA Cleavage during Type III CRISPR-Cas Immunity. Cell 161,
1164-1174 (2015)). (B) LshC2c2 cleavage of DNA target after
co-transcriptional cleavage assay. No cleavage is observed.
[0227] FIG. 136. MS2 restriction assay reveals that single HEPN
mutants abrogate LshC2c2 activity. All four possible single HEPN
mutants were generated in the pLshC2c2 vector (R597A, H602A,
R1278A, and H1283A) with protospacer 1. Images from plaque assay
testing these HEPN mutant loci show similar plaque formation to the
non-targeting locus and is significantly higher than the WtC2c2
locus. Phage dilutions were spotted on bacteria plates at
decreasing numbers of plaque forming units (PFU). Spacer targets
are shown above images; biological replicates are labeled BR1, BR2,
or BR3. Non-targeting control is the native LshC2c2 locus. Figure
discloses SEQ ID NO: 2171.
[0228] FIGS. 137A-137F. Quantitation of LshC2c2 binding. (A)
Calculation of binding affinity for wildtype LshC2c2-crRNA complex
and on-target ssRNA. Fraction of protein bound was quantified by
densitometry from FIG. 4D and KD was calculated by fitting to
binding isotherm. (B) Calculation of binding affinity for HEPN
mutant R1278A LshC2c2-crRNA complex and on-target ssRNA. Fraction
of protein bound was quantified by densitometry from FIG. 4E and KD
was calculated by fitting to binding isotherm. (C) Electrophoretic
mobility shift assay with HEPN mutant R1278A LshC2c2 against
on-target ssRNA in the absence of crRNA. EDTA is supplemented to
reaction condition. (D) Electrophoretic mobility shift assay crRNA
against on-target ssRNA. EDTA is supplemented to reaction
condition. (E) Calculation of binding affinity for HEPN mutant
R1278A LshC2c2 and on-target ssRNA in the absence of crRNA.
Fraction of protein bound was quantified by densitometry from FIG.
S12C and KD was calculated by fitting to binding isotherm. (F)
Calculation of binding affinity for crRNA and on-target ssRNA.
Fraction of crRNA bound was quantified by densitometry from FIG.
S12D and KD was calculated by fitting to binding isotherm.
[0229] FIG. 138. MS2 restriction assay testing the effect of single
and double mismatches on LshC2c2 activity. pLshC2c2 with
protospacer 41 was modified to have a series of single mismatches
and consecutive double mismatches as shown. Images from plaque
assay testing these mismatched spacers reveals reduced plaque
formation for the single-mismatch spacers on-par with the fully
complementary spacer. The double mismatch spacers show increased
plaque formation for a seed region in the middle of spacer
sequence. Phage dilutions were spotted on bacteria plates at
decreasing numbers of plaque forming units (PFU). Spacer targets
are shown above images; biological replicates are labeled BR1, BR2,
or BR3. Non-targeting control is the native LshC2c2 locus. Figure
discloses SEQ ID NOS 2173-2185, respectively, in order of
appearance.
[0230] FIG. 139. HEPN mutant LshC2c2 are tested for RFP mRNA
targeting activity. The pLshC2c2 vector with protospacer 36 was
modified to have the single HEPN mutants R597A and R1278A (one in
each of the HEPN domains). These mutations resulted in little
detectable RFP knockdown as measured by flow cytometry on the E.
coli. Figure discloses SEQ ID NOS 2186-2187, respectively, in order
of appearance.
[0231] FIGS. 140A-140B. Biochemical characterization of the
collateral cleavage effect. (A) LshCc2 is incubated with a crRNA
targeting protospacer 14 with and without unlabeled ssRNA target 1
(contains protospacer 14). When LshC2c2 is in the presence of
target 1, significant cleavage activity is observed for
fluorescently labeled non-complementary targets 6-9. (B) HEPN
mutant collateral activity is compared to WT C2c2. The proteins are
incubated with crRNA complementary to protospacer 14 and with and
without unlabeled homopolymer targets 2 or 3 (both containing
protospacer 14). The collateral effect is no longer observed with
the HEPN mutant proteins on the fluorescently labeled
non-complementary target 8.
[0232] FIGS. 141A-141B. Growth suppression is correlated with RFP
knockdown in cells that express C2c2 and RFP-targeting crRNA. FIG.
141A shows the effect on growth of inducible RFP expression in E.
coli expressing C2c2 and a crRNA that targets RFP. RFP was
expressed using an anhydrotetracycline (aTc)-inducible gene
expression system. Cell cultures were treated with aTc at the
concentrations indicated. Increasing aTc expression suppressed
growth. FIG. 141B shows the effect on growth of inducible RFP
expression when a non-targeting crRNA was substituted for the
RFP-targeting crRNA.
[0233] FIGS. 142A-142D. C2c2 preferentially cleaves at poly U
tracts. ssRNA cleavage by C2c2 was examined using ssRNA substrate
containing or lacking a poly U tract. End-labeled ssRNA was
incubated with C2c2 and crRNA and digestion products resolved. Poly
U-containing substrate RNA was efficiently cleaved. Substrate
cleavage was crRNA-dependent as shown by absence of digestion
products when C2c2 but not crRNA was present. Panels A and B:
3'-end labeled substrate. Panels C and D: 5'-end labeled substrate.
Panels B and D indicate substrate cleavage was efficient and
specific as substrate concentration was increased.
[0234] FIGS. 143A-143B. Cleavage of target RNA with mismatched
crRNA is position dependent. ssRNA target was treated with crRNA
containing double (panel A) or triple (panel B) mismatches and
LshC2c2. Products of cleavage reactions were separated by
electrophoresis. FIG. 143A discloses SEQ ID NOS 2188-2200,
respectively, in order of appearance. FIG. 143B discloses SEQ ID
NOS 2201-2207, respectively, in order of appearance.
[0235] FIG. 144. Cleavage of target RNA is sensitive to mutations
and deletions in the 3' direct repeat region. ssRNA target was
treated with LshC2c2 and crRNA containing mismatches or deletions
designed to disrupt secondary structure in the DR region. Products
of cleavage reactions were separated by electrophoresis. FIG. 144
discloses SEQ ID NOS 2208-2224, respectively, in order of
appearance.
[0236] FIGS. 145A-145B. C2c2 and MS2-crRNA can bind ssRNA. FIG.
145A. Binding of a LshC2c2(R1278A) which is defective for substrate
cleavage, to ssRNA was tested. FIG. 145B: LshC2c2(R1278A) and
MS2-crRNA were incubated with increasing amounts of labeled ssRNA
10 (left panel) or labeled reverse complement (RC) of ssRNA 10
(right panel). (See Table B for ssRNA 10 sequence).
[0237] FIG. 146. C2c2 complex does not bind ssDNA. LshC2c2(R1278A)
and MS2-crRNA were incubated with increasing amounts of ssDNA 10
(left panel) or ssDNA 10 reverse complement (RC) (right panel).
(See Table B for ssRNA 10 sequence).
[0238] The figures herein are for illustrative purposes only and
are not necessarily drawn to scale.
DETAILED DESCRIPTION OF THE INVENTION
[0239] In general, a CRISPR-Cas or CRISPR system as used in the
foregoing documents, such as WO 2014/093622 (PCT/US2013/074667) and
refers collectively to transcripts and other elements involved in
the expression of or directing the activity of CRISPR-associated
("Cas") genes, including sequences encoding a Cas gene, a tracr
(trans-activating CRISPR) sequence (e.g. tracrRNA or an active
partial tracrRNA), a tracr-mate sequence (encompassing a "direct
repeat" and a tracrRNA-processed partial direct repeat in the
context of an endogenous CRISPR system), a guide sequence (also
referred to as a "spacer" in the context of an endogenous CRISPR
system), or "RNA(s)" as that term is herein used (e.g., RNA(s) to
guide Cas, such as Cas9, e.g. CRISPR RNA and transactivating
(tracr) RNA or a single guide RNA (sgRNA) (chimeric RNA)) or other
sequences and transcripts from a CRISPR locus. In general, a CRISPR
system is characterized by elements that promote the formation of a
CRISPR complex at the site of a target sequence (also referred to
as a protospacer in the context of an endogenous CRISPR system).
When the CRISPR protein is a C2c2 protein, a tracrRNA is not
required.
[0240] In the context of formation of a CRISPR complex, "target
sequence" refers to a sequence to which a guide sequence is
designed to have complementarity, where hybridization between a
target sequence and a guide sequence promotes the formation of a
CRISPR complex. A target sequence may comprise any polynucleotide,
such as DNA or RNA polynucleotides. In some embodiments, a target
sequence is located in the nucleus or cytoplasm of a cell. In some
embodiments, direct repeats may be identified in silico by
searching for repetitive motifs that fulfill any or all of the
following criteria: 1. found in a 2Kb window of genomic sequence
flanking the type II CRISPR locus; 2. span from 20 to 50 bp; and 3.
interspaced by 20 to 50 bp. In some embodiments, 2 of these
criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In
some embodiments, all 3 criteria may be used.
[0241] In embodiments of the invention the terms guide sequence and
guide RNA, i.e. RNA capable of guiding Cas to a target genomic
locus, are used interchangeably as in foregoing cited documents
such as WO 2014/093622 (PCT/US2013/074667). In general, a guide
sequence is any polynucleotide sequence having sufficient
complementarity with a target polynucleotide sequence to hybridize
with the target sequence and direct sequence-specific binding of a
CRISPR complex to the target sequence. In some embodiments, the
degree of complementarity between a guide sequence and its
corresponding target sequence, when optimally aligned using a
suitable alignment algorithm, is about or more than about 50%, 60%,
75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may
be determined with the use of any suitable algorithm for aligning
sequences, non-limiting example of which include the Smith-Waterman
algorithm, the Needleman-Wunsch algorithm, algorithms based on the
Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner),
ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies;
available at www.novocraft.com), ELAND (Illumina, San Diego,
Calif.), SOAP (available at soap.genomics.org.cn), and Maq
(available at maq.sourceforge.net). In some embodiments, a guide
sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45,
50, 75, or more nucleotides in length. In some embodiments, a guide
sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12,
or fewer nucleotides in length. Preferably the guide sequence is 10
30 nucleotides long. The ability of a guide sequence to direct
sequence-specific binding of a CRISPR complex to a target sequence
may be assessed by any suitable assay. For example, the components
of a CRISPR system sufficient to form a CRISPR complex, including
the guide sequence to be tested, may be provided to a host cell
having the corresponding target sequence, such as by transfection
with vectors encoding the components of the CRISPR sequence,
followed by an assessment of preferential cleavage within the
target sequence, such as by Surveyor assay as described herein.
Similarly, cleavage of a target polynucleotide sequence may be
evaluated in a test tube by providing the target sequence,
components of a CRISPR complex, including the guide sequence to be
tested and a control guide sequence different from the test guide
sequence, and comparing binding or rate of cleavage at the target
sequence between the test and control guide sequence reactions.
Other assays are possible, and will occur to those skilled in the
art.
[0242] In a classic CRISPR-Cas systems, the degree of
complementarity between a guide sequence and its corresponding
target sequence can be about or more than about 50%, 60%, 75%, 80%,
85%, 90%, 95%, 97.5%, 99%, or 100%; a guide or RNA or sgRNA can be
about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or
more nucleotides in length; or guide or RNA or sgRNA can be less
than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer
nucleotides in length. However, an aspect of the invention is to
reduce off-target interactions, e.g., reduce the guide interacting
with a target sequence having low complementarity. Indeed, in the
examples, it is shown that the invention involves mutations that
result in the CRISPR-Cas system being able to distinguish between
target and off-target sequences that have greater than 80% to about
95% complementarity, e.g., 83%-84% or 88-89% or 94-95%
complementarity (for instance, distinguishing between a target
having 18 nucleotides from an off-target of 18 nucleotides having
1, 2 or 3 mismatches). Accordingly, in the context of the present
invention the degree of complementarity between a guide sequence
and its corresponding target sequence is greater than 94.5% or 95%
or 95.5% or 96% or 96.5% or 97% or 97.5% or 98% or 98.5% or 99% or
99.5% or 99.9%, or 100%. Off target is less than 100% or 99.9% or
99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96%
or 95.5% or 95% or 94.5% or 94% or 93% or 92% or 91% or 90% or 89%
or 88% or 87% or 86% or 85% or 84% or 83% or 82% or 81% or 80%
complementarity between the sequence and the guide, with it
advantageous that off target is 100% or 99.9% or 99.5% or 99% or
99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95%
or 94.5% complementarity between the sequence and the guide.
[0243] In certain embodiments, modulations of cleavage efficiency
can be exploited by introduction of mismatches, e.g. 1 or more
mismatches, such as 1 or 2 mismatches between spacer sequence and
target sequence, including the position of the mismatch along the
spacer/target. The more central (i.e. not 3' or 5') for instance a
double mismatch is, the more cleavage efficiency is affected.
Accordingly, by choosing mismatch position along the spacer,
cleavage efficiency can be modulated. By means of example, if less
than 100% cleavage of targets is desired (e.g. in a cell
population), 1 or more, such as preferably 2 mismatches between
spacer and target sequence may be introduced in the spacer
sequences. The more central along the spacer of the mismatch
position, the lower the cleavage percentage.
[0244] The methods according to the invention as described herein
comprehend inducing one or more nucleotide modifications in a
eukaryotic cell (in vitro, i.e. in an isolated eukaryotic cell) as
herein discussed comprising delivering to cell a vector as herein
discussed. The mutation(s) can include the introduction, deletion,
or substitution of one or more nucleotides at each target sequence
of cell(s) via the guide(s) RNA(s) or sgRNA(s). The mutations can
include the introduction, deletion, or substitution of 1-75
nucleotides at each target sequence of said cell(s) via the
guide(s) RNA(s). The mutations can include the introduction,
deletion, or substitution of 1, 5, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50,
or 75 nucleotides at each target sequence of said cell(s) via the
guide(s) RNA(s). The mutations can include the introduction,
deletion, or substitution of 5, 10, 11, 12, 13, 14, 15, 16, 17, 18,
19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, or
75 nucleotides at each target sequence of said cell(s) via the
guide(s) RNA(s). The mutations include the introduction, deletion,
or substitution of 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, or 75
nucleotides at each target sequence of said cell(s) via the
guide(s) RNA(s). The mutations can include the introduction,
deletion, or substitution of 20, 21, 22, 23, 24, 25, 26, 27, 28,
29, 30, 35, 40, 45, 50, or 75 nucleotides at each target sequence
of said cell(s) via the guide(s) RNA(s). The mutations can include
the introduction, deletion, or substitution of 40, 45, 50, 75, 100,
200, 300, 400 or 500 nucleotides at each target sequence of said
cell(s) via the guide(s) RNA(s).
[0245] For minimization of toxicity and off-target effect, it will
be important to control the concentration of Cas mRNA or protein
and guide RNA delivered. Optimal concentrations of Cas mRNA or
protein and guide RNA can be determined by testing different
concentrations in a cellular or non-human eukaryote animal model
and using deep sequencing the analyze the extent of modification at
potential off-target genomic loci.
[0246] Typically, in the context of an endogenous CRISPR system,
formation of a CRISPR complex (comprising a guide sequence
hybridized to a target sequence and complexed with one or more Cas
proteins) results in cleavage in or near (e.g. within 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target
sequence.
[0247] The nucleic acid molecule encoding a Cas is advantageously
codon optimized Cas. An example of a codon optimized sequence, is
in this instance a sequence optimized for expression in a
eukaryote, e.g., humans (i.e. being optimized for expression in
humans), or for another eukaryote, animal or mammal as herein
discussed; see, e.g., SaCas9 human codon optimized sequence in WO
2014/093622 (PCT/US2013/074667). Whilst this is preferred, it will
be appreciated that other examples are possible and codon
optimization for a host species other than human, or for codon
optimization for specific organs is known. In some embodiments, an
enzyme coding sequence encoding a Cas is codon optimized for
expression in particular cells, such as eukaryotic cells. The
eukaryotic cells may be those of or derived from a particular
organism, such as a mammal, including but not limited to human, or
non-human eukaryote or animal or mammal as herein discussed, e.g.,
mouse, rat, rabbit, dog, livestock, or non-human mammal or primate.
In some embodiments, processes for modifying the germ line genetic
identity of human beings and/or processes for modifying the genetic
identity of animals which are likely to cause them suffering
without any substantial medical benefit to man or animal, and also
animals resulting from such processes, may be excluded. In general,
codon optimization refers to a process of modifying a nucleic acid
sequence for enhanced expression in the host cells of interest by
replacing at least one codon (e.g. about or more than about 1, 2,
3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence
with codons that are more frequently or most frequently used in the
genes of that host cell while maintaining the native amino acid
sequence. Various species exhibit particular bias for certain
codons of a particular amino acid. Codon bias (differences in codon
usage between organisms) often correlates with the efficiency of
translation of messenger RNA (mRNA), which is in turn believed to
be dependent on, among other things, the properties of the codons
being translated and the availability of particular transfer RNA
(tRNA) molecules. The predominance of selected tRNAs in a cell is
generally a reflection of the codons used most frequently in
peptide synthesis. Accordingly, genes can be tailored for optimal
gene expression in a given organism based on codon optimization.
Codon usage tables are readily available, for example, at the
"Codon Usage Database" available at www.kazusa.orjp/codon/ and
these tables can be adapted in a number of ways. See Nakamura, Y.,
et al. "Codon usage tabulated from the international DNA sequence
databases: status for the year 2000" Nucl. Acids Res. 28:292
(2000). Computer algorithms for codon optimizing a particular
sequence for expression in a particular host cell are also
available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also
available. In some embodiments, one or more codons (e.g. 1, 2, 3,
4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence
encoding a Cas correspond to the most frequently used codon for a
particular amino acid.
[0248] In certain embodiments, the methods as described herein may
comprise providing a Cas transgenic cell in which one or more
nucleic acids encoding one or more guide RNAs are provided or
introduced operably connected in the cell with a regulatory element
comprising a promoter of one or more gene of interest. As used
herein, the term "Cas transgenic cell" refers to a cell, such as a
eukaryotic cell, in which a Cas gene has been genomically
integrated. The nature, type, or origin of the cell are not
particularly limiting according to the present invention. Also the
way how the Cas transgene is introduced in the cell is may vary and
can be any method as is known in the art. In certain embodiments,
the Cas transgenic cell is obtained by introducing the Cas
transgene in an isolated cell. In certain other embodiments, the
Cas transgenic cell is obtained by isolating cells from a Cas
transgenic organism. By means of example, and without limitation,
the Cas transgenic cell as referred to herein may be derived from a
Cas transgenic eukaryote, such as a Cas knock-in eukaryote.
Reference is made to WO 2014/093622 (PCT/US13/74667), incorporated
herein by reference. Methods of US Patent Publication Nos.
20120017290 and 20110265198 assigned to Sangamo BioSciences, Inc.
directed to targeting the Rosa locus may be modified to utilize the
CRISPR Cas system of the present invention. Methods of US Patent
Publication No. 20130236946 assigned to Cellectis directed to
targeting the Rosa locus may also be modified to utilize the CRISPR
Cas system of the present invention. By means of further example
reference is made to Platt et. al. (Cell; 159(2):440-455 (2014)),
describing a Cas9 knock-in mouse, which is incorporated herein by
reference. The Cas transgene can further comprise a
Lox-Stop-polyA-Lox(LSL) cassette thereby rendering Cas expression
inducible by Cre recombinase. Alternatively, the Cas transgenic
cell may be obtained by introducing the Cas transgene in an
isolated cell. Delivery systems for transgenes are well known in
the art. By means of example, the Cas transgene may be delivered in
for instance eukaryotic cell by means of vector (e.g., AAV,
adenovirus, lentivirus) and/or particle and/or nanoparticle
delivery, as also described herein elsewhere.
[0249] It will be understood by the skilled person that the cell,
such as the Cas transgenic cell, as referred to herein may comprise
further genomic alterations besides having an integrated Cas gene
or the mutations arising from the sequence specific action of Cas
when complexed with RNA capable of guiding Cas to a target locus,
such as for instance one or more oncogenic mutations, as for
instance and without limitation described in Platt et al. (2014),
Chen et al., (2014) or Kumar et al.. (2009).
[0250] In some embodiments, the Cas sequence is fused to one or
more nuclear localization sequences (NLSs), such as about or more
than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some
embodiments, the Cas comprises about or more than about 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus,
about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more
NLSs at or near the carboxy-terminus, or a combination of these
(e.g. zero or at least one or more NLS at the amino-terminus and
zero or at one or more NLS at the carboxy terminus). When more than
one NLS is present, each may be selected independently of the
others, such that a single NLS may be present in more than one copy
and/or in combination with one or more other NLSs present in one or
more copies. In a preferred embodiment of the invention, the Cas
comprises at most 6 NLSs. In some embodiments, an NLS is considered
near the N- or C-terminus when the nearest amino acid of the NLS is
within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more
amino acids along the polypeptide chain from the N- or C-terminus.
Non-limiting examples of NLSs include an NLS sequence derived from:
the NLS of the SV40 virus large T-antigen, having the amino acid
sequence PKKKRKV(SEQ ID NO: 1); the NLS from nucleoplasmin (e.g.
the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK)
(SEQ ID NO: 2); the c-myc NLS having the amino acid sequence
PAAKRVKLD (SEQ ID NO: 3) or RQRRNELKRSP(SEQ ID NO: 4); the hRNPA1
M9 NLS having the sequence
NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY(SEQ ID NO: 5); the sequence
RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 6) of the
IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO:
7) and PPKKARED (SEQ ID NO: 8) of the myoma T protein; the sequence
PQPKKKPL (SEQ ID NO: 9) of human p53; the sequence SALIKKKKKMAP
(SEQ ID NO: 10) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO:
11) and PKQKKRK (SEQ ID NO: 12) of the influenza virus NS1; the
sequence RKLKKKIKKL (SEQ ID NO: 13) of the Hepatitis virus delta
antigen; the sequence REKKKFLKRR (SEQ ID NO: 14) of the mouse Mx1
protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 15) of the
human poly(ADP-ribose) polymerase; and the sequence
RKCLQAGMNLEARKTKK (SEQ ID NO: 16) of the steroid hormone receptors
(human) glucocorticoid. In general, the one or more NLSs are of
sufficient strength to drive accumulation of the Cas in a
detectable amount in the nucleus of a eukaryotic cell. In general,
strength of nuclear localization activity may derive from the
number of NLSs in the Cas, the particular NLS(s) used, or a
combination of these factors. Detection of accumulation in the
nucleus may be performed by any suitable technique. For example, a
detectable marker may be fused to the Cas, such that location
within a cell may be visualized, such as in combination with a
means for detecting the location of the nucleus (e.g. a stain
specific for the nucleus such as DAPI). Cell nuclei may also be
isolated from cells, the contents of which may then be analyzed by
any suitable process for detecting protein, such as
immunohistochemistry, Western blot, or enzyme activity assay.
Accumulation in the nucleus may also be determined indirectly, such
as by an assay for the effect of CRISPR complex formation (e.g.
assay for DNA cleavage or mutation at the target sequence, or assay
for altered gene expression activity affected by CRISPR complex
formation and/or Cas enzyme activity), as compared to a control no
exposed to the Cas or complex, or exposed to a Cas lacking the one
or more NLSs or NESs. In certain embodiments, other localization
tags may be fused to the Cas protein, such as without limitation
for localizing the Cas to particular sites in a cell, such as
organells, such mitochondria, plastids, chloroplast, vesicles,
golgi, (nuclear or cellular) membranes, ribosomes, nucleoluse, ER,
cytoskeleton, vacuoles, centrosome, nucleosome, granules,
centrioles, etc.
[0251] In certain aspects the invention involves vectors, e.g. for
delivering or introducing in a cell Cas and/or RNA capable of
guiding Cas to a target locus (i.e. guide RNA), but also for
propagating these components (e.g. in prokaryotic cells). A used
herein, a "vector" is a tool that allows or facilitates the
transfer of an entity from one environment to another. It is a
replicon, such as a plasmid, phage, or cosmid, into which another
DNA segment may be inserted so as to bring about the replication of
the inserted segment. Generally, a vector is capable of replication
when associated with the proper control elements. In general, the
term "vector" refers to a nucleic acid molecule capable of
transporting another nucleic acid to which it has been linked.
Vectors include, but are not limited to, nucleic acid molecules
that are single-stranded, double-stranded, or partially
double-stranded; nucleic acid molecules that comprise one or more
free ends, no free ends (e.g. circular); nucleic acid molecules
that comprise DNA, RNA, or both; and other varieties of
polynucleotides known in the art. One type of vector is a
"plasmid," which refers to a circular double stranded DNA loop into
which additional DNA segments can be inserted, such as by standard
molecular cloning techniques. Another type of vector is a viral
vector, wherein virally-derived DNA or RNA sequences are present in
the vector for packaging into a virus (e.g. retroviruses,
replication defective retroviruses, adenoviruses, replication
defective adenoviruses, and adeno-associated viruses (AAVs)). Viral
vectors also include polynucleotides carried by a virus for
transfection into a host cell. Certain vectors are capable of
autonomous replication in a host cell into which they are
introduced (e.g. bacterial vectors having a bacterial origin of
replication and episomal mammalian vectors). Other vectors (e.g.,
non-episomal mammalian vectors) are integrated into the genome of a
host cell upon introduction into the host cell, and thereby are
replicated along with the host genome. Moreover, certain vectors
are capable of directing the expression of genes to which they are
operatively-linked. Such vectors are referred to herein as
"expression vectors." Common expression vectors of utility in
recombinant DNA techniques are often in the form of plasmids.
[0252] Recombinant expression vectors can comprise a nucleic acid
of the invention in a form suitable for expression of the nucleic
acid in a host cell, which means that the recombinant expression
vectors include one or more regulatory elements, which may be
selected on the basis of the host cells to be used for expression,
that is operatively-linked to the nucleic acid sequence to be
expressed. Within a recombinant expression vector, "operably
linked" is intended to mean that the nucleotide sequence of
interest is linked to the regulatory element(s) in a manner that
allows for expression of the nucleotide sequence (e.g. in an in
vitro transcription/translation system or in a host cell when the
vector is introduced into the host cell). With regards to
recombination and cloning methods, mention is made of U.S. patent
application Ser. No. 10/815,730, published Sep. 2, 2004 as US
2004-0171156 A1, the contents of which are herein incorporated by
reference in their entirety.
[0253] The vector(s) can include the regulatory element(s), e.g.,
promoter(s). The vector(s) can comprise Cas encoding sequences,
and/or a single, but possibly also can comprise at least 3 or 8 or
16 or 32 or 48 or 50 guide RNA(s) (e.g., sgRNAs) encoding
sequences, such as 1-2, 1-3, 1-4 1-5, 3-6, 3-7, 3-8, 3-9, 3-10,
3-8, 3-16, 3-30, 3-32, 3-48, 3-50 RNA(s) (e.g., sgRNAs). In a
single vector there can be a promoter for each RNA (e.g., sgRNA),
advantageously when there are up to about 16 RNA(s); and, when a
single vector provides for more than 16 RNA(s), one or more
promoter(s) can drive expression of more than one of the RNA(s),
e.g., when there are 32 RNA(s), each promoter can drive expression
of two RNA(s), and when there are 48 RNA(s), each promoter can
drive expression of three RNA(s). By simple arithmetic and well
established cloning protocols and the teachings in this disclosure
one skilled in the art can readily practice the invention as to the
RNA(s) for a suitable exemplary vector such as AAV, and a suitable
promoter such as the U6 promoter. For example, the packaging limit
of AAV is .about.4.7 kb. The length of a single U6-gRNA (plus
restriction sites for cloning) is 361 bp. Therefore, the skilled
person can readily fit about 12-16, e.g., 13 U6-gRNA cassettes in a
single vector. This can be assembled by any suitable means, such as
a golden gate strategy used for TALE assembly
(www.genome-engineering.org/taleffectors/). The skilled person can
also use a tandem guide strategy to increase the number of U6-gRNAs
by approximately 1.5 times, e.g., to increase from 12-16, e.g., 13
to approximately 18-24, e.g., about 19 U6-gRNAs. Therefore, one
skilled in the art can readily reach approximately 18-24, e.g.,
about 19 promoter-RNAs, e.g., U6-gRNAs in a single vector, e.g., an
AAV vector. A further means for increasing the number of promoters
and RNAs in a vector is to use a single promoter (e.g., U6) to
express an array of RNAs separated by cleavable sequences. And an
even further means for increasing the number of promoter-RNAs in a
vector, is to express an array of promoter-RNAs separated by
cleavable sequences in the intron of a coding sequence or gene;
and, in this instance it is advantageous to use a polymerase II
promoter, which can have increased expression and enable the
transcription of long RNA in a tissue specific manner. (see, e.g.,
nar.oxfordjournals.org/content/34/7/e53. short,
www.nature.com/mt/journal/v16/n9/abs/mt2008144a.html). In an
advantageous embodiment, AAV may package U6 tandem gRNA targeting
up to about 50 genes. Accordingly, from the knowledge in the art
and the teachings in this disclosure the skilled person can readily
make and use vector(s), e.g., a single vector, expressing multiple
RNAs or guides under the control or operatively or functionally
linked to one or more promoters-especially as to the numbers of
RNAs or guides discussed herein, without any undue
experimentation.
[0254] The guide RNA(s) encoding sequences and/or Cas encoding
sequences, can be functionally or operatively linked to regulatory
element(s) and hence the regulatory element(s) drive expression.
The promoter(s) can be constitutive promoter(s) and/or conditional
promoter(s) and/or inducible promoter(s) and/or tissue specific
promoter(s). The promoter can be selected from the group consisting
of RNA polymerases, pol I, pol II, pol III, T7, U6, H1, retroviral
Rous sarcoma virus (RSV) LTR promoter, the cytomegalovirus (CMV)
promoter, the SV40 promoter, the dihydrofolate reductase promoter,
the .beta.-actin promoter, the phosphoglycerol kinase (PGK)
promoter, and the EF1.alpha. promoter. An advantageous promoter is
the promoter is U6.
[0255] The CRISPR-Cas loci has more than 50 gene families and there
is no strictly universal genes. Therefore, no single evolutionary
tree is feasible and a multi-pronged approach is needed to identify
new families. So far, there is comprehensive cas gene
identification of 395 profiles for 93 Cas proteins. Classification
includes signature gene profiles plus signatures of locus
architecture. A new classification of CRISPR-Cas systems is
proposed in FIGS. 1A and 1B. Class 1 includes multisubunit
crRNA-effector complexes (Cascade) and Class 2 includes
Single-subunit crRNA-effector complexes (Cas9-like). FIG. 2
provides a molecular organization of CRISPR-Cas. FIG. 3 provides
structures of Type I and III effector complexes: common
architecture/common ancestry despite extensive sequence divergence.
FIG. 4 shows CRISPR-Cas as a RNA recognition motif (RRM)-centered
system. FIG. 5 shows Cas1 phylogeny where recombination of
adaptation and crRNA-effector modules show a major aspect of
CRISPR-Cas evolution. FIG. 6 shows a CRISPR-Cas census,
specifically a distribution of CRISPR-Cas types/subtypes among
archaea and bacteria.
[0256] The action of the CRISPR-Cas system is usually divided into
three stages: (1) adaptation or spacer integration, (2) processing
of the primary transcript of the CRISPR locus (pre-crRNA) and
maturation of the crRNA which includes the spacer and variable
regions corresponding to 5' and 3' fragments of CRISPR repeats, and
(3) DNA or RNA interference. Two proteins, Cas1 and Cas2, that are
present in the great majority of the known CRISPR-Cas systems are
sufficient for the insertion of spacers into the CRISPR cassettes.
These two proteins form a complex that is required for this
adaptation process; the endonuclease activity of Cas1 is required
for spacer integration whereas Cas2 appears to perform a
nonenzymatic function. The Cas1-Cas2 complex represents the highly
conserved "information processing" module of CRISPR-Cas that
appears to be quasi-autonomous from the rest of the system. (See
Annotation and Classification of CRISPR-Cas Systems. Makarova K S,
Koonin E V. Methods Mol Biol. 2015; 1311:47-75).
[0257] The previously described Class 2 systems, namely Type II and
the putative Type V, consisted of only three or four genes in the
cas operon, namely the cas1 and cas2 genes comprising the
adaptation module (the cas1-cas2 pair of genes are not involved in
interference), a single multidomain effector protein that is
responsible for interference but also contributes to the pre-crRNA
processing and adaptation, and often a fourth gene with
uncharacterized functions that is dispensable in at least some Type
II systems (and in some cases the fourth gene is cas4 (biochemical
or in silico evidence shows that Cas4 is a PD-(DE).times.K
superfamily nuclease with three-cysteine C-terminal cluster;
possesses 5'-ssDNA exonuclease activity) or csn2, which encodes an
inactivated ATPase). In most cases, a CRISPR array and a gene for a
distinct RNA species known as tracrRNA, a trans-encoded small
CRISPR RNA, are adjacent to Class 2 cas operons. The tracrRNA is
partially homologous to the repeats within the respective CRISPR
array and is essential for the processing of pre-crRNA that is
catalyzed by RNAse III, a ubiquitous bacterial enzyme that is not
associated with the CRISPR-cas loci.
[0258] Cas1 is the most conserved protein that is present in most
of the CRISPR-Cas systems and evolves slower than other Cas
proteins. Accordingly, Cas1 phylogeny has been used as the guide
for CRISPR-Cas system classification. Biochemical or in silico
evidence shows that Cas1 is a metal-dependent deoxyribonuclease.
Deletion of Cas1 in E. coli results in increased sensitivity to DNA
damage and impaired chromosomal segregation as described in "A dual
function of the CRISPR-Cassystem in bacterial antivirus immunity
and DNA repair," Babu M et al. Mol Microbiol 79:484-502 (2011).
Biochemical or in silico evidence shows that Cas 2 is a RNase
specific to U-rich regions and is a double-stranded DNase.
[0259] Aspects of the invention relate to the identification and
engineering of novel effector proteins associated with Class 2
CRISPR-Cas systems. In a preferred embodiment, the effector protein
comprises a single-subunit effector module. In a further embodiment
the effector protein is functional in prokaryotic or eukaryotic
cells for in vitro, in vivo or ex vivo applications. An aspect of
the invention encompasses computational methods and algorithms to
predict new Class 2 CRISPR-Cas systems and identify the components
therein.
[0260] In one embodiment, a computational method of identifying
novel Class 2 CRISPR-Cas loci comprises the following steps:
detecting all contigs encoding the Cas1 protein; identifying all
predicted protein coding genes within 20 kB of the cas1 gene, more
particularly within the region 20 kb from the start of the cas1
gene and 20 kb from the end of the cas1 gene; comparing the
identified genes with Cas protein-specific profiles and predicting
CRISPR arrays; selecting partial and/or unclassified candidate
CRISPR-Cas loci containing proteins larger than 500 amino acids
(>500 aa); analyzing selected candidates using PSI-BLAST and
HHPred, thereby isolating and identifying novel Class 2 CRISPR-Cas
loci. In addition to the above mentioned steps, additional analysis
of the candidates may be conducted by searching metagenomics
databases for additional homologs.
[0261] In one aspect the detecting all contigs encoding the Cas1
protein is performed by GenemarkS which a gene prediction program
as further described in "GeneMarkS: a self-training method for
prediction of gene starts in microbial genomes. Implications for
finding sequence motifs in regulatory regions." John Besemer,
Alexandre Lomsadze and Mark Borodovsky, Nucleic Acids Research
(2001) 29, pp 2607-2618, herein incorporated by reference.
[0262] In one aspect the identifying all predicted protein coding
genes is carried out by comparing the identified genes with Cas
protein-specific profiles and annotating them according to NCBI
Conserved Domain Database (CDD) which is a protein annotation
resource that consists of a collection of well-annotated multiple
sequence alignment models for ancient domains and full-length
proteins. These are available as position-specific score matrices
(PSSMs) for fast identification of conserved domains in protein
sequences via RPS-BLAST. CDD content includes NCBI-curated domains,
which use 3D-structure information to explicitly define domain
boundaries and provide insights into sequence/structure/function
relationships, as well as domain models imported from a number of
external source databases (Pfam, SMART, COG, PRK, TIGRFAM). In a
further aspect, CRISPR arrays were predicted using a PILER-CR
program which is a public domain software for finding CRISPR
repeats as described in "PILER-CR: fast and accurate identification
of CRISPR repeats", Edgar, R. C., BMC Bioinformatics, January 20;
8:18(2007), herein incorporated by reference.
[0263] In a further aspect, the case by case analysis is performed
using PSI-BLAST (Position-Specific Iterative Basic Local Alignment
Search Tool). PSI-BLAST derives a position-specific scoring matrix
(PSSM) or profile from the multiple sequence alignment of sequences
detected above a given score threshold using protein-protein BLAST.
This PSSM is used to further search the database for new matches,
and is updated for subsequent iterations with these newly detected
sequences. Thus, PSI-BLAST provides a means of detecting distant
relationships between proteins.
[0264] In another aspect, the case by case analysis is performed
using HHpred, a method for sequence database searching and
structure prediction that is as easy to use as BLAST or PSI-BLAST
and that is at the same time much more sensitive in finding remote
homologs. In fact, HHpred's sensitivity is competitive with the
most powerful servers for structure prediction currently available.
HHpred is the first server that is based on the pairwise comparison
of profile hidden Markov models (HMMs). Whereas most conventional
sequence search methods search sequence databases such as UniProt
or the NR, HHpred searches alignment databases, like Pfam or SMART.
This greatly simplifies the list of hits to a number of sequence
families instead of a clutter of single sequences. All major
publicly available profile and alignment databases are available
through HHpred. HHpred accepts a single query sequence or a
multiple alignment as input. Within only a few minutes it returns
the search results in an easy-to-read format similar to that of
PSI-BLAST. Search options include local or global alignment and
scoring secondary structure similarity. HHpred can produce pairwise
query-template sequence alignments, merged query-template multiple
alignments (e.g. for transitive searches), as well as 3D structural
models calculated by the MODELLER software from HHpred
alignments.
[0265] The term "nucleic acid-targeting system", wherein nucleic
acid is DNA or RNA, and in some aspects may also refer to DNA-RNA
hybrids or derivatives thereof, refers collectively to transcripts
and other elements involved in the expression of or directing the
activity of DNA or RNA-targeting CRISPR-associated ("Cas") genes,
which may include sequences encoding a DNA or RNA-targeting Cas
protein and a DNA or RNA-targeting guide RNA comprising a CRISPR
RNA (crRNA) sequence and (in some but not all systems) a
trans-activating CRISPR/Cas system RNA (tracrRNA) sequence, or
other sequences and transcripts from a DNA or RNA-targeting CRISPR
locus. In general, a RNA-targeting system is characterized by
elements that promote the formation of a DNA or RNA-targeting
complex at the site of a target DNA or RNA sequence. In the context
of formation of a DNA or RNA-targeting complex, "target sequence"
refers to a DNA or RNA sequence to which a DNA or RNA-targeting
guide RNA is designed to have complementarity, where hybridization
between a target sequence and a RNA-targeting guide RNA promotes
the formation of a RNA-targeting complex. In some embodiments, a
target sequence is located in the nucleus or cytoplasm of a
cell.
[0266] In an aspect of the invention, novel RNA targeting systems
also referred to as RNA- or RNA-targeting CRISPR/Cas or the
CRISPR-Cas system RNA-targeting system of the present application
are based on identified Type VI Cas proteins which do not require
the generation of customized proteins to target specific RNA
sequences but rather a single enzyme can be programmed by a RNA
molecule to recognize a specific RNA target, in other words the
enzyme can be recruited to a specific RNA target using said RNA
molecule.
[0267] In an aspect of the invention, novel DNA targeting systems
also referred to as DNA- or DNA-targeting CRISPR/Cas or the
CRISPR-Cas system RNA-targeting system of the present application
are based on identified Type VI Cas proteins which do not require
the generation of customized proteins to target specific RNA
sequences but rather a single enzyme can be programmed by a RNA
molecule to recognize a specific DNA target, in other words the
enzyme can be recruited to a specific DNA target using said RNA
molecule.
[0268] The nucleic acids-targeting systems, the vector systems, the
vectors and the compositions described herein may be used in
various nucleic acids-targeting applications, altering or modifying
synthesis of a gene product, such as a protein, nucleic acids
cleavage, nucleic acids editing, nucleic acids splicing;
trafficking of target nucleic acids, tracing of target nucleic
acids, isolation of target nucleic acids, visualization of target
nucleic acids, etc.
[0269] As used herein, a Cas protein or a CRISPR enzyme refers to
any of the proteins presented in the new classification of
CRISPR-Cas systems.
[0270] In an advantageous embodiment, the present invention
encompasses effector proteins identified in a Type VI CRISPR-Cas
loci, e.g. the C2c2 loci. Herein, C2c2 refers to Class 2 candidate
2. The C2c2 loci encompass cas1 and cas2 genes along with the large
protein Applicants denote as C2c2p, and a CRISPR array; however,
C2c2p is often encoded next to a CRISPR array but not cas1-cas2
(compare FIG. 9 and FIG. 15).
C2c2 Nuclease
[0271] The activity of C2c2 depends on the presence of two HEPN
domains. These have been shown to be RNase domains, i.e. nuclease
(in particular an endonuclease) cutting RNA. C2c2 HEPN may also
target DNA, or potentially DNA and/or RNA. On the basis that that
the HEPN domains of C2c2 are at least capable of binding to and, in
their wild-type form, cutting RNA, then it is preferred that the
C2c2 effector protein has RNase function. It may also, or
alternatively, have DNase function.
[0272] Thus, in some embodiments, the effector protein may be a
RNA-binding protein, such as a dead-Cas type effector protein,
which may be optionally functionalized as described herein for
instance with an transcriptional activator or repressor domain, NLS
or other functional domain. In some embodiments, the effector
protein may be a RNA-binding protein that cleaves a single strand
of RNA. If the RNA bound is ssRNA, then the ssRNA is fully cleaved.
In some embodiments, the effector protein may be a RNA-binding
protein that cleaves a double strand of RNA, for example if it
comprises two RNase domains. If the RNA bound is dsRNA, then the
dsRNA is fully cleaved.
[0273] RNase function in CRISPR systems is known, for example mRNA
targeting has been reported for certain type III CRISPR-Cas systems
(Hale et al., 2014, Genes Dev, vol. 28, 2432-2443; Hale et al.,
2009, Cell, vol. 139, 945-956; Peng et al., 2015, Nucleic acids
research, vol. 43, 406-417) and provides significant advantages. In
the Staphylococcus epidermis type III-A system, transcription
across targets results in cleavage of the target DNA and its
transcripts, mediated by independent active sites within the
Cas10-Csm ribonucleoprotein effector complex (see, Samai et al.,
2015, Cell, vol. 151, 1164-1174). A CRISPR-Cas system, composition
or method targeting RNA via the present effector proteins is thus
provided.
[0274] The target RNA, i.e. the RNA of interest, is the RNA to be
targeted by the present invention leading to the recruitment to,
and the binding of the effector protein at, the target site of
interest on the target RNA. The target RNA may be any suitable form
of RNA. This may include, in some embodiments, mRNA. In other
embodiments, the target RNA may include tRNA or rRNA. In other
embodiments, the target RNA may include miRNA. In other
embodiments, the target RNA may include siRNA.
Interfering RNA (RNAi) and microRNA (miRNA)
[0275] In other embodiments, the target RNA may include interfering
RNA, i.e. RNA involved in an RNA interference pathway, such as
shRNA, siRNA and so forth. In other embodiments, the target RNA may
include microRNA (miRNA). Control over interfering RNA or miRNA may
help reduce off-target effects (OTE) seen with those approaches by
reducing the longevity of the interfering RNA or miRNA in vivo or
in vitro.
[0276] In certain embodiments, the target is not the miRNA itself,
but the miRNA binding site of a miRNA target.
[0277] In certain embodiments, miRNAs may be sequestered (such as
including subcellularly relocated). In certain embodiments, miRNAs
may be cut, such as without limitation at hairpins.
[0278] In certain embodiments, miRNA processing (such as including
turnover) is increased or decreased.
[0279] If the effector protein and suitable guide are selectively
expressed (for example spatially or temporally under the control of
a suitable promoter, for example a tissue- or cell cycle-specific
promoter and/or enhancer) then this could be used to `protect` the
cells or systems (in vivo or in vitro) from RNAi in those cells.
This may be useful in neighbouring tissues or cells where RNAi is
not required or for the purposes of comparison of the cells or
tissues where the effector protein and suitable guide are and are
not expressed (i.e. where the RNAi is not controlled and where it
is, respectively). The effector protein may be used to control or
bind to molecules comprising or consisting of RNA, such as
ribozymes, ribosomes or riboswitches. In embodiments of the
invention, the RNA guide can recruit the effector protein to these
molecules so that the effector protein is able to bind to them.
[0280] The protein system of the invention can be applied in areas
of RNAi technologies, without undue experimentation, from this
disclosure, including therapeutic, assay and other applications
(see, e.g., Guidi et al., PLoS Negl Trop Dis 9(5): e0003801. doi:
10. 1371/journal.pntd; Crotty et al., In vivo RNAi screens:
concepts and applications. Shane Crotty . . . 2015 Elsevier Ltd.
Published by Elsevier Inc., Pesticide Biochemistry and Physiology
(Impact Factor: 2.01). 01/2015; 120. DOI:
10.1016/j.pestbp.2015.01.002 and Makkonen et al., Viruses 2015,
7(4), 2099-2125; doi:10.3390/v7042099), because the present
application provides the foundation for informed engineering of the
system.
Ribosomal RNA (rRNA)
[0281] For example, azalide antibiotics such as azithromycin, are
well known. They target and disrupt the 50S ribosomal subunit. The
present effector protein, together with a suitable guide RNA to
target the 50S ribosomal subunit, may be, in some embodiments,
recruited to and bind to the 50S ribosomal subunit. Thus, the
present effector protein in concert with a suitable guide directed
at a ribosomal (especially the 50s ribosomal subunit) target is
provided. Use of this use effector protein in concert with the
suitable guide directed at the ribosomal (especially the 50s
ribosomal subunit) target may include antibiotic use. In
particular, the antibiotic use is analogous to the action of
azalide antibiotics, such as azithromycin. In some embodiments,
prokaryotic ribosomal subunits, such as the 70S subunit in
prokaryotes, the 50S subunit mentioned above, the 30S subunit, as
well as the 16S and 5S subunits may be targeted. In other
embodiments, eukaryotic ribosomal subunits, such as the 80S subunit
in eukaryotes, the 60S subunit, the 40S subunit, as well as the
28S, 18S. 5.8S and 5S subunits may be targeted.
[0282] In some embodiments, the effector protein may be a
RNA-binding protein, optionally functionalized, as described
herein. In some embodiments, the effector protein may be a
RNA-binding protein that cleaves a single strand of RNA. In either
case, but particularly where the RNA-binding protein cleaves a
single strand of RNA, then ribosomal function may be modulated and,
in particular, reduced or destroyed. This may apply to any
ribosomal RNA and any ribosomal subunit and the sequences of rRNA
are well known.
[0283] Control of ribosomal activity is thus envisaged through use
of the present effector protein in concert with a suitable guide to
the ribosomal target. This may be through cleavage of, or binding
to, the ribosome. In particular, reduction of ribosomal activity is
envisaged. This may be useful in assaying ribosomal function in
vivo or in vitro, but also as a means of controlling therapies
based on ribosomal activity, in vivo or in vitro. Furthermore,
control (i.e. reduction) of protein synthesis in an in vivo or in
vitro system is envisaged, such control including antibiotic and
research and diagnostic use.
Riboswitches
[0284] A riboswitch (also known as an aptozyme) is a regulatory
segment of a messenger RNA molecule that binds a small molecule.
This typically results in a change in production of the proteins
encoded by the mRNA. Thus, control of riboswitch activity is thus
envisaged through use of the present effector protein in concert
with a suitable guide to the riboswitch target. This may be through
cleavage of, or binding to, the riboswitch. In particular,
reduction of riboswitch activity is envisaged. This may be useful
in assaying riboswitch function in vivo or in vitro, but also as a
means of controlling therapies based on riboswitch activity, in
vivo or in vitro. Furthermore, control (i.e. reduction) of protein
synthesis in an in vivo or in vitro system is envisaged. This
control, as for rRNA may include antibiotic and research and
diagnostic use.
Ribozymes
[0285] Ribozymes are RNA molecules having catalytic properties,
analogous to enzymes (which are proteins). As ribozymes, both
naturally occurring and engineered, comprise or consist of RNA,
they may also be targeted by the present RNA-binding effector
protein. In some embodiments, the effector protein may be a
RNA-binding protein cleaves the ribozyme to thereby disable it.
Control of ribozymal activity is thus envisaged through use of the
present effector protein in concert with a suitable guide to the
ribozymal target. This may be through cleavage of, or binding to,
the ribozyme. In particular, reduction of ribozymal activity is
envisaged. This may be useful in assaying ribozymal function in
vivo or in vitro, but also as a means of controlling therapies
based on ribozymal activity, in vivo or in vitro.
Gene Expression, Including RNA Processing
[0286] The effector protein may also be used, together with a
suitable guide, to target gene expression, including via control of
RNA processing. The control of RNA processing may include RNA
processing reactions such as RNA splicing, including alternative
splicing, via targeting of RNApol; viral replication (in particular
of satellite viruses, bacteriophages and retroviruses, such as HBV,
HBC and HIV and others listed herein) including virioids in plants;
and tRNA biosynthesis. The effector protein and suitable guide may
also be used to control RNAactivation (RNAa). RNAa leads to the
promotion of gene expression, so control of gene expression may be
achieved that way through disruption or reduction of RNAa and thus
less promotion of gene expression. This is discussed more in detail
below.
RNAi Screens
[0287] Identifying gene products whose knockdown is associated with
phenotypic changes, biological pathways can be interrogated and the
constituent parts identified, via RNAi screens. Control may also be
exerted over or during these screens by use of the effector protein
and suitable guide to remove or reduce the activity of the RNAi in
the screen and thus reinstate the activity of the (previously
interfered with) gene product (by removing or reducing the
interference/repression).
[0288] Satellite RNAs (satRNAs) and satellite viruses may also be
treated.
[0289] Control herein with reference to RNase activity generally
means reduction, negative disruption or known-down or knock
out.
In Vivo RNA Applications
Inhibition of Gene Expression
[0290] The target-specific RNAses provided herein allow for very
specific cutting of a target RNA. The interference at RNA level
allows for modulation both spatially and temporally and in a
non-invasive way, as the genome is not modified.
[0291] A number of diseases have been demonstrated to be treatable
by mRNA targeting. While most of these studies relate to
administration of siRNA, it is clear that the RNA targeting
effector proteins provided herein can be applied in a similar
way.
[0292] Examples of mRNA targets (and corresponding disease
treatments) are VEGF, VEGF-R1 and RTP801 (in the treatment of AMD
and/or DME), Caspase 2 (in the treatment of Naion) ADRB2 (in the
treatment of intraocular pressure), TRPVI (in the treatment of Dry
eye syndrome, Syk kinase (in the treatment of asthma), Apo B (in
the treatment of hypercholesterolemia), PLK1, KSP and VEGF (in the
treatment of solid tumors), Ber-Abl (in the treatment of CML)
(Burnett and Rossi Chem Biol. 2012, 19(1): 60-71)). Similarly, RNA
targeting has been demonstrated to be effective in the treatment of
RNA-virus mediated diseases such as HIV (targeting of HIV Tet and
Rev), RSV (targeting of RSV nucleocapsid) and HCV (targeting of
miR-122) (Burnett and Rossi Chem Biol. 2012, 19(1): 60-71).
[0293] It is further envisaged that the RNA targeting effector
protein of the invention can be used for mutation specific or
allele specific knockdown. Guide RNA's can be designed that
specifically target a sequence in the transcribed mRNA comprising a
mutation or an allele-specific sequence. Such specific knockdown is
particularly suitable for therapeutic applications relating to
disorders associated with mutated or allele-specific gene products.
For example, most cases of familial hypobetalipoproteinemia (FHBL)
are caused by mutations in the ApoB gene. This gene encodes two
versions of the apolipoprotein B protein: a short version (ApoB-48)
and a longer version (ApoB-100). Several ApoB gene mutations that
lead to FHBL cause both versions of ApoB to be abnormally short.
Specifically targeting and knockdown of mutated ApoB mRNA
transcripts with an RNA targeting effector protein of the invention
may be beneficial in treatment of FHBL. As another example,
Huntington's disease (HD) is caused by an expansion of CAG triplet
repeats in the gene coding for the Huntingtin protein, which
results in an abnormal protein. Specifically targeting and
knockdown of mutated or allele-specific mRNA transcripts encoding
the Huntingtin protein with an RNA targeting effector protein of
the invention may be beneficial in treatment of HD.
[0294] It is noted that in this context, and more generally for the
various applications as described herein, the use of a split
version of the RNA targeting effector protein can be envisaged.
Indeed, this may not only allow increased specificity but may also
be advantageous for delivery. The C2c2 is split in the sense that
the two parts of the C2c2 enzyme substantially comprise a
functioning C2c2. Ideally, the split should always be so that the
catalytic domain(s) are unaffected. That C2c2 may function as a
nuclease or it may be a dead-C2c2 which is essentially an
RNA-binding protein with very little or no catalytic activity, due
to typically mutation(s) in its catalytic domains.
[0295] Each half of the split C2c2 may be fused to a dimerization
partner. By means of example, and without limitation, employing
rapamycin sensitive dimerization domains, allows to generate a
chemically inducible split C2c2 for temporal control of
C2c2activity. C2c2 can thus be rendered chemically inducible by
being split into two fragments and that rapamycin-sensitive
dimerization domains may be used for controlled reassembly of the
C2c2. The two parts of the split C2c2 can be thought of as the N'
terminal part and the C' terminal part of the split C2c2. The
fusion is typically at the split point of the C2c2. In other words,
the C' terminal of the N' terminal part of the split C2c2 is fused
to one of the dimer halves, whilst the N' terminal of the C'
terminal part is fused to the other dimer half.
[0296] The C2c2 does not have to be split in the sense that the
break is newly created. The split point is typically designed in
silico and cloned into the constructs. Together, the two parts of
the split C2c2, the N` terminal and C` terminal parts, form a full
C2c2, comprising preferably at least 70% or more of the wildtype
amino acids (or nucleotides encoding them), preferably at least 80%
or more, preferably at least 90% or more, preferably at least 95%
or more, and most preferably at least 99% or more of the wildtype
amino acids (or nucleotides encoding them). Some trimming may be
possible, and mutants are envisaged. Non-functional domains may be
removed entirely. What is important is that the two parts may be
brought together and that the desired C2c2 function is restored or
reconstituted. The dimer may be a homodimer or a heterodimer.
[0297] In certain embodiments, the C2c2 effector as described
herein may be used for mutation-specific, or allele-specific
targeting, such as. for mutation-specific, or allele-specific
knockdown.
[0298] The RNA targeting effector protein can moreover be fused to
another functional RNAse domain, such as a non-specific RNase or
Argonaute 2, which acts in synergy to increase the RNAse activity
or to ensure further degradation of the message.
[0299] Modulation of Gene Expression Through Modulation of RNA
Function
[0300] Apart from a direct effect on gene expression through
cleavage of the mRNA, RNA targeting can also be used to impact
specific aspects of the RNA processing within the cell, which may
allow a more subtle modulation of gene expression. Generally,
modulation can for instance be mediated by interfering with binding
of proteins to the RNA, such as for instance blocking binding of
proteins, or recruiting RNA binding proteins. Indeed, modulations
can be ensured at different levels such as splicing, transport,
localization, translation and turnover of the mRNA. Similarly in
the context of therapy, it can be envisaged to address (pathogenic)
malfunctioning at each of these levels by using RNA-specific
targeting molecules. In these embodiments it is in many cases
preferred that the RNA targeting protein is a "dead" C2c2 that has
lost the ability to cut the RNA target but maintains its ability to
bind thereto, such as the mutated forms of c2c2 described
herein.
a) Alternative Splicing
[0301] Many of the human genes express multiple mRNAs as a result
of alternative splicing. Different diseases have been shown to be
linked to aberrant splicing leading to loss of function or gain of
function of the expressed gene. While some of these diseases are
caused by mutations that cause splicing defects, a number of these
are not. One therapeutic option is to target the splicing mechanism
directly. The RNA targeting effector proteins described herein can
for instance be used to block or promote slicing, include or
exclude exons and influence the expression of specific isoforms
and/or stimulate the expression of alternative protein products.
Such applications are described in more detail below.
[0302] A RNA targeting effector protein binding to a target RNA can
sterically block access of splicing factors to the RNA sequence.
The RNA targeting effector protein targeted to a splice site may
block splicing at the site, optionally redirecting splicing to an
adjacent site. For instance a RNA targeting effector protein
binding to the 5' splice site binding can block the recruitment of
the U1 component of the spliceosome, favoring the skipping of that
exon. Alternatively, a RNA targeting effector protein targeted to a
splicing enhancer or silencer can prevent binding of transacting
regulatory splicing factors at the target site and effectively
block or promote splicing. Exon exclusion can further be achieved
by recruitment of ILF2/3 to precursor mRNA near an exon by an RNA
targeting effector protein as described herein. As yet another
example, a glycine rich domain can be attached for recruitment of
hnRNP A1 and exon exclusion (Del Gatto-Konczak et al. Mol Cell
Biol. 1999 January; 19(1):251-60).
[0303] In certain embodiments, through appropriate selection of
gRNA, specific splice variants may be targeted, while other splice
variants will not be targeted
[0304] In some cases the RNA targeting effector protein can be used
to promote slicing (e.g. where splicing is defective). For instance
a RNA targeting effector protein can be associated with an effector
capable of stabilizing a splicing regulatory stem-loop in order to
further splicing. The RNA targeting effector protein can be linked
to a consensus binding site sequence for a specific splicing factor
in order to recruit the protein to the target DNA.
[0305] Examples of diseases which have been associated with
aberrant splicing include, but are not limited to Paraneoplastic
Opsoclonus Myoclonus Ataxia (or POMA), resulting from a loss of
Nova proteins which regulate splicing of proteins that function in
the synapse, and Cystic Fibrosis, which is caused by defective
splicing of a cystic fibrosis transmembrane conductance regulator,
resulting in the production of nonfunctional chloride channels. In
other diseases aberrant RNA splicing results in gain-of-function.
This is the case for instance in myotonic dystrophy which is caused
by a CUG triplet-repeat expansion (from 50 to >1500 repeats) in
the 3'UTR of an mRNA, causing splicing defects.
[0306] The RNA targeting effector protein can be used to include an
exon by recruiting a splicing factor (such as U1) to a 5'splicing
site to promote excision of introns around a desired exon. Such
recruitment could be mediated trough a fusion with an
arginine/serine rich domain, which functions as splicing activator
(Gravely BR and Maniatis T, Mol Cell. 1998 (5):765-71).
[0307] It is envisaged that the RNA targeting effector protein can
be used to block the splicing machinery at a desired locus,
resulting in preventing exon recognition and the expression of a
different protein product. An example of a disorder that may
treated is Duchenne muscular dystrophy (DMD), which is caused by
mutations in the gene encoding for the dystrophin protein. Almost
all DMD mutations lead to frameshifts, resulting in impaired
dystrophin translation. The RNA targeting effector protein can be
paired with splice junctions or exonic splicing enhancers (ESEs)
thereby preventing exon recognition, resulting in the translation
of a partially functional protein. This converts the lethal
Duchenne phenotype into the less severe Becker phenotype.
b) RNA Modification
[0308] RNA editing is a natural process whereby the diversity of
gene products of a given sequence is increased by minor
modification in the RNA. Typically, the modification involves the
conversion of adenosine (A) to inosine (I), resulting in an RNA
sequence which is different from that encoded by the genome. RNA
modification is generally ensured by the ADAR enzyme, whereby the
pre-RNA target forms an imperfect duplex RNA by base-pairing
between the exon that contains the adenosine to be edited and an
intronic non-coding element. A classic example of A-I editing is
the glutamate receptor GluR-B mRNA, whereby the change results in
modified conductance properties of the channel (Higuchi M, et al.
Cell. 1993; 75:1361-70).
[0309] In humans, a heterozygous functional-null mutation in the
ADAR1 gene leads to a skin disease, human pigmentary genodermatosis
(Miyamura Y, et al. Am J Hum Genet. 2003; 73:693-9). It is
envisaged that the RNA targeting effector proteins of the present
invention can be used to correct malfunctioning RNA
modification.
[0310] It is further envisaged that RNA adenosine methylase
(N(6)-methyladenosine) can be fused to the RNA targeting effector
proteins of the invention and targeted to a transcript of interest.
This methylase causes reversible methylation, has regulatory roles
and may affect gene expression and cell fate decisions by
modulating multiple RNA-related cellular pathways (Fu et al Nat Rev
Genet. 2014; 15(5):293-306).
c) Polyadenylation
[0311] Polyadenylation of an mRNA is important for nuclear
transport, translation efficiency and stability of the mRNA., and
all of these, as well as the process of polyadenylation, depend on
specific RBPs. Most eukaryotic mRNAs receive a 3' poly(A) tail of
about 200 nucleotides after transcription. Polyadenylation involves
different RNA-binding protein complexes which stimulate the
activity of a poly(A)polymerase (Minvielle-Sebastia L et al. Curr
Opin Cell Biol. 1999; 11:352-7). It is envisaged that the
RNA-targeting effector proteins provided herein can be used to
interfere with or promote the interaction between the RNA-binding
proteins and RNA.
[0312] Examples of diseases which have been linked to defective
proteins involved in polyadenylation are oculopharyngeal muscular
dystrophy (OPMD) (Brais B, et al. Nat Genet. 1998; 18:164-7).
d) RNA Export
[0313] After pre-mRNA processing, the mRNA is exported from the
nucleus to the cytoplasm. This is ensured by a cellular mechanism
which involves the generation of a carrier complex, which is then
translocated through the nuclear pore and releases the mRNA in the
cytoplasm, with subsequent recycling of the carrier.
[0314] Overexpression of proteins (such as TAP) which play a role
in the export of RNA has been found to increase export of
transcripts that are otherwise ineffeciently exported in Xenopus
(Katahira J, et al. EMBO J. 1999; 18:2593-609).
e) mRNA Localization
[0315] mRNA localization ensures spatially regulated protein
production. Localization of transcripts to a specific region of the
cell can be ensured by localization elements. In particular
embodiments, it is envisaged that the effector proteins described
herein can be used to target localization elements to the RNA of
interest. The effector proteins can be designed to bind the target
transcript and shuttle them to a location in the cell determined by
its peptide signal tag. More particularly for instance, a RNA
targeting effector protein fused to a nuclear localization signal
(NLS) can be used to alter RNA localization.
[0316] Further examples of localization signals include the zipcode
binding protein (ZBP1) which ensures localization of .beta.-actin
to the cytoplasm in several asymmetric cell types, KDEL retention
sequence (SEQ ID NO: 17) (localization to endoplasmic reticulum),
nuclear export signal (localization to cytoplasm), mitochondrial
targeting signal (localization to mitochondria), peroxisomal
targeting signal (localization to peroxisome) and m6A
marking/YTHDF2 (localization to p-bodies). Other approaches that
are envisaged are fusion of the RNA targeting effector protein with
proteins of known localization (for instance membrane,
synapse).
[0317] Alternatively, the effector protein according to the
invention may for instance be used in localization-dependent
knockdown. By fusing the effector protein to a appropriate
localization signal, the effector is targeted to a particular
cellular compartment. Only target RNAs residing in this compartment
will effectively be targeted, whereas otherwise identical targets,
but residing in a different cellular compartment will not be
targeted, such that a localization dependent knockdown can be
established.
f) Translation
[0318] The RNA targeting effector proteins described herein can be
used to enhance or repress translation. It is envisaged that
upregulating translation is a very robust way to control cellular
circuits. Further, for functional studies a protein translation
screen can be favorable over transcriptional upregulation screens,
which have the shortcoming that upregulation of transcript does not
translate into increased protein production.
[0319] It is envisaged that the RNA targeting effector proteins
described herein can be used to bring translation initiation
factors, such as EIF4G in the vicinity of the 5' untranslated
repeat (5'UTR) of a messenger RNA of interest to drive translation
(as described in De Gregorio et al. EMBO J. 1999; 18(17):4865-74
for a non-reprogrammable RNA binding protein). As another example
GLD2, a cytoplasmic poly(A) polymerase, can be recruited to the
target mRNA by an RNA targeting effector protein. This would allow
for directed polyadenylation of the target mRNA thereby stimulating
translation.
[0320] Similarly, the RNA targeting effector proteins envisaged
herein can be used to block translational repressors of mRNA, such
as ZBP1 (Huttelmaier S, et al. Nature. 2005; 438:512-5). By binding
to translation initiation site of a target RNA, translation can be
directly affected.
[0321] In addition, fusing the RNA targeting effector proteins to a
protein that stabilizes mRNAs, e.g. by preventing degradation
thereof such as RNase inhibitors, it is possible to increase
protein production from the transcripts of interest.
[0322] It is envisaged that the RNA targeting effector proteins
described herein can be used to repress translation by binding in
the 5' UTR regions of a RNA transcript and preventing the ribosome
from forming and beginning translation.
[0323] Further, the RNA targeting effector protein can be used to
recruit Cafl, a component of the CCR4-NOT deadenylase complex, to
the target mRNA, resulting in deadenylation or the target
transcript and inhibition of protein translation.
[0324] For instance, the RNA targeting effector protein of the
invention can be used to increase or decrease translation of
therapeutically relevant proteins. Examples of therapeutic
applications wherein the RNA targeting effector protein can be used
to downregulate or upregulate translation are in amyotrophic
lateral sclerosis (ALS) and cardiovascular disorders. Reduced
levels of the glial glutamate transporter EAAT2 have been reported
in ALS motor cortex and spinal cord, as well as multiple abnormal
EAAT2 mRNA transcripts in ALS brain tissue. Loss of the EAAT2
protein and function thought to be the main cause of excitotoxicity
in ALS. Restoration of EAAT2 protein levels and function may
provide therapeutic benefit. Hence, the RNA targeting effector
protein can be beneficially used to upregulate the expression of
EAAT2 protein, e.g. by blocking translational repressors or
stabilizing mRNA as described above. Apolipoprotein A1 is the major
protein component of high density lipoprotein (HDL) and ApoA1 and
HDL are generally considered as atheroprotective. It is envisages
that the RNA targeting effector protein can be beneficially used to
upregulate the expression of ApoA1, e.g. by blocking translational
repressors or stabilizing mRNA as described above.
g) mRNA Turnover
[0325] Translation is tightly coupled to mRNA turnover and
regulated mRNA stability. Specific proteins have been described to
be involved in the stability of transcripts (such as the ELAV/Hu
proteins in neurons, Keene J D, 1999, Proc Natl Acad Sci USA.
96:5-7) and tristetraprolin (TTP). These proteins stabilize target
mRNAs by protecting the messages from degradation in the cytoplasm
(Peng S S et al., 1988, EMBO J. 17:3461-70).
[0326] It can be envisaged that the RNA-targeting effector proteins
of the present invention can be used to interfere with or to
promote the activity of proteins acting to stabilize mRNA
transcripts, such that mRNA turnover is affected. For instance,
recruitment of human TTP to the target RNA using the RNA targeting
effector protein would allow for adenylate-uridylate-rich element
(AU-rich element) mediated translational repression and target
degradation. AU-rich elements are found in the 3' UTR of many mRNAs
that code for proto-oncogenes, nuclear transcription factors, and
cytokines and promote RNA stability. As another example, the RNA
targeting effector protein can be fused to HuR, another mRNA
stabilization protein (Hinman M N and Lou H, Cell Mol Life Sci
2008; 65:3168-81), and recruit it to a target transcript to prolong
its lifetime or stabilize short-lived mRNA.
[0327] It is further envisaged that the RNA-targeting effector
proteins described herein can be used to promote degradation of
target transcripts. For instance, m6A methyltransferase can be
recruited to the target transcript to localize the transcript to
P-bodies leading to degradation of the target.
[0328] As yet another example, an RNA targeting effector protein as
described herein can be fused to the non-specific endonuclease
domain PilT N-terminus (PIN), to recruit it to a target transcript
and allow degradation thereof.
[0329] Patients with paraneoplastic neurological disorder
(PND)-associated encephalomyelitis and neuropathy are patients who
develop autoantibodies against Hu-proteins in tumors outside of the
central nervous system (Szabo A et al. 1991, Cell.; 67:325-33 which
then cross the blood-brain barrier. It can be envisaged that the
RNA-targeting effector proteins of the present invention can be
used to interfere with the binding of auto-antibodies to mRNA
transcripts.
[0330] Patients with dystrophy type 1 (DM1), caused by the
expansion of (CUG)n in the 3' UTR of dystrophia myotonica-protein
kinase (DMPK) gene, are characterized by the accumulation of such
transcripts in the nucleus. It is envisaged that the RNA targeting
effector proteins of the invention fused with an endonuclease
targeted to the (CUG)n repeats could inhibit such accumulation of
aberrant transcripts. h) Interaction with multi-functional
proteins
[0331] Some RNA-binding proteins bind to multiple sites on numerous
RNAs to function in diverse processes. For instance, the hnRNP A1
protein has been found to bind exonic splicing silencer sequences,
antagonizing the splicing factors, associate with telomere ends
(thereby stimulating telomere activity) and bind miRNA to
facilitate Drosha-mediated processing thereby affecting maturation.
It is envisaged that the RNA-binding effector proteins of the
present invention can interfere with the binding of RNA-binding
proteins at one or more locations. i) RNA folding
[0332] RNA adopts a defined structure in order to perform its
biological activities. Transitions in conformation among
alternative tertiary structures are critical to most RNA-mediated
processes. However, RNA folding can be associated with several
problems. For instance, RNA may have a tendency to fold into, and
be upheld in, improper alternative conformations and/or the correct
tertiary structure may not be sufficiently thermodynamically
favored over alternative structures. The RNA targeting effector
protein, in particular a cleavage-deficient or dead RNA targeting
protein, of the invention may be used to direct folding of (m)RNA
and/or capture the correct tertiary structure thereof.
Use of RNA-Targeting Effector Protein in Modulating Cellular
Status
[0333] In certain embodiments C2c2 in a complex with crRNA is
activated upon binding to target RNA and subsequently cleaves any
nearby ssRNA targets (i.e. "collateral" or "bystander" effects).
C2c2, once primed by the cognate target, can cleave other
(non-complementary) RNA molecules. Such promiscuous RNA cleavage
could potentially cause cellular toxicity, or otherwise affect
cellular physiology or cell status.
[0334] Accordingly, in certain embodiments, the non-naturally
occurring or engineered composition, vector system, or delivery
systems as described herein are used for or are for use in
induction of cell dormancy. In certain embodiments, the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein are used for or are for use
in induction of cell cycle arrest. In certain embodiments, the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein are used for or are for use
in reduction of cell growth and/or cell proliferation. In certain
embodiments, the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein are used for
or are for use in induction of cell anergy. In certain embodiments,
the non-naturally occurring or engineered composition, vector
system, or delivery systems as described herein are used for or are
for use in induction of cell apoptosis. In certain embodiments, the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein are used for or are for use
in induction of cell necrosis. In certain embodiments, the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein are used for or are for use
in induction of cell death. In certain embodiments, the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein are used for or are for use
in induction of programmed cell death.
[0335] In certain embodiments, the invention relates to a method
for induction of cell dormancy comprising introducing or inducing
the non-naturally occurring or engineered composition, vector
system, or delivery systems as described herein. In certain
embodiments, the invention relates to a method for induction of
cell cycle arrest comprising introducing or inducing the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein. In certain embodiments,
the invention relates to a method for reduction of cell growth
and/or cell proliferation comprising introducing or inducing the
non-naturally occurring or engineered composition, vector system,
or delivery systems as described herein. In certain embodiments,
the invention relates to a method for induction of cell anergy
comprising introducing or inducing the non-naturally occurring or
engineered composition, vector system, or delivery systems as
described herein. In certain embodiments, the invention relates to
a method for induction of cell apoptosis comprising introducing or
inducing the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein. In certain
embodiments, the invention relates to a method for induction of
cell necrosis comprising introducing or inducing the non-naturally
occurring or engineered composition, vector system, or delivery
systems as described herein. In certain embodiments, the invention
relates to a method for induction of cell death comprising
introducing or inducing the non-naturally occurring or engineered
composition, vector system, or delivery systems as described
herein. In certain embodiments, the invention relates to a method
for induction of programmed cell death comprising introducing or
inducing the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein.
[0336] The methods and uses as described herein may be therapeutic
or prophylactic and may target particular cells, cell
(sub)populations, or cell/tissue types. In particular, the methods
and uses as described herein may be therapeutic or prophylactic and
may target particular cells, cell (sub)populations, or cell/tissue
types expressing one or more target sequences, such as one or more
particular target RNA (e.g. ss RNA). Without limitation, target
cells may for instance be cancer cells expressing a particular
transcript, e.g. neurons of a given class, (immune) cells causing
e.g. autoimmunity, or cells infected by a specific (e.g. viral)
pathogen, etc.
[0337] Accordingly, in certain embodiments, the invention relates
to a method for treating a pathological condition characterized by
the presence of undesirable cells (host cells), comprising
introducing or inducing the non-naturally occurring or engineered
composition, vector system, or delivery systems as described
herein. In certain embodiments, the invention relates the use of
the non-naturally occurring or engineered composition, vector
system, or delivery systems as described herein for treating a
pathological condition characterized by the presence of undesirable
cells (host cells). In certain embodiments, the invention relates
the non-naturally occurring or engineered composition, vector
system, or delivery systems as described herein for use in treating
a pathological condition characterized by the presence of
undesirable cells (host cells). It is to be understood that
preferably the CRISPR-Cas system targets a target specific for the
undesirable cells. In certain embodiments, the invention relates to
the use of the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein for
treating, preventing, or alleviating cancer. In certain
embodiments, the invention relates to the non-naturally occurring
or engineered composition, vector system, or delivery systems as
described herein for use in treating, preventing, or alleviating
cancer. In certain embodiments, the invention relates to a method
for treating, preventing, or alleviating cancer comprising
introducing or inducing the non-naturally occurring or engineered
composition, vector system, or delivery systems as described
herein. It is to be understood that preferably the CRISPR-Cas
system targets a target specific for the cancer cells. In certain
embodiments, the invention relates to the use of the non-naturally
occurring or engineered composition, vector system, or delivery
systems as described herein for treating, preventing, or
alleviating infection of cells by a pathogen. In certain
embodiments, the invention relates to the non-naturally occurring
or engineered composition, vector system, or delivery systems as
described herein for use in treating, preventing, or alleviating
infection of cells by a pathogen. In certain embodiments, the
invention relates to a method for treating, preventing, or
alleviating infection of cells by a pathogen comprising introducing
or inducing the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein. It is to be
understood that preferably the CRISPR-Cas system targets a target
specific for the cells infected by the pathogen (e.g. a pathogen
derived target). In certain embodiments, the invention relates to
the use of the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein for
treating, preventing, or alleviating an autoimmune disorder. In
certain embodiments, the invention relates to the non-naturally
occurring or engineered composition, vector system, or delivery
systems as described herein for use in treating, preventing, or
alleviating an autoimmune disorder. In certain embodiments, the
invention relates to a method for treating, preventing, or
alleviating an autoimmune disorder comprising introducing or
inducing the non-naturally occurring or engineered composition,
vector system, or delivery systems as described herein. It is to be
understood that preferably the CRISPR-Cas system targets a target
specific for the cells responsible for the autoimmune disorder
(e.g. specific immune cells).
Use of RNA-Targeting Effector Protein in RNA Detection
[0338] It is further envisaged that the RNA targeting effector
protein can be used in Northern blot assays. Northern blotting
involves the use of electrophoresis to separate RNA samples by
size. The RNA targeting effector protein can be used to
specifically bind and detect the target RNA sequence.
[0339] A RNA targeting effector protein can be fused to a
fluorescent protein (such as GFP) and used to track RNA
localization in living cells. More particularly, the RNA targeting
effector protein can be inactivated in that it no longer cleaves
RNA. In particular embodiments, it is envisaged that a split RNA
targeting effector protein can be used, whereby the signal is
dependent on the binding of both subproteins, in order to ensure a
more precise visualization. Alternatively, a split fluorescent
protein can be used that is reconstituted when multiple RNA
targeting effector protein complexes bind to the target transcript.
It is further envisaged that a transcript is targeted at multiple
binding sites along the mRNA so the fluorescent signal can amplify
the true signal and allow for focal identification. As yet another
alternative, the fluorescent protein can be reconstituted form a
split intein.
[0340] RNA targeting effector proteins are for instance suitably
used to determine the localization of the RNA or specific splice
variants, the level of mRNA transcript, up- or down-regulation of
transcripts and disease-specific diagnosis. The RNA targeting
effector proteins can be used for visualization of RNA in (living)
cells using e.g. fluorescent microscopy or flow cytometry, such as
fluorescence-activated cell sorting (FACS) which allows for
high-throughput screening of cells and recovery of living cells
following cell sorting. Further, expression levels of different
transcripts can be assessed simultaneously under stress, e.g.
inhibition of cancer growth using molecular inhibitors or hypoxic
conditions on cells. Another application would be to track
localization of transcripts to synaptic connections during a neural
stimulus using two photon microscopy.
[0341] In certain embodiments, the components or complexes
according to the invention as described herein can be used in
multiplexed error-robust fluorescence in situ hybridization
(MERFISH; Chen et al. Science; 2015; 348(6233)), such as for
instance with (fluorescently) labeled C2c2 effectors.
In Vitro Apex Labeling
[0342] Cellular processes depend on a network of molecular
interactions among protein, RNA, and DNA. Accurate detection of
protein-DNA and protein-RNA interactions is key to understanding
such processes. In vitro proximity labeling technology employs an
affinity tag combined with e.g. a photoactivatable probe to label
polypeptides and RNAs in the vicinity of a protein or RNA of
interest in vitro. After UV irradiation the photoactivatable group
reacts with proteins and other molecules that are in close
proximity to the tagged molecule, thereby labelling them. Labelled
interacting molecules can subsequently be recovered and identified.
The RNA targeting effector protein of the invention can for
instance be used to target a probe to a selected RNA sequence.
[0343] These applications could also be applied in animal models
for in vivo imaging of disease relevant applications or
difficult-to culture cell types. Use of RNA-targeting effector
protein in RNA origami/in vitro assembly lines--combinatorics RNA
origami refers to nanoscale folded structures for creating
two-dimensional or three-dimensional structures using RNA as
integrated template. The folded structure is encoded in the RNA and
the shape of the resulting RNA is thus determined by the
synthesized RNA sequence (Geary, et al. 2014. Science, 345 (6198).
pp. 799-804). The RNA origami may act as scaffold for arranging
other components, such as proteins, into complexes. The RNA
targeting effector protein of the invention can for instance be
used to target proteins of interest to the RNA origami using a
suitable guide RNA.
[0344] These applications could also be applied in animal models
for in vivo imaging of disease relevant applications or
difficult-to culture cell types.
Use of RNA-Targeting Effector Protein in RNA Isolation or
Purification, Enrichment or Depletion
[0345] It is further envisages that the RNA targeting effector
protein when complexed to RNA can be used to isolate and/or purify
the RNA. The RNA targeting effector protein can for instance be
fused to an affinity tag that can be used to isolate and/or purify
the RNA-RNA targeting effector protein complex. Such applications
are for instance useful in the analysis of gene expression profiles
in cells.
[0346] In particular embodiments, it can be envisaged that the RNA
targeting effector proteins can be used to target a specific
noncoding RNA (ncRNA) thereby blocking its activity, providing a
useful functional probe. In certain embodiments, the effector
protein as described herein may be used to specifically enrich for
a particular RNA (including but not limited to increasing
stability, etc.), or alternatively to specifically deplete a
particular RNA (such as without limitation for instance particular
splice variants, isoforms, etc.).
Interrogation of lincRNA Function and Other Nuclear RNAs
[0347] Current RNA knockdown strategies such as siRNA have the
disadvantage that they are mostly limited to targeting cytosolic
transcripts since the protein machinery is cytosolic. The advantage
of a RNA targeting effector protein of the present invention, an
exogenous system that is not essential to cell function, is that it
can be used in any compartment in the cell. By fusing a NLS signal
to the RNA targeting effector protein, it can be guided to the
nucleus, allowing nuclear RNAs to be targeted. It is for instance
envisaged to probe the function of lincRNAs. Long intergenic
non-coding RNAs (lincRNAs) are a vastly underexplored area of
research. Most lincRNAs have as of yet unknown functions which
could be studies using the RNA targeting effector protein of the
invention.
Identification of RNA Binding Proteins
[0348] Identifying proteins bound to specific RNAs can be useful
for understanding the roles of many RNAs. For instance, many
lincRNAs associate with transcriptional and epigenetic regulators
to control transcription. Understanding what proteins bind to a
given lincRNA can help elucidate the components in a given
regulatory pathway. A RNA targeting effector protein of the
invention can be designed to recruit a biotin ligase to a specific
transcript in order to label locally bound proteins with biotin.
The proteins can then be pulled down and analyzed by mass
spectrometry to identify them.
Assembly of Complexes on RNA and Substrate Shuttling
[0349] RNA targeting effector proteins of the invention can further
be used to assemble complexes on RNA. This can be achieved by
functionalizing the RNA targeting effector protein with multiple
related proteins (e.g. components of a particular synthesis
pathway). Alternatively, multiple RNA targeting effector proteins
can be functionalized with such different related proteins and
targeted to the same or adjacent target RNA. Useful application of
assembling complexes on RNA are for instance facilitating substrate
shuttling between proteins.
Synthetic Biology
[0350] The development of biological systems have a wide utility,
including in clinical applications. It is envisaged that the
programmable RNA targeting effector proteins of the invention can
be used fused to split proteins of toxic domains for targeted cell
death, for instance using cancer-linked RNA as target transcript.
Further, pathways involving protein-protein interaction can be
influenced in synthetic biological systems with e.g. fusion
complexes with the appropriate effectors such as kinases or other
enzymes.
Protein Splicing: Inteins
[0351] Protein splicing is a post-translational process in which an
intervening polypeptide, referred to as an intein, catalyzes its
own excision from the polypeptides flacking it, referred to as
exteins, as well as subsequent ligation of the exteins. The
assembly of two or more RNA targeting effector proteins as
described herein on a target transcript could be used to direct the
release of a split intein (Topilina and Mills Mob DNA. 2014 Feb. 4;
5(1):5), thereby allowing for direct computation of the existence
of a mRNA transcript and subsequent release of a protein product,
such as a metabolic enzyme or a transcription factor (for
downstream actuation of transcription pathways). This application
may have significant relevance in synthetic biology (see above) or
large-scale bioproduction (only produce product under certain
conditions).
Inducible, Dosed and Self-Inactivating Systems
[0352] In one embodiment, fusion complexes comprising an RNA
targeting effector protein of the invention and an effector
component are designed to be inducible, for instance light
inducible or chemically inducible. Such inducibility allows for
activation of the effector component at a desired moment in
time.
[0353] Light inducibility is for instance achieved by designing a
fusion complex wherein CRY2 PHR/CIBN pairing is used for fusion.
This system is particularly useful for light induction of protein
interactions in living cells (Konermann S, et al. Nature. 2013;
500:472-476).
[0354] Chemical inducibility is for instance provided for by
designing a fusion complex wherein FKBP/FRB (FK506 binding
protein/FKBP rapamycin binding) pairing is used for fusion. Using
this system rapamycin is required for binding of proteins (Zetsche
et al. Nat Biotechnol. 2015; 33(2):139-42 describes the use of this
system for Cas9).
[0355] Further, when introduced in the cell as DNA, the RNA
targeting effector protein of the inventions can be modulated by
inducible promoters, such as tetracycline or doxycycline controlled
transcriptional activation (Tet-On and Tet-Off expression system),
hormone inducible gene expression system such as for instance an
ecdysone inducible gene expression system and an
arabinose-inducible gene expression system. When delivered as RNA,
expression of the RNA targeting effector protein can be modulated
via a riboswitch, which can sense a small molecule like
tetracycline (as described in Goldfless et al. Nucleic Acids Res.
2012; 40(9):e64).
[0356] In one embodiment, the delivery of the RNA targeting
effector protein of the invention can be modulated to change the
amount of protein or crRNA in the cell, thereby changing the
magnitude of the desired effect or any undesired off-target
effects.
[0357] In one embodiment, the RNA targeting effector proteins
described herein can be designed to be self-inactivating. When
delivered to a cell as RNA, either mRNA or as a replication RNA
therapeutic (Wrobleska et al Nat Biotechnol. 2015 August; 33(8):
839-841), they can self-inactivate expression and subsequent
effects by destroying the own RNA, thereby reducing residency and
potential undesirable effects.
[0358] For further in vivo applications of RNA targeting effector
proteins as described herein, reference is made to Mackay J P et al
(Nat Struct Mol Biol. 2011 March; 18(3):256-61), Nelles et al
(Bioessays. 2015 July; 37(7):732-9) and Abil Z and Zhao H (Mol
Biosyst. 2015 October; 11(10):2658-65), which are incorporated
herein by reference. In particular, the following applications are
envisaged in certain embodiments of the invention, preferably in
certain embodiments by using catalytically inactive C2c2: enhancing
translation (e.g. C2c2-translation promotion factor fusions (e.g.
eIF4 fusions)); repressing translation (e.g. gRNA targeting
ribosome binding sites); exon skipping (e.g. gRNAs targeting splice
donor and/or acceptor sites); exon inclusion (e.g. gRNA targeting a
particular exon splice donor and/or acceptor site to be included or
C2c2 fused to or recruiting spliceosome components (e.g. U1
snRNA)); accessing RNA localization (e.g. C2c2-marker fusions (e.g.
EGFP fusions)); altering RNA localization (e.g. C2c2-localization
signal fusions (e.g. NLS or NES fusions)); RNA degradation (in this
case no catalytically inactive C2c2 is to be used if relied on the
activity of C2c2, alternatively and for increased specificity, a
split C2c2 may be used); inhibition of non-coding RNA function
(e.g. miRNA), such as by degradation or binding of gRNA to
functional sites (possibly titrating out at specific sites by
relocalization by C2c2-signal sequence fusions).
[0359] As described herein before and demonstrated in the Examples,
C2c2 function is robust to 5' or 3' extensions of the crRNA and to
extension of the crRNA loop. It is therefore envisages that MS2
loops and other recruitment domains can be added to the crRNA
without affecting complex formation and binding to target
transcripts. Such modifications to the crRNA for recruitment of
various effector domains are applicable in the uses of a RNA
targeted effector proteins described above.
[0360] As demonstrated in the Examples, C2c2, in particular
LshC2c2, is capable of mediating resistance to RNA phages. It is
therefore envisaged that C2c2 can be used to immunize, e.g.
animals, humans and plants, against RNA-only pathogens, including
but not limited to Ebola virus and Zika virus.
[0361] The present inventors have shown that C2c2 can processes
(cleaves) its own array. This applies to both the wildtype C2c2
protein and the mutated C2c2 protein containing one or more mutated
amino acid residues R597, H602, R1278 and H1283, such as one or
more of the modifications selected from R597A, H602A, R1278A and
H1283A. It is therefore envisaged that multiple crRNAs designed for
different target transcripts and/or applications can be delivered
as a single pre-crRNA or as a single transcript driven by one
promotor. Such method of delivery has the advantages that it is
substantially more compact, easier to synthesize and easier to
delivery in viral systems. Preferably, amino acid numbering as
described herein refers to Lsh C2c2 protein. It will be understood
that exact amino acid positions may vary for orthologues of Lsh
C2c2, which can be adequately determined by protein alignment, as
is known in the art, and as described herein elsewhere.
[0362] Aspects of the invention also encompass methods and uses of
the compositions and systems described herein in genome
engineering, e.g. for altering or manipulating the expression of
one or more genes or the one or more gene products, in prokaryotic
or eukaryotic cells, in vitro, in vivo or ex vivo.
[0363] In an aspect, the invention provides methods and
compositions for modulating, e.g., reducing, expression of a target
RNA in cells. In the subject methods, a C2c2 system of the
invention is provided that interferes with transcription,
stability, and/or translation of an RNA.
[0364] In certain embodiments, an effective amount of C2c2 system
is used to cleave RNA or otherwise inhibit RNA expression. In this
regard, the system has uses similar to siRNA and shRNA, thus can
also be substituted for such methods. The method includes, without
limitation, use of a C2c2 system as a substitute for e.g., an
interfering ribonucleic acid (such as an siRNA or shRNA) or a
transcription template thereof, e.g., a DNA encoding an shRNA. The
C2c2 system is introduced into a target cell, e.g., by being
administered to a mammal that includes the target cell.
[0365] Advantageously, a C2c2 system of the invention is specific.
For example, whereas interfering ribonucleic acid (such as an siRNA
or shRNA) polynucleotide systems are plagued by design and
stability issues and off-target binding, a C2c2 system of the
invention can be designed with high specificity.
Destabilized C2c2
[0366] In certain embodiments, the effector protein (CRISPR enzyme;
C2c2) according to the invention as described herein is associated
with or fused to a destabilization domain (DD). In some
embodiments, the DD is ER50. A corresponding stabilizing ligand for
this DD is, in some embodiments, 4HT. As such, in some embodiments,
one of the at least one DDs is ER50 and a stabilizing ligand
therefor is 4HT or CMP8. In some embodiments, the DD is DHFR50. A
corresponding stabilizing ligand for this DD is, in some
embodiments, TMP. As such, in some embodiments, one of the at least
one DDs is DHFR50 and a stabilizing ligand therefor is TMP. In some
embodiments, the DD is ER50. A corresponding stabilizing ligand for
this DD is, in some embodiments, CMP8. CMP8 may therefore be an
alternative stabilizing ligand to 4HT in the ER50 system. While it
may be possible that CMP8 and 4HT can/should be used in a
competitive matter, some cell types may be more susceptible to one
or the other of these two ligands, and from this disclosure and the
knowledge in the art the skilled person can use CMP8 and/or
4HT.
[0367] In some embodiments, one or two DDs may be fused to the
N-terminal end of the CRISPR enzyme with one or two DDs fused to
the C-terminal of the CRISPR enzyme. In some embodiments, the at
least two DDs are associated with the CRISPR enzyme and the DDs are
the same DD, i.e. the DDs are homologous. Thus, both (or two or
more) of the DDs could be ER50 DDs. This is preferred in some
embodiments. Alternatively, both (or two or more) of the DDs could
be DHFR50 DDs. This is also preferred in some embodiments. In some
embodiments, the at least two DDs are associated with the CRISPR
enzyme and the DDs are different DDs, i.e. the DDs are
heterologous. Thus, one of the DDS could be ER50 while one or more
of the DDs or any other DDs could be DHFR50. Having two or more DDs
which are heterologous may be advantageous as it would provide a
greater level of degradation control. A tandem fusion of more than
one DD at the N or C-term may enhance degradation; and such a
tandem fusion can be, for example ER50-ER50-C2c2 or DHFR-DHFR-C2c2
It is envisaged that high levels of degradation would occur in the
absence of either stabilizing ligand, intermediate levels of
degradation would occur in the absence of one stabilizing ligand
and the presence of the other (or another) stabilizing ligand,
while low levels of degradation would occur in the presence of both
(or two of more) of the stabilizing ligands. Control may also be
imparted by having an N-terminal ER50 DD and a C-terminal DHFR50
DD.
[0368] In some embodiments, the fusion of the CRISPR enzyme with
the DD comprises a linker between the DD and the CRISPR enzyme. In
some embodiments, the linker is a GlySer linker. In some
embodiments, the DD-CRISPR enzyme further comprises at least one
Nuclear Export Signal (NES). In some embodiments, the DD-CRISPR
enzyme comprises two or more NESs. In some embodiments, the
DD-CRISPR enzyme comprises at least one Nuclear Localization Signal
(NLS). This may be in addition to an NES. In some embodiments, the
CRISPR enzyme comprises or consists essentially of or consists of a
localization (nuclear import or export) signal as, or as part of,
the linker between the CRISPR enzyme and the DD. HA or Flag tags
are also within the ambit of the invention as linkers. Applicants
use NLS and/or NES as linker and also use Glycine Serine linkers as
short as GS up to (GGGGS)3 (SEQ ID NO: 19).
[0369] Destabilizing domains have general utility to confer
instability to a wide range of proteins; see, e.g., Miyazaki, J Am
Chem Soc. Mar. 7, 2012; 134(9): 3942-3945, incorporated herein by
reference. CMP8 or 4-hydroxytamoxifen can be destabilizing domains.
More generally, A temperature-sensitive mutant of mammalian DHFR
(DHFRts), a destabilizing residue by the N-end rule, was found to
be stable at a permissive temperature but unstable at 37.degree. C.
The addition of methotrexate, a high-affinity ligand for mammalian
DHFR, to cells expressing DHFRts inhibited degradation of the
protein partially. This was an important demonstration that a small
molecule ligand can stabilize a protein otherwise targeted for
degradation in cells. A rapamycin derivative was used to stabilize
an unstable mutant of the FRB domain of mTOR (FRB*) and restore the
function of the fused kinase, GSK-3.beta..6,7 This system
demonstrated that ligand-dependent stability represented an
attractive strategy to regulate the function of a specific protein
in a complex biological environment. A system to control protein
activity can involve the DD becoming functional when the ubiquitin
complementation occurs by rapamycin induced dimerization of
FK506-binding protein and FKBP12. Mutants of human FKBP12 or ecDHFR
protein can be engineered to be metabolically unstable in the
absence of their high-affinity ligands, Shield-1 or trimethoprim
(TMP), respectively. These mutants are some of the possible
destabilizing domains (DDs) useful in the practice of the invention
and instability of a DD as a fusion with a CRISPR enzyme confers to
the CRISPR protein degradation of the entire fusion protein by the
proteasome. Shield-1 and TMP bind to and stabilize the DD in a
dose-dependent manner. The estrogen receptor ligand binding domain
(ERLBD, residues 305-549 of ERS1) can also be engineered as a
destabilizing domain. Since the estrogen receptor signaling pathway
is involved in a variety of diseases such as breast cancer, the
pathway has been widely studied and numerous agonist and
antagonists of estrogen receptor have been developed. Thus,
compatible pairs of ERLBD and drugs are known. There are ligands
that bind to mutant but not wild-type forms of the ERLBD. By using
one of these mutant domains encoding three mutations (L384M, M421G,
G521R)12, it is possible to regulate the stability of an
ERLBD-derived DD using a ligand that does not perturb endogenous
estrogen-sensitive networks. An additional mutation (Y537S) can be
introduced to further destabilize the ERLBD and to configure it as
a potential DD candidate. This tetra-mutant is an advantageous DD
development. The mutant ERLBD can be fused to a CRISPR enzyme and
its stability can be regulated or perturbed using a ligand, whereby
the CRISPR enzyme has a DD. Another DD can be a 12-kDa
(107-amino-acid) tag based on a mutated FKBP protein, stabilized by
Shield1 ligand; see, e.g., Nature Methods 5, (2008). For instance a
DD can be a modified FK506 binding protein 12 (FKBP12) that binds
to and is reversibly stabilized by a synthetic, biologically inert
small molecule, Shield-1; see, e.g., Banaszynski L A, Chen L C,
Maynard-Smith L A, Ooi A G, Wandless T J. A rapid, reversible, and
tunable method to regulate protein function in living cells using
synthetic small molecules. Cell. 2006; 126:995-1004; Banaszynski L
A, Sellmyer M A, Contag C H, Wandless T J, Thorne S H. Chemical
control of protein stability and function in living mice. Nat Med.
2008; 14:1123-1127; Maynard-Smith L A, Chen L C, Banaszynski L A,
Ooi A G, Wandless T J. A directed approach for engineering
conditional protein stability using biologically silent small
molecules. The Journal of biological chemistry. 2007;
282:24866-24872; and Rodriguez, Chem Biol. Mar. 23, 2012; 19(3):
391-398--all of which are incorporated herein by reference and may
be employed in the practice of the invention in selected a DD to
associate with a CRISPR enzyme in the practice of this invention.
As can be seen, the knowledge in the art includes a number of DDs,
and the DD can be associated with, e.g., fused to, advantageously
with a linker, to a CRISPR enzyme, whereby the DD can be stabilized
in the presence of a ligand and when there is the absence thereof
the DD can become destabilized, whereby the CRISPR enzyme is
entirely destabilized, or the DD can be stabilized in the absence
of a ligand and when the ligand is present the DD can become
destabilized; the DD allows the CRISPR enzyme and hence the
CRISPR-Cas complex or system to be regulated or controlled-turned
on or off so to speak, to thereby provide means for regulation or
control of the system, e.g., in an in vivo or in vitro environment.
For instance, when a protein of interest is expressed as a fusion
with the DD tag, it is destabilized and rapidly degraded in the
cell, e.g., by proteasomes. Thus, absence of stabilizing ligand
leads to a D associated Cas being degraded. When a new DD is fused
to a protein of interest, its instability is conferred to the
protein of interest, resulting in the rapid degradation of the
entire fusion protein. Peak activity for Cas is sometimes
beneficial to reduce off-target effects. Thus, short bursts of high
activity are preferred. The present invention is able to provide
such peaks. In some senses the system is inducible. In some other
senses, the system repressed in the absence of stabilizing ligand
and de-repressed in the presence of stabilizing ligand.
Application of RNA Targeting-CRISPR System to Plants and Yeast
Definitions
[0370] In general, the term "plant" relates to any various
photosynthetic, eukaryotic, unicellular or multicellular organism
of the kingdom Plantae characteristically growing by cell division,
containing chloroplasts, and having cell walls comprised of
cellulose. The term plant encompasses monocotyledonous and
dicotyledonous plants. Specifically, the plants are intended to
comprise without limitation angiosperm and gymnosperm plants such
as acacia, alfalfa, amaranth, apple, apricot, artichoke, ash tree,
asparagus, avocado, banana, barley, beans, beet, birch, beech,
blackberry, blueberry, broccoli, Brussel's sprouts, cabbage,
canola, cantaloupe, carrot, cassava, cauliflower, cedar, a cereal,
celery, chestnut, cherry, Chinese cabbage, citrus, clementine,
clover, coffee, corn, cotton, cowpea, cucumber, cypress, eggplant,
elm, endive, eucalyptus, fennel, figs, fir, geranium, grape,
grapefruit, groundnuts, ground cherry, gum hemlock, hickory, kale,
kiwifruit, kohlrabi, larch, lettuce, leek, lemon, lime, locust,
pine, maidenhair, maize, mango, maple, melon, millet, mushroom,
mustard, nuts, oak, oats, oil palm, okra, onion, orange, an
ornamental plant or flower or tree, papaya, palm, parsley, parsnip,
pea, peach, peanut, pear, peat, pepper, persimmon, pigeon pea,
pine, pineapple, plantain, plum, pomegranate, potato, pumpkin,
radicchio, radish, rapeseed, raspberry, rice, rye, sorghum,
safflower, sallow, soybean, spinach, spruce, squash, strawberry,
sugar beet, sugarcane, sunflower, sweet potato, sweet corn,
tangerine, tea, tobacco, tomato, trees, triticale, turf grasses,
turnips, vine, walnut, watercress, watermelon, wheat, yams, yew,
and zucchini. The term plant also encompasses Algae, which are
mainly photoautotrophs unified primarily by their lack of roots,
leaves and other organs that characterize higher plants.
[0371] The methods for modulating gene expression using the RNA
targeting system as described herein can be used to confer desired
traits on essentially any plant. A wide variety of plants and plant
cell systems may be engineered for the desired physiological and
agronomic characteristics described herein using the nucleic acid
constructs of the present disclosure and the various transformation
methods mentioned above. In preferred embodiments, target plants
and plant cells for engineering include, but are not limited to,
those monocotyledonous and dicotyledonous plants, such as crops
including grain crops (e.g., wheat, maize, rice, millet, barley),
fruit crops (e.g., tomato, apple, pear, strawberry, orange), forage
crops (e.g., alfalfa), root vegetable crops (e.g., carrot, potato,
sugar beets, yam), leafy vegetable crops (e.g., lettuce, spinach);
flowering plants (e.g., petunia, rose, chrysanthemum), conifers and
pine trees (e.g., pine fir, spruce); plants used in
phytoremediation (e.g., heavy metal accumulating plants); oil crops
(e.g., sunflower, rape seed) and plants used for experimental
purposes (e.g., Arabidopsis). Thus, the methods and CRISPR-Cas
systems can be used over a broad range of plants, such as for
example with dicotyledonous plants belonging to the orders
Magniolales, Illiciales, Laurales, Piperales, Aristochiales,
Nymphaeales, Ranunculales, Papeverales, Sarraceniaceae,
Trochodendrales, Hamarnelidales, Eucorniales, Leitneriales.
Myricales, Fagales, Casuarinales, Ca yophyllales, Batales,
Polygonales, Plumbaginales, Dilleniales, Theales, Malvales,
Urticales, Lecythidales, Violales, Salicales, Capparales, Ericales,
Diapensales, Ebenales, Primulales, Rosales, Fabales, Podostemales,
Haloragales, Myrtales, Cornales, Proteales, San tales,
Rafflesiales, Celastrales, Euphorbiales, Rhamnales, Sapindales,
Juglandales, Geraniales, Polygalales, Umbellales, Gentianales,
Polemoniales, Lamiales, Plantaginales, Scrophulariales,
Campanulales, Rubiales, Dipsacales, and Asterales; the methods and
CRISPR-Cas systems can be used with monocotyledonous plants such as
those belonging to the orders Alismatales, Hydrocharitales,
Najadales, Triuridales, Commelinales, Eriocaulales, Restionales,
Poales, Juncales, Cyperales, Typhales, Bromeliales, Zingiberales,
Arecales, Cyclanthales, Pandanales, Arales, Lilliales, and Orchid
ales, or with plants belonging to Gymnospermae, e.g those belonging
to the orders Pinales, Ginkgoales, Cycadales, Araucariales,
Cupressales and Gnetales.
[0372] The RNA targeting CRISPR systems and methods of use
described herein can be used over a broad range of plant species,
included in the non-limitative list of dicot, monocot or gymnosperm
genera hereunder: Atropa, Alseodaphne, Anacardium, Arachis,
Beilschmiedia Brassica, Carthamus, Cocculus, Croton, Cucumis,
Citrus, Citrullus, Capsicum, Catharanthus, Cocos, Coffea,
Cucurbita, Daucus, Duguetia, Eschsehoizia, Ficus, Fragaria,
Glaucium, Glycine, Gossypium, Helianthus, Hevea, Hyoscyamus,
Lactuca, Landolphia, Linum, Litsea, Lycopersicon, Lunpinus,
Manihot, Majorana, Malus, Medicago, Nicotiana, Olea, Parthenium,
Papaver, Persea, Phaseolus, Pistacia, Pisum, Pyrus, Prunus,
Raphanus, Ricinus, Senecio, Sinomenium, Stephania, Sinapis,
Solanum, Theobroma, Trifolium, Trigonella, Vicia, Vinca, Vilis, and
Vigna; and the genera Allium, Andropogon, Aragrostis, Asparagus,
Avena, Cynodon, Elaeis, Festuca, Festulolium, Heterocallis,
Hordeum, Lemna, Lolium, Musa, Oryza, Panicum, Pannesetum, Phleum,
Poa, Secale, Sorghum, Triticum, Zea, Abies, Cunninghamia, Ephedra,
Picea, Pinus, and Pseudotsuga.
[0373] The RNA targeting CRISPR systems and methods of use can also
be used over a broad range of "algae" or "algae cells"; including
for example algae selected from several eukaryotic phyla, including
the Rhodophyta (red algae), Chlorophyta (green algae), Phaeophyta
(brown algae), Bacillariophyta (diatoms), Eustigmatophyta and
dinoflagellates as well as the prokaryotic phylum Cyanobacteria
(blue-green algae). The term "algae" includes for example algae
selected from: Amphora, Anabaena, Anikstrodesmis, Botryococcus,
Chaetoceros, Chlamydomonas, Chlorella, Chlorococcum, Cyclotella,
Cylindrotheca, Dunaliella, Emiliana, Euglena, Hematococcus,
Isochrysis, Monochrysis, Monoraphidium, Nannochloris,
Nannnochloropsis, Navicula, Nephrochloris, Nephroselmis, Nitzschia,
Nodularia, Nostoc, Oochromonas, Oocystis, Oscillartoria, Pavlova,
Phaeodactylum, Playtmonas, Pleurochrysis, Porhyra, Pseudoanabaena,
Pyramimonas, Stichococcus, Synechococcus, Synechocystis,
Tetraselmis, Thalassiosira, and Trichodesmium.
[0374] A part of a plant, i.e., a "plant tissue" may be treated
according to the methods of the present invention to produce an
improved plant. Plant tissue also encompasses plant cells. The term
"plant cell" as used herein refers to individual units of a living
plant, either in an intact whole plant or in an isolated form grown
in in vitro tissue cultures, on media or agar, in suspension in a
growth media or buffer or as a part of higher organized unites,
such as, for example, plant tissue, a plant organ, or a whole
plant.
[0375] A "protoplast" refers to a plant cell that has had its
protective cell wall completely or partially removed using, for
example, mechanical or enzymatic means resulting in an intact
biochemical competent unit of living plant that can reform their
cell wall, proliferate and regenerate grow into a whole plant under
proper growing conditions.
[0376] The term "transformation" broadly refers to the process by
which a plant host is genetically modified by the introduction of
DNA by means of Agrobacteria or one of a variety of chemical or
physical methods. As used herein, the term "plant host" refers to
plants, including any cells, tissues, organs, or progeny of the
plants. Many suitable plant tissues or plant cells can be
transformed and include, but are not limited to, protoplasts,
somatic embryos, pollen, leaves, seedlings, stems, calli, stolons,
microtubers, and shoots. A plant tissue also refers to any clone of
such a plant, seed, progeny, propagule whether generated sexually
or asexually, and descendents of any of these, such as cuttings or
seed.
[0377] The term "transformed" as used herein, refers to a cell,
tissue, organ, or organism into which a foreign DNA molecule, such
as a construct, has been introduced. The introduced DNA molecule
may be integrated into the genomic DNA of the recipient cell,
tissue, organ, or organism such that the introduced DNA molecule is
transmitted to the subsequent progeny. In these embodiments, the
"transformed" or "transgenic" cell or plant may also include
progeny of the cell or plant and progeny produced from a breeding
program employing such a transformed plant as a parent in a cross
and exhibiting an altered phenotype resulting from the presence of
the introduced DNA molecule. Preferably, the transgenic plant is
fertile and capable of transmitting the introduced DNA to progeny
through sexual reproduction.
[0378] The term "progeny", such as the progeny of a transgenic
plant, is one that is born of, begotten by, or derived from a plant
or the transgenic plant. The introduced DNA molecule may also be
transiently introduced into the recipient cell such that the
introduced DNA molecule is not inherited by subsequent progeny and
thus not considered "transgenic". Accordingly, as used herein, a
"non-transgenic" plant or plant cell is a plant which does not
contain a foreign DNA stably integrated into its genome.
[0379] The term "plant promoter" as used herein is a promoter
capable of initiating transcription in plant cells, whether or not
its origin is a plant cell. Exemplary suitable plant promoters
include, but are not limited to, those that are obtained from
plants, plant viruses, and bacteria such as Agrobacterium or
Rhizobium which comprise genes expressed in plant cells.
[0380] As used herein, a "fungal cell" refers to any type of
eukaryotic cell within the kingdom of fungi. Phyla within the
kingdom of fungi include Ascomycota, Basidiomycota,
Blastocladiomycota, Chytridiomycota, Glomeromycota, Microsporidia,
and Neocallimastigomycota. Fungal cells may include yeasts, molds,
and filamentous fungi. In some embodiments, the fungal cell is a
yeast cell.
[0381] As used herein, the term "yeast cell" refers to any fungal
cell within the phyla Ascomycota and Basidiomycota. Yeast cells may
include budding yeast cells, fission yeast cells, and mold cells.
Without being limited to these organisms, many types of yeast used
in laboratory and industrial settings are part of the phylum
Ascomycota. In some embodiments, the yeast cell is an S.
cerervisiae, Kluyveromyces marxianus, or Issatchenkia orientalis
cell. Other yeast cells may include without limitation Candida spp.
(e.g., Candida albicans), Yarrowia spp. (e.g., Yarrowia
lipolytica), Pichia spp. (e.g., Pichia pastoris), Kluyveromyces
spp. (e.g., Kluyveromyces lactis and Kluyveromyces marxianus),
Neurospora spp. (e.g., Neurospora crassa), Fusarium spp. (e.g.,
Fusarium oxysporum), and Issatchenkia spp. (e.g., Issatchenkia
orientalis, a.k.a. Pichia kudriavzevii and Candida
acidothermophilum). In some embodiments, the fungal cell is a
filamentous fungal cell. As used herein, the term "filamentous
fungal cell" refers to any type of fungal cell that grows in
filaments, i.e., hyphae or mycelia. Examples of filamentous fungal
cells may include without limitation Aspergillus spp. (e.g.,
Aspergillus niger), Trichoderma spp. (e.g., Trichoderma reesei),
Rhizopus spp. (e.g., Rhizopus oryzae), and Mortierella spp. (e.g.,
Mortierella isabellina).
[0382] In some embodiments, the fungal cell is an industrial
strain. As used herein, "industrial strain" refers to any strain of
fungal cell used in or isolated from an industrial process, e.g.,
production of a product on a commercial or industrial scale.
Industrial strain may refer to a fungal species that is typically
used in an industrial process, or it may refer to an isolate of a
fungal species that may be also used for non-industrial purposes
(e.g., laboratory research). Examples of industrial processes may
include fermentation (e.g., in production of food or beverage
products), distillation, biofuel production, production of a
compound, and production of a polypeptide. Examples of industrial
strains may include, without limitation, JAY270 and ATCC4124.
[0383] In some embodiments, the fungal cell is a polyploid cell. As
used herein, a "polyploid" cell may refer to any cell whose genome
is present in more than one copy. A polyploid cell may refer to a
type of cell that is naturally found in a polyploid state, or it
may refer to a cell that has been induced to exist in a polyploid
state (e.g., through specific regulation, alteration, inactivation,
activation, or modification of meiosis, cytokinesis, or DNA
replication). A polyploid cell may refer to a cell whose entire
genome is polyploid, or it may refer to a cell that is polyploid in
a particular genomic locus of interest. Without wishing to be bound
to theory, it is thought that the abundance of guideRNA may more
often be a rate-limiting component in genome engineering of
polyploid cells than in haploid cells, and thus the methods using
the C2c2 CRISPRS system described herein may take advantage of
using a certain fungal cell type.
[0384] In some embodiments, the fungal cell is a diploid cell. As
used herein, a "diploid" cell may refer to any cell whose genome is
present in two copies. A diploid cell may refer to a type of cell
that is naturally found in a diploid state, or it may refer to a
cell that has been induced to exist in a diploid state (e.g.,
through specific regulation, alteration, inactivation, activation,
or modification of meiosis, cytokinesis, or DNA replication). For
example, the S. cerevisiae strain S228C may be maintained in a
haploid or diploid state. A diploid cell may refer to a cell whose
entire genome is diploid, or it may refer to a cell that is diploid
in a particular genomic locus of interest. In some embodiments, the
fungal cell is a haploid cell. As used herein, a "haploid" cell may
refer to any cell whose genome is present in one copy. A haploid
cell may refer to a type of cell that is naturally found in a
haploid state, or it may refer to a cell that has been induced to
exist in a haploid state (e.g., through specific regulation,
alteration, inactivation, activation, or modification of meiosis,
cytokinesis, or DNA replication). For example, the S. cerevisiae
strain S228C may be maintained in a haploid or diploid state. A
haploid cell may refer to a cell whose entire genome is haploid, or
it may refer to a cell that is haploid in a particular genomic
locus of interest.
[0385] As used herein, a "yeast expression vector" refers to a
nucleic acid that contains one or more sequences encoding an RNA
and/or polypeptide and may further contain any desired elements
that control the expression of the nucleic acid(s), as well as any
elements that enable the replication and maintenance of the
expression vector inside the yeast cell. Many suitable yeast
expression vectors and features thereof are known in the art; for
example, various vectors and techniques are illustrated in in Yeast
Protocols, 2nd edition, Xiao, W., ed. (Humana Press, New York,
2007) and Buckholz, R. G. and Gleeson, M. A. (1991) Biotechnology
(NY) 9(11): 1067-72. Yeast vectors may contain, without limitation,
a centromeric (CEN) sequence, an autonomous replication sequence
(ARS), a promoter, such as an RNA Polymerase III promoter, operably
linked to a sequence or gene of interest, a terminator such as an
RNA polymerase III terminator, an origin of replication, and a
marker gene (e.g., auxotrophic, antibiotic, or other selectable
markers). Examples of expression vectors for use in yeast may
include plasmids, yeast artificial chromosomes, 2 plasmids, yeast
integrative plasmids, yeast replicative plasmids, shuttle vectors,
and episomal plasmids.
Stable Integration of RNA Targeting CRISP System Components in the
Genome of Plants and Plant Cells
[0386] In particular embodiments, it is envisaged that the
polynucleotides encoding the components of the RNA targeting CRISPR
system are introduced for stable integration into the genome of a
plant cell. In these embodiments, the design of the transformation
vector or the expression system can be adjusted depending on when,
where and under what conditions the guide RNA and/or the RNA
targeting gene(s) are expressed.
[0387] In particular embodiments, it is envisaged to introduce the
components of the RNA targeting CRISPR system stably into the
genomic DNA of a plant cell. Additionally or alternatively, it is
envisaged to introduce the components of the RNA targeting CRISPR
system for stable integration into the DNA of a plant organelle
such as, but not limited to a plastid, e mitochondrion or a
chloroplast.
[0388] The expression system for stable integration into the genome
of a plant cell may contain one or more of the following elements:
a promoter element that can be used to express the guide RNA and/or
RNA targeting enzyme in a plant cell; a 5' untranslated region to
enhance expression; an intron element to further enhance expression
in certain cells, such as monocot cells; a multiple-cloning site to
provide convenient restriction sites for inserting the one or more
guide RNAs and/or the RNA targeting gene sequences and other
desired elements; and a 3' untranslated region to provide for
efficient termination of the expressed transcript.
[0389] The elements of the expression system may be on one or more
expression constructs which are either circular such as a plasmid
or transformation vector, or non-circular such as linear double
stranded DNA. In a particular embodiment, a RNA targeting CRISPR
expression system comprises at least: [0390] (a) a nucleotide
sequence encoding a guide RNA (gRNA) that hybridizes with a target
sequence in a plant, and wherein the guide RNA comprises a guide
sequence and a direct repeat sequence, and [0391] (b) a nucleotide
sequence encoding a RNA targeting protein, wherein components (a)
or (b) are located on the same or on different constructs, and
whereby the different nucleotide sequences can be under control of
the same or a different regulatory element operable in a plant
cell.
[0392] DNA construct(s) containing the components of the RNA
targeting CRISPR system, and, where applicable, template sequence
may be introduced into the genome of a plant, plant part, or plant
cell by a variety of conventional techniques. The process generally
comprises the steps of selecting a suitable host cell or host
tissue, introducing the construct(s) into the host cell or host
tissue, and regenerating plant cells or plants therefrom.
[0393] In particular embodiments, the DNA construct may be
introduced into the plant cell using techniques such as but not
limited to electroporation, microinjection, aerosol beam injection
of plant cell protoplasts, or the DNA constructs can be introduced
directly to plant tissue using biolistic methods, such as DNA
particle bombardment (see also Fu et al., Transgenic Res. 2000
February; 9(1): 1-9). The basis of particle bombardment is the
acceleration of particles coated with gene/s of interest toward
cells, resulting in the penetration of the protoplasm by the
particles and typically stable integration into the genome. (see
e.g. Klein et al, Nature (1987), Klein et ah, Bio/Technology
(1992), Casas et al, Proc. Natl. Acad. Sci USA (1993).).
[0394] In particular embodiments, the DNA constructs containing
components of the RNA targeting CRISPR system may be introduced
into the plant by Agrobacterium-mediated transformation. The DNA
constructs may be combined with suitable T-DNA flanking regions and
introduced into a conventional Agrobacterium tumefaciens host
vector. The foreign DNA can be incorporated into the genome of
plants by infecting the plants or by incubating plant protoplasts
with Agrobacterium bacteria, containing one or more Ti
(tumor-inducing) plasmids. (see e.g. Fraley et al., (1985), Rogers
et al, (1987) and U.S. Pat. No. 5,563,055).
Plant Promoters
[0395] In order to ensure appropriate expression in a plant cell,
the components of the C2c2 CRISPR system described herein are
typically placed under control of a plant promoter, i.e. a promoter
operable in plant cells. The use of different types of promoters is
envisaged.
[0396] A constitutive plant promoter is a promoter that is able to
express the open reading frame (ORF) that it controls in all or
nearly all of the plant tissues during all or nearly all
developmental stages of the plant (referred to as "constitutive
expression"). One non-limiting example of a constitutive promoter
is the cauliflower mosaic virus 35S promoter. The present invention
envisages methods for modifying RNA sequences and as such also
envisages regulating expression of plant biomolecules. In
particular embodiments of the present invention it is thus
advantageous to place one or more elements of the RNA targeting
CRISPR system under the control of a promoter that can be
regulated. "Regulated promoter" refers to promoters that direct
gene expression not constitutively, but in a temporally- and/or
spatially-regulated manner, and includes tissue-specific,
tissue-preferred and inducible promoters. Different promoters may
direct the expression of a gene in different tissues or cell types,
or at different stages of development, or in response to different
environmental conditions. In particular embodiments, one or more of
the RNA targeting CRISPR components are expressed under the control
of a constitutive promoter, such as the cauliflower mosaic virus
35S promoter issue-preferred promoters can be utilized to target
enhanced expression in certain cell types within a particular plant
tissue, for instance vascular cells in leaves or roots or in
specific cells of the seed. Examples of particular promoters for
use in the RNA targeting CRISPR system--are found in Kawamata et
al., (1997) Plant Cell Physiol 38:792-803; Yamamoto et al., (1997)
Plant J 12:255-65; Hire et al, (1992) Plant Mol Biol 20:207-18,
Kuster et al, (1995) Plant Mol Biol 29:759-72, and Capana et al.,
(1994) Plant Mol Biol 25:681-91.
[0397] Examples of promoters that are inducible and that allow for
spatiotemporal control of gene editing or gene expression may use a
form of energy. The form of energy may include but is not limited
to sound energy, electromagnetic radiation, chemical energy and/or
thermal energy. Examples of inducible systems include tetracycline
inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid
transcription activations systems (FKBP, ABA, etc), or light
inducible systems (Phytochrome, LOV domains, or cryptochrome).,
such as a Light Inducible Transcriptional Effector (LITE) that
direct changes in transcriptional activity in a sequence-specific
manner. The components of a light inducible system may include a
RNA targeting CRISPR enzyme, a light-responsive cytochrome
heterodimer (e.g. from Arabidopsis thaliana), and a transcriptional
activation/repression domain. Further examples of inducible DNA
binding proteins and methods for their use are provided in U.S.
61/736,465 and U.S. 61/721,283, which is hereby incorporated by
reference in its entirety.
[0398] In particular embodiments, transient or inducible expression
can be achieved by using, for example, chemical-regulated
promotors, i.e. whereby the application of an exogenous chemical
induces gene expression. Modulating of gene expression can also be
obtained by a chemical-repressible promoter, where application of
the chemical represses gene expression. Chemical-inducible
promoters include, but are not limited to, the maize In2-2
promoter, activated by benzene sulfonamide herbicide safeners (De
Veylder et al., (1997) Plant Cell Physiol 38:568-77), the maize GST
promoter (GST-ll-27, WO93/01294), activated by hydrophobic
electrophilic compounds used as pre-emergent herbicides, and the
tobacco PR-1 a promoter (Ono et al., (2004) Biosci Biotechnol
Biochem 68:803-7) activated by salicylic acid. Promoters which are
regulated by antibiotics, such as tetracycline-inducible and
tetracycline-repressible promoters (Gatz et al., (1991) Mol Gen
Genet 227:229-37; U.S. Pat. Nos. 5,814,618 and 5,789,156) can also
be used herein.
Translocation to and/or Expression in Specific Plant Organelles
[0399] The expression system may comprise elements for
translocation to and/or expression in a specific plant
organelle.
Chloroplast Targeting
[0400] In particular embodiments, it is envisaged that the RNA
targeting CRISPR system is used to specifically modify expression
and/or translation of chloroplast genes or to ensure expression in
the chloroplast. For this purpose use is made of chloroplast
transformation methods or compartmentalization of the RNA targeting
CRISPR components to the chloroplast. For instance, the
introduction of genetic modifications in the plastid genome can
reduce biosafety issues such as gene flow through pollen.
[0401] Methods of chloroplast transformation are known in the art
and include Particle bombardment, PEG treatment, and
microinjection. Additionally, methods involving the translocation
of transformation cassettes from the nuclear genome to the plastid
can be used as described in WO2010061186.
[0402] Alternatively, it is envisaged to target one or more of the
RNA targeting CRISPR components to the plant chloroplast. This is
achieved by incorporating in the expression construct a sequence
encoding a chloroplast transit peptide (CTP) or plastid transit
peptide, operably linked to the 5' region of the sequence encoding
the RNA targeting protein. The CTP is removed in a processing step
during translocation into the chloroplast. Chloroplast targeting of
expressed proteins is well known to the skilled artisan (see for
instance Protein Transport into Chloroplasts, 2010, Annual Review
of Plant Biology, Vol. 61: 157-180). In such embodiments it is also
desired to target the one or more guide RNAs to the plant
chloroplast. Methods and constructs which can be used for
translocating guide RNA into the chloroplast by means of a
chloroplast localization sequence are described, for instance, in
US 20040142476, incorporated herein by reference. Such variations
of constructs can be incorporated into the expression systems of
the invention to efficiently translocate the RNA targeting-guide
RNA(s).
Introduction of Polynucleotides Encoding the CRISPR-RNA Targeting
System in Algal Cells.
[0403] Transgenic algae (or other plants such as rape) may be
particularly useful in the production of vegetable oils or biofuels
such as alcohols (especially methanol and ethanol) or other
products. These may be engineered to express or overexpress high
levels of oil or alcohols for use in the oil or biofuel
industries.
[0404] U.S. Pat. No. 8,945,839 describes a method for engineering
Micro-Algae (Chlamydomonas reinhardtii cells) species) using Cas9.
Using similar tools, the methods of the RNA targeting CRISPR system
described herein can be applied on Chlamydomonas species and other
algae. In particular embodiments, RNA targeting protein and guide
RNA(s) are introduced in algae expressed using a vector that
expresses RNA targeting protein under the control of a constitutive
promoter such as Hsp70A-Rbc S2 or Beta2-tubulin. Guide RNA is
optionally delivered using a vector containing T7 promoter.
Alternatively, RNA targeting mRNA and in vitro transcribed guide
RNA can be delivered to algal cells. Electroporation protocols are
available to the skilled person such as the standard recommended
protocol from the GeneArt Chlamydomonas Engineering kit.
Introduction of Polynucleotides Encoding RNA Targeting Components
in Yeast Cells
[0405] In particular embodiments, the invention relates to the use
of the RNA targeting CRISPR system for RNA editing in yeast cells.
Methods for transforming yeast cells which can be used to introduce
polynucleotides encoding the RNA targeting CRISPR system components
are well known to the artisan and are reviewed by Kawai et al.,
2010, Bioeng Bugs. 2010 November-Dec; 1(6): 395-403). Non-limiting
examples include transformation of yeast cells by lithium acetate
treatment (which may further include carrier DNA and PEG
treatment), bombardment or by electroporation.
Transient Expression of RNA Targeting CRISP System Components in
Plants and Plant Cell
[0406] In particular embodiments, it is envisaged that the guide
RNA and/or RNA targeting gene are transiently expressed in the
plant cell. In these embodiments, the RNA targeting CRISPR system
can ensure modification of RNA target molecules only when both the
guide RNA and the RNA targeting protein is present in a cell, such
that gene expression can further be controlled. As the expression
of the RNA targeting enzyme is transient, plants regenerated from
such plant cells typically contain no foreign DNA. In particular
embodiments the RNA targeting enzyme is stably expressed by the
plant cell and the guide sequence is transiently expressed.
[0407] In particularly preferred embodiments, the RNA targeting
CRISPR system components can be introduced in the plant cells using
a plant viral vector (Scholthof et al. 1996, Annu Rev Phytopathol.
1996; 34:299-323). In further particular embodiments, said viral
vector is a vector from a DNA virus. For example, geminivirus
(e.g., cabbage leaf curl virus, bean yellow dwarf virus, wheat
dwarf virus, tomato leaf curl virus, maize streak virus, tobacco
leaf curl virus, or tomato golden mosaic virus) or nanovirus (e.g.,
Faba bean necrotic yellow virus). In other particular embodiments,
said viral vector is a vector from an RNA virus. For example,
tobravirus (e.g., tobacco rattle virus, tobacco mosaic virus),
potexvirus (e.g., potato virus X), or hordeivirus (e.g., barley
stripe mosaic virus). The replicating genomes of plant viruses are
non-integrative vectors, which is of interest in the context of
avoiding the production of GMO plants.
[0408] In particular embodiments, the vector used for transient
expression of RNA targeting CRISPR constructs is for instance a
pEAQ vector, which is tailored for Agrobacterium-mediated transient
expression (Sainsbury F. et al., Plant Biotechnol J. 2009
September; 7(7):682-93) in the protoplast. Precise targeting of
genomic locations was demonstrated using a modified Cabbage Leaf
Curl virus (CaLCuV) vector to express gRNAs in stable transgenic
plants expressing a CRISPR enzyme (Scientific Reports 5, Article
number: 14926 (2015), doi: 10. 1038/srep14926).
[0409] In particular embodiments, double-stranded DNA fragments
encoding the guide RNA and/or the RNA targeting gene can be
transiently introduced into the plant cell. In such embodiments,
the introduced double-stranded DNA fragments are provided in
sufficient quantity to modify RNA molecule(s) in the cell but do
not persist after a contemplated period of time has passed or after
one or more cell divisions. Methods for direct DNA transfer in
plants are known by the skilled artisan (see for instance Davey et
al. Plant Mol Biol. 1989 September; 13(3):273-85.)
[0410] In other embodiments, an RNA polynucleotide encoding the RNA
targeting protein is introduced into the plant cell, which is then
translated and processed by the host cell generating the protein in
sufficient quantity to modify the RNA molecule(s) cell (in the
presence of at least one guide RNA) but which does not persist
after a contemplated period of time has passed or after one or more
cell divisions. Methods for introducing mRNA to plant protoplasts
for transient expression are known by the skilled artisan (see for
instance in Gallie, Plant Cell Reports (1993), 13; 119-122).
Combinations of the different methods described above are also
envisaged.
Delivery of RNA Targeting CRISPR Components to the Plant Cell
[0411] In particular embodiments, it is of interest to deliver one
or more components of the RNA targeting CRISPR system directly to
the plant cell. This is of interest, inter alia, for the generation
of non-transgenic plants (see below). In particular embodiments,
one or more of the RNA targeting components is prepared outside the
plant or plant cell and delivered to the cell. For instance in
particular embodiments, the RNA targeting protein is prepared in
vitro prior to introduction to the plant cell. RNA targeting
protein can be prepared by various methods known by one of skill in
the art and include recombinant production. After expression, the
RNA targeting protein is isolated, refolded if needed, purified and
optionally treated to remove any purification tags, such as a
His-tag. Once crude, partially purified, or more completely
purified RNA targeting protein is obtained, the protein may be
introduced to the plant cell.
[0412] In particular embodiments, the RNA targeting protein is
mixed with guide RNA targeting the RNA of interest to form a
pre-assembled ribonucleoprotein.
[0413] The individual components or pre-assembled ribonucleoprotein
can be introduced into the plant cell via electroporation, by
bombardment with RNA targeting-associated gene product coated
particles, by chemical transfection or by some other means of
transport across a cell membrane. For instance, transfection of a
plant protoplast with a pre-assembled CRISPR ribonucleoprotein has
been demonstrated to ensure targeted modification of the plant
genome (as described by Woo et al. Nature Biotechnology, 2015; DOI:
10.1038/nbt.3389). These methods can be modified to achieve
targeted modification of RNA molecules in the plants.
[0414] In particular embodiments, the RNA targeting CRISPR system
components are introduced into the plant cells using nanoparticles.
The components, either as protein or nucleic acid or in a
combination thereof, can be uploaded onto or packaged in
nanoparticles and applied to the plants (such as for instance
described in WO 2008042156 and US 20130185823). In particular,
embodiments of the invention comprise nanoparticles uploaded with
or packed with DNA molecule(s) encoding the RNA targeting protein,
DNA molecules encoding the guide RNA and/or isolated guide RNA as
described in WO2015089419.
[0415] Further means of introducing one or more components of the
RNA targeting CRISPR system to the plant cell is by using cell
penetrating peptides (CPP). Accordingly, in particular, embodiments
the invention comprises compositions comprising a cell penetrating
peptide linked to an RNA targeting protein. In particular
embodiments of the present invention, an RNA targeting protein
and/or guide RNA(s) is coupled to one or more CPPs to effectively
transport them inside plant protoplasts (Ramakrishna (2014, Genome
Res. 2014 June; 24(6):1020-7 for Cas9 in human cells). In other
embodiments, the RNA targeting gene and/or guide RNA(s) are encoded
by one or more circular or non-circular DNA molecule(s) which are
coupled to one or more CPPs for plant protoplast delivery. The
plant protoplasts are then regenerated to plant cells and further
to plants. CPPs are generally described as short peptides of fewer
than 35 amino acids either derived from proteins or from chimeric
sequences which are capable of transporting biomolecules across
cell membrane in a receptor independent manner. CPP can be cationic
peptides, peptides having hydrophobic sequences, amphipatic
peptides, peptides having proline-rich and anti-microbial sequence,
and chimeric or bipartite peptides (Pooga and Langel 2005). CPPs
are able to penetrate biological membranes and as such trigger the
movement of various biomolecules across cell membranes into the
cytoplasm and to improve their intracellular routing, and hence
facilitate interaction of the biolomolecule with the target.
Examples of CPP include amongst others: Tat, a nuclear
transcriptional activator protein required for viral replication by
HIV type1, penetratin, Kaposi fibroblast growth factor (FGF) signal
peptide sequence, integrin .beta.3 signal peptide sequence;
polyarginine peptide Args sequence, Guanine rich-molecular
transporters, sweet arrow peptide, etc. . . .
Target RNA Envisaged for Plant, Algae or Fungal Applications
[0416] The target RNA, i.e. the RNA of interest, is the RNA to be
targeted by the present invention leading to the recruitment to,
and the binding of the RNA targeting protein at, the target site of
interest on the target RNA. The target RNA may be any suitable form
of RNA. This may include, in some embodiments, mRNA. In other
embodiments, the target RNA may include transfer RNA (tRNA) or
ribosomal RNA (rRNA). In other embodiments the target RNA may
include interfering RNA (RNAi), microRNA (miRNA), microswitches,
microzymes, satellite RNAs and RNA viruses. The target RNA may be
located in the cytoplasm of the plant cell, or in the cell nucleus
or in a plant cell organelle such as a mitochondrion, chloroplast
or plastid.
[0417] In particular embodiments, the RNA targeting CRISPR system
is used to cleave RNA or otherwise inhibit RNA expression.
Use of RNA Targeting CRISPR System for Modulating Plant Gene
Expression Via RNA Modulation
[0418] The RNA targeting protein may also be used, together with a
suitable guide RNA, to target gene expression, via control of RNA
processing. The control of RNA processing may include RNA
processing reactions such as RNA splicing, including alternative
splicing; viral replication (in particular of plant viruses,
including virioids in plants and tRNA biosynthesis. The RNA
targeting protein in combination with a suitable guide RNA may also
be used to control RNA activation (RNAa). RNAa leads to the
promotion of gene expression, so control of gene expression may be
achieved that way through disruption or reduction of RNAa and thus
less promotion of gene expression.
[0419] The RNA targeting effector protein of the invention can
further be used for antiviral activity in plants, in particular
against RNA viruses. The effector protein can be targeted to the
viral RNA using a suitable guide RNA selective for a selected viral
RNA sequence. In particular, the effector protein may be an active
nuclease that cleaves RNA, such as single stranded RNA. provided is
therefore the use of an RNA targeting effector protein of the
invention as an antiviral agent. Examples of viruses that can be
counteracted in this way include, but are not limited to, Tobacco
mosaic virus (TMV), Tomato spotted wilt virus (TSWV), Cucumber
mosaic virus (CMV), Potato virus Y (PVY), Cauliflower mosaic virus
(CaMV) (RT virus), Plum pox virus (PPV), Brome mosaic virus (BMV)
and Potato virus X (PVX).
[0420] Examples of modulating RNA expression in plants, algae or
fungi, as an alternative of targeted gene modification are
described herein further.
[0421] Of particular interest is the regulated control of gene
expression through regulated cleavage of mRNA. This can be achieved
by placing elements of the RNA targeting under the control of
regulated promoters as described herein.
Use of the RNA Targeting CRISPR System to Restore the Functionality
of tRNA Molecules.
[0422] Pring et al describe RNA editing in plant mitochondria and
chloroplasts that alters mRNA sequences to code for different
proteins than the DNA. (Plant Mol. Biol. (1993) 21 (6): 1163-1170.
doi:l0.1007/BF00023611). In particular embodiments of the
invention, the elements of the RNA targeting CRISPR system
specifically targeting mitochondrial and chloroplast mRNA can be
introduced in a plant or plant cell to express different proteins
in such plant cell organelles mimicking the processes occurring in
vivo.
Use of the RNA Targeting CRISPR System as an Alternative to RNA
Interference to Inhibit RNA Expression.
[0423] The RNA targeting CRISPR system has uses similar to RNA
inhibition or RNA interference, thus can also be substituted for
such methods. In particular embodiment, the methods of the present
invention include the use of the RNA targeting CRISPR as a
substitute for e.g. an interfering ribonucleic acid (such as an
siRNA or shRNA or a dsRNA). Examples of inhibition of RNA
expression in plants, algae or fungi as an alternative of targeted
gene modification are described herein further.
Use of the RNA Targeting CRISPR System to Control RNA
Interference.
[0424] Control over interfering RNA or miRNA may help reduce
off-target effects (OTE) seen with those approaches by reducing the
longevity of the interfering RNA or miRNA in vivo or in vitro. In
particular embodiments, the target RNA may include interfering RNA,
i.e. RNA involved in an RNA interference pathway, such as shRNA,
siRNA and so forth. In other embodiments, the target RNA may
include microRNA (miRNA) or double stranded RNA (dsRNA).
[0425] In other particular embodiments, if the RNA targeting
protein and suitable guide RNA(s) are selectively expressed (for
example spatially or temporally under the control of a regulated
promoter, for example a tissue- or cell cycle-specific promoter
and/or enhancer) this can be used to `protect` the cells or systems
(in vivo or in vitro) from RNAi in those cells. This may be useful
in neighbouring tissues or cells where RNAi is not required or for
the purposes of comparison of the cells or tissues where the
effector protein and suitable guide are and are not expressed (i.e.
where the RNAi is not controlled and where it is, respectively).
The RNA targeting protein may be used to control or bind to
molecules comprising or consisting of RNA, such as ribozymes,
ribosomes or riboswitches. In embodiments of the invention, the
guide RNA can recruit the RNA targeting protein to these molecules
so that the RNA targeting protein is able to bind to them.
[0426] The RNA targeting CRISPR system of the invention can be
applied in areas of in-planta RNAi technologies, without undue
experimentation, from this disclosure, including insect pest
management, plant disease management and management of herbicide
resistance, as well as in plant assay and for other applications
(see, for instance Kim et al., in Pesticide Biochemistry and
Physiology (Impact Factor: 2.01). 01/2015; 120. DOI:
10.1016/j.pestbp.2015.01.002; Sharma et al. in Academic Journals
(2015), Vol. 12(18) pp 2303-2312); Green J. M, inPest Management
Science, Vol 70(9), pp 1351-1357), because the present application
provides the foundation for informed engineering of the system.
Use of RNA Targeting CRISPR System to Modify Riboswitches and
Control Metabolic Regulation in Plants, Algae and Fungi
[0427] Riboswitches (also known as aptozymes) are regulatory
segments of messenger RNA that bind small molecules and in turn
regulate gene expression. This mechanism allows the cell to sense
the intracellular concentration of these small molecules. A
particular riboswitch typically regulates its adjacent gene by
altering the transcription, the translation or the splicing of this
gene. Thus, in particular embodiments of the present invention,
control of riboswitch activity is envisaged through the use of the
RNA targeting protein in combination with a suitable guide RNA to
target the riboswitch. This may be through cleavage of, or binding
to, the riboswitch. In particular embodiments, reduction of
riboswitch activity is envisaged. Recently, a riboswitch that binds
thiamin pyrophosphate (TPP) was characterized and found to regulate
thiamin biosynthesis in plants and algae. Furthermore it appears
that this element is an essential regulator of primary metabolism
in plants (Bocobza and Aharoni, Plant J. 2014 August;
79(4):693-703. doi: 10.1111/tpj.12540. Epub 2014 Jun 17). TPP
riboswitches are also found in certain fungi, such as in Neurospora
crassa, where it controls alternative splicing to conditionally
produce an Upstream Open Reading Frame (uORF), thereby affecting
the expression of downstream genes (Cheah M T et al., (2007) Nature
447 (7143): 497-500. doi:10.1038/nature05769) The RNA targeting
CRISPR system described herein may be used to manipulate the
endogenous riboswitch activity in plants, algae or fungi and as
such alter the expression of downstream genes controlled by it. In
particular embodiments, the RNA targeting CRISP system may be used
in assaying riboswitch function in vivo or in vitro and in studying
its relevance for the metabolic network. In particular embodiments
the RNA targeting CRISPR system may potentially be used for
engineering of riboswitches as metabolite sensors in plants and
platforms for gene control.
Use of RNA Targeting CRISPR System in RNAi Screens for Plants,
Algae or Fungi
[0428] Identifying gene products whose knockdown is associated with
phenotypic changes, biological pathways can be interrogated and the
constituent parts identified, via RNAi screens. In particular
embodiments of the invention, control may also be exerted over or
during these screens by use of the Guide 29 or Guide 30 protein and
suitable guide RNA described herein to remove or reduce the
activity of the RNAi in the screen and thus reinstate the activity
of the (previously interfered with) gene product (by removing or
reducing the interference/repression).
Use of RNA Targeting Proteins for Visualization of RNA Molecules In
Vivo and In Vitro
[0429] In particular embodiments, the invention provides a nucleic
acid binding system. In situ hybridization of RNA with
complementary probes is a powerful technique. Typically fluorescent
DNA oligonucleotides are used to detect nucleic acids by
hybridization. Increased efficiency has been attained by certain
modifications, such as locked nucleic acids (LNAs), but there
remains a need for efficient and versatile alternatives. As such,
labelled elements of the RNA targeting system can be used as an
alternative for efficient and adaptable system for in situ
hybridization
Further Applications of the RNA Targeting CRISPR System in Plants
and Yeasts
Use of RNA Targeting CRISPR System in Biofuel Production
[0430] The term "biofuel" as used herein is an alternative fuel
made from plant and plant-derived resources. Renewable biofuels can
be extracted from organic matter whose energy has been obtained
through a process of carbon fixation or are made through the use or
conversion of biomass. This biomass can be used directly for
biofuels or can be converted to convenient energy containing
substances by thermal conversion, chemical conversion, and
biochemical conversion. This biomass conversion can result in fuel
in solid, liquid, or gas form. There are two types of biofuels:
bioethanol and biodiesel. Bioethanol is mainly produced by the
sugar fermentation process of cellulose (starch), which is mostly
derived from maize and sugar cane. Biodiesel on the other hand is
mainly produced from oil crops such as rapeseed, palm, and soybean.
Biofuels are used mainly for transportation.
Enhancing Plant Properties for Biofuel Production
[0431] In particular embodiments, the methods using the RNA
targeting CRISPR system as described herein are used to alter the
properties of the cell wall in order to facilitate access by key
hydrolysing agents for a more efficient release of sugars for
fermentation. In particular embodiments, the biosynthesis of
cellulose and/or lignin are modified. Cellulose is the major
component of the cell wall. The biosynthesis of cellulose and
lignin are co-regulated. By reducing the proportion of lignin in a
plant the proportion of cellulose can be increased. In particular
embodiments, the methods described herein are used to downregulate
lignin biosynthesis in the plant so as to increase fermentable
carbohydrates. More particularly, the methods described herein are
used to downregulate at least a first lignin biosynthesis gene
selected from the group consisting of 4-coumarate 3-hydroxylase
(C3H), phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase
(C4H), hydroxycinnamoyl transferase (HCT), caffeic acid
O-methyltransferase (COMT), caffeoyl CoA 3-O-methyltransferase
(CCoAOMT), ferulate 5-hydroxylase (F5H), cinnamyl alcohol
dehydrogenase (CAD), cinnamoyl CoA-reductase (CCR), 4-coumarate-CoA
ligase (4CL), monolignol-lignin-specific glycosyltransferase, and
aldehyde dehydrogenase (ALDH) as disclosed in WO 2008064289 A2.
[0432] In particular embodiments, the methods described herein are
used to produce plant mass that produces lower levels of acetic
acid during fermentation (see also WO 2010096488).
Modifying Yeast for Biofuel Production
[0433] In particular embodiments, the RNA targeting enzyme provided
herein is used for bioethanol production by recombinant
micro-organisms. For instance, RNA targeting enzymes can be used to
engineer micro-organisms, such as yeast, to generate biofuel or
biopolymers from fermentable sugars and optionally to be able to
degrade plant-derived lignocellulose derived from agricultural
waste as a source of fermentable sugars. More particularly, the
invention provides methods whereby the RNA targeting CRISPR complex
is used to modify the expression of endogenous genes required for
biofuel production and/or to modify endogenous genes why may
interfere with the biofuel synthesis. More particularly the methods
involve stimulating the expression in a micro-organism such as a
yeast of one or more nucleotide sequence encoding enzymes involved
in the conversion of pyruvate to ethanol or another product of
interest. In particular embodiments the methods ensure the
stimulation of expression of one or more enzymes which allows the
micro-organism to degrade cellulose, such as a cellulase. In yet
further embodiments, the RNA targeting CRISPR complex is used to
suppress endogenous metabolic pathways which compete with the
biofuel production pathway.
Modifying Algae and Plants for Production of Vegetable Oils or
Biofuels
[0434] Transgenic algae or other plants such as rape may be
particularly useful in the production of vegetable oils or biofuels
such as alcohols (especially methanol and ethanol), for instance.
These may be engineered to express or overexpress high levels of
oil or alcohols for use in the oil or biofuel industries.
[0435] U.S. Pat. No. 8,945,839 describes a method for engineering
Micro-Algae (Chlamydomonas reinhardtii cells) species) using Cas9.
Using similar tools, the methods of the RNA targeting CRISPR system
described herein can be applied on Chlamydomonas species and other
algae. In particular embodiments, the RNA targeting effector
protein and guide RNA are introduced in algae expressed using a
vector that expresses the RNA targeting effector protein under the
control of a constitutive promoter such as Hsp70A-Rbc S2 or
Beta2-tubulin. Guide RNA will be delivered using a vector
containing T7 promoter. Alternatively, in vitro transcribed guide
RNA can be delivered to algae cells. Electroporation protocol
follows standard recommended protocol from the GeneArt
Chlamydomonas Engineering kit.
Particular Applications of the RNA Targeting Enzymes in Plants
[0436] In particular embodiments, present invention can be used as
a therapy for virus removal in plant systems as it is able to
cleave viral RNA. Previous studies in human systems have
demonstrated the success of utilizing CRISPR in targeting the
single strand RNA virus, hepatitis C (A. Price, et al., Proc. Natl.
Acad. Sci, 2015). These methods may also be adapted for using the
RNA targeting CRISPR system in plants.
Improved Plants
[0437] The present invention also provides plants and yeast cells
obtainable and obtained by the methods provided herein. The
improved plants obtained by the methods described herein may be
useful in food or feed production through the modified expression
of genes which, for instance ensure tolerance to plant pests,
herbicides, drought, low or high temperatures, excessive water,
etc.
[0438] The improved plants obtained by the methods described
herein, especially crops and algae may be useful in food or feed
production through expression of, for instance, higher protein,
carbohydrate, nutrient or vitamin levels than would normally be
seen in the wildtype. In this regard, improved plants, especially
pulses and tubers are preferred.
[0439] Improved algae or other plants such as rape may be
particularly useful in the production of vegetable oils or biofuels
such as alcohols (especially methanol and ethanol), for instance.
These may be engineered to express or overexpress high levels of
oil or alcohols for use in the oil or biofuel industries.
[0440] The invention also provides for improved parts of a plant.
Plant parts include, but are not limited to, leaves, stems, roots,
tubers, seeds, endosperm, ovule, and pollen. Plant parts as
envisaged herein may be viable, nonviable, regeneratable, and/or
non-regeneratable.
[0441] It is also encompassed herein to provide plant cells and
plants generated according to the methods of the invention.
Gametes, seeds, embryos, either zygotic or somatic, progeny or
hybrids of plants comprising the genetic modification, which are
produced by traditional breeding methods, are also included within
the scope of the present invention. Such plants may contain a
heterologous or foreign DNA sequence inserted at or instead of a
target sequence. Alternatively, such plants may contain only an
alteration (mutation, deletion, insertion, substitution) in one or
more nucleotides. As such, such plants will only be different from
their progenitor plants by the presence of the particular
modification.
[0442] In an embodiment of the invention, a C2c2 system is used to
engineer pathogen resistant plants, for example by creating
resistance against diseases caused by bacteria, fungi or viruses.
In certain embodiments, pathogen resistance can be accomplished by
engineering crops to produce a C2c2 system that will be ingested by
an insect pest, leading to mortality. In an embodiment of the
invention, a C2c2 system is used to engineer abiotic stress
tolerance. In another embodiment, a C2c2 system is used to engineer
drought stress tolerance or salt stress tolerance, or cold or heat
stress tolerance. Younis et al. 2014, Int. J. Biol. Sci. 10; 1150
reviewed potential targets of plant breeding methods, all of which
are amenable to correction or improvement through use of a C2c2
system described herein. Some non-limiting target crops include
Arabidops Zea mays is thaliana, Oryza sativa L, Prunus domestica
L., Gossypium hirsutum, Nicotiana rustica, Zea mays, Medicago
sativa, Nicotiana benthamiana and Arabidopsis thaliana
[0443] In an embodiment of the invention, a C2c2 system is used for
management of crop pests. For example, a C2c2 system operable in a
crop pest can be expressed from a plant host or transferred
directly to the target, for example using a viral vector.
[0444] In an embodiment, the invention provides a method of
efficiently producing homozygous organisms from a heterozygous
non-human starting organism. In an embodiment, the invention is
used in plant breeding. In another embodiment, the invention is
used in animal breeding. In such embodiments, a homozygous organism
such as a plant or animal is made by preventing or suppressing
recombination by interfering with at least one target gene involved
in double strand breaks, chromosome pairing and/or strand
exchange.
Application of the C2C2 Proteins in Optimized Functional RNA
Targeting Systems
[0445] In an aspect the invention provides a system for specific
delivery of functional components to the RNA environment. This can
be ensured using the CRISPR systems comprising the RNA targeting
effector proteins of the present invention which allow specific
targeting of different components to RNA. More particularly such
components include activators or repressors, such as activators or
repressors of RNA translation, degradation, etc. Applications of
this system are described elsewhere herein.
[0446] According to one aspect the invention provides non-naturally
occurring or engineered composition comprising a guide RNA
comprising a guide sequence capable of hybridizing to a target
sequence in a genomic locus of interest in a cell, wherein the
guide RNA is modified by the insertion of one or more distinct RNA
sequence(s) that bind an adaptor protein. In particular
embodiments, the RNA sequences may bind to two or more adaptor
proteins (e.g. aptamers), and wherein each adaptor protein is
associated with one or more functional domains. The guide RNAs of
the c2c2 enzymes described herein are shown to be amenable to
modification of the guide sequence. In particular embodiments, the
guide RNA is modified by the insertion of distinct RNA sequence(s)
5' of the direct repeat, within the direct repeat, or 3' of the
guide sequence. When there is more than one functional domain, the
functional domains can be same or different, e.g., two of the same
or two different activators or repressors. In an aspect the
invention provides a herein-discussed composition, wherein the one
or more functional domains are attached to the RNA targeting enzyme
so that upon binding to the target RNA the functional domain is in
a spatial orientation allowing for the functional domain to
function in its attributed function; In an aspect the invention
provides a herein-discussed composition, wherein the composition
comprises a CRISPR-Cas complex having at least three functional
domains, at least one of which is associated with the RNA targeting
enzyme and at least two of which are associated with the gRNA.
[0447] Accordingly, In an aspect the invention provides
non-naturally occurring or engineered CRISPR-Cas complex
composition comprising the guide RNA as herein-discussed and a
CRISPR enzyme which is an RNA targeting enzyme, wherein optionally
the RNA targeting enzyme comprises at least one mutation, such that
the RNA targeting enzyme has no more than 5% of the nuclease
activity of the enzyme not having the at least one mutation, and
optionally one or more comprising at least one or more nuclear
localization sequences. In particular embodiments, the guide RNA is
additionally or alternatively modified so as to still ensure
binding of the RNA targeting enzyme but to prevent cleavage by the
RNA targeting enzyme (as detailed elsewhere herein).
[0448] In particular embodiments, the RNA targeting enzyme is a
c2c2 enzyme which has a diminished nuclease activity of at least
97%, or 100% as compared with the c2c2 enzyme not having the at
least one mutation. In an aspect the invention provides a
herein-discussed composition, wherein the C2c2 enzyme comprises two
or more mutations. The mutations may be selected from mutations of
one or more of the following amino acid residues: R597, H602,
R1278, and H1283, such as for instance one or more of the following
mutations: R597A, H602A, R1278A, and H1283A, according to
Leptotrichia shahii c2c2 protein or a corresponding position in an
ortholog.
[0449] In particular embodiments, an RNA targeting system is
provided as described herein above comprising two or more
functional domains. In particular embodiments, the two or more
functional domains are heterologous functional domain. In
particular embodiments, the system comprises an adaptor protein
which is a fusion protein comprising a functional domain, the
fusion protein optionally comprising a linker between the adaptor
protein and the functional domain. In particular embodiments, the
linker includes a GlySer linker. Additionally or alternatively, one
or more functional domains are attached to the RNA effector protein
by way of a linker, optionally a GlySer linker. In particular
embodiments, the one or more functional domains are attached to the
RNA targeting enzyme through one or both of the HEPN domains.
[0450] In an aspect the invention provides a herein-discussed
composition, wherein the one or more functional domains associated
with the adaptor protein or the RNA targeting enzyme is a domain
capable of activating or repressing RNA translation. In an aspect
the invention provides a herein-discussed composition, wherein at
least one of the one or more functional domains associated with the
adaptor protein have one or more activities comprising methylase
activity, demethylase activity, transcription activation activity,
transcription repression activity, transcription release factor
activity, histone modification activity, DNA integration activity
RNA cleavage activity, DNA cleavage activity or nucleic acid
binding activity, or molecular switch activity or chemical
inducibility or light inducibility.
[0451] In an aspect the invention provides a herein-discussed
composition comprising an aptamer sequence. In particular
embodiments, the aptamer sequence is two or more aptamer sequences
specific to the same adaptor protein. In an aspect the invention
provides a herein-discussed composition, wherein the aptamer
sequence is two or more aptamer sequences specific to different
adaptor protein. In an aspect the invention provides a
herein-discussed composition, wherein the adaptor protein comprises
MS2, PP7, Q.beta., F2, GA, fr, JP501, M12, R17, BZ13, JP34, JP500,
KU1, M11, MX1, TW18, VK, SP, FI, ID2, NL95, TW19, AP205, .PHI.Cb5,
.PHI.Cb8r, .PHI.Cb12r, .PHI.Cb23r, 7s, PRR1. Accordingly, in
particular embodiments, the aptamer is selected from a binding
protein specifically binding any one of the adaptor proteins listed
above. In an aspect the invention provides a herein-discussed
composition, wherein the cell is a eukaryotic cell. In an aspect
the invention provides a herein-discussed composition, wherein the
eukaryotic cell is a mammalian cell, a plant cell or a yeast cell,
whereby the mammalian cell is optionally a mouse cell. In an aspect
the invention provides a herein-discussed composition, wherein the
mammalian cell is a human cell.
[0452] In an aspect the invention provides a herein above-discussed
composition wherein there is more than one gRNA, and the gRNAs
target different sequences whereby when the composition is
employed, there is multiplexing. In an aspect the invention
provides a composition wherein there is more than one gRNA modified
by the insertion of distinct RNA sequence(s) that bind to one or
more adaptor proteins.
[0453] In an aspect the invention provides a herein-discussed
composition wherein one or more adaptor proteins associated with
one or more functional domains is present and bound to the distinct
RNA sequence(s) inserted into the guide RNA(s).
[0454] In an aspect the invention provides a herein-discussed
composition wherein the guide RNA is modified to have at least one
non-coding functional loop; e.g., wherein the at least one
non-coding functional loop is repressive; for instance, wherein at
least one non-coding functional loop comprises Alu.
[0455] In an aspect the invention provides a method for modifying
gene expression comprising the administration to a host or
expression in a host in vivo of one or more of the compositions as
herein-discussed.
[0456] In an aspect the invention provides a herein-discussed
method comprising the delivery of the composition or nucleic acid
molecule(s) coding therefor, wherein said nucleic acid molecule(s)
are operatively linked to regulatory sequence(s) and expressed in
vivo. In an aspect the invention provides a herein-discussed method
wherein the expression in vivo is via a lentivirus, an adenovirus,
or an AAV.
[0457] In an aspect the invention provides a mammalian cell line of
cells as herein-discussed, wherein the cell line is, optionally, a
human cell line or a mouse cell line. In an aspect the invention
provides a transgenic mammalian model, optionally a mouse, wherein
the model has been transformed with a herein-discussed composition
or is a progeny of said transformant.
[0458] In an aspect the invention provides a nucleic acid
molecule(s) encoding guide RNA or the RNA targeting CRISPR-Cas
complex or the composition as herein-discussed. In an aspect the
invention provides a vector comprising: a nucleic acid molecule
encoding a guide RNA (gRNA) comprising a guide sequence capable of
hybridizing to a target sequence in a genomic locus of interest in
a cell, wherein the direct repeat of the gRNA is modified by the
insertion of distinct RNA sequence(s) that bind(s) to two or more
adaptor proteins, and wherein each adaptor protein is associated
with one or more functional domains; or, wherein the gRNA is
modified to have at least one non-coding functional loop. In an
aspect the invention provides vector(s) comprising nucleic acid
molecule(s) encoding: non-naturally occurring or engineered
CRISPR-Cas complex composition comprising the gRNA
herein-discussed, and an RNA targeting enzyme, wherein optionally
the RNA targeting enzyme comprises at least one mutation, such that
the RNA targeting enzyme has no more than 5% of the nuclease
activity of the RNA targeting enzyme not having the at least one
mutation, and optionally one or more comprising at least one or
more nuclear localization sequences. In an aspect a vector can
further comprise regulatory element(s) operable in a eukaryotic
cell operably linked to the nucleic acid molecule encoding the
guide RNA (gRNA) and/or the nucleic acid molecule encoding the RNA
targeting enzyme and/or the optional nuclear localization
sequence(s).
[0459] In one aspect, the invention provides a kit comprising one
or more of the components described hereinabove. In some
embodiments, the kit comprises a vector system as described above
and instructions for using the kit.
[0460] In an aspect the invention provides a method of screening
for gain of function (GOF) or loss of function (LOF) or for
screening non-coding RNAs or potential regulatory regions (e.g.
enhancers, repressors) comprising the cell line of as
herein-discussed or cells of the model herein-discussed containing
or expressing the RNA targeting enzyme and introducing a
composition as herein-discussed into cells of the cell line or
model, whereby the gRNA includes either an activator or a
repressor, and monitoring for GOF or LOF respectively as to those
cells as to which the introduced gRNA includes an activator or as
to those cells as to which the introduced gRNA includes a
repressor.
[0461] In an aspect the invention provides a library of
non-naturally occurring or engineered compositions, each comprising
a RNA targeting CRISPR guide RNA (gRNA) comprising a guide sequence
capable of hybridizing to a target RNA sequence of interest in a
cell, an RNA targeting enzyme, wherein the RNA targeting enzyme
comprises at least one mutation, such that the RNA targeting enzyme
has no more than 5% of the nuclease activity of the RNA targeting
enzyme not having the at least one mutation, wherein the gRNA is
modified by the insertion of distinct RNA sequence(s) that bind to
one or more adaptor proteins, and wherein the adaptor protein is
associated with one or more functional domains, wherein the
composition comprises one or more or two or more adaptor proteins,
wherein the each protein is associated with one or more functional
domains, and wherein the gRNAs comprise a genome wide library
comprising a plurality of RNA targeting guide RNAs (gRNAs). In an
aspect the invention provides a library as herein-discussed,
wherein the RNA targeting RNA targeting enzyme has a diminished
nuclease activity of at least 97%, or 100% as compare with the RNA
targeting enzyme not having the at least one mutation. In an aspect
the invention provides a library as herein-discussed, wherein the
adaptor protein is a fusion protein comprising the functional
domain. In an aspect the invention provides a library as herein
discussed, wherein the gRNA is not modified by the insertion of
distinct RNA sequence(s) that bind to the one or two or more
adaptor proteins. In an aspect the invention provides a library as
herein discussed, wherein the one or two or more functional domains
are associated with the RNA targeting enzyme. In an aspect the
invention provides a library as herein discussed, wherein the cell
population of cells is a population of eukaryotic cells. In an
aspect the invention provides a library as herein discussed,
wherein the eukaryotic cell is a mammalian cell, a plant cell or a
yeast cell. In an aspect the invention provides a library as herein
discussed, wherein the mammalian cell is a human cell. In an aspect
the invention provides a library as herein discussed, wherein the
population of cells is a population of embryonic stem (ES)
cells.
[0462] In an aspect the invention provides a library as herein
discussed, wherein the targeting is of about 100 or more RNA
sequences. In an aspect the invention provides a library as herein
discussed, wherein the targeting is of about 1000 or more RNA
sequences. In an aspect the invention provides a library as herein
discussed, wherein the targeting is of about 20,000 or more
sequences. In an aspect the invention provides a library as herein
discussed, wherein the targeting is of the entire transcriptome. In
an aspect the invention provides a library as herein discussed,
wherein the targeting is of a panel of target sequences focused on
a relevant or desirable pathway. In an aspect the invention
provides a library as herein discussed, wherein the pathway is an
immune pathway. In an aspect the invention provides a library as
herein discussed, wherein the pathway is a cell division
pathway.
[0463] In one aspect, the invention provides a method of generating
a model eukaryotic cell comprising a gene with modified expression.
In some embodiments, a disease gene is any gene associated an
increase in the risk of having or developing a disease. In some
embodiments, the method comprises (a) introducing one or more
vectors encoding the components of the system described herein
above into a eukaryotic cell, and (b) allowing a CRISPR complex to
bind to a target polynucleotide so as to modify expression of a
gene, thereby generating a model eukaryotic cell comprising
modified gene expression.
[0464] The structural information provided herein allows for
interrogation of guide RNA interaction with the target RNA and the
RNA targeting enzyme permitting engineering or alteration of guide
RNA structure to optimize functionality of the entire RNA targeting
CRISPR-Cas system. For example, the guide RNA may be extended,
without colliding with the RNA targeting protein by the insertion
of adaptor proteins that can bind to RNA. These adaptor proteins
can further recruit effector proteins or fusions which comprise one
or more functional domains.
[0465] An aspect of the invention is that the above elements are
comprised in a single composition or comprised in individual
compositions. These compositions may advantageously be applied to a
host to elicit a functional effect on the genomic level.
[0466] The skilled person will understand that modifications to the
guide RNA which allow for binding of the adapter+functional domain
but not proper positioning of the adapter+functional domain (e.g.
due to steric hindrance within the three dimensial structure of the
CRISPR complex) are modifications which are not intended. The one
or more modified guide RNA may be modified, by introduction of a
distinct RNA sequence(s) 5' of the direct repeat, within the direct
repeat, or 3' of the guide sequence.
[0467] The modified guide RNA, the inactivated RNA targeting enzyme
(with or without functional domains), and the binding protein with
one or more functional domains, may each individually be comprised
in a composition and administered to a host individually or
collectively. Alternatively, these components may be provided in a
single composition for administration to a host. Administration to
a host may be performed via viral vectors known to the skilled
person or described herein for delivery to a host (e.g. lentiviral
vector, adenoviral vector, AAV vector). As explained herein, use of
different selection markers (e.g. for lentiviral gRNA selection)
and concentration of gRNA (e.g. dependent on whether multiple gRNAs
are used) may be advantageous for eliciting an improved effect.
[0468] Using the provided compositions, the person skilled in the
art can advantageously and specifically target single or multiple
loci with the same or different functional domains to elicit one or
more genomic events. The compositions may be applied in a wide
variety of methods for screening in libraries in cells and
functional modeling in vivo (e.g. gene activation of lincRNA and
indentification of function; gain-of-function modeling;
loss-of-function modeling; the use the compositions of the
invention to establish cell lines and transgenic animals for
optimization and screening purposes).
[0469] The current invention comprehends the use of the
compositions of the current invention to establish and utilize
conditional or inducible CRISPR RNA targeting events. (See, e.g.,
Platt et al., Cell (2014), dx.doi.org/10.1016/j.cell.2014.09.014,
or PCT patent publications cited herein, such as WO 2014/093622
(PCT/US2013/074667), which are not believed prior to the present
invention or application). For example, the target cell comprises
RNA targeting CRISRP enzyme conditionally or inducibly (e.g. in the
form of Cre dependent constructs) and/or the adapter protein
conditionally or inducibly and, on expression of a vector
introduced into the target cell, the vector expresses that which
induces or gives rise to the condition of s RNA targeting enzyme
expression and/or adaptor expression in the target cell. By
applying the teaching and compositions of the current invention
with the known method of creating a CRISPR complex, inducible gene
expression affected by functional domains are also an aspect of the
current invention. Alternatively, the adaptor protein may be
provided as a conditional or inducible element with a conditional
or inducible s RNA targeting enzyme to provide an effective model
for screening purposes, which advantageously only requires minimal
design and administration of specific gRNAs for a broad number of
applications.
Guide RNA According to the Invention Comprising a Dead Guide
Sequence
[0470] In one aspect, the invention provides guide sequences which
are modified in a manner which allows for formation of the CRISPR
complex and successful binding to the target, while at the same
time, not allowing for successful nuclease activity (i.e. without
nuclease activity/without indel activity). For matters of
explanation such modified guide sequences are referred to as "dead
guides" or "dead guide sequences". These dead guides or dead guide
sequences can be thought of as catalytically inactive or
conformationally inactive with regard to nuclease activity. Indeed,
dead guide sequences may not sufficiently engage in productive base
pairing with respect to the ability to promote catalytic activity
or to distinguish on-target and off-target binding activity.
Briefly, the assay involves synthesizing a CRISPR target RNA and
guide RNAs comprising mismatches with the target RNA, combining
these with the RNA targeting enzyme and analyzing cleavage based on
gels based on the presence of bands generated by cleavage products,
and quantifying cleavage based upon relative band intensities.
[0471] Hence, in a related aspect, the invention provides a
non-naturally occurring or engineered composition RNA targeting
CRISPR-Cas system comprising a functional RNA targeting as
described herein, and guide RNA (gRNA) wherein the gRNA comprises a
dead guide sequence whereby the gRNA is capable of hybridizing to a
target sequence such that the RNA targeting CRISPR-Cas system is
directed to a genomic locus of interest in a cell without
detectable RNA cleavage activity of a non-mutant RNA targeting
enzyme of the system. It is to be understood that any of the gRNAs
according to the invention as described herein elsewhere may be
used as dead gRNAs/gRNAs comprising a dead guide sequence as
described herein below. Any of the methods, products, compositions
and uses as described herein elsewhere is equally applicable with
the dead gRNAs/gRNAs comprising a dead guide sequence as further
detailed below. By means of further guidance, the following
particular aspects and embodiments are provided.
[0472] The ability of a dead guide sequence to direct
sequence-specific binding of a CRISPR complex to an RNA target
sequence may be assessed by any suitable assay. For example, the
components of a CRISPR system sufficient to form a CRISPR complex,
including the dead guide sequence to be tested, may be provided to
a host cell having the corresponding target sequence, such as by
transfection with vectors encoding the components of the CRISPR
sequence, followed by an assessment of preferential cleavage within
the target sequence. For instance, cleavage of a target RNA
polynucleotide sequence may be evaluated in a test tube by
providing the target sequence, components of a CRISPR complex,
including the dead guide sequence to be tested and a control guide
sequence different from the test dead guide sequence, and comparing
binding or rate of cleavage at the target sequence between the test
and control guide sequence reactions. Other assays are possible,
and will occur to those skilled in the art. A dead guide sequence
may be selected to target any target sequence. In some embodiments,
the target sequence is a sequence within a genome of a cell.
[0473] As explained further herein, several structural parameters
allow for a proper framework to arrive at such dead guides. Dead
guide sequences are typically shorter than respective guide
sequences which result in active RNA cleavage. In particular
embodiments, dead guides are 5%, 10%, 20%, 30%, 40%, 50%, shorter
than respective guides directed to the same.
[0474] As explained below and known in the art, one aspect of
gRNA--RNA targeting specificity is the direct repeat sequence,
which is to be appropriately linked to such guides. In particular,
this implies that the direct repeat sequences are designed
dependent on the origin of the RNA targeting enzyme. Thus,
structural data available for validated dead guide sequences may be
used for designing C2c2 specific equivalents. Structural similarity
between, e.g., the orthologous nuclease domains HEPN of two or more
C2c2 effector proteins may be used to transfer design equivalent
dead guides. Thus, the dead guide herein may be appropriately
modified in length and sequence to reflect such C2c2 specific
equivalents, allowing for formation of the CRISPR complex and
successful binding to the target RNA, while at the same time, not
allowing for successful nuclease activity.
[0475] The use of dead guides in the context herein as well as the
state of the art provides a surprising and unexpected platform for
network biology and/or systems biology in both in vitro, ex vivo,
and in vivo applications, allowing for multiplex gene targeting,
and in particular bidirectional multiplex gene targeting. Prior to
the use of dead guides, addressing multiple targets has been
challenging and in some cases not possible. With the use of dead
guides, multiple targets, and thus multiple activities, may be
addressed, for example, in the same cell, in the same animal, or in
the same patient. Such multiplexing may occur at the same time or
staggered for a desired timeframe.
[0476] For example, the dead guides allow to use gRNA as a means
for gene targeting, without the consequence of nuclease activity,
while at the same time providing directed means for activation or
repression. Guide RNA comprising a dead guide may be modified to
further include elements in a manner which allow for activation or
repression of gene activity, in particular protein adaptors (e.g.
aptamers) as described herein elsewhere allowing for functional
placement of gene effectors (e.g. activators or repressors of gene
activity). One example is the incorporation of aptamers, as
explained herein and in the state of the art. By engineering the
gRNA comprising a dead guide to incorporate protein-interacting
aptamers (Konermann et al., "Genome-scale transcription activation
by an engineered CRISPR-Cas9 complex," doi:10.1038/nature14136,
incorporated herein by reference), one may assemble multiple
distinct effector domains. Such may be modeled after natural
processes.
[0477] Thus, one aspect is a gRNA of the invention which comprises
a dead guide, wherein the gRNA further comprises modifications
which provide for gene activation or repression, as described
herein. The dead gRNA may comprise one or more aptamers. The
aptamers may be specific to gene effectors, gene activators or gene
repressors. Alternatively, the aptamers may be specific to a
protein which in turn is specific to and recruits/binds a specific
gene effector, gene activator or gene repressor. If there are
multiple sites for activator or repressor recruitment, it is
preferred that the sites are specific to either activators or
repressors. If there are multiple sites for activator or repressor
binding, the sites may be specific to the same activators or same
repressors. The sites may also be specific to different activators
or different repressors. The effectors, activators, repressors may
be present in the form of fusion proteins.
[0478] In an aspect, the invention provides a method of selecting a
dead guide RNA targeting sequence for directing a functionalized
CRISPR system to a gene locus in an organism, which comprises: a)
locating one or more CRISPR motifs in the gene locus; b) analyzing
the 20 nt sequence downstream of each CRISPR motif by: i)
determining the GC content of the sequence; and ii) determining
whether there are off-target matches of the first 15 nt of the
sequence in the genome of the organism; c) selecting the sequence
for use in a guide RNA if the GC content of the sequence is 70% or
less and no off-target matches are identified. In an embodiment,
the sequence is selected if the GC content is 50% or less. In an
embodiment, the sequence is selected if the GC content is 40% or
less. In an embodiment, the sequence is selected if the GC content
is 30% or less. In an embodiment, two or more sequences are
analyzed and the sequence having the lowest GC content is selected.
In an embodiment, off-target matches are determined in regulatory
sequences of the organism. In an embodiment, the gene locus is a
regulatory region. An aspect provides a dead guide RNA comprising
the targeting sequence selected according to the aforementioned
methods.
[0479] In an aspect, the invention provides a dead guide RNA for
targeting a functionalized CRISPR system to a gene locus in an
organism. In an embodiment of the invention, the dead guide RNA
comprises a targeting sequence wherein the CG content of the target
sequence is 70% or less, and the first 15 nt of the targeting
sequence does not match an off-target sequence downstream from a
CRISPR motif in the regulatory sequence of another gene locus in
the organism. In certain embodiments, the GC content of the
targeting sequence 60% or less, 55% or less, 50% or less, 45% or
less, 40% or less, 35% or less or 30% or less. In certain
embodiments, the GC content of the targeting sequence is from 70%
to 60% or from 60% to 50% or from 50% to 40% or from 40% to 30%. In
an embodiment, the targeting sequence has the lowest CG content
among potential targeting sequences of the locus.
[0480] In an embodiment of the invention, the first 15 nt of the
dead guide match the target sequence. In another embodiment, first
14 nt of the dead guide match the target sequence. In another
embodiment, the first 13 nt of the dead guide match the target
sequence. In another embodiment first 12 nt of the dead guide match
the target sequence. In another embodiment, first 11 nt of the dead
guide match the target sequence. In another embodiment, the first
10 nt of the dead guide match the target sequence. In an embodiment
of the invention the first 15 nt of the dead guide does not match
an off-target sequence downstream from a CRISPR motif in the
regulatory region of another gene locus. In other embodiments, the
first 14 nt, or the first 13 nt of the dead guide, or the first 12
nt of the guide, or the first 11 nt of the dead guide, or the first
10 nt of the dead guide, does not match an off-target sequence
downstream from a CRISPR motif in the regulatory region of another
gene locus. In other embodiments, the first 15 nt, or 14 nt, or 13
nt, or 12 nt, or 11 nt of the dead guide do not match an off-target
sequence downstream from a CRISPR motif in the genome.
[0481] In certain embodiments, the dead guide RNA includes
additional nucleotides at the 3'-end that do not match the target
sequence. Thus, a dead guide RNA that includes the first 20-28 nt,
downstream of a CRISPR motif can be extended in length at the 3'
end.
General Provisions
[0482] In an aspect, the invention provides a nucleic acid binding
system. In situ hybridization of RNA with complementary probes is a
powerful technique. Typically fluorescent DNA oligonucleotides are
used to detect nucleic acids by hybridization. Increased efficiency
has been attained by certain modifications, such as locked nucleic
acids (LNAs), but there remains a need for efficient and versatile
alternatives. The invention provides an efficient and adaptable
system for in situ hybridization.
[0483] In embodiments of the invention the terms guide sequence and
guide RNA are used interchangeably as in foregoing cited documents
such as WO 2014/093622 (PCT/US2013/074667). In general, a guide
sequence is any polynucleotide sequence having sufficient
complementarity with a target polynucleotide sequence to hybridize
with the target sequence and direct sequence-specific binding of a
CRISPR complex to the target sequence. In some embodiments, the
degree of complementarity between a guide sequence and its
corresponding target sequence, when optimally aligned using a
suitable alignment algorithm, is about or more than about 50%, 60%,
75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may
be determined with the use of any suitable algorithm for aligning
sequences, non-limiting example of which include the Smith-Waterman
algorithm, the Needleman-Wunsch algorithm, algorithms based on the
Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner),
ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies;
available at www.novocraft.com), ELAND (Illumina, San Diego,
Calif.), SOAP (available at soap.genomics.org.cn), and Maq
(available at maq.sourceforge.net). In some embodiments, a guide
sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45,
50, 75, or more nucleotides in length. In some embodiments, a guide
sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12,
or fewer nucleotides in length. Preferably the guide sequence is
10-30 nucleotides long. The ability of a guide sequence to direct
sequence-specific binding of a CRISPR complex to a target sequence
may be assessed by any suitable assay. For example, the components
of a CRISPR system sufficient to form a CRISPR complex, including
the guide sequence to be tested, may be provided to a host cell
having the corresponding target sequence, such as by transfection
with vectors encoding the components of the CRISPR sequence,
followed by an assessment of preferential cleavage within the
target sequence, such as by Surveyor assay as described herein.
Similarly, cleavage of a target polynucleotide sequence may be
evaluated in a test tube by providing the target sequence,
components of a CRISPR complex, including the guide sequence to be
tested and a control guide sequence different from the test guide
sequence, and comparing binding or rate of cleavage at the target
sequence between the test and control guide sequence reactions.
Other assays are possible, and will occur to those skilled in the
art. A guide sequence may be selected to target any target
sequence. In some embodiments, the target sequence is a sequence
within a genome of a cell. Exemplary target sequences include those
that are unique in the target genome.
[0484] In general, and throughout this specification, the term
"vector" refers to a nucleic acid molecule capable of transporting
another nucleic acid to which it has been linked. Vectors include,
but are not limited to, nucleic acid molecules that are
single-stranded, double-stranded, or partially double-stranded;
nucleic acid molecules that comprise one or more free ends, no free
ends (e.g., circular); nucleic acid molecules that comprise DNA,
RNA, or both; and other varieties of polynucleotides known in the
art. One type of vector is a "plasmid," which refers to a circular
double stranded DNA loop into which additional DNA segments can be
inserted, such as by standard molecular cloning techniques. Another
type of vector is a viral vector, wherein virally-derived DNA or
RNA sequences are present in the vector for packaging into a virus
(e.g., retroviruses, replication defective retroviruses,
adenoviruses, replication defective adenoviruses, and
adeno-associated viruses). Viral vectors also include
polynucleotides carried by a virus for transfection into a host
cell. Certain vectors are capable of autonomous replication in a
host cell into which they are introduced (e.g., bacterial vectors
having a bacterial origin of replication and episomal mammalian
vectors). Other vectors (e.g., non-episomal mammalian vectors) are
integrated into the genome of a host cell upon introduction into
the host cell, and thereby are replicated along with the host
genome. Moreover, certain vectors are capable of directing the
expression of genes to which they are operatively-linked. Such
vectors are referred to herein as "expression vectors." Vectors for
and that result in expression in a eukaryotic cell can be referred
to herein as "eukaryotic expression vectors." Common expression
vectors of utility in recombinant DNA techniques are often in the
form of plasmids.
[0485] Recombinant expression vectors can comprise a nucleic acid
of the invention in a form suitable for expression of the nucleic
acid in a host cell, which means that the recombinant expression
vectors include one or more regulatory elements, which may be
selected on the basis of the host cells to be used for expression,
that is operatively-linked to the nucleic acid sequence to be
expressed. Within a recombinant expression vector, "operably
linked" is intended to mean that the nucleotide sequence of
interest is linked to the regulatory element(s) in a manner that
allows for expression of the nucleotide sequence (e.g., in an in
vitro transcription/translation system or in a host cell when the
vector is introduced into the host cell).
[0486] The term "regulatory element" is intended to include
promoters, enhancers, internal ribosomal entry sites (IRES), and
other expression control elements (e.g., transcription termination
signals, such as polyadenylation signals and poly-U sequences).
Such regulatory elements are described, for example, in Goeddel,
GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic
Press, San Diego, Calif. (1990). Regulatory elements include those
that direct constitutive expression of a nucleotide sequence in
many types of host cell and those that direct expression of the
nucleotide sequence only in certain host cells (e.g.,
tissue-specific regulatory sequences). A tissue-specific promoter
may direct expression primarily in a desired tissue of interest,
such as muscle, neuron, bone, skin, blood, specific organs (e.g.,
liver, pancreas), or particular cell types (e.g., lymphocytes).
Regulatory elements may also direct expression in a
temporal-dependent manner, such as in a cell-cycle dependent or
developmental stage-dependent manner, which may or may not also be
tissue or cell-type specific. In some embodiments, a vector
comprises one or more pol III promoter (e.g., 1, 2, 3, 4, 5, or
more pol III promoters), one or more pol II promoters (e.g., 1, 2,
3, 4, 5, or more pol II promoters), one or more pol I promoters
(e.g., 1, 2, 3, 4, 5, or more pol I promoters), or combinations
thereof. Examples of pol III promoters include, but are not limited
to, U6 and H1 promoters. Examples of pol II promoters include, but
are not limited to, the retroviral Rous sarcoma virus (RSV) LTR
promoter (optionally with the RSV enhancer), the cytomegalovirus
(CMV) promoter (optionally with the CMV enhancer) [see, e.g.,
Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the
dihydrofolate reductase promoter, the .beta.-actin promoter, the
phosphoglycerol kinase (PGK) promoter, and the EF1.alpha. promoter.
Also encompassed by the term "regulatory element" are enhancer
elements, such as WPRE; CMV enhancers; the R-U5' segment in LTR of
HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40
enhancer; and the intron sequence between exons 2 and 3 of rabbit
.beta.-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31,
1981). It will be appreciated by those skilled in the art that the
design of the expression vector can depend on such factors as the
choice of the host cell to be transformed, the level of expression
desired, etc. A vector can be introduced into host cells to thereby
produce transcripts, proteins, or peptides, including fusion
proteins or peptides, encoded by nucleic acids as described herein
(e.g., clustered regularly interspersed short palindromic repeats
(CRISPR) transcripts, proteins, enzymes, mutant forms thereof,
fusion proteins thereof, etc.).
[0487] Advantageous vectors include lentiviruses and
adeno-associated viruses, and types of such vectors can also be
selected for targeting particular types of cells.
[0488] As used herein, the term "crRNA" or "guide RNA" or "single
guide RNA" or "sgRNA" or "one or more nucleic acid components" of a
Type V or Type VI CRISPR-Cas locus effector protein comprises any
polynucleotide sequence having sufficient complementarity with a
target nucleic acid sequence to hybridize with the target nucleic
acid sequence and direct sequence-specific binding of a nucleic
acid-targeting complex to the target nucleic acid sequence. In some
embodiments, the degree of complementarity, when optimally aligned
using a suitable alignment algorithm, is about or more than about
50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal
alignment may be determined with the use of any suitable algorithm
for aligning sequences, non-limiting example of which include the
Smith-Waterman algorithm, the Needleman-Wunsch algorithm,
algorithms based on the Burrows-Wheeler Transform (e.g., the
Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign
(Novocraft Technologies; available at www.novocraft.com), ELAND
(Illumina, San Diego, Calif.), SOAP (available at
soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
The ability of a guide sequence (within a nucleic acid-targeting
guide RNA) to direct sequence-specific binding of a nucleic
acid-targeting complex to a target nucleic acid sequence may be
assessed by any suitable assay. For example, the components of a
nucleic acid-targeting CRISPR system sufficient to form a nucleic
acid-targeting complex, including the guide sequence to be tested,
may be provided to a host cell having the corresponding target
nucleic acid sequence, such as by transfection with vectors
encoding the components of the nucleic acid-targeting complex,
followed by an assessment of preferential targeting (e.g.,
cleavage) within the target nucleic acid sequence, such as by
Surveyor assay as described herein. Similarly, cleavage of a target
nucleic acid sequence may be evaluated in a test tube by providing
the target nucleic acid sequence, components of a nucleic
acid-targeting complex, including the guide sequence to be tested
and a control guide sequence different from the test guide
sequence, and comparing binding or rate of cleavage at the target
sequence between the test and control guide sequence reactions.
Other assays are possible, and will occur to those skilled in the
art. A guide sequence, and hence a nucleic acid-targeting guide RNA
may be selected to target any target nucleic acid sequence. The
target sequence may be DNA. The target sequence may be any RNA
sequence. In some embodiments, the target sequence may be a
sequence within a RNA molecule selected from the group consisting
of messenger RNA (mRNA), pre-mRNA, ribosomaal RNA (rRNA), transfer
RNA (tRNA), micro-RNA (miRNA), small interfering RNA (siRNA), small
nuclear RNA (snRNA), small nucleolar RNA (snoRNA), double stranded
RNA (dsRNA), non coding RNA (ncRNA), long non-coding RNA (IncRNA),
and small cytoplasmatic RNA (scRNA). In some preferred embodiments,
the target sequence may be a sequence within a RNA molecule
selected from the group consisting of mRNA, pre-mRNA, and rRNA. In
some preferred embodiments, the target sequence may be a sequence
within a RNA molecule selected from the group consisting of ncRNA,
and IncRNA. In some more preferred embodiments, the target sequence
may be a sequence within an mRNA molecule or a pre-mRNA
molecule.
[0489] In some embodiments, a nucleic acid-targeting guide RNA is
selected to reduce the degree secondary structure within the
RNA-targeting guide RNA. In some embodiments, about or less than
about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of
the nucleotides of the nucleic acid-targeting guide RNA participate
in self-complementary base pairing when optimally folded. Optimal
folding may be determined by any suitable polynucleotide folding
algorithm. Some programs are based on calculating the minimal Gibbs
free energy. An example of one such algorithm is mFold, as
described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981),
133-148). Another example folding algorithm is the online webserver
RNAfold, developed at Institute for Theoretical Chemistry at the
University of Vienna, using the centroid structure prediction
algorithm (see e.g., A. R. Gruber et al., 2008, Cell 106(1): 23-24;
and PA Carr and GM Church, 2009, Nature Biotechnology 27(12):
1151-62).
[0490] In certain embodiments, a guide RNA or crRNA may comprise,
consist essentially of, or consist of a direct repeat (DR) sequence
and a guide sequence or spacer sequence. In certain embodiments,
the guide RNA or crRNA may comprise, consist essentially of, or
consist of a direct repeat sequence fused or linked to a guide
sequence or spacer sequence. In certain embodiments, the direct
repeat sequence may be located upstream (i.e., 5') from the guide
sequence or spacer sequence. In other embodiments, the direct
repeat sequence may be located downstream (i.e., 3') from the guide
sequence or spacer sequence.
[0491] In certain embodiments, the crRNA comprises a stem loop,
preferably a single stem loop. In certain embodiments, the direct
repeat sequence forms a stem loop, preferably a single stem
loop.
[0492] In certain embodiments, the spacer length of the guide RNA
is from 15 to 35 nt. In certain embodiments, the spacer length of
the guide RNA is at least 15 nucleotides, preferably at least 18
nt, such at at least 19, 20, 21, 22, or more nt. In certain
embodiments, the spacer length is from 15 to 17 nt, e.g., 15, 16,
or 17 nt, from 17 to 20 nt, e.g., 17, 18, 19, or 20 nt, from 20 to
24 nt, e.g., 20, 21, 22, 23, or 24 nt, from 23 to 25 nt, e.g., 23,
24, or 25 nt, from 24 to 27 nt, e.g., 24, 25, 26, or 27 nt, from
27-30 nt, e.g., 27, 28, 29, or 30 nt, from 30-35 nt, e.g., 30, 31,
32, 33, 34, or 35 nt, or 35 nt or longer.
[0493] Applicants also perform a challenge experiment to verify the
DNA targeting and cleaving capability of a Type V protein such as
C2c1 or C2c3. This experiment closely parallels similar work in E.
coli for the heterologous expression of StCas9 (Sapranauskas, R. et
al. Nucleic Acids Res 39, 9275-9282 (2011)). Applicants introduce a
plasmid containing both a PAM and a resistance gene into the
heterologous E. coli, and then plate on the corresponding
antibiotic. If there is DNA cleavage of the plasmid, Applicants
observe no viable colonies.
[0494] In further detail, the assay is as follows for a DNA target.
Two E. coli strains are used in this assay. One carries a plasmid
that encodes the endogenous effector protein locus from the
bacterial strain. The other strain carries an empty plasmid (e.g.
pACYC184, control strain). All possible 7 or 8 bp PAM sequences are
presented on an antibiotic resistance plasmid (pUC19 with
ampicillin resistance gene). The PAM is located next to the
sequence of proto-spacer 1 (the DNA target to the first spacer in
the endogenous effector protein locus). Two PAM libraries were
cloned. One has a 8 random bp 5' of the proto-spacer (e.g. total of
65536 different PAM sequences=complexity). The other library has 7
random bp 3' of the proto-spacer (e.g. total complexity is 16384
different PAMs). Both libraries were cloned to have in average 500
plasmids per possible PAM. Test strain and control strain were
transformed with 5'PAM and 3'PAM library in separate
transformations and transformed cells were plated separately on
ampicillin plates. Recognition and subsequent cutting/interference
with the plasmid renders a cell vulnerable to ampicillin and
prevents growth. Approximately 12h after transformation, all
colonies formed by the test and control strains where harvested and
plasmid DNA was isolated. Plasmid DNA was used as template for PCR
amplification and subsequent deep sequencing. Representation of all
PAMs in the untransfomed libraries showed the expected
representation of PAMs in transformed cells. Representation of all
PAMs found in control strains showed the actual representation.
Representation of all PAMs in test strain showed which PAMs are not
recognized by the enzyme and comparison to the control strain
allows extracting the sequence of the depleted PAM.
[0495] For minimization of toxicity and off-target effect, it will
be important to control the concentration of nucleic acid-targeting
guide RNA delivered. Optimal concentrations of nucleic
acid-targeting guide RNA can be determined by testing different
concentrations in a cellular or non-human eukaryote animal model
and using deep sequencing the analyze the extent of modification at
potential off-target genomic loci. The concentration that gives the
highest level of on-target modification while minimizing the level
of off-target modification should be chosen for in vivo delivery.
The nucleic acid-targeting system is derived advantageously from a
Type VI CRISPR system. In some embodiments, one or more elements of
a nucleic acid-targeting system is derived from a particular
organism comprising an endogenous RNA-targeting system. In
particular embodiments, the Type VI RNA-targeting Cas enzyme is
C2c2. Non-limiting examples of Cas proteins include Cas1, Cas1B,
Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1
and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5,
Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6,
Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1,
Csx15, Csf1, Csf2, Csf3, Csf4, homologues thereof, or modified
versions thereof. In embodiments, the Type VI protein such as
C2c2as referred to herein also encompasses a homologue or an
orthologue of a Type VI protein such as C2c2. The terms
"orthologue" (also referred to as "ortholog" herein) and
"homologue" (also referred to as "homolog" herein) are well known
in the art. By means of further guidance, a "homologue" of a
protein as used herein is a protein of the same species which
performs the same or a similar function as the protein it is a
homologue of. Homologous proteins may but need not be structurally
related, or are only partially structurally related. An
"orthologue" of a protein as used herein is a protein of a
different species which performs the same or a similar function as
the protein it is an orthologue of. Orthologous proteins may but
need not be structurally related, or are only partially
structurally related. In particular embodiments, the homologue or
orthologue of a Type VI protein such as C2c2as referred to herein
has a sequence homology or identity of at least 80%, more
preferably at least 85%, even more preferably at least 90%, such as
for instance at least 95% with a Type VI protein such as C2c2. In
further embodiments, the homologue or orthologue of a Type VI
protein such as C2c2as referred to herein has a sequence identity
of at least 80%, more preferably at least 85%, even more preferably
at least 90%, such as for instance at least 95% with the wild type
Type VI protein such as C2c2.
[0496] In an embodiment, the Type VI RNA-targeting Cas protein may
be a C2c2ortholog of an organism of a genus which includes but is
not limited to Corynebacter, Sutterella, Legionella, Treponema,
Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma,
Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta,
Azospirillum, Gluconacetobacter, Neisseria, Roseburia,
Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma and
Campylobacter. Species of organism of such a genus can be as
otherwise herein discussed.
[0497] Some methods of identifying orthologs of CRISPR-Cas system
enzymes may involve identifying tracr sequences in genomes of
interest. Identification of tracr sequences may relate to the
following steps: Search for the direct repeats or tract mate
sequences in a database to identify a CRISPR region comprising a
CRISPR enzyme. Search for homologous sequences in the CRISPR region
flanking the CRISPR enzyme in both the sense and antisense
directions. Look for transcriptional terminators and secondary
structures. Identify any sequence that is not a direct repeat or a
tract mate sequence but has more than 50% identity to the direct
repeat or tract mate sequence as a potential tracr sequence. Take
the potential tracr sequence and analyze for transcriptional
terminator sequences associated therewith.
[0498] It will be appreciated that any of the functionalities
described herein may be engineered into CRISPR enzymes from other
orthologs, including chimeric enzymes comprising fragments from
multiple orthologs. Examples of such orthologs are described
elsewhere herein. Thus, chimeric enzymes may comprise fragments of
CRISPR enzyme orthologs of an organism which includes but is not
limited to Corynebacter, Sutterella, Legionella, Treponema,
Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma,
Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta,
Azospirillum, Gluconacetobacter, Neisseria, Roseburia,
Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma and
Campylobacter. A chimeric enzyme can comprise a first fragment and
a second fragment, and the fragments can be of CRISPR enzyme
orthologs of organisms of genuses herein mentioned or of species
herein mentioned; advantageously the fragments are from CRISPR
enzyme orthologs of different species.
[0499] In embodiments, the Type VI RNA-targeting effector protein,
in particular the C2c2 protein as referred to herein also
encompasses a functional variant of C2c2 or a homologue or an
orthologue thereof. A "functional variant" of a protein as used
herein refers to a variant of such protein which retains at least
partially the activity of that protein. Functional variants may
include mutants (which may be insertion, deletion, or replacement
mutants), including polymorphs, etc. Also included within
functional variants are fusion products of such protein with
another, usually unrelated, nucleic acid, protein, polypeptide or
peptide. Functional variants may be naturally occurring or may be
man-made. Advantageous embodiments can involve engineered or
non-naturally occurring Type VI RNA-targeting effector protein,
e.g., C2c1/C2c3 or an ortholog or homolog thereof.
[0500] In an embodiment, nucleic acid molecule(s) encoding the Type
VI RNA-targeting effector protein, in particular C2c2 or an
ortholog or homolog thereof, may be codon-optimized for expression
in an eukaryotic cell. A eukaryote can be as herein discussed.
Nucleic acid molecule(s) can be engineered or non-naturally
occurring.
[0501] In an embodiment, the Type VI RNA-targeting effector
protein, in particular C2c2 or an ortholog or homolog thereof, may
comprise one or more mutations (and hence nucleic acid molecule(s)
coding for same may have mutation(s). The mutations may be
artificially introduced mutations and may include but are not
limited to one or more mutations in a catalytic domain. Examples of
catalytic domains with reference to a Cas9 enzyme may include but
are not limited to RuvC I, RuvC II, RuvC III and HNH domains.
[0502] In an embodiment, the Type VI protein such as C2c2 or an
ortholog or homolog thereof, may comprise one or more mutations.
The mutations may be artificially introduced mutations and may
include but are not limited to one or more mutations in a catalytic
domain. Examples of catalytic domains with reference to a Cas
enzyme may include but are not limited to RuvC I, RuvC II, RuvC
III, HNH domains, and HEPN domains.
[0503] In an embodiment, the Type VI protein such as C2c2 or an
ortholog or homolog thereof, may be used as a generic nucleic acid
binding protein with fusion to or being operably linked to a
functional domain. Exemplary functional domains may include but are
not limited to translational initiator, translational activator,
translational repressor, nucleases, in particular ribonucleases, a
spliceosome, beads, a light inducible/controllable domain or a
chemically inducible/controllable domain.
[0504] In some embodiments, the unmodified nucleic acid-targeting
effector protein may have cleavage activity. In some embodiments,
the RNA-targeting effector protein may direct cleavage of one or
both nucleic acid (DNA or RNA) strands at the location of or near a
target sequence, such as within the target sequence and/or within
the complement of the target sequence or at sequences associated
with the target sequence. In some embodiments, the nucleic
acid-targeting Cas protein may direct cleavage of one or both DNA
or RNA strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20,
25, 50, 100, 200, 500, or more base pairs from the first or last
nucleotide of a target sequence. In some embodiments, the cleavage
may be blunt, i.e., generating blunt ends. In some embodiments, the
cleavage may be staggered, i.e., generating sticky ends. In some
embodiments, the cleavage may be a staggered cut with a 5'
overhang, e.g., a 5' overhang of 1 to 5 nucleotides. In some
embodiments, the cleavage may be a staggered cut with a 3'
overhang, e.g., a 3' overhang of 1 to 5 nucleotides. In some
embodiments, a vector encodes a nucleic acid-targeting Cas protein
that may be mutated with respect to a corresponding wild-type
enzyme such that the mutated nucleic acid-targeting Cas protein
lacks the ability to cleave one or both DNA or RNA strands of a
target polynucleotide containing a target sequence. As a further
example, two or more catalytic domains of Cas (RuvC I, RuvC II, and
RuvC III or the HNH domain, or HEPN domain) may be mutated to
produce a mutated Cas substantially lacking all RNA cleavage
activity. As described herein, corresponding catalytic domains of a
C2c2 effector protein may also be mutated to produce a mutated C2c2
effector protein lacking all DNA cleavage activity or having
substantially reduced DNA cleavage activity. In some embodiments, a
nucleic acid-targeting effector protein may be considered to
substantially lack all RNA cleavage activity when the RNA cleavage
activity of the mutated enzyme is about no more than 25%, 10%, 5%,
1%, 0.1%, 0.01%, or less of the nucleic acid cleavage activity of
the non-mutated form of the enzyme; an example can be when the
nucleic acid cleavage activity of the mutated form is nil or
negligible as compared with the non-mutated form. An effector
protein may be identified with reference to the general class of
enzymes that share homology to the biggest nuclease with multiple
nuclease domains from the Type V/Type VI CRISPR system. Most
preferably, the effector protein is a Type V/Type VI protein such
as C2c2. By derived, Applicants mean that the derived enzyme is
largely based, in the sense of having a high degree of sequence
homology with, a wildtype enzyme, but that it has been mutated
(modified) in some way as known in the art or as described
herein.
[0505] Again, it will be appreciated that the terms Cas and CRISPR
enzyme and CRISPR protein and Cas protein are generally used
interchangeably and at all points of reference herein refer by
analogy to novel CRISPR effector proteins further described in this
application, unless otherwise apparent, such as by specific
reference to Cas9. As mentioned above, many of the residue
numberings used herein refer to the effector protein from the Type
V/Type VI CRISPR locus. However, it will be appreciated that this
invention includes many more effector proteins from other species
of microbes. In certain embodiments, Cas may be constitutively
present or inducibly present or conditionally present or
administered or delivered. Cas optimization may be used to enhance
function or to develop new functions, one can generate chimeric Cas
proteins. And Cas may be used as a generic nucleic acid binding
protein.
[0506] Typically, in the context of an endogenous nucleic
acid-targeting system, formation of a nucleic acid-targeting
complex (comprising a guide RNA hybridized to a target sequence and
complexed with one or more nucleic acid-targeting effector
proteins) results in cleavage of one or both DNA or RNA strands in
or near (e.g., within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or
more base pairs from) the target sequence. As used herein the term
"sequence(s) associated with a target locus of interest" refers to
sequences near the vicinity of the target sequence (e.g. within 1,
2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from the
target sequence, wherein the target sequence is comprised within a
target locus of interest).
[0507] An example of a codon optimized sequence, is in this
instance a sequence optimized for expression in a eukaryote, e.g.,
humans (i.e. being optimized for expression in humans), or for
another eukaryote, animal or mammal as herein discussed; see, e.g.,
SaCas9 human codon optimized sequence in WO 2014/093622
(PCT/US2013/074667) as an example of a codon optimized sequence
(from knowledge in the art and this disclosure, codon optimizing
coding nucleic acid molecule(s), especially as to effector protein
(e.g., C2c2) is within the ambit of the skilled artisan).. Whilst
this is preferred, it will be appreciated that other examples are
possible and codon optimization for a host species other than
human, or for codon optimization for specific organs is known. In
some embodiments, an enzyme coding sequence encoding a
DNA/RNA-targeting Cas protein is codon optimized for expression in
particular cells, such as eukaryotic cells. The eukaryotic cells
may be those of or derived from a particular organism, such as a
mammal, including but not limited to human, or non-human eukaryote
or animal or mammal as herein discussed, e.g., mouse, rat, rabbit,
dog, livestock, or non-human mammal or primate. In some
embodiments, processes for modifying the germ line genetic identity
of human beings and/or processes for modifying the genetic identity
of animals which are likely to cause them suffering without any
substantial medical benefit to man or animal, and also animals
resulting from such processes, may be excluded. In general, codon
optimization refers to a process of modifying a nucleic acid
sequence for enhanced expression in the host cells of interest by
replacing at least one codon (e.g., about or more than about 1, 2,
3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence
with codons that are more frequently or most frequently used in the
genes of that host cell while maintaining the native amino acid
sequence. Various species exhibit particular bias for certain
codons of a particular amino acid. Codon bias (differences in codon
usage between organisms) often correlates with the efficiency of
translation of messenger RNA (mRNA), which is in turn believed to
be dependent on, among other things, the properties of the codons
being translated and the availability of particular transfer RNA
(tRNA) molecules. The predominance of selected tRNAs in a cell is
generally a reflection of the codons used most frequently in
peptide synthesis. Accordingly, genes can be tailored for optimal
gene expression in a given organism based on codon optimization.
Codon usage tables are readily available, for example, at the
"Codon Usage Database" available at www.kazusa.orjp/codon/ and
these tables can be adapted in a number of ways. See Nakamura, Y.,
et al. "Codon usage tabulated from the international DNA sequence
databases: status for the year 2000" Nucl. Acids Res. 28:292
(2000). Computer algorithms for codon optimizing a particular
sequence for expression in a particular host cell are also
available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also
available. In some embodiments, one or more codons (e.g., 1, 2, 3,
4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence
encoding a DNA/RNA-targeting Cas protein corresponds to the most
frequently used codon for a particular amino acid.
[0508] In some embodiments, a vector encodes a nucleic
acid-targeting effector protein such as the Type V RNA-targeting
effector protein, in particular C2c2, or an ortholog or homolog
thereof comprising one or more nuclear localization sequences
(NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, or more NLSs. In some embodiments, the RNA-targeting effector
protein comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8,
9, 10, or more NLSs at or near the amino-terminus, about or more
than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near
the carboxy-terminus, or a combination of these (e.g., zero or at
least one or more NLS at the amino-terminus and zero or at one or
more NLS at the carboxy terminus). When more than one NLS is
present, each may be selected independently of the others, such
that a single NLS may be present in more than one copy and/or in
combination with one or more other NLSs present in one or more
copies. In some embodiments, an NLS is considered near the N- or
C-terminus when the nearest amino acid of the NLS is within about
1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids
along the polypeptide chain from the N- or C-terminus. Non-limiting
examples of NLSs include an NLS sequence derived from: the NLS of
the SV40 virus large T-antigen, having the amino acid sequence
PKKKRKV (SEQ ID NO: 1); the NLS from nucleoplasmin (e.g., the
nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ
ID NO: 2)); the c-myc NLS having the amino acid sequence PAAKRVKLD
(SEQ ID NO: 3) or RQRRNELKRSP (SEQ ID NO: 4); the hRNPA1 M9 NLS
having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID
NO: 5); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV
(SEQ ID NO: 6) of the IBB domain from importin-alpha; the sequences
VSRKRPRP (SEQ ID NO: 7) and PPKKARED (SEQ ID NO: 8) of the myoma T
protein; the sequence PQPKKKPL (SEQ ID NO: 9) of human p53; the
sequence SALIKKKKKMAP (SEQ ID NO: 10) of mouse c-abl IV; the
sequences DRLRR (SEQ ID NO: 11) and PKQKKRK (SEQ ID NO: 12) of the
influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 13) of the
Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO:
14) of the mouse Mx1 protein; the sequence KRKGDEVDGVDEVAKKKSKK
(SEQ ID NO: 15) of the human poly(ADP-ribose) polymerase; and the
sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 16) of the steroid hormone
receptors (human) glucocorticoid. In general, the one or more NLSs
are of sufficient strength to drive accumulation of the
DNA/RNA-targeting Cas protein in a detectable amount in the nucleus
of a eukaryotic cell. In general, strength of nuclear localization
activity may derive from the number of NLSs in the nucleic
acid-targeting effector protein, the particular NLS(s) used, or a
combination of these factors. Detection of accumulation in the
nucleus may be performed by any suitable technique. For example, a
detectable marker may be fused to the nucleic acid-targeting
protein, such that location within a cell may be visualized, such
as in combination with a means for detecting the location of the
nucleus (e.g., a stain specific for the nucleus such as DAPI). Cell
nuclei may also be isolated from cells, the contents of which may
then be analyzed by any suitable process for detecting protein,
such as immunohistochemistry, Western blot, or enzyme activity
assay. Accumulation in the nucleus may also be determined
indirectly, such as by an assay for the effect of nucleic
acid-targeting complex formation (e.g., assay for DNA or RNA
cleavage or mutation at the target sequence, or assay for altered
gene expression activity affected by DNA or RNA-targeting complex
formation and/or DNA or RNA-targeting Cas protein activity), as
compared to a control not exposed to the nucleic acid-targeting Cas
protein or nucleic acid-targeting complex, or exposed to a nucleic
acid-targeting Cas protein lacking the one or more NLSs. In
preferred embodiments of the herein described C2c2 effector protein
complexes and systems the codon optimized C2c2 effector proteins
comprise an NLS attached to the C-terminal of the protein.
[0509] In some embodiments, one or more vectors driving expression
of one or more elements of a nucleic acid-targeting system are
introduced into a host cell such that expression of the elements of
the nucleic acid-targeting system direct formation of a nucleic
acid-targeting complex at one or more target sites. For example, a
nucleic acid-targeting effector enzyme and a nucleic acid-targeting
guide RNA could each be operably linked to separate regulatory
elements on separate vectors. RNA(s) of the nucleic acid-targeting
system can be delivered to a transgenic nucleic acid-targeting
effector protein animal or mammal, e.g., an animal or mammal that
constitutively or inducibly or conditionally expresses nucleic
acid-targeting effector protein; or an animal or mammal that is
otherwise expressing nucleic acid-targeting effector protein or has
cells containing nucleic acid-targeting effector protein, such as
by way of prior administration thereto of a vector or vectors that
code for and express in vivo nucleic acid-targeting effector
protein. Alternatively, two or more of the elements expressed from
the same or different regulatory elements, may be combined in a
single vector, with one or more additional vectors providing any
components of the nucleic acid-targeting system not included in the
first vector. nucleic acid-targeting system elements that are
combined in a single vector may be arranged in any suitable
orientation, such as one element located 5' with respect to
("upstream" of) or 3' with respect to ("downstream" of) a second
element. The coding sequence of one element may be located on the
same or opposite strand of the coding sequence of a second element,
and oriented in the same or opposite direction. In some
embodiments, a single promoter drives expression of a transcript
encoding a nucleic acid-targeting effector protein and the nucleic
acid-targeting guide RNA, embedded within one or more intron
sequences (e.g., each in a different intron, two or more in at
least one intron, or all in a single intron). In some embodiments,
the nucleic acid-targeting effector protein and the nucleic
acid-targeting guide RNA may be operably linked to and expressed
from the same promoter. Delivery vehicles, vectors, particles,
nanoparticles, formulations and components thereof for expression
of one or more elements of a nucleic acid-targeting system are as
used in the foregoing documents, such as WO 2014/093622
(PCT/US2013/074667). In some embodiments, a vector comprises one or
more insertion sites, such as a restriction endonuclease
recognition sequence (also referred to as a "cloning site"). In
some embodiments, one or more insertion sites (e.g., about or more
than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites)
are located upstream and/or downstream of one or more sequence
elements of one or more vectors. In some embodiments, a vector
comprises two or more insertion sites, so as to allow insertion of
a guide sequence at each site. In such an arrangement, the two or
more guide sequences may comprise two or more copies of a single
guide sequence, two or more different guide sequences, or
combinations of these. When multiple different guide sequences are
used, a single expression construct may be used to target nucleic
acid-targeting activity to multiple different, corresponding target
sequences within a cell. For example, a single vector may comprise
about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or
more guide sequences. In some embodiments, about or more than about
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such
guide-sequence-containing vectors may be provided, and optionally
delivered to a cell. In some embodiments, a vector comprises a
regulatory element operably linked to an enzyme-coding sequence
encoding a a nucleic acid-targeting effector protein. nucleic
acid-targeting effector protein or nucleic acid-targeting guide RNA
or RNA(s) can be delivered separately; and advantageously at least
one of these is delivered via a particle or nanoparticle complex.
nucleic acid-targeting effector protein mRNA can be delivered prior
to the nucleic acid-targeting guide RNA to give time for nucleic
acid-targeting effector protein to be expressed. nucleic
acid-targeting effector protein mRNA might be administered 1-12
hours (preferably around 2-6 hours) prior to the administration of
nucleic acid-targeting guide RNA. Alternatively, nucleic
acid-targeting effector protein mRNA and nucleic acid-targeting
guide RNA can be administered together. Advantageously, a second
booster dose of guide RNA can be administered 1-12 hours
(preferably around 2-6 hours) after the initial administration of
nucleic acid-targeting effector protein mRNA+guide RNA. Additional
administrations of nucleic acid-targeting effector protein mRNA
and/or guide RNA might be useful to achieve the most efficient
levels of genome and/or transcriptome modification.
[0510] In one aspect, the invention provides methods for using one
or more elements of a nucleic acid-targeting system. The nucleic
acid-targeting complex of the invention provides an effective means
for modifying a target DNA or RNA single or double stranded, linear
or super-coiled). The nucleic acid-targeting complex of the
invention has a wide variety of utility including modifying (e.g.,
deleting, inserting, translocating, inactivating, activating) a
target DNA or RNA in a multiplicity of cell types. As such the
nucleic acid-targeting complex of the invention has a broad
spectrum of applications in, e.g., gene therapy, drug screening,
disease diagnosis, and prognosis. An exemplary nucleic
acid-targeting complex comprises a DNA or RNA-targeting effector
protein complexed with a guide RNA hybridized to a target sequence
within the target locus of interest.
[0511] In one embodiment, this invention provides a method of
cleaving a target RNA. The method may comprise modifying a target
RNA using a nucleic acid-targeting complex that binds to the target
RNA and effect cleavage of said target RNA. In an embodiment, the
nucleic acid-targeting complex of the invention, when introduced
into a cell, may create a break (e.g., a single or a double strand
break) in the RNA sequence. For example, the method can be used to
cleave a disease RNA in a cell For example, an exogenous RNA
template comprising a sequence to be integrated flanked by an
upstream sequence and a downstream sequence may be introduced into
a cell. The upstream and downstream sequences share sequence
similarity with either side of the site of integration in the RNA.
Where desired, a donor RNA can be mRNA. The exogenous RNA template
comprises a sequence to be integrated (e.g., a mutated RNA). The
sequence for integration may be a sequence endogenous or exogenous
to the cell. Examples of a sequence to be integrated include RNA
encoding a protein or a non-coding RNA (e.g., a microRNA). Thus,
the sequence for integration may be operably linked to an
appropriate control sequence or sequences. Alternatively, the
sequence to be integrated may provide a regulatory function. The
upstream and downstream sequences in the exogenous RNA template are
selected to promote recombination between the RNA sequence of
interest and the donor RNA. The upstream sequence is a RNA sequence
that shares sequence similarity with the RNA sequence upstream of
the targeted site for integration. Similarly, the downstream
sequence is a RNA sequence that shares sequence similarity with the
RNA sequence downstream of the targeted site of integration. The
upstream and downstream sequences in the exogenous RNA template can
have 75%, 80%, 85%, 90%, 95%, or 100% sequence identity with the
targeted RNA sequence. Preferably, the upstream and downstream
sequences in the exogenous RNA template have about 95%, 96%, 97%,
98%, 99%, or 100% sequence identity with the targeted RNA sequence.
In some methods, the upstream and downstream sequences in the
exogenous RNA template have about 99% or 100% sequence identity
with the targeted RNA sequence. An upstream or downstream sequence
may comprise from about 20 bp to about 2500 bp, for example, about
50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200,
1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300,
2400, or 2500 bp. In some methods, the exemplary upstream or
downstream sequence have about 200 bp to about 2000 bp, about 600
bp to about 1000 bp, or more particularly about 700 bp to about
1000 bp. In some methods, the exogenous RNA template may further
comprise a marker. Such a marker may make it easy to screen for
targeted integrations. Examples of suitable markers include
restriction sites, fluorescent proteins, or selectable markers. The
exogenous RNA template of the invention can be constructed using
recombinant techniques (see, for example, Sambrook et al., 2001 and
Ausubel et al., 1996). In a method for modifying a target RNA by
integrating an exogenous RNA template, a break (e.g., double or
single stranded break in double or single stranded DNA or RNA) is
introduced into the DNA or RNA sequence by the nucleic
acid-targeting complex, the break is repaired via homologous
recombination with an exogenous RNA template such that the template
is integrated into the RNA target. The presence of a
double-stranded break facilitates integration of the template. In
other embodiments, this invention provides a method of modifying
expression of a RNA in a eukaryotic cell. The method comprises
increasing or decreasing expression of a target polynucleotide by
using a nucleic acid-targeting complex that binds to the DNA or RNA
(e.g., mRNA or pre-mRNA). In some methods, a target RNA can be
inactivated to effect the modification of the expression in a cell.
For example, upon the binding of a RNA-targeting complex to a
target sequence in a cell, the target RNA is inactivated such that
the sequence is not translated, the coded protein is not produced,
or the sequence does not function as the wild-type sequence does.
For example, a protein or microRNA coding sequence may be
inactivated such that the protein or microRNA or pre-microRNA
transcript is not produced. The target RNA of a RNA-targeting
complex can be any RNA endogenous or exogenous to the eukaryotic
cell. For example, the target RNA can be a RNA residing in the
nucleus of the eukaryotic cell. The target RNA can be a sequence
(e.g., mRNA or pre-mRNA) coding a gene product (e.g., a protein) or
a non-coding sequence (e.g., ncRNA, lncRNA, tRNA, or rRNA).
Examples of target RNA include a sequence associated with a
signaling biochemical pathway, e.g., a signaling biochemical
pathway-associated RNA. Examples of target RNA include a disease
associated RNA. A "disease-associated" RNA refers to any RNA which
is yielding translation products at an abnormal level or in an
abnormal form in cells derived from a disease-affected tissues
compared with tissues or cells of a non disease control. It may be
a RNA transcribed from a gene that becomes expressed at an
abnormally high level; it may be a RNA transcribed from a gene that
becomes expressed at an abnormally low level, where the altered
expression correlates with the occurrence and/or progression of the
disease. A disease-associated RNA also refers to a RNA transcribed
from a gene possessing mutation(s) or genetic variation that is
directly responsible or is in linkage disequilibrium with a gene(s)
that is responsible for the etiology of a disease. The translated
products may be known or unknown, and may be at a normal or
abnormal level. The target RNA of a RNA-targeting complex can be
any RNA endogenous or exogenous to the eukaryotic cell. For
example, the target RNA can be a RNA residing in the nucleus of the
eukaryotic cell. The target RNA can be a sequence (e.g., mRNA or
pre-mRNA) coding a gene product (e.g., a protein) or a non-coding
sequence (e.g., ncRNA, lncRNA, tRNA, or rRNA).
[0512] In some embodiments, the method may comprise allowing a
nucleic acid-targeting complex to bind to the target DNA or RNA to
effect cleavage of said target DNA or RNA thereby modifying the
target DNA or RNA, wherein the nucleic acid-targeting complex
comprises a nucleic acid-targeting effector protein complexed with
a guide RNA hybridized to a target sequence within said target DNA
or RNA. In one aspect, the invention provides a method of modifying
expression of DNA or RNA in a eukaryotic cell. In some embodiments,
the method comprises allowing a nucleic acid-targeting complex to
bind to the DNA or RNA such that said binding results in increased
or decreased expression of said DNA or RNA; wherein the nucleic
acid-targeting complex comprises a nucleic acid-targeting effector
protein complexed with a guide RNA. Similar considerations and
conditions apply as above for methods of modifying a target DNA or
RNA. In fact, these sampling, culturing and re-introduction options
apply across the aspects of the present invention. In one aspect,
the invention provides for methods of modifying a target DNA or RNA
in a eukaryotic cell, which may be in vivo, ex vivo or in vitro. In
some embodiments, the method comprises sampling a cell or
population of cells from a human or non-human animal, and modifying
the cell or cells. Culturing may occur at any stage ex vivo. The
cell or cells may even be re-introduced into the non-human animal
or plant. For re-introduced cells it is particularly preferred that
the cells are stem cells.
[0513] Indeed, in any aspect of the invention, the nucleic
acid-targeting complex may comprise a nucleic acid-targeting
effector protein complexed with a guide RNA hybridized to a target
sequence.
[0514] The invention relates to the engineering and optimization of
systems, methods and compositions used for the control of gene
expression involving DNA or RNA sequence targeting, that relate to
the nucleic acid-targeting system and components thereof. In
advantageous embodiments, the effector protein enzyme is a Type VI
protein such as C2c2. An advantage of the present methods is that
the CRISPR system minimizes or avoids off-target binding and its
resulting side effects. This is achieved using systems arranged to
have a high degree of sequence specificity for the target DNA or
RNA.
[0515] In relation to a nucleic acid-targeting complex or system
preferably, the tracr sequence has one or more hairpins and is 30
or more nucleotides in length, 40 or more nucleotides in length, or
50 or more nucleotides in length; the crRNA sequence is between 10
to 30 nucleotides in length, the nucleic acid-targeting effector
protein is a Type VI effector protein.
[0516] In certain embodiments, the effector protein may be a
Listeria sp. C2c2p, preferably Listeria seeligeria C2c2p, more
preferably Listeria seeligeria serovar 1/2b str. SLCC3954 C2c2p and
the crRNA sequence may be 44 to 47 nucleotides in length, with a 5'
29-nt direct repeat (DR) and a 15-nt to 18-nt spacer.
[0517] In certain embodiments, the effector protein may be a
Leptotrichia sp. C2c2p, preferably Leptotrichia shahii C2c2p, more
preferably Leptotrichia shahii DSM 19757 C2c2p and the crRNA
sequence may be 42 to 58 nucleotides in length, with a 5'direct
repeat of at least 24 nt, such as a 5' 24-28-nt direct repeat (DR)
and a spacer of at least 14 nt, such as a 14-nt to 28-nt spacer, or
a spacer of at least 18 nt, such as 19, 20, 21, 22, or more nt,
such as 18-28, 19-28, 20-28, 21-28, or 22-28 nt..
[0518] In certain embodiments, the effector protein may be a Type
VI loci effector protein, more particularly a C2c2p, and the crRNA
sequence may be 36 to 63 nucleotides in length, preferably 37-nt to
62-nt in length, or 38-nt to 61-nt in length, or 39-nt to 60-nt in
length, more preferably 40-nt to 59-nt in length, or 41-nt to 58-nt
in length, most preferably 42-nt to 57-nt in length. For example,
the crRNA may comprise, consist essentially of or consist of a
direct repeat (DR), preferably a 5' DR, 26-nt to 31-nt in length,
preferably 27-nt to 30-nt in length, even more preferably 28-nt or
29-nt in length or at least 28 or 29 nt in length, and a spacer
10-nt to 32-nt in length, preferably 11-nt to 31-nt in length, more
preferably 12-nt to 30-nt in length, even more preferably 13-nt to
29-nt in length, and most preferably 14-nt to 28-nt in length, such
as 18-28 nt, 19-28 nt, 20-28 nt, 21-28 nt, or 22-28 nt.
[0519] In certain embodiments, the effector protein may be a Type
VI loci effector protein, more particularly a C2c2p, and the
tracrRNA sequence may be at least 60-nt long, such as at least
65-nt in length, or at least 70-nt in length, such as from 60-nt to
70-nt in length, or from 60-nt to 70-nt in length, or from 70-nt to
80-nt in length, or from 80-nt to 90-nt in length, or from 90-nt to
100-nt in length, or from 100-nt to 110-nt in length, or from
110-nt to 120-nt in length, or from 120-nt to 130-nt in length, or
from 130-nt to 140-nt in length, or from 140-nt to 150-nt in
length, or more than 150-nt in length. See illustrative examples in
FIG. 22-37.
[0520] In certain embodiments, the effector protein may be a Type
VI loci effector protein, more particularly a C2c2p, and no
tracrRNA may be required for cleavage.
[0521] The use of two different aptamers (each associated with a
distinct nucleic acid-targeting guide RNAs) allows an
activator-adaptor protein fusion and a repressor-adaptor protein
fusion to be used, with different nucleic acid-targeting guide
RNAs, to activate expression of one DNA or RNA, whilst repressing
another. They, along with their different guide RNAs can be
administered together, or substantially together, in a multiplexed
approach. A large number of such modified nucleic acid-targeting
guide RNAs can be used all at the same time, for example 10 or 20
or 30 and so forth, whilst only one (or at least a minimal number)
of effector protein molecules need to be delivered, as a
comparatively small number of effector protein molecules can be
used with a large number modified guides. The adaptor protein may
be associated (preferably linked or fused to) one or more
activators or one or more repressors. For example, the adaptor
protein may be associated with a first activator and a second
activator. The first and second activators may be the same, but
they are preferably different activators. Three or more or even
four or more activators (or repressors) may be used, but package
size may limit the number being higher than 5 different functional
domains. Linkers are preferably used, over a direct fusion to the
adaptor protein, where two or more functional domains are
associated with the adaptor protein. Suitable linkers might include
the GlySer linker.
[0522] It is also envisaged that the nucleic acid-targeting
effector protein-guide RNA complex as a whole may be associated
with two or more functional domains. For example, there may be two
or more functional domains associated with the nucleic
acid-targeting effector protein, or there may be two or more
functional domains associated with the guide RNA (via one or more
adaptor proteins), or there may be one or more functional domains
associated with the nucleic acid-targeting effector protein and one
or more functional domains associated with the guide RNA (via one
or more adaptor proteins).
[0523] The fusion between the adaptor protein and the activator or
repressor may include a linker. For example, GlySer linkers GGGS
(SEQ ID NO: 18) can be used. They can be used in repeats of 3
((GGGGS).sub.3 (SEQ ID NO: 19)) or 6, 9 or even 12 (SEQ ID NOS
20-22, respectively) or more, to provide suitable lengths, as
required. Linkers can be used between the guide RNAs and the
functional domain (activator or repressor), or between the nucleic
acid-targeting effector protein and the functional domain
(activator or repressor). The linkers the user to engineer
appropriate amounts of"mechanical flexibility".
[0524] The invention comprehends a nucleic acid-targeting complex
comprising a nucleic acid-targeting effector protein and a guide
RNA, wherein the nucleic acid-targeting effector protein comprises
at least one mutation, such that the nucleic acid-targeting Cas
protein has no more than 5% of the activity of the nucleic
acid-targeting Cas protein not having the at least one mutation
and, optionally, at least one or more nuclear localization
sequences; the guide RNA comprises a guide sequence capable of
hybridizing to a target sequence in a RNA of interest in a cell;
and wherein: the nucleic acid-targeting effector protein is
associated with two or more functional domains; or at least one
loop of the guide RNA is modified by the insertion of distinct RNA
sequence(s) that bind to one or more adaptor proteins, and wherein
the adaptor protein is associated with two or more functional
domains; or the nucleic acid-targeting effector protein is
associated with one or more functional domains and at least one
loop of the guide RNA is modified by the insertion of distinct RNA
sequence(s) that bind to one or more adaptor proteins, and wherein
the adaptor protein is associated with one or more functional
domains.
Delivery Generally
C2c2 Effector Protein Complexes can Deliver Functional
Effectors
[0525] Unlike CRISPR-Cas-mediated gene knockout, which permanently
eliminates expression by mutating the gene at the DNA level,
CRISPR-Cas knockdown allows for temporary reduction of gene
expression through the use of artificial transcription or
translation factors. Mutating key residues in both DNA or RNA
cleavage domains of the C2c2 protein results in the generation of a
catalytically inactive C2c2. A catalytically inactive C2c2
complexes with a guide RNA and localizes to the DNA or RNA sequence
specified by that guide RNA's targeting domain, however, it does
not cleave the target DNA or RNA. Fusion of the inactive C2c2
protein to an effector domain, e.g., a transcription or translation
repression domain, enables recruitment of the effector to any DNA
or RNA site specified by the guide RNA. In certain embodiments,
C2c2 may be fused to a transcriptional repression domain and
recruited to the promoter region of a gene. Especially for gene
repression, it is contemplated herein that blocking the binding
site of an endogenous transcription factor would aid in
downregulating gene expression. In another embodiment, an inactive
C2c2 can be fused to a chromatin modifying protein. Altering
chromatin status can result in decreased expression of the target
gene. In further embodiments, C2c2 may be fused to a translation
repression domain.
[0526] In an embodiment, a guide RNA molecule can be targeted to a
known transcription response elements (e.g., promoters, enhancers,
etc.), a known upstream activating sequences, and/or sequences of
unknown or known function that are suspected of being able to
control expression of the target DNA.
[0527] In some methods, a target polynucleotide can be inactivated
to effect the modification of the expression in a cell. For
example, upon the binding of a CRISPR complex to a target sequence
in a cell, the target polynucleotide is inactivated such that the
sequence is not transcribed, the coded protein is not produced, or
the sequence does not function as the wild-type sequence does. For
example, a protein or microRNA coding sequence may be inactivated
such that the protein is not produced. In some methods, a target
polynucleotide can be inactivated to effect the modification of the
expression in a cell. For example, upon the binding of a CRISPR
complex to an RNA target sequence in a cell, the target
polynucleotide is inactivated such that the sequence is not
translated, affecting the expression level of the protein in the
cell.
[0528] In particular embodiments, the CRISPR enzyme comprises one
or more mutations selected from the group consisting of R597A,
H602A, R1278A and H1283A and/or the one or more mutations are in
the HEPN domain of the CRISPR enzyme or is a mutation as otherwise
discussed herein. In some embodiments, the CRISPR enzyme has one or
more mutations in a catalytic domain, wherein when transcribed, the
direct repeat sequence forms a single stem loop and the guide
sequence directs sequence-specific binding of a CRISPR complex to
the target sequence, and wherein the enzyme further comprises a
functional domain. In some embodiments, the functional domain is a.
In some embodiments, the functional domain is a transcription
repression domain, preferably KRAB. In some embodiments, the
transcription repression domain is SID, or concatemers of SID (eg
SID4X). In some embodiments, the functional domain is an epigenetic
modifying domain, such that an epigenetic modifying enzyme is
provided. In some embodiments, the functional domain is an
activation domain, which may be the P65 activation domain.
Delivery of the C2c2 Effector Protein Complex or Components
Thereof
[0529] Through this disclosure and the knowledge in the art, TALEs,
CRISPR-Cas systems, or components thereof or nucleic acid molecules
thereof or nucleic acid molecules encoding or providing components
thereof may be delivered by a delivery system herein described both
generally and in detail.
[0530] Vector delivery, e.g., plasmid, viral delivery: The CRISPR
enzyme, for instance a Type V protein such as C2c2, and/or any of
the present RNAs, for instance a guide RNA, can be delivered using
any suitable vector, e.g., plasmid or viral vectors, such as adeno
associated virus (AAV), lentivirus, adenovirus or other viral
vector types, or combinations thereof. Effector proteins and one or
more guide RNAs can be packaged into one or more vectors, e.g.,
plasmid or viral vectors. In some embodiments, the vector, e.g.,
plasmid or viral vector is delivered to the tissue of interest by,
for example, an intramuscular injection, while other times the
delivery is via intravenous, transdermal, intranasal, oral,
mucosal, or other delivery methods. Such delivery may be either via
a single dose, or multiple doses. One skilled in the art
understands that the actual dosage to be delivered herein may vary
greatly depending upon a variety of factors, such as the vector
choice, the target cell, organism, or tissue, the general condition
of the subject to be treated, the degree of
transformation/modification sought, the administration route, the
administration mode, the type of transformation/modification
sought, etc.
[0531] Such a dosage may further contain, for example, a carrier
(water, saline, ethanol, glycerol, lactose, sucrose, calcium
phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil,
etc.), a diluent, a pharmaceutically-acceptable carrier (e.g.,
phosphate-buffered saline), a pharmaceutically-acceptable
excipient, and/or other compounds known in the art. The dosage may
further contain one or more pharmaceutically acceptable salts such
as, for example, a mineral acid salt such as a hydrochloride, a
hydrobromide, a phosphate, a sulfate, etc.; and the salts of
organic acids such as acetates, propionates, malonates, benzoates,
etc. Additionally, auxiliary substances, such as wetting or
emulsifying agents, pH buffering substances, gels or gelling
materials, flavorings, colorants, microspheres, polymers,
suspension agents, etc. may also be present herein. In addition,
one or more other conventional pharmaceutical ingredients, such as
preservatives, humectants, suspending agents, surfactants,
antioxidants, anticaking agents, fillers, chelating agents, coating
agents, chemical stabilizers, etc. may also be present, especially
if the dosage form is a reconstitutable form. Suitable exemplary
ingredients include microcrystalline cellulose,
carboxymethylcellulose sodium, polysorbate 80, phenylethyl alcohol,
chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide,
propyl gallate, the parabens, ethyl vanillin, glycerin, phenol,
parachlorophenol, gelatin, albumin and a combination thereof. A
thorough discussion of pharmaceutically acceptable excipients is
available in REMINGTON'S PHARMACEUTICAL SCIENCES (Mack Pub. Co.,
N.J. 1991) which is incorporated by reference herein.
[0532] In an embodiment herein the delivery is via an adenovirus,
which may be at a single booster dose containing at least
1.times.10.sup.5 particles (also referred to as particle units, pu)
of adenoviral vector. In an embodiment herein, the dose preferably
is at least about 1.times.10.sup.6 particles (for example, about
1.times.10.sup.6-1.times.10.sup.12 particles), more preferably at
least about 1.times.10.sup.7 particles, more preferably at least
about 1.times.10.sup.8 particles (e.g., about
1.times.10.sup.8-1.times.10.sup.11 particles or about
1.times.10.sup.8-1.times.10.sup.12 particles), and most preferably
at least about 1.times.10.sup.10 particles (e.g., about
1.times.10.sup.9-1.times.10.sup.10 particles or about
1.times.10.sup.9-1.times.10.sup.12 particles), or even at least
about 1.times.10.sup.10 particles (e.g., about
1.times.10.sup.10-1.times.10.sup.12 particles) of the adenoviral
vector. Alternatively, the dose comprises no more than about
1.times.10.sup.14 particles, preferably no more than about
1.times.10.sup.13 particles, even more preferably no more than
about 1.times.10.sup.12 particles, even more preferably no more
than about 1.times.10.sup.11 particles, and most preferably no more
than about 1.times.10.sup.10 particles (e.g., no more than about
1.times.10.sup.9 articles). Thus, the dose may contain a single
dose of adenoviral vector with, for example, about 1.times.10.sup.6
particle units (pu), about 2.times.10.sup.6 pu, about
4.times.10.sup.6 pu, about 1.times.10' pu, about 2.times.10.sup.7
pu, about 4.times.10.sup.7 pu, about 1.times.10.sup.8 pu, about
2.times.10.sup.8 pu, about 4.times.10.sup.8 pu, about
1.times.10.sup.9 pu, about 2.times.10.sup.9 pu, about
4.times.10.sup.9 pu, about 1.times.10.sup.10 pu, about
2.times.10.sup.10 pu, about 4.times.10.sup.10 pu, about
1.times.10.sup.11 pu, about 2.times.10.sup.11 pu, about
4.times.10.sup.11 pu, about 1.times.10.sup.12 pu, about
2.times.10.sup.12 pu, or about 4.times.10.sup.12 pu of adenoviral
vector. See, for example, the adenoviral vectors in U.S. Pat. No.
8,454,972 B2 to Nabel, et. al., granted on Jun. 4, 2013;
incorporated by reference herein, and the dosages at col 29, lines
36-58 thereof. In an embodiment herein, the adenovirus is delivered
via multiple doses.
[0533] In an embodiment herein, the delivery is via an AAV. A
therapeutically effective dosage for in vivo delivery of the AAV to
a human is believed to be in the range of from about 20 to about 50
ml of saline solution containing from about 1.times.10.sup.10 to
about 1.times.10.sup.10 functional AAV/ml solution. The dosage may
be adjusted to balance the therapeutic benefit against any side
effects. In an embodiment herein, the AAV dose is generally in the
range of concentrations of from about 1.times.10.sup.5 to
1.times.10.sup.50 genomes AAV, from about 1.times.10.sup.8 to
1.times.10.sup.20 genomes AAV, from about 1.times.10.sup.10 to
about 1.times.10.sup.16 genomes, or about 1.times.10.sup.11 to
about 1.times.10.sup.16 genomes AAV. A human dosage may be about
1.times.10.sup.13 genomes AAV. Such concentrations may be delivered
in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml,
or about 10 to about 25 ml of a carrier solution. Other effective
dosages can be readily established by one of ordinary skill in the
art through routine trials establishing dose response curves. See,
for example, U.S. Pat. No. 8,404,658 B2 to Hajjar, et al., granted
on Mar. 26, 2013, at col. 27, lines 45-60.
[0534] In an embodiment herein the delivery is via a plasmid. In
such plasmid compositions, the dosage should be a sufficient amount
of plasmid to elicit a response. For instance, suitable quantities
of plasmid DNA in plasmid compositions can be from about 0.1 to
about 2 mg, or from about 1 .mu.g to about 10 .mu.g per 70 kg
individual. Plasmids of the invention will generally comprise (i) a
promoter; (ii) a sequence encoding an nucleic acid-targeting CRISPR
enzyme, operably linked to said promoter; (iii) a selectable
marker; (iv) an origin of replication; and (v) a transcription
terminator downstream of and operably linked to (ii). The plasmid
can also encode the RNA components of a CRISPR complex, but one or
more of these may instead be encoded on a different vector.
[0535] The doses herein are based on an average 70 kg individual.
The frequency of administration is within the ambit of the medical
or veterinary practitioner (e.g., physician, veterinarian), or
scientist skilled in the art. It is also noted that mice used in
experiments are typically about 20g and from mice experiments one
can scale up to a 70 kg individual.
[0536] In some embodiments the RNA molecules of the invention are
delivered in liposome or lipofectin formulations and the like and
can be prepared by methods well known to those skilled in the art.
Such methods are described, for example, in U.S. Pat. Nos.
5,593,972, 5,589,466, and 5,580,859, which are herein incorporated
by reference. Delivery systems aimed specifically at the enhanced
and improved delivery of siRNA into mammalian cells have been
developed, (see, for example, Shen et al FEBS Let. 2003,
539:111-114; Xia et al., Nat. Biotech. 2002, 20:1006-1010; Reich et
al., Mol. Vision. 2003, 9: 210-216; Sorensen et al., J. Mol. Biol.
2003, 327: 761-766; Lewis et al., Nat. Gen. 2002, 32: 107-108 and
Simeoni et al., NAR 2003, 31, 11: 2717-2724) and may be applied to
the present invention. siRNA has recently been successfully used
for inhibition of gene expression in primates (see for example.
Tolentino et al., Retina 24(4):660 which may also be applied to the
present invention.
[0537] Indeed, RNA delivery is a useful method of in vivo delivery.
It is possible to deliver nucleic acid-targeting Cas proteinCas9
and guide RNAgRNA (and, for instance, HR repair template) into
cells using liposomes or particles. Thus delivery of the nucleic
acid-targeting Cas protein/CRISPR enzyme, such as a CasCas9 and/or
delivery of the guide RNAs of the invention may be in RNA form and
via microvesicles, liposomes or particles. For example, Cas mRNA
and guide RNA can be packaged into liposomal particles for delivery
in vivo. Liposomal transfection reagents such as lipofectamine from
Life Technologies and other reagents on the market can effectively
deliver RNA molecules into the liver.
[0538] Means of delivery of RNA also preferred include delivery of
RNA via nanoparticles (Cho, S., Goldberg, M., Son, S., Xu, Q.,
Yang, F., Mei, Y., Bogatyrev, S., Langer, R. and Anderson, D.,
Lipid-like nanoparticles for small interfering RNA delivery to
endothelial cells, Advanced Functional Materials, 19: 3112-3118,
2010) or exosomes (Schroeder, A., Levins, C., Cortez, C., Langer,
R., and Anderson, D., Lipid-based nanotherapeutics for siRNA
delivery, Journal of Internal Medicine, 267: 9-21, 2010, PMID:
20059641). Indeed, exosomes have been shown to be particularly
useful in delivery siRNA, a system with some parallels to the
RNA-targeting system. For instance, El-Andaloussi S, et al.
("Exosome-mediated delivery of siRNA in vitro and in vivo." Nat
Protoc. 2012 December; 7(12):2112-26. doi: 10.1038/nprot.2012.131.
Epub 2012 Nov. 15.) describe how exosomes are promising tools for
drug delivery across different biological barriers and can be
harnessed for delivery of siRNA in vitro and in vivo. Their
approach is to generate targeted exosomes through transfection of
an expression vector, comprising an exosomal protein fused with a
peptide ligand. The exosomes are then purify and characterized from
transfected cell supernatant, then RNA is loaded into the exosomes.
Delivery or administration according to the invention can be
performed with exosomes, in particular but not limited to the
brain. Vitamin E (a-tocopherol) may be conjugated with nucleic
acid-targeting Cas protein and delivered to the brain along with
high density lipoprotein (HDL), for example in a similar manner as
was done by Uno et al. (HUMAN GENE THERAPY 22:711-719 (June 2011))
for delivering short-interfering RNA (siRNA) to the brain. Mice
were infused via Osmotic minipumps (model 1007D; Alzet, Cupertino,
Calif.) filled with phosphate-buffered saline (PBS) or free
TocsiBACE or Toc-siBACE/HDL and connected with Brain Infusion Kit 3
(Alzet). A brain-infusion cannula was placed about 0.5 mm posterior
to the bregma at midline for infusion into the dorsal third
ventricle. Uno et al. found that as little as 3 nmol of Toc-siRNA
with HDL could induce a target reduction in comparable degree by
the same ICV infusion method. A similar dosage of nucleic
acid-targeting effector protein conjugated to a-tocopherol and
co-administered with HDL targeted to the brain may be contemplated
for humans in the present invention, for example, about 3 nmol to
about 3 .mu.mol of nucleic acid-targeting effector protein targeted
to the brain may be contemplated. Zou et al. ((HUMAN GENE THERAPY
22:465-475 (April 2011)) describes a method of lentiviral-mediated
delivery of short-hairpin RNAs targeting PKC.gamma. for in vivo
gene silencing in the spinal cord of rats. Zou et al. administered
about 10 .mu.l of a recombinant lentivirus having a titer of
1.times.10.sup.9 transducing units (TU)/ml by an intrathecal
catheter. A similar dosage of nucleic acid-targeting effector
protein expressed in a lentiviral vector targeted to the brain may
be contemplated for humans in the present invention, for example,
about 10-50 ml of nucleic acid-targeting effector protein targeted
to the brain in a lentivirus having a titer of 1.times.10.sup.9
transducing units (TU)/ml may be contemplated.
[0539] In terms of local delivery to the brain, this can be
achieved in various ways. For instance, material can be delivered
intrastriatally e.g., by injection. Injection can be performed
stereotactically via a craniotomy.
[0540] Enhancing NHEJ or HR efficiency is also helpful for
delivery. It is preferred that NHEJ efficiency is enhanced by
co-expressing end-processing enzymes such as Trex2 (Dumitrache et
al. Genetics. 2011 August; 188(4): 787-797). It is preferred that
HR efficiency is increased by transiently inhibiting NHEJ
machineries such as Ku70 and Ku86. HR efficiency can also be
increased by co-expressing prokaryotic or eukaryotic homologous
recombination enzymes such as RecBCD, RecA.
Packaging and Promoters Generally
[0541] Ways to package nucleic acid-targeting effector protein
(such as a Type V protein such as C2c2) coding nucleic acid
molecules, e.g., DNA, into vectors, e.g., viral vectors, to mediate
genome modification in vivo include:
[0542] To achieve NHEJ-mediated gene knockout:
[0543] Single virus vector: [0544] Vector containing two or more
expression cassettes: [0545] Promoter-nucleic acid-targeting
effector protein coding nucleic acid molecule-terminator [0546]
Promoter-guide RNA1-terminator [0547] Promoter-guide RNA
(N)-terminator (up to size limit of vector) Double virus vector:
[0548] Vector 1 containing one expression cassette for driving the
expression of nucleic acid-targeting effector protein (such as a
Type V protein such as C2c2) [0549] Promoter-nucleic acid-targeting
effector protein coding nucleic acid molecule-terminator [0550]
Vector 2 containing one more expression cassettes for driving the
expression of one or more guideRNAs [0551] Promoter-guide
RNA1-terminator [0552] Promoter-guide RNA1 (N)-terminator (up to
size limit of vector)
[0553] To mediate homology-directed repair. [0554] In addition to
the single and double virus vector approaches described above, an
additional vector is used to deliver a homology-direct repair
template.
[0555] The promoter used to drive nucleic acid-targeting effector
protein (such as a Type V protein such as C2c2) coding nucleic acid
molecule expression can include:
[0556] AAV ITR can serve as a promoter: this is advantageous for
eliminating the need for an additional promoter element (which can
take up space in the vector). The additional space freed up can be
used to drive the expression of additional elements (gRNA, etc.).
Also, ITR activity is relatively weaker, so can be used to reduce
potential toxicity due to over expression of nucleic acid-targeting
effector protein (such as a Type V protein such as C2c2).
[0557] For ubiquitous expression, can use promoters: CMV, CAG, CBh,
PGK, SV40, Ferritin heavy or light chains, etc.
[0558] For brain or other CNS expression, can use promoters:
SynapsinI for all neurons, CaMKIIalpha for excitatory neurons,
GAD67 or GAD65 or VGAT for GABAergic neurons, etc.
[0559] For liver expression, can use Albumin promoter.
[0560] For lung expression, can use SP-B.
[0561] For endothelial cells, can use ICAM.
[0562] For hematopoietic cells can use IFNbeta or CD45.
[0563] For Osteoblasts can use OG-2.
[0564] The promoter used to drive guide RNA can include:
[0565] Pol III promoters such as U6 or H1
[0566] Use of Pol II promoter and intronic cassettes to express
guide RNA
Adeno Associated Virus (AAV)
[0567] nucleic acid-targeting effector protein (such as a Type V
protein such as C2c2) and one or more guide RNA can be delivered
using adeno associated virus (AAV), lentivirus, adenovirus or other
plasmid or viral vector types, in particular, using formulations
and doses from, for example, U.S. Pat. No. 8,454,972 (formulations,
doses for adenovirus), U.S. Pat. No. 8,404,658 (formulations, doses
for AAV) and U.S. Pat. No. 5,846,946 (formulations, doses for DNA
plasmids) and from clinical trials and publications regarding the
clinical trials involving lentivirus, AAV and adenovirus. For
examples, for AAV, the route of administration, formulation and
dose can be as in U.S. Pat. No. 8,454,972 and as in clinical trials
involving AAV. For Adenovirus, the route of administration,
formulation and dose can be as in U.S. Pat. No. 8,404,658 and as in
clinical trials involving adenovirus. For plasmid delivery, the
route of administration, formulation and dose can be as in U.S.
Pat. No. 5,846,946 and as in clinical studies involving plasmids.
Doses may be based on or extrapolated to an average 70 kg
individual (e.g., a male adult human), and can be adjusted for
patients, subjects, mammals of different weight and species.
Frequency of administration is within the ambit of the medical or
veterinary practitioner (e.g., physician, veterinarian), depending
on usual factors including the age, sex, general health, other
conditions of the patient or subject and the particular condition
or symptoms being addressed. The viral vectors can be injected into
the tissue of interest. For cell-type specific genome/transcriptome
modification, the expression of nucleic acid-targeting effector
protein (such as a Type V protein such as C2c2) can be driven by a
cell-type specific promoter. For example, liver-specific expression
might use the Albumin promoter and neuron-specific expression
(e.g., for targeting CNS disorders) might use the Synapsin I
promoter.
[0568] In terms of in vivo delivery, AAV is advantageous over other
viral vectors for a couple of reasons: [0569] Low toxicity (this
may be due to the purification method not requiring ultra
centrifugation of cell particles that can activate the immune
response) and [0570] Low probability of causing insertional
mutagenesis because it doesn't integrate into the host genome.
[0571] AAV has a packaging limit of 4.5 or 4.75 Kb. This means that
nucleic acid-targeting effector protein (such as a Type V protein
such as C2c2) as well as a promoter and transcription terminator
have to be all fit into the same viral vector. Therefore
embodiments of the invention include utilizing homologs of nucleic
acid-targeting effector protein (such as a Type V protein such as
C2c2) that are shorter.
[0572] As to AAV, the AAV can be AAV1, AAV2, AAV5 or any
combination thereof. One can select the AAV of the AAV with regard
to the cells to be targeted; e.g., one can select AAV serotypes 1,
2, 5 or a hybrid capsid AAV1, AAV2, AAV5 or any combination thereof
for targeting brain or neuronal cells; and one can select AAV4 for
targeting cardiac tissue. AAV8 is useful for delivery to the liver.
The herein promoters and vectors are preferred individually. A
tabulation of certain AAV serotypes as to these cells (see Grimm,
D. et al, J. Virol. 82: 5887-5911 (2008)) is as follows:
TABLE-US-00001 Cell Line AAV-1 AAV-2 AAV-3 AAV-4 AAV-5 AAV-6 AAV-8
AAV-9 Huh-7 13 100 2.5 0.0 0.1 10 0.7 0.0 HEK293 25 100 2.5 0.1 0.1
5 0.7 0.1 HeLa 3 100 2.0 0.1 6.7 1 0.2 0.1 HepG2 3 100 16.7 0.3 1.7
5 0.3 ND Hep1A 20 100 0.2 1.0 0.1 1 0.2 0.0 911 17 100 11 0.2 0.1
17 0.1 ND CHO 100 100 14 1.4 333 50 10 1.0 COS 33 100 33 3.3 5.0 14
2.0 0.5 MeWo 10 100 20 0.3 6.7 10 1.0 0.2 NIH3T3 10 100 2.9 2.9 0.3
10 0.3 ND A549 14 100 20 ND 0.5 10 0.5 0.1 HT1180 20 100 10 0.1 0.3
33 0.5 0.1 Monocytes 1111 100 ND ND 125 1429 ND ND Immature DC 2500
100 ND ND 222 2857 ND ND Mature DC 2222 100 ND ND 333 3333 ND
ND
Lentivirus
[0573] Lentiviruses are complex retroviruses that have the ability
to infect and express their genes in both mitotic and post-mitotic
cells. The most commonly known lentivirus is the human
immunodeficiency virus (HIV), which uses the envelope glycoproteins
of other viruses to target a broad range of cell types.
[0574] Lentiviruses may be prepared as follows. After cloning
pCasES10 (which contains a lentiviral transfer plasmid backbone),
HEK293FT at low passage (p=5) were seeded in a T-75 flask to 50%
confluence the day before transfection in DMEM with 10% fetal
bovine serum and without antibiotics. After 20 hours, media was
changed to OptiMEM (serum-free) media and transfection was done 4
hours later. Cells were transfected with 10 .mu.g of lentiviral
transfer plasmid (pCasES10) and the following packaging plasmids: 5
.mu.g of pMD2.G (VSV-g pseudotype), and 7.5 ug of psPAX2
(gag/pol/rev/tat). Transfection was done in 4 mL OptiMEM with a
cationic lipid delivery agent (50 uL Lipofectamine 2000 and 100 ul
Plus reagent). After 6 hours, the media was changed to
antibiotic-free DMEM with 10% fetal bovine serum. These methods use
serum during cell culture, but serum-free methods are
preferred.
[0575] Lentivirus may be purified as follows. Viral supernatants
were harvested after 48 hours. Supernatants were first cleared of
debris and filtered through a 0.45 um low protein binding (PVDF)
filter. They were then spun in a ultracentrifuge for 2 hours at
24,000 rpm. Viral pellets were resuspended in 50 ul of DMEM
overnight at 4C. They were then aliquotted and immediately frozen
at -80.degree. C.
[0576] In another embodiment, minimal non-primate lentiviral
vectors based on the equine infectious anemia virus (EIAV) are also
contemplated, especially for ocular gene therapy (see, e.g.,
Balagaan, J Gene Med 2006; 8: 275-285). In another embodiment,
RetinoStat.RTM., an equine infectious anemia virus-based lentiviral
gene therapy vector that expresses angiostatic proteins endostatin
and angiostatin that is delivered via a subretinal injection for
the treatment of the web form of age-related macular degeneration
is also contemplated (see, e.g., Binley et al., HUMAN GENE THERAPY
23:980-991 (September 2012)) and this vector may be modified for
the nucleic acid-targeting system of the present invention.
[0577] In another embodiment, self-inactivating lentiviral vectors
with an siRNA targeting a common exon shared by HIV tat/rev, a
nucleolar-localizing TAR decoy, and an anti-CCR5-specific
hammerhead ribozyme (see, e.g., DiGiusto et al. (2010) Sci Transl
Med 2:36ra43) may be used/and or adapted to the nucleic
acid-targeting system of the present invention. A minimum of
2.5.times.10.sup.6 CD34+ cells per kilogram patient weight may be
collected and prestimulated for 16 to 20 hours in X-VIVO 15 medium
(Lonza) containing 2 .mu.mol/L-glutamine, stem cell factor (100
ng/ml), Flt-3 ligand (Flt-3L) (100 ng/ml), and thrombopoietin (10
ng/ml) (CellGenix) at a density of 2.times.10.sup.6 cells/ml.
Prestimulated cells may be transduced with lentiviral at a
multiplicity of infection of 5 for 16 to 24 hours in 75-cm.sup.2
tissue culture flasks coated with fibronectin (25 mg/cm.sup.2)
(RetroNectin, Takara Bio Inc.).
[0578] Lentiviral vectors have been disclosed as in the treatment
for Parkinson's Disease, see, e.g., US Patent Publication No.
20120295960 and U.S. Pat. Nos. 7,303,910 and 7,351,585. Lentiviral
vectors have also been disclosed for the treatment of ocular
diseases, see e.g., US Patent Publication Nos. 20060281180,
20090007284, US20110117189; US20090017543; US20070054961,
US20100317109. Lentiviral vectors have also been disclosed for
delivery to the brain, see, e.g., US Patent Publication Nos.
US20110293571; US20110293571, US20040013648, US20070025970,
US20090111106 and U.S. Pat. No. 7,259,015.
RNA Delivery
[0579] RNA delivery: The nucleic acid-targeting Cas protein, for
instance a Type V protein such as C2c2, and/or guide RNA, can also
be delivered in the form of RNA. nucleic acid-targeting Cas protein
(such as a Type VI protein such as C2c2) mRNA can be generated
using in vitro transcription. For example, nucleic acid-targeting
effector protein (such as a Type V protein such as C2c2) mRNA can
be synthesized using a PCR cassette containing the following
elements: T7_promoter-kozak sequence (GCCACC)-effector protein-3'
UTR from beta globin-polyA tail (a string of 120 or more adenines).
The cassette can be used for transcription by T7 polymerase. Guide
RNAs can also be transcribed using in vitro transcription from a
cassette containing T7_promoter-GG-guide RNA sequence.
[0580] To enhance expression and reduce possible toxicity, the
nucleic acid-targeting effector protein-coding sequence and/or the
guide RNA can be modified to include one or more modified
nucleoside e.g., using pseudo-U or 5-Methyl-C.
[0581] mRNA delivery methods are especially promising for liver
delivery currently.
[0582] Much clinical work on RNA delivery has focused on RNAi or
antisense, but these systems can be adapted for delivery of RNA for
implementing the present invention. References below to RNAi etc.
should be read accordingly.
Particle Delivery Systems and/or Formulations:
[0583] Several types of particle delivery systems and/or
formulations are known to be useful in a diverse spectrum of
biomedical applications. In general, a particle is defined as a
small object that behaves as a whole unit with respect to its
transport and properties. Particles are further classified
according to diameter. Coarse particles cover a range between 2,500
and 10,000 nanometers. Fine particles are sized between 100 and
2,500 nanometers. Ultrafine particles, or nanoparticles, are
generally between 1 and 100 nanometers in size. The basis of the
100-nm limit is the fact that novel properties that differentiate
particles from the bulk material typically develop at a critical
length scale of under 100 nm.
[0584] As used herein, a particle delivery system/formulation is
defined as any biological delivery system/formulation which
includes a particle in accordance with the present invention. A
particle in accordance with the present invention is any entity
having a greatest dimension (e.g. diameter) of less than 100
microns (.mu.m). In some embodiments, inventive particles have a
greatest dimension of less than 10 .mu.m. In some embodiments,
inventive particles have a greatest dimension of less than 2000
nanometers (nm). In some embodiments, inventive particles have a
greatest dimension of less than 1000 nanometers (nm). In some
embodiments, inventive particles have a greatest dimension of less
than 900 nm, 800 nm, 700 nm, 600 nm, 500 nm, 400 nm, 300 nm, 200
nm, or 100 nm. Typically, inventive particles have a greatest
dimension (e.g., diameter) of 500 nm or less. In some embodiments,
inventive particles have a greatest dimension (e.g., diameter) of
250 nm or less. In some embodiments, inventive particles have a
greatest dimension (e.g., diameter) of 200 nm or less. In some
embodiments, inventive particles have a greatest dimension (e.g.,
diameter) of 150 nm or less. In some embodiments, inventive
particles have a greatest dimension (e.g., diameter) of 100 nm or
less. Smaller particles, e.g., having a greatest dimension of 50 nm
or less are used in some embodiments of the invention. In some
embodiments, inventive particles have a greatest dimension ranging
between 25 nm and 200 nm.
[0585] Particle characterization (including e.g., characterizing
morphology, dimension, etc.) is done using a variety of different
techniques. Common techniques are electron microscopy (TEM, SEM),
atomic force microscopy (AFM), dynamic light scattering (DLS),
X-ray photoelectron spectroscopy (XPS), powder X-ray diffraction
(XRD), Fourier transform infrared spectroscopy (FTIR),
matrix-assisted laser desorption/ionization time-of-flight mass
spectrometry(MALDI-TOF), ultraviolet-visible spectroscopy, dual
polarisation interferometry and nuclear magnetic resonance (NMR).
Characterization (dimension measurements) may be made as to native
particles (i.e., preloading) or after loading of the cargo (herein
cargo refers to e.g., one or more components of CRISPR-Cas system
e.g., CRISPR enzyme or mRNA or guide RNA, or any combination
thereof, and may include additional carriers and/or excipients) to
provide particles of an optimal size for delivery for any in vitro,
ex vivo and/or in vivo application of the present invention. In
certain preferred embodiments, particle dimension (e.g., diameter)
characterization is based on measurements using dynamic laser
scattering (DLS). Mention is made of U.S. Pat. Nos. 8,709,843;
6,007,845; 5,855,913; 5,985,309; 5,543,158; and the publication by
James E. Dahlman and Carmen Barnes et al. Nature Nanotechnology
(2014) published online 11 May 2014, doi:10.1038/nnano.2014.84,
concerning particles, methods of making and using them and
measurements thereof.
[0586] Particles delivery systems within the scope of the present
invention may be provided in any form, including but not limited to
solid, semi-solid, emulsion, or colloidal particles. As such any of
the delivery systems described herein, including but not limited
to, e.g., lipid-based systems, liposomes, micelles, microvesicles,
exosomes, or gene gun may be provided as particle delivery systems
within the scope of the present invention.
Particles
[0587] CRISPR enzyme mRNA and guide RNA may be delivered
simultaneously using particles or lipid envelopes; for instance,
CRISPR enzyme and RNA of the invention, e.g., as a complex, can be
delivered via a particle as in Dahlman et al., WO2015089419 A2 and
documents cited therein, such as 7C1 (see, e.g., James E. Dahlman
and Carmen Barnes et al. Nature Nanotechnology (2014) published
online 11 May 2014, doi:10.1038/nnano.2014.84), e.g., delivery
particle comprising lipid or lipidoid and hydrophilic polymer,
e.g., cationic lipid and hydrophilic polymer, for instance wherein
the the cationic lipid comprises
1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) or
1,2-ditetradecanoyl-sn-glycero-3-phosphocholine (DMPC) and/or
wherein the hydrophilic polymer comprises ethylene glycol or
polyethylene glycol (PEG); and/or wherein the particle further
comprises cholesterol (e.g., particle from formulation 1=DOTAP 100,
DMPC 0, PEG 0, Cholesterol 0; formulation number 2=DOTAP 90, DMPC
0, PEG 10, Cholesterol 0; formulation number 3=DOTAP 90, DMPC 0,
PEG 5, Cholesterol 5), wherein particles are formed using an
efficient, multistep process wherein first, effector protein and
RNA are mixed together, e.g., at a 1:1 molar ratio, e.g., at room
temperature, e.g., for 30 minutes, e.g., in sterile, nuclease free
1.times.PBS; and separately, DOTAP, DMPC, PEG, and cholesterol as
applicable for the formulation are dissolved in alcohol, e.g., 100%
ethanol; and, the two solutions are mixed together to form
particles containing the complexes).
[0588] Nucleic acid-targeting effector proteins (such as a Type VI
protein such as C2c2) mRNA and guide RNA may be delivered
simultaneously using particles or lipid envelopes.
[0589] For example, Su X, Fricke J, Kavanagh DG, Irvine DJ ("In
vitro and in vivo mRNA delivery using lipid-enveloped pH-responsive
polymer nanoparticles" Mol Pharm. 2011 Jun 6; 8(3):774-87. doi:
10.1021/mp100390w. Epub 2011 Apr. 1) describes biodegradable
core-shell structured particles with a poly(.beta.-amino ester)
(PBAE) core enveloped by a phospholipid bilayer shell. These were
developed for in vivo mRNA delivery. The pH-responsive PBAE
component was chosen to promote endosome disruption, while the
lipid surface layer was selected to minimize toxicity of the
polycation core. Such are, therefore, preferred for delivering RNA
of the present invention.
[0590] In one embodiment, particles based on self-assembling
bioadhesive polymers are contemplated, which may be applied to oral
delivery of peptides, intravenous delivery of peptides and nasal
delivery of peptides, all to the brain. Other embodiments, such as
oral absorption and ocular delivery of hydrophobic drugs are also
contemplated. The molecular envelope technology involves an
engineered polymer envelope which is protected and delivered to the
site of the disease (see, e.g., Mazza, M. et al. ACSNano, 2013.
7(2): 1016-1026; Siew, A., et al. Mol Pharm, 2012. 9(1):14-28;
Lalatsa, A., et al. J Contr Rel, 2012. 161(2):523-36; Lalatsa, A.,
et al., Mol Pharm, 2012. 9(6):1665-80; Lalatsa, A., et al. Mol
Pharm, 2012. 9(6):1764-74; Garrett, N. L., et al. J Biophotonics,
2012. 5(5-6):458-68; Garrett, N. L., et al. J Raman Spect, 2012.
43(5):681-688; Ahmad, S., et al. J Royal Soc Interface 2010.
7:S423-33; Uchegbu, I.F. Expert Opin Drug Deliv, 2006. 3(5):629-40;
Qu, X.,et al. Biomacromolecules, 2006. 7(12):3452-9 and Uchegbu, I.
F., et al. Int J Pharm, 2001. 224:185-199). Doses of about 5 mg/kg
are contemplated, with single or multiple doses, depending on the
target tissue.
[0591] In one embodiment, particles that can deliver RNA to a
cancer cell to stop tumor growth developed by Dan Anderson's lab at
MIT may be used/and or adapted to the nucleic acid-targeting system
of the present invention. In particular, the Anderson lab developed
fully automated, combinatorial systems for the synthesis,
purification, characterization, and formulation of new biomaterials
and nanoformulations. See, e.g., Alabi et al., Proc Natl Acad Sci
USA. 2013 Aug 6; 110(32):12881-6; Zhang et al., Adv Mater. 2013 Sep
6; 25(33):4641-5; Jiang et al., Nano Lett. 2013 Mar 13; 13(3):
1059-64; Karagiannis et al., ACS Nano. 2012 Oct 23; 6(10):8484-7;
Whitehead et al., ACS Nano. 2012 Aug 28; 6(8):6922-9 and Lee et
al., Nat Nanotechnol. 2012 Jun 3; 7(6):389-93.
[0592] US patent application 20110293703 relates to lipidoid
compounds are also particularly useful in the administration of
polynucleotides, which may be applied to deliver the nucleic
acid-targeting system of the present invention. In one aspect, the
aminoalcohol lipidoid compounds are combined with an agent to be
delivered to a cell or a subject to form microparticles,
nanoparticles, liposomes, or micelles. The agent to be delivered by
the particles, liposomes, or micelles may be in the form of a gas,
liquid, or solid, and the agent may be a polynucleotide, protein,
peptide, or small molecule. The minoalcohol lipidoid compounds may
be combined with other aminoalcohol lipidoid compounds, polymers
(synthetic or natural), surfactants, cholesterol, carbohydrates,
proteins, lipids, etc. to form the particles. These particles may
then optionally be combined with a pharmaceutical excipient to form
a pharmaceutical composition.
[0593] US Patent Publication No. 20110293703 also provides methods
of preparing the aminoalcohol lipidoid compounds. One or more
equivalents of an amine are allowed to react with one or more
equivalents of an epoxide-terminated compound under suitable
conditions to form an aminoalcohol lipidoid compound of the present
invention. In certain embodiments, all the amino groups of the
amine are fully reacted with the epoxide-terminated compound to
form tertiary amines. In other embodiments, all the amino groups of
the amine are not fully reacted with the epoxide-terminated
compound to form tertiary amines thereby resulting in primary or
secondary amines in the aminoalcohol lipidoid compound. These
primary or secondary amines are left as is or may be reacted with
another electrophile such as a different epoxide-terminated
compound. As will be appreciated by one skilled in the art,
reacting an amine with less than excess of epoxide-terminated
compound will result in a plurality of different aminoalcohol
lipidoid compounds with various numbers of tails. Certain amines
may be fully functionalized with two epoxide-derived compound tails
while other molecules will not be completely functionalized with
epoxide-derived compound tails. For example, a diamine or polyamine
may include one, two, three, or four epoxide-derived compound tails
off the various amino moieties of the molecule resulting in
primary, secondary, and tertiary amines. In certain embodiments,
all the amino groups are not fully functionalized. In certain
embodiments, two of the same types of epoxide-terminated compounds
are used. In other embodiments, two or more different
epoxide-terminated compounds are used. The synthesis of the
aminoalcohol lipidoid compounds is performed with or without
solvent, and the synthesis may be performed at higher temperatures
ranging from 30-100.degree. C., preferably at approximately
50-90.degree. C. The prepared aminoalcohol lipidoid compounds may
be optionally purified. For example, the mixture of aminoalcohol
lipidoid compounds may be purified to yield an aminoalcohol
lipidoid compound with a particular number of epoxide-derived
compound tails. Or the mixture may be purified to yield a
particular stereo- or regioisomer. The aminoalcohol lipidoid
compounds may also be alkylated using an alkyl halide (e.g., methyl
iodide) or other alkylating agent, and/or they may be acylated.
[0594] US Patent Publication No. 20110293703 also provides
libraries of aminoalcohol lipidoid compounds prepared by the
inventive methods. These aminoalcohol lipidoid compounds may be
prepared and/or screened using high-throughput techniques involving
liquid handlers, robots, microtiter plates, computers, etc. In
certain embodiments, the aminoalcohol lipidoid compounds are
screened for their ability to transfect polynucleotides or other
agents (e.g., proteins, peptides, small molecules) into the
cell.
[0595] US Patent Publication No. 20130302401 relates to a class of
poly(beta-amino alcohols) (PBAAs) has been prepared using
combinatorial polymerization. The inventive PBAAs may be used in
biotechnology and biomedical applications as coatings (such as
coatings of films or multilayer films for medical devices or
implants), additives, materials, excipients, non-biofouling agents,
micropatterning agents, and cellular encapsulation agents. When
used as surface coatings, these PBAAs elicited different levels of
inflammation, both in vitro and in vivo, depending on their
chemical structures. The large chemical diversity of this class of
materials allowed us to identify polymer coatings that inhibit
macrophage activation in vitro. Furthermore, these coatings reduce
the recruitment of inflammatory cells, and reduce fibrosis,
following the subcutaneous implantation of carboxylated polystyrene
microparticles. These polymers may be used to form polyelectrolyte
complex capsules for cell encapsulation. The invention may also
have many other biological applications such as antimicrobial
coatings, DNA or siRNA delivery, and stem cell tissue engineering.
The teachings of US Patent Publication No. 20130302401 may be
applied to the nucleic acid-targeting system of the present
invention.
[0596] In another embodiment, lipid nanoparticles (LNPs) are
contemplated. An antitransthyretin small interfering RNA has been
encapsulated in lipid nanoparticles and delivered to humans (see,
e.g., Coelho et al., N Engl J Med 2013; 369:819-29), and such a
system may be adapted and applied to the nucleic acid-targeting
system of the present invention. Doses of about 0.01 to about 1 mg
per kg of body weight administered intravenously are contemplated.
Medications to reduce the risk of infusion-related reactions are
contemplated, such as dexamethasone, acetampinophen,
diphenhydramine or cetirizine, and ranitidine are contemplated.
Multiple doses of about 0.3 mg per kilogram every 4 weeks for five
doses are also contemplated.
[0597] LNPs have been shown to be highly effective in delivering
siRNAs to the liver (see, e.g., Tabernero et al., Cancer Discovery,
April 2013, Vol. 3, No. 4, pages 363-470) and are therefore
contemplated for delivering RNA encoding nucleic acid-targeting
effector protein to the liver. A dosage of about four doses of 6
mg/kg of the LNP every two weeks may be contemplated. Tabernero et
al. demonstrated that tumor regression was observed after the first
2 cycles of LNPs dosed at 0.7 mg/kg, and by the end of 6 cycles the
patient had achieved a partial response with complete regression of
the lymph node metastasis and substantial shrinkage of the liver
tumors. A complete response was obtained after 40 doses in this
patient, who has remained in remission and completed treatment
after receiving doses over 26 months. Two patients with RCC and
extrahepatic sites of disease including kidney, lung, and lymph
nodes that were progressing following prior therapy with VEGF
pathway inhibitors had stable disease at all sites for
approximately 8 to 12 months, and a patient with PNET and liver
metastases continued on the extension study for 18 months (36
doses) with stable disease.
[0598] However, the charge of the LNP must be taken into
consideration. As cationic lipids combined with negatively charged
lipids to induce nonbilayer structures that facilitate
intracellular delivery. Because charged LNPs are rapidly cleared
from circulation following intravenous injection, ionizable
cationic lipids with pKa values below 7 were developed (see, e.g.,
Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200,
Dec. 2011). Negatively charged polymers such as RNA may be loaded
into LNPs at low pH values (e.g., pH 4) where the ionizable lipids
display a positive charge. However, at physiological pH values, the
LNPs exhibit a low surface charge compatible with longer
circulation times. Four species of ionizable cationic lipids have
been focused upon, namely 1,2-dilineoyl-3-dimethylammonium-propane
(DLinDAP), 1,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA),
1,2-dilinoleyloxy-keto-N,N-dimethyl-3-aminopropane (DLinKDMA), and
1,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLinKC2-DMA). It has been shown that LNP siRNA systems containing
these lipids exhibit remarkably different gene silencing properties
in hepatocytes in vivo, with potencies varying according to the
series DLinKC2-DMA>DLinKDMA>DLinDMA>>DLinDAP employing
a Factor VII gene silencing model (see, e.g., Rosin et al,
Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 2011). A
dosage of 1 .mu.g/ml of LNP or CRISPR-Cas RNA in or associated with
the LNP may be contemplated, especially for a formulation
containing DLinKC2-DMA.
[0599] Preparation of LNPs and CRISPR-Cas encapsulation may be
used/and or adapted from Rosin et al, Molecular Therapy, vol. 19,
no. 12, pages 1286-2200, Dec. 2011). The cationic lipids
1,2-dilineoyl-3-dimethylammonium-propane (DLinDAP),
1,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA),
1,2-dilinoleyloxyketo-N,N-dimethyl-3-aminopropane (DLinK-DMA),
1,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLinKC2-DMA), (3-o-[2''-(methoxypolyethyleneglycol 2000)
succinoyl]-1,2-dimyristoyl-sn-glycol (PEG-S-DMG), and
R-3-[((o-methoxy-poly(ethylene glycol)2000)
carbamoyl]-1,2-dimyristyloxlpropyl-3-amine (PEG-C-DOMG) may be
provided by Tekmira Pharmaceuticals (Vancouver, Canada) or
synthesized. Cholesterol may be purchased from Sigma (St Louis,
Mo.). The specific nucleic acid-targeting complex (CRISPR-Cas) RNA
may be encapsulated in LNPs containing DLinDAP, DLinDMA, DLinK-DMA,
and DLinKC2-DMA (cationic lipid:DSPC:CHOL: PEGS-DMG or PEG-C-DOMG
at 40:10:40:10 molar ratios). When required, 0.2% SP-DiOC18
(Invitrogen, Burlington, Canada) may be incorporated to assess
cellular uptake, intracellular delivery, and biodistribution.
Encapsulation may be performed by dissolving lipid mixtures
comprised of cationic lipid:DSPC:cholesterol:PEG-c-DOMG
(40:10:40:10 molar ratio) in ethanol to a final lipid concentration
of 10 mmol/l. This ethanol solution of lipid may be added drop-wise
to 50 mmol/l citrate, pH 4.0 to form multilamellar vesicles to
produce a final concentration of 30% ethanol vol/vol. Large
unilamellar vesicles may be formed following extrusion of
multilamellar vesicles through two stacked 80 nm Nuclepore
polycarbonate filters using the Extruder (Northern Lipids,
Vancouver, Canada). Encapsulation may be achieved by adding RNA
dissolved at 2 mg/ml in 50 mmol/l citrate, pH 4.0 containing 30%
ethanol vol/vol drop-wise to extruded preformed large unilamellar
vesicles and incubation at 31.degree. C. for 30 minutes with
constant mixing to a final RNA/lipid weight ratio of 0.06/1 wt/wt.
Removal of ethanol and neutralization of formulation buffer were
performed by dialysis against phosphate-buffered saline (PBS), pH
7.4 for 16 hours using Spectra/Por 2 regenerated cellulose dialysis
membranes. Particle size distribution may be determined by dynamic
light scattering using a NICOMP 370 particle sizer, the
vesicle/intensity modes, and Gaussian fitting (Nicomp Particle
Sizing, Santa Barbara, Calif.). The particle size for all three LNP
systems may be .about.70 nm in diameter. RNA encapsulation
efficiency may be determined by removal of free RNA using VivaPureD
MiniH columns (Sartorius Stedim Biotech) from samples collected
before and after dialysis. The encapsulated RNA may be extracted
from the eluted particles and quantified at 260 nm. RNA to lipid
ratio was determined by measurement of cholesterol content in
vesicles using the Cholesterol E enzymatic assay from Wako
Chemicals USA (Richmond, Va.). In conjunction with the herein
discussion of LNPs and PEG lipids, PEGylated liposomes or LNPs are
likewise suitable for delivery of a nucleic acid-targeting system
or components thereof.
[0600] Preparation of large LNPs may be used/and or adapted from
Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200,
Dec. 2011. A lipid premix solution (20.4 mg/ml total lipid
concentration) may be prepared in ethanol containing DLinKC2-DMA,
DSPC, and cholesterol at 50:10:38.5 molar ratios. Sodium acetate
may be added to the lipid premix at a molar ratio of 0.75:1 (sodium
acetate:DLinKC2-DMA). The lipids may be subsequently hydrated by
combining the mixture with 1.85 volumes of citrate buffer (10
mmol/l, pH 3.0) with vigorous stirring, resulting in spontaneous
liposome formation in aqueous buffer containing 35% ethanol. The
liposome solution may be incubated at 37.degree. C. to allow for
time-dependent increase in particle size. Aliquots may be removed
at various times during incubation to investigate changes in
liposome size by dynamic light scattering (Zetasizer Nano ZS,
Malvern Instruments, Worcestershire, UK). Once the desired particle
size is achieved, an aqueous PEG lipid solution (stock=10 mg/ml
PEG-DMG in 35% (vol/vol) ethanol) may be added to the liposome
mixture to yield a final PEG molar concentration of 3.5% of total
lipid. Upon addition of PEG-lipids, the liposomes should their
size, effectively quenching further growth. RNA may then be added
to the empty liposomes at a RNA to total lipid ratio of
approximately 1:10 (wt:wt), followed by incubation for 30 minutes
at 37.degree. C. to form loaded LNPs. The mixture may be
subsequently dialyzed overnight in PBS and filtered with a
0.45-.mu.m syringe filter.
[0601] Spherical Nucleic Acid (SNA.TM.) constructs and other
particles (particularly gold particles) are also contemplated as a
means to delivery nucleic acid-targeting system to intended
targets. Significant data show that AuraSense Therapeutics'
Spherical Nucleic Acid (SNA.TM.) constructs, based upon nucleic
acid-functionalized gold particles, are useful.
[0602] Literature that may be employed in conjunction with herein
teachings include: Cutler et al., J. Am. Chem. Soc. 2011
133:9254-9257, Hao et al., Small. 2011 7:3158-3162, Zhang et al.,
ACS Nano. 2011 5:6962-6970, Cutler et al., J. Am. Chem. Soc. 2012
134:1376-1391, Young et al., Nano Lett. 2012 12:3867-71, Zheng et
al., Proc. Natl. Acad. Sci. USA. 2012 109:11975-80, Mirkin,
Nanomedicine 2012 7:635-638 Zhang et al., J. Am. Chem. Soc. 2012
134:16488-1691, Weintraub, Nature 2013 495:S14-S16, Choi et al.,
Proc. Natl. Acad. Sci. USA. 2013 110(19):7625-7630, Jensen et al.,
Sci. Transl. Med. 5, 209ra152 (2013) and Mirkin, et al., Small,
10:186-192.
[0603] Self-assembling particles with RNA may be constructed with
polyethyleneimine (PEI) that is PEGylated with an Arg-Gly-Asp (RGD)
peptide ligand attached at the distal end of the polyethylene
glycol (PEG). This system has been used, for example, as a means to
target tumor neovasculature expressing integrins and deliver siRNA
inhibiting vascular endothelial growth factor receptor-2 (VEGF R2)
expression and thereby achieve tumor angiogenesis (see, e.g.,
Schiffelers et al., Nucleic Acids Research, 2004, Vol. 32, No. 19).
Nanoplexes may be prepared by mixing equal volumes of aqueous
solutions of cationic polymer and nucleic acid to give a net molar
excess of ionizable nitrogen (polymer) to phosphate (nucleic acid)
over the range of 2 to 6. The electrostatic interactions between
cationic polymers and nucleic acid resulted in the formation of
polyplexes with average particle size distribution of about 100 nm,
hence referred to here as nanoplexes. A dosage of about 100 to 200
mg of nucleic acid-targeting complex RNA is envisioned for delivery
in the self-assembling particles of Schiffelers et al.
[0604] The nanoplexes of Bartlett et al. (PNAS, Sep. 25, 2007,vol.
104, no. 39) may also be applied to the present invention. The
nanoplexes of Bartlett et al. are prepared by mixing equal volumes
of aqueous solutions of cationic polymer and nucleic acid to give a
net molar excess of ionizable nitrogen (polymer) to phosphate
(nucleic acid) over the range of 2 to 6. The electrostatic
interactions between cationic polymers and nucleic acid resulted in
the formation of polyplexes with average particle size distribution
of about 100 nm, hence referred to here as nanoplexes. The
DOTA-siRNA of Bartlett et al. was synthesized as follows:
1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid
mono(N-hydroxysuccinimide ester) (DOTA-NHSester) was ordered from
Macrocyclics (Dallas, Tex.). The amine modified RNA sense strand
with a 100-fold molar excess of DOTA-NHS-ester in carbonate buffer
(pH 9) was added to a microcentrifuge tube. The contents were
reacted by stirring for 4 h at room temperature. The DOTA-RNAsense
conjugate was ethanol-precipitated, resuspended in water, and
annealed to the unmodified antisense strand to yield DOTA-siRNA.
All liquids were pretreated with Chelex-100 (Bio-Rad, Hercules,
Calif.) to remove trace metal contaminants. Tf-targeted and
nontargeted siRNA particles may be formed by using
cyclodextrin-containing polycations. Typically, particles were
formed in water at a charge ratio of 3 (+/-) and an siRNA
concentration of 0.5 g/liter. One percent of the adamantane-PEG
molecules on the surface of the targeted particles were modified
with Tf (adamantane-PEG-Tf). The particles were suspended in a 5%
(wt/vol) glucose carrier solution for injection.
[0605] Davis et al. (Nature, Vol 464, 15 Apr. 2010) conducts a RNA
clinical trial that uses a targeted particle-delivery system
(clinical trial registration number NCT00689065). Patients with
solid cancers refractory to standard-of-care therapies are
administered doses of targeted particles on days 1, 3, 8 and 10 of
a 21-day cycle by a 30-min intravenous infusion. The particles
comprise, consist essentially of, or consist of a synthetic
delivery system containing: (1) a linear, cyclodextrin-based
polymer (CDP), (2) a human transferrin protein (TF) targeting
ligand displayed on the exterior of the nanoparticle to engage TF
receptors (TFR) on the surface of the cancer cells, (3) a
hydrophilic polymer (polyethylene glycol (PEG) used to promote
nanoparticle stability in biological fluids), and (4) siRNA
designed to reduce the expression of the RRM2 (sequence used in the
clinic was previously denoted siR2B+5). The TFR has long been known
to be upregulated in malignant cells, and RRM2 is an established
anti-cancer target. These particles (clinical version denoted as
CALAA-01) have been shown to be well tolerated in multi-dosing
studies in non-human primates. Although a single patient with
chronic myeloid leukaemia has been administered siRNAby liposomal
delivery, Davis et al.'s clinical trial is the initial human trial
to systemically deliver siRNA with a targeted delivery system and
to treat patients with solid cancer. To ascertain whether the
targeted delivery system can provide effective delivery of
functional siRNA to human tumours, Davis et al. investigated
biopsies from three patients from three different dosing cohorts;
patients A, B and C, all of whom had metastatic melanoma and
received CALAA-01 doses of 18, 24 and 30 mg m.sup.2 siRNA,
respectively. Similar doses may also be contemplated for the
nucleic acid-targeting system of the present invention. The
delivery of the invention may be achieved with particles containing
a linear, cyclodextrin-based polymer (CDP), a human transferrin
protein (TF) targeting ligand displayed on the exterior of the
particle to engage TF receptors (TFR) on the surface of the cancer
cells and/or a hydrophilic polymer (for example, polyethylene
glycol (PEG) used to promote particle stability in biological
fluids).
[0606] In terms of this invention, it is preferred to have one or
more components of nucleic acid-targeting complex, e.g., nucleic
acid-targeting effector protein or mRNA, or guide RNA delivered
using particles or lipid envelopes. Other delivery systems or
vectors are may be used in conjunction with the particle aspects of
the invention.
[0607] In general, a "nanoparticle" refers to any particle having a
diameter of less than 1000 nm. In certain preferred embodiments,
nanoparticles of the invention have a greatest dimension (e.g.,
diameter) of 500 nm or less. In other preferred embodiments,
nanoparticles of the invention have a greatest dimension ranging
between 25 nm and 200 nm. In other preferred embodiments, particles
of the invention have a greatest dimension of 100 nm or less. In
other preferred embodiments, nanoparticles of the invention have a
greatest dimension ranging between 35 nm and 60 nm.
[0608] Particles encompassed in the present invention may be
provided in different forms, e.g., as solid particles (e.g., metal
such as silver, gold, iron, titanium), non-metal, lipid-based
solids, polymers), suspensions of particles, or combinations
thereof. Metal, dielectric, and semiconductor particles may be
prepared, as well as hybrid structures (e.g., core-shell
particles). Particles made of semiconducting material may also be
labeled quantum dots if they are small enough (typically sub 10 nm)
that quantization of electronic energy levels occurs. Such
nanoscale particles are used in biomedical applications as drug
carriers or imaging agents and may be adapted for similar purposes
in the present invention.
[0609] Semi-solid and soft particles have been manufactured, and
are within the scope of the present invention. A prototype particle
of semi-solid nature is the liposome. Various types of liposome
particles are currently used clinically as delivery systems for
anticancer drugs and vaccines. Particles with one half hydrophilic
and the other half hydrophobic are termed Janus particles and are
particularly effective for stabilizing emulsions. They can
self-assemble at water/oil interfaces and act as solid
surfactants.
[0610] U.S. Pat. No. 8,709,843, incorporated herein by reference,
provides a drug delivery system for targeted delivery of
therapeutic agent-containing particles to tissues, cells, and
intracellular compartments. The invention provides targeted
particles comprising polymer conjugated to a surfactant,
hydrophilic polymer or lipid.
[0611] U.S. Pat. No. 6,007,845, incorporated herein by reference,
provides particles which have a core of a multiblock copolymer
formed by covalently linking a multifunctional compound with one or
more hydrophobic polymers and one or more hydrophilic polymers, and
contain a biologically active material.
[0612] U.S. Pat. No. 5,855,913, incorporated herein by reference,
provides a particulate composition having aerodynamically light
particles having a tap density of less than 0.4 g/cm3 with a mean
diameter of between 5 .mu.m and 30 .mu.m, incorporating a
surfactant on the surface thereof for drug delivery to the
pulmonary system.
[0613] U.S. Pat. No. 5,985,309, incorporated herein by reference,
provides particles incorporating a surfactant and/or a hydrophilic
or hydrophobic complex of a positively or negatively charged
therapeutic or diagnostic agent and a charged molecule of opposite
charge for delivery to the pulmonary system.
[0614] U.S. Pat. No. 5,543,158, incorporated herein by reference,
provides biodegradable injectable particles having a biodegradable
solid core containing a biologically active material and
poly(alkylene glycol) moieties on the surface.
[0615] WO2012135025 (also published as US20120251560), incorporated
herein by reference, describes conjugated polyethyleneimine (PEI)
polymers and conjugated aza-macrocycles (collectively referred to
as "conjugated lipomer" or "lipomers"). In certain embodiments, it
can be envisioned that such methods and materials of herein-cited
documents, e.g., conjugated lipomers can be used in the context of
the nucleic acid-targeting system to achieve in vitro, ex vivo and
in vivo genomic perturbations to modify gene expression, including
modulation of protein expression.
[0616] In one embodiment, the particle may be epoxide-modified
lipid-polymer, advantageously 7C1 (see, e.g., James E. Dahlman and
Carmen Barnes et al. Nature Nanotechnology (2014) published online
11 May 2014, doi:10.1038/nnano.2014.84). C71 was synthesized by
reacting C15 epoxide-terminated lipids with PEI600 at a 14:1 molar
ratio, and was formulated with C14PEG2000 to produce particles
(diameter between 35 and 60 nm) that were stable in PBS solution
for at least 40 days.
[0617] An epoxide-modified lipid-polymer may be utilized to deliver
the nucleic acid-targeting system of the present invention to
pulmonary, cardiovascular or renal cells, however, one of skill in
the art may adapt the system to deliver to other target organs.
Dosage ranging from about 0.05 to about 0.6 mg/kg are envisioned.
Dosages over several days or weeks are also envisioned, with a
total dosage of about 2 mg/kg.
Exosomes
[0618] Exosomes are endogenous nano-vesicles that transport RNAs
and proteins, and which can deliver RNA to the brain and other
target organs. To reduce immunogenicity, Alvarez-Erviti et al.
(2011, Nat Biotechnol 29: 341) used self-derived dendritic cells
for exosome production. Targeting to the brain was achieved by
engineering the dendritic cells to express Lamp2b, an exosomal
membrane protein, fused to the neuron-specific RVG peptide.
Purified exosomes were loaded with exogenous RNA by
electroporation. Intravenously injected RVG-targeted exosomes
delivered GAPDH siRNA specifically to neurons, microglia,
oligodendrocytes in the brain, resulting in a specific gene
knockdown. Pre-exposure to RVG exosomes did not attenuate
knockdown, and non-specific uptake in other tissues was not
observed. The therapeutic potential of exosome-mediated siRNA
delivery was demonstrated by the strong mRNA (60%) and protein
(62%) knockdown of BACE1, a therapeutic target in Alzheimer's
disease.
[0619] To obtain a pool of immunologically inert exosomes,
Alvarez-Erviti et al. harvested bone marrow from inbred C57BL/6
mice with a homogenous major histocompatibility complex (MHC)
haplotype. As immature dendritic cells produce large quantities of
exosomes devoid of T-cell activators such as MHC-II and CD86,
Alvarez-Erviti et al. selected for dendritic cells with
granulocyte/macrophage-colony stimulating factor (GM-CSF) for 7 d.
Exosomes were purified from the culture supernatant the following
day using well-established ultracentrifugation protocols. The
exosomes produced were physically homogenous, with a size
distribution peaking at 80 nm in diameter as determined by particle
tracking analysis (NTA) and electron microscopy. Alvarez-Erviti et
al. obtained 6-12 .mu.g of exosomes (measured based on protein
concentration) per 10.sup.6 cells.
[0620] Next, Alvarez-Erviti et al. investigated the possibility of
loading modified exosomes with exogenous cargoes using
electroporation protocols adapted for nanoscale applications. As
electroporation for membrane particles at the nanometer scale is
not well-characterized, nonspecific Cy5-labeled RNA was used for
the empirical optimization of the electroporation protocol. The
amount of encapsulated RNA was assayed after ultracentrifugation
and lysis of exosomes. Electroporation at 400 V and 125 .mu.F
resulted in the greatest retention of RNA and was used for all
subsequent experiments.
[0621] Alvarez-Erviti et al. administered 150 .mu.g of each BACE1
siRNA encapsulated in 150 .mu.g of RVG exosomes to normal C57BL/6
mice and compared the knockdown efficiency to four controls:
untreated mice, mice injected with RVG exosomes only, mice injected
with BACE1 siRNA complexed to an in vivo cationic liposome reagent
and mice injected with BACE1 siRNA complexed to RVG-9R, the RVG
peptide conjugated to 9 D-arginines that electrostatically binds to
the siRNA. Cortical tissue samples were analyzed 3 d after
administration and a significant protein knockdown (45%, P<0.05,
versus 62%, P<0.01) in both siRNA-RVG-9R-treated and siRNARVG
exosome-treated mice was observed, resulting from a significant
decrease in BACE1 mRNA levels (66% [+ or -] 15%, P<0.001 and 61%
[+ or -] 13% respectively, P<0.01). Moreover, Applicants
demonstrated a significant decrease (55%, P<0.05) in the total
[beta]-amyloid 1-42 levels, a main component of the amyloid plaques
in Alzheimer's pathology, in the RVG-exosome-treated animals. The
decrease observed was greater than the .beta.-amyloid 1-40 decrease
demonstrated in normal mice after intraventricular injection of
BACE1 inhibitors. Alvarez-Erviti et al. carried out 5'-rapid
amplification of cDNA ends (RACE) on BACE1 cleavage product, which
provided evidence of RNAi-mediated knockdown by the siRNA.
[0622] Finally, Alvarez-Erviti et al. investigated whether RNA-RVG
exosomes induced immune responses in vivo by assessing IL-6, IP-10,
TNF.alpha. and IFN-.alpha. serum concentrations. Following exosome
treatment, nonsignificant changes in all cytokines were registered
similar to siRNA-transfection reagent treatment in contrast to
siRNA-RVG-9R, which potently stimulated 1-6 secretion, confirming
the immunologically inert profile of the exosome treatment. Given
that exosomes encapsulate only 20% of siRNA, delivery with
RVG-exosome appears to be more efficient than RVG-9R delivery as
comparable mRNA knockdown and greater protein knockdown was
achieved with fivefold less siRNA without the corresponding level
of immune stimulation. This experiment demonstrated the therapeutic
potential of RVG-exosome technology, which is potentially suited
for long-term silencing of genes related to neurodegenerative
diseases. The exosome delivery system of Alvarez-Erviti et al. may
be applied to deliver the nucleic acid-targeting system of the
present invention to therapeutic targets, especially
neurodegenerative diseases. A dosage of about 100 to 1000 mg of
nucleic acid-targeting system encapsulated in about 100 to 1000 mg
of RVG exosomes may be contemplated for the present invention.
[0623] El-Andaloussi et al. (Nature Protocols 7, 2112-2126(2012))
discloses how exosomes derived from cultured cells can be harnessed
for delivery of RNA in vitro and in vivo. This protocol first
describes the generation of targeted exosomes through transfection
of an expression vector, comprising an exosomal protein fused with
a peptide ligand. Next, El-Andaloussi et al. explain how to purify
and characterize exosomes from transfected cell supernatant. Next,
El-Andaloussi et al. detail crucial steps for loading RNA into
exosomes. Finally, El-Andaloussi et al. outline how to use exosomes
to efficiently deliver RNA in vitro and in vivo in mouse brain.
Examples of anticipated results in which exosome-mediated RNA
delivery is evaluated by functional assays and imaging are also
provided. The entire protocol takes .about.3 weeks. Delivery or
administration according to the invention may be performed using
exosomes produced from self-derived dendritic cells. From the
herein teachings, this can be employed in the practice of the
invention
[0624] In another embodiment, the plasma exosomes of Wahlgren et
al. (Nucleic Acids Research, 2012, Vol. 40, No. 17 e130) are
contemplated. Exosomes are nano-sized vesicles (30-90 nm in size)
produced by many cell types, including dendritic cells (DC), B
cells, T cells, mast cells, epithelial cells and tumor cells. These
vesicles are formed by inward budding of late endosomes and are
then released to the extracellular environment upon fusion with the
plasma membrane. Because exosomes naturally carry RNA between
cells, this property may be useful in gene therapy, and from this
disclosure can be employed in the practice of the instant
invention.
[0625] Exosomes from plasma can be prepared by centrifugation of
buffy coat at 900g for 20 min to isolate the plasma followed by
harvesting cell supernatants, centrifuging at 300g for 10 min to
eliminate cells and at 16 500g for 30 min followed by filtration
through a 0.22 mm filter. Exosomes are pelleted by
ultracentrifugation at 120 000g for 70 min. Chemical transfection
of siRNA into exosomes is carried out according to the
manufacturer's instructions in RNAi Human/Mouse Starter Kit
(Quiagen, Hilden, Germany). siRNA is added to 100 ml PBS at a final
concentration of 2 mmol/ml. After adding HiPerFect transfection
reagent, the mixture is incubated for 10 min at RT. In order to
remove the excess of micelles, the exosomes are re-isolated using
aldehyde/sulfate latex beads. The chemical transfection of nucleic
acid-targeting system into exosomes may be conducted similarly to
siRNA. The exosomes may be co-cultured with monocytes and
lymphocytes isolated from the peripheral blood of healthy donors.
Therefore, it may be contemplated that exosomes containing nucleic
acid-targeting system may be introduced to monocytes and
lymphocytes of and autologously reintroduced into a human.
Accordingly, delivery or administration according to the invention
may be performed using plasma exosomes.
Liposomes
[0626] Delivery or administration according to the invention can be
performed with liposomes. Liposomes are spherical vesicle
structures composed of a uni- or multilamellar lipid bilayer
surrounding internal aqueous compartments and a relatively
impermeable outer lipophilic phospholipid bilayer. Liposomes have
gained considerable attention as drug delivery carriers because
they are biocompatible, nontoxic, can deliver both hydrophilic and
lipophilic drug molecules, protect their cargo from degradation by
plasma enzymes, and transport their load across biological
membranes and the blood brain barrier (BBB) (see, e.g., Spuch and
Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679, 12
pages, 2011. doi:10.1155/2011/469679 for review).
[0627] Liposomes can be made from several different types of
lipids; however, phospholipids are most commonly used to generate
liposomes as drug carriers. Although liposome formation is
spontaneous when a lipid film is mixed with an aqueous solution, it
can also be expedited by applying force in the form of shaking by
using a homogenizer, sonicator, or an extrusion apparatus (see,
e.g., Spuch and Navarro, Journal of Drug Delivery, vol. 2011,
Article ID 469679, 12 pages, 2011. doi: 10.1155/2011/469679 for
review).
[0628] Several other additives may be added to liposomes in order
to modify their structure and properties. For instance, either
cholesterol or sphingomyelin may be added to the liposomal mixture
in order to help stabilize the liposomal structure and to prevent
the leakage of the liposomal inner cargo. Further, liposomes are
prepared from hydrogenated egg phosphatidylcholine or egg
phosphatidylcholine, cholesterol, and dicetyl phosphate, and their
mean vesicle sizes were adjusted to about 50 and 100 nm. (see,
e.g., Spuch and Navarro, Journal of Drug Delivery, vol. 2011,
Article ID 469679, 12 pages, 2011. doi:10.1155/2011/469679 for
review).
[0629] A liposome formulation may be mainly comprised of natural
phospholipids and lipids such as
1,2-distearoryl-sn-glycero-3-phosphatidyl choline (DSPC),
sphingomyelin, egg phosphatidylcholines and monosialoganglioside.
Since this formulation is made up of phospholipids only, liposomal
formulations have encountered many challenges, one of the ones
being the instability in plasma. Several attempts to overcome these
challenges have been made, specifically in the manipulation of the
lipid membrane. One of these attempts focused on the manipulation
of cholesterol. Addition of cholesterol to conventional
formulations reduces rapid release of the encapsulated bioactive
compound into the plasma or
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE) increases the
stability (see, e.g., Spuch and Navarro, Journal of Drug Delivery,
vol. 2011, Article ID 469679, 12 pages, 2011.
doi:10.1155/2011/469679 for review).
[0630] In a particularly advantageous embodiment, Trojan Horse
liposomes (also known as Molecular Trojan Horses) are desirable and
protocols may be found at
cshprotocols.cshlp.org/content/2010/4/pdb.prot5407.long. These
particles allow delivery of a transgene to the entire brain after
an intravascular injection. Without being bound by limitation, it
is believed that neutral lipid particles with specific antibodies
conjugated to surface allow crossing of the blood brain barrier via
endocytosis. Applicant postulates utilizing Trojan Horse Liposomes
to deliver the CRISPR family of nucleases to the brain via an
intravascular injection, which would allow whole brain transgenic
animals without the need for embryonic manipulation. About 1-5 g of
DNA or RNA may be contemplated for in vivo administration in
liposomes.
[0631] In another embodiment, the nucleic acid-targeting system or
components thereof may be administered in liposomes, such as a
stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et
al., Nature Biotechnology, Vol. 23, No. 8, August 2005). Daily
intravenous injections of about 1, 3 or 5 mg/kg/day of a specific
nucleic acid-targeting system targeted in a SNALP are contemplated.
The daily treatment may be over about three days and then weekly
for about five weeks. In another embodiment, a specific nucleic
acid-targeting system encapsulated SNALP) administered by
intravenous injection to at doses of about 1 or 2.5 mg/kg are also
contemplated (see, e.g., Zimmerman et al., Nature Letters, Vol.
441, 4 May 2006). The SNALP formulation may contain the lipids
3-N-[(wmethoxypoly(ethylene glycol) 2000)
carbamoyl]-1,2-dimyristyloxy-propylamine (PEG-C-DMA),
1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane (DLinDMA),
1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC) and cholesterol,
in a 2:40:10:48 molar percent ratio (see, e.g., Zimmerman et al.,
Nature Letters, Vol. 441, 4 May 2006).
[0632] In another embodiment, stable nucleic-acid-lipid particles
(SNALPs) have proven to be effective delivery molecules to highly
vascularized HepG2-derived liver tumors but not in poorly
vascularized HCT-116 derived liver tumors (see, e.g., Li, Gene
Therapy (2012) 19, 775-780). The SNALP liposomes may be prepared by
formulating D-Lin-DMA and PEG-C-DMA with
distearoylphosphatidylcholine (DSPC), Cholesterol and siRNA using a
25:1 lipid/siRNA ratio and a 48/40/10/2 molar ratio of
Cholesterol/D-Lin-DMA/DSPC/PEG-C-DMA. The resulted SNALP liposomes
are about 80-100 nm in size.
[0633] In yet another embodiment, a SNALP may comprise synthetic
cholesterol (Sigma-Aldrich, St Louis, Mo., USA),
dipalmitoylphosphatidylcholine (Avanti Polar Lipids, Alabaster,
Ala., USA), 3-N-[(w-methoxy poly(ethylene
glycol)2000)carbamoyl]-1,2-dimyrestyloxypropylamine, and cationic
1,2-dilinoleyloxy-3-N,Ndimethylaminopropane (see, e.g., Geisbert et
al., Lancet 2010; 375: 1896-905). A dosage of about 2 mg/kg total
nucleic acid-targeting systemper dose administered as, for example,
a bolus intravenous infusion may be contemplated.
[0634] In yet another embodiment, a SNALP may comprise synthetic
cholesterol (Sigma-Aldrich),
1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC; Avanti Polar
Lipids Inc.), PEG-cDMA, and
1,2-dilinoleyloxy-3-(N;N-dimethyl)aminopropane (DLinDMA) (see,
e.g., Judge, J. Clin. Invest. 119:661-673 (2009)). Formulations
used for in vivo studies may comprise a final lipid/RNA mass ratio
of about 9:1.
[0635] The safety profile of RNAi nanomedicines has been reviewed
by Barros and Gollob of Alnylam Pharmaceuticals (see, e.g.,
Advanced Drug Delivery Reviews 64 (2012) 1730-1737). The stable
nucleic acid lipid particle (SNALP) is comprised of four different
lipids--an ionizable lipid (DLinDMA) that is cationic at low pH, a
neutral helper lipid, cholesterol, and a diffusible polyethylene
glycol (PEG)-lipid. The particle is approximately 80 nm in diameter
and is charge-neutral at physiologic pH. During formulation, the
ionizable lipid serves to condense lipid with the anionic RNA
during particle formation. When positively charged under
increasingly acidic endosomal conditions, the ionizable lipid also
mediates the fusion of SNALP with the endosomal membrane enabling
release of RNA into the cytoplasm. The PEG-lipid stabilizes the
particle and reduces aggregation during formulation, and
subsequently provides a neutral hydrophilic exterior that improves
pharmacokinetic properties.
[0636] To date, two clinical programs have been initiated using
SNALP formulations with RNA. Tekmira Pharmaceuticals recently
completed a phase I single-dose study of SNALP-ApoB in adult
volunteers with elevated LDL cholesterol. ApoB is predominantly
expressed in the liver and jejunum and is essential for the
assembly and secretion of VLDL and LDL. Seventeen subjects received
a single dose of SNALP-ApoB (dose escalation across 7 dose levels).
There was no evidence of liver toxicity (anticipated as the
potential dose-limiting toxicity based on preclinical studies). One
(of two) subjects at the highest dose experienced flu-like symptoms
consistent with immune system stimulation, and the decision was
made to conclude the trial.
[0637] Alnylam Pharmaceuticals has similarly advanced ALN-TTR01,
which employs the SNALP technology described above and targets
hepatocyte production of both mutant and wild-type TTR to treat TTR
amyloidosis (ATTR). Three ATTR syndromes have been described:
familial amyloidotic polyneuropathy (FAP) and familial amyloidotic
cardiomyopathy (FAC)--both caused by autosomal dominant mutations
in TTR; and senile systemic amyloidosis (SSA) cause by wildtype
TTR. A placebo-controlled, single dose-escalation phase I trial of
ALN-TTR01 was recently completed in patients with ATTR. ALN-TTR01
was administered as a 15-minute IV infusion to 31 patients (23 with
study drug and 8 with placebo) within a dose range of 0.01 to 1.0
mg/kg (based on siRNA). Treatment was well tolerated with no
significant increases in liver function tests. Infusion-related
reactions were noted in 3 of 23 patients at .gtoreq.0.4 mg/kg; all
responded to slowing of the infusion rate and all continued on
study. Minimal and transient elevations of serum cytokines IL-6,
IP-10 and IL-1ra were noted in two patients at the highest dose of
1 mg/kg (as anticipated from preclinical and NHP studies). Lowering
of serum TTR, the expected pharmacodynamics effect of ALN-TTR01,
was observed at 1 mg/kg.
[0638] In yet another embodiment, a SNALP may be made by
solubilizing a cationic lipid, DSPC, cholesterol and PEG-lipid
e.g., in ethanol, e.g., at a molar ratio of 40:10:40:10,
respectively (see, Semple et al., Nature Niotechnology, Volume 28
Number 2 Feb. 2010, pp. 172-177). The lipid mixture was added to an
aqueous buffer (50 mM citrate, pH 4) with mixing to a final ethanol
and lipid concentration of 30% (vol/vol) and 6.1 mg/ml,
respectively, and allowed to equilibrate at 22.degree. C. for 2 min
before extrusion. The hydrated lipids were extruded through two
stacked 80 nm pore-sized filters (Nuclepore) at 22.degree. C. using
a Lipex Extruder (Northern Lipids) until a vesicle diameter of
70-90 nm, as determined by dynamic light scattering analysis, was
obtained. This generally required 1-3 passes. The siRNA
(solubilized in a 50 mM citrate, pH 4 aqueous solution containing
30% ethanol) was added to the pre-equilibrated (35.degree. C.)
vesicles at a rate of .about.5 ml/min with mixing. After a final
target siRNA/lipid ratio of 0.06 (wt/wt) was reached, the mixture
was incubated for a further 30 min at 35.degree. C. to allow
vesicle reorganization and encapsulation of the siRNA. The ethanol
was then removed and the external buffer replaced with PBS (155 mM
NaCl, 3 mM Na.sub.2HPO.sub.4, 1 mM KH.sub.2PO.sub.4, pH 7.5) by
either dialysis or tangential flow diafiltration. siRNA were
encapsulated in SNALP using a controlled step-wise dilution method
process. The lipid constituents of KC2-SNALP were DLin-KC2-DMA
(cationic lipid), dipalmitoylphosphatidylcholine (DPPC; Avanti
Polar Lipids), synthetic cholesterol (Sigma) and PEG-C-DMA used at
a molar ratio of 57.1:7.1:34.3:1.4. Upon formation of the loaded
particles, SNALP were dialyzed against PBS and filter sterilized
through a 0.2 .mu.m filter before use. Mean particle sizes were
75-85 nm and 90-95% of the siRNA was encapsulated within the lipid
particles. The final siRNA/lipid ratio in formulations used for in
vivo testing was .about.0.15 (wt/wt). LNP-siRNA systems containing
Factor VII siRNA were diluted to the appropriate concentrations in
sterile PBS immediately before use and the formulations were
administered intravenously through the lateral tail vein in a total
volume of 10 ml/kg. This method and these delivery systems may be
extrapolated to the nucleic acid-targeting system of the present
invention.
Other Lipids
[0639] Other cationic lipids, such as amino lipid
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA)
may be utilized to encapsulate nucleic acid-targeting system or
components thereof or nucleic acid molecule(s) coding therefor
e.g., similar to SiRNA (see, e.g., Jayaraman, Angew. Chem. Int. Ed.
2012, 51, 8529-8533), and hence may be employed in the practice of
the invention. A preformed vesicle with the following lipid
composition may be contemplated: amino lipid,
distearoylphosphatidylcholine (DSPC), cholesterol and
(R)-2,3-bis(octadecyloxy) propyl-1-(methoxy poly(ethylene
glycol)2000)propylcarbamate (PEG-lipid) in the molar ratio
40/10/40/10, respectively, and a FVII siRNA/total lipid ratio of
approximately 0.05 (w/w). To ensure a narrow particle size
distribution in the range of 70-90 nm and a low polydispersity
index of 0.11.+-.0.04 (n=56), the particles may be extruded up to
three times through 80 nm membranes prior to adding the guide RNA.
Particles containing the highly potent amino lipid 16 may be used,
in which the molar ratio of the four lipid components 16, DSPC,
cholesterol and PEG-lipid (50/10/38.5/1.5) which may be further
optimized to enhance in vivo activity.
[0640] Michael S D Kormann et al. ("Expression of therapeutic
proteins after delivery of chemically modified mRNA in mice: Nature
Biotechnology, Volume: 29, Pages: 154-157 (2011)) describes the use
of lipid envelopes to deliver RNA. Use of lipid envelopes is also
preferred in the present invention.
[0641] In another embodiment, lipids may be formulated with the
nucleic acid-targeting system of the present invention or
component(s) thereof or nucleic acid molecule(s) coding therefor to
form lipid nanoparticles (LNPs). Lipids include, but are not
limited to, DLin-KC2-DMA4, C12-200 and colipids
disteroylphosphatidyl choline, cholesterol, and PEG-DMG may be
formulated with RNA-targeting system instead of siRNA (see, e.g.,
Novobrantseva, Molecular Therapy-Nucleic Acids (2012) 1, e4;
doi:10.1038/mtna.2011.3) using a spontaneous vesicle formation
procedure. The component molar ratio may be about 50/10/38.5/1.5
(DLin-KC2-DMA or C12-200/disteroylphosphatidyl
choline/cholesterol/PEG-DMG). The final lipid:siRNA weight ratio
may be .about.12:1 and 9:1 in the case of DLin-KC2-DMA and C12-200
lipid particles (LNPs), respectively. The formulations may have
mean particle diameters of -80 nm with >90% entrapment
efficiency. A 3 mg/kg dose may be contemplated.
[0642] Tekmira has a portfolio of approximately 95 patent families,
in the U.S. and abroad, that are directed to various aspects of
LNPs and LNP formulations (see, e.g., U.S. Pat. Nos. 7,982,027;
7,799,565; 8,058,069; 8,283,333; 7,901,708; 7,745,651; 7,803,397;
8,101,741; 8,188,263; 7,915,399; 8,236,943 and 7,838,658 and
European Pat. Nos 1766035; 1519714; 1781593 and 1664316), all of
which may be used and/or adapted to the present invention.
[0643] The nucleic acid-targetingsystem or components thereof or
nucleic acid molecule(s) coding therefor may be delivered
encapsulated in PLGA Microspheres such as that further described in
US published applications 20130252281 and 20130245107 and
20130244279 (assigned to Moderna Therapeutics) which relate to
aspects of formulation of compositions comprising modified nucleic
acid molecules which may encode a protein, a protein precursor, or
a partially or fully processed form of the protein or a protein
precursor. The formulation may have a molar ratio
50:10:38.5:1.5-3.0 (cationic lipid:fusogenic lipid:cholesterol:PEG
lipid). The PEG lipid may be selected from, but is not limited to
PEG-c-DOMG, PEG-DMG. The fusogenic lipid may be DSPC. See also,
Schrum et al., Delivery and Formulation of Engineered Nucleic
Acids, US published application 20120251618.
[0644] Nanomerics' technology addresses bioavailability challenges
for a broad range of therapeutics, including low molecular weight
hydrophobic drugs, peptides, and nucleic acid based therapeutics
(plasmid, siRNA, miRNA). Specific administration routes for which
the technology has demonstrated clear advantages include the oral
route, transport across the blood-brain-barrier, delivery to solid
tumours, as well as to the eye. See, e.g., Mazza et al., 2013, ACS
Nano. 2013 Feb 26; 7(2):1016-26; Uchegbu and Siew, 2013, J Pharm
Sci. 102(2):305-10 and Lalatsa et al., 2012, J Control Release.
2012 Jul 20; 161(2):523-36.
[0645] US Patent Publication No. 20050019923 describes cationic
dendrimers for delivering bioactive molecules, such as
polynucleotide molecules, peptides and polypeptides and/or
pharmaceutical agents, to a mammalian body. The dendrimers are
suitable for targeting the delivery of the bioactive molecules to,
for example, the liver, spleen, lung, kidney or heart (or even the
brain). Dendrimers are synthetic 3-dimensional macromolecules that
are prepared in a step-wise fashion from simple branched monomer
units, the nature and functionality of which can be easily
controlled and varied. Dendrimers are synthesized from the repeated
addition of building blocks to a multifunctional core (divergent
approach to synthesis), or towards a multifunctional core
(convergent approach to synthesis) and each addition of a
3-dimensional shell of building blocks leads to the formation of a
higher generation of the dendrimers. Polypropylenimine dendrimers
start from a diaminobutane core to which is added twice the number
of amino groups by a double Michael addition of acrylonitrile to
the primary amines followed by the hydrogenation of the nitriles.
This results in a doubling of the amino groups. Polypropylenimine
dendrimers contain 100% protonable nitrogens and up to 64 terminal
amino groups (generation 5, DAB 64). Protonable groups are usually
amine groups which are able to accept protons at neutral pH. The
use of dendrimers as gene delivery agents has largely focused on
the use of the polyamidoamine. and phosphorous containing compounds
with a mixture of amine/amide or N--P(O.sub.2)S as the conjugating
units respectively with no work being reported on the use of the
lower generation polypropylenimine dendrimers for gene delivery.
Polypropylenimine dendrimers have also been studied as pH sensitive
controlled release systems for drug delivery and for their
encapsulation of guest molecules when chemically modified by
peripheral amino acid groups. The cytotoxicity and interaction of
polypropylenimine dendrimers with DNA as well as the transfection
efficacy of DAB 64 has also been studied.
[0646] US Patent Publication No. 20050019923 is based upon the
observation that, contrary to earlier reports, cationic dendrimers,
such as polypropylenimine dendrimers, display suitable properties,
such as specific targeting and low toxicity, for use in the
targeted delivery of bioactive molecules, such as genetic material.
In addition, derivatives of the cationic dendrimer also display
suitable properties for the targeted delivery of bioactive
molecules. See also, Bioactive Polymers, US published application
20080267903, which discloses "Various polymers, including cationic
polyamine polymers and dendrimeric polymers, are shown to possess
anti-proliferative activity, and may therefore be useful for
treatment of disorders characterised by undesirable cellular
proliferation such as neoplasms and tumours, inflammatory disorders
(including autoimmune disorders), psoriasis and atherosclerosis.
The polymers may be used alone as active agents, or as delivery
vehicles for other therapeutic agents, such as drug molecules or
nucleic acids for gene therapy. In such cases, the polymers' own
intrinsic anti-tumour activity may complement the activity of the
agent to be delivered." The disclosures of these patent
publications may be employed in conjunction with herein teachings
for delivery of nucleic acid-targetingsystem(s) or component(s)
thereof or nucleic acid molecule(s) coding therefor.
Supercharged Proteins
[0647] Supercharged proteins are a class of engineered or naturally
occurring proteins with unusually high positive or negative net
theoretical charge and may be employed in delivery of nucleic
acid-targetingsystem(s) or component(s) thereof or nucleic acid
molecule(s) coding therefor. Both supernegatively and
superpositively charged proteins exhibit a remarkable ability to
withstand thermally or chemically induced aggregation.
Superpositively charged proteins are also able to penetrate
mammalian cells. Associating cargo with these proteins, such as
plasmid DNA, RNA, or other proteins, can enable the functional
delivery of these macromolecules into mammalian cells both in vitro
and in vivo. David Liu's lab reported the creation and
characterization of supercharged proteins in 2007 (Lawrence et al.,
2007, Journal of the American Chemical Society 129,
10110-10112).
[0648] The nonviral delivery of RNA and plasmid DNA into mammalian
cells are valuable both for research and therapeutic applications
(Akinc et al., 2010, Nat. Biotech. 26, 561-569). Purified +36 GFP
protein (or other superpositively charged protein) is mixed with
RNAs in the appropriate serum-free media and allowed to complex
prior addition to cells. Inclusion of serum at this stage inhibits
formation of the supercharged protein-RNA complexes and reduces the
effectiveness of the treatment. The following protocol has been
found to be effective for a variety of cell lines (McNaughton et
al., 2009, Proc. Natl. Acad. Sci. USA 106, 6111-6116). However,
pilot experiments varying the dose of protein and RNA should be
performed to optimize the procedure for specific cell lines.
[0649] (1) One day before treatment, plate 1.times.10.sup.5 cells
per well in a 48-well plate.
[0650] (2) On the day of treatment, dilute purified +36 GFP protein
in serumfree media to a final concentration 200 nM. Add RNA to a
final concentration of 50 nM. Vortex to mix and incubate at room
temperature for 10 min.
[0651] (3) During incubation, aspirate media from cells and wash
once with PBS.
[0652] (4) Following incubation of +36 GFP and RNA, add the
protein-RNA complexes to cells.
[0653] (5) Incubate cells with complexes at 37.degree. C. for
4h.
[0654] (6) Following incubation, aspirate the media and wash three
times with 20 U/mL heparin PBS. Incubate cells with
serum-containing media for a further 48 h or longer depending upon
the assay for activity.
[0655] (7) Analyze cells by immunoblot, qPCR, phenotypic assay, or
other appropriate method.
[0656] David Liu's lab has further found +36 GFP to be an effective
plasmid delivery reagent in a range of cells. As plasmid DNA is a
larger cargo than siRNA, proportionately more +36 GFP protein is
required to effectively complex plasmids. For effective plasmid
delivery Applicants have developed a variant of +36 GFP bearing a
C-terminal HA2 peptide tag, a known endosome-disrupting peptide
derived from the influenza virus hemagglutinin protein. The
following protocol has been effective in a variety of cells, but as
above it is advised that plasmid DNA and supercharged protein doses
be optimized for specific cell lines and delivery applications.
[0657] (1) One day before treatment, plate 1.times.10.sup.5 per
well in a 48-well plate.
[0658] (2) On the day of treatment, dilute purified b36 GFP protein
in serumfree media to a final concentration 2 mM. Add 1 mg of
plasmid DNA. Vortex to mix and incubate at room temperature for 10
min.
[0659] (3) During incubation, aspirate media from cells and wash
once with PBS.
[0660] (4) Following incubation of b36 GFP and plasmid DNA, gently
add the protein-DNA complexes to cells.
[0661] (5) Incubate cells with complexes at 37 C for 4h.
[0662] (6) Following incubation, aspirate the media and wash with
PBS. Incubate cells in serum-containing media and incubate for a
further 24-48h.
[0663] (7) Analyze plasmid delivery (e.g., by plasmid-driven gene
expression) as appropriate.
[0664] See also, e.g., McNaughton et al., Proc. Natl. Acad. Sci.
USA 106, 6111-6116 (2009); Cronican et al., ACS Chemical Biology 5,
747-752 (2010); Cronican et al., Chemistry & Biology 18,
833-838 (2011); Thompson et al., Methods in Enzymology 503, 293-319
(2012); Thompson, D. B., et al., Chemistry & Biology 19 (7),
831-843 (2012). The methods of the super charged proteins may be
used and/or adapted for delivery of the nucleic acid-targeting
system of the present invention. These systems of Dr. Lui and
documents herein in conjunction with herein teachings can be
employed in the delivery of nucleic acid-targeting system(s) or
component(s) thereof or nucleic acid molecule(s) coding
therefor.
Cell Penetrating Peptides (CPPs)
[0665] In yet another embodiment, cell penetrating peptides (CPPs)
are contemplated for the delivery of the CRISPR Cas system. CPPs
are short peptides that facilitate cellular uptake of various
molecular cargo (from nanosize particles to small chemical
molecules and large fragments of DNA). The term "cargo" as used
herein includes but is not limited to the group consisting of
therapeutic agents, diagnostic probes, peptides, nucleic acids,
antisense oligonucleotides, plasmids, proteins, particles including
nanoparticles, liposomes, chromophores, small molecules and
radioactive materials. In aspects of the invention, the cargo may
also comprise any component of the CRISPR Cas system or the entire
functional CRISPR Cas system. Aspects of the present invention
further provide methods for delivering a desired cargo into a
subject comprising: (a) preparing a complex comprising the cell
penetrating peptide of the present invention and a desired cargo,
and (b) orally, intraarticularly, intraperitoneally, intrathecally,
intrarterially, intranasally, intraparenchymally, subcutaneously,
intramuscularly, intravenously, dermally, intrarectally, or
topically administering the complex to a subject. The cargo is
associated with the peptides either through chemical linkage via
covalent bonds or through non-covalent interactions.
[0666] The function of the CPPs are to deliver the cargo into
cells, a process that commonly occurs through endocytosis with the
cargo delivered to the endosomes of living mammalian cells.
Cell-penetrating peptides are of different sizes, amino acid
sequences, and charges but all CPPs have one distinct
characteristic, which is the ability to translocate the plasma
membrane and facilitate the delivery of various molecular cargoes
to the cytoplasm or an organelle. CPP translocation may be
classified into three main entry mechanisms: direct penetration in
the membrane, endocytosis-mediated entry, and translocation through
the formation of a transitory structure. CPPs have found numerous
applications in medicine as drug delivery agents in the treatment
of different diseases including cancer and virus inhibitors, as
well as contrast agents for cell labeling. Examples of the latter
include acting as a carrier for GFP, MRI contrast agents, or
quantum dots. CPPs hold great potential as in vitro and in vivo
delivery vectors for use in research and medicine. CPPs typically
have an amino acid composition that either contains a high relative
abundance of positively charged amino acids such as lysine or
arginine or has sequences that contain an alternating pattern of
polar/charged amino acids and non-polar, hydrophobic amino acids.
These two types of structures are referred to as polycationic or
amphipathic, respectively. A third class of CPPs are the
hydrophobic peptides, containing only apolar residues, with low net
charge or have hydrophobic amino acid groups that are crucial for
cellular uptake. One of the initial CPPs discovered was the
trans-activating transcriptional activator (Tat) from Human
Immunodeficiency Virus 1 (HIV-1) which was found to be efficiently
taken up from the surrounding media by numerous cell types in
culture. Since then, the number of known CPPs has expanded
considerably and small molecule synthetic analogues with more
effective protein transduction properties have been generated. CPPs
include but are not limited to Penetratin, Tat (48-60),
Transportan, and ((R-AhX-R)4) (Ahx=aminohexanoyl) (SEQ ID NO:
23).
[0667] U.S. Pat. No. 8,372,951, provides a CPP derived from
eosinophil cationic protein (ECP) which exhibits highly
cell-penetrating efficiency and low toxicity. Aspects of delivering
the CPP with its cargo into a vertebrate subject are also provided.
Further aspects of CPPs and their delivery are described in U.S.
Pat. No. 8,575,305; 8; 614,194 and 8,044,019. CPPs can be used to
deliver the CRISPR-Cas system or components thereof. That CPPs can
be employed to deliver the CRISPR-Cas system or components thereof
is also provided in the manuscript "Gene disruption by
cell-penetrating peptide-mediated delivery of Cas9 protein and
guide RNA", by Suresh Ramakrishna, Abu-Bonsrah Kwaku Dad, Jagadish
Beloor, et al. Genome Res. 2014 Apr 2. [Epub ahead of print],
incorporated by reference in its entirety, wherein it is
demonstrated that treatment with CPP-conjugated recombinant Cas9
protein and CPP-complexed guide RNAs lead to endogenous gene
disruptions in human cell lines. In the paper the Cas9 protein was
conjugated to CPP via a thioether bond, whereas the guide RNA was
complexed with CPP, forming condensed, positively charged
particles. It was shown that simultaneous and sequential treatment
of human cells, including embryonic stem cells, dermal fibroblasts,
HEK293T cells, HeLa cells, and embryonic carcinoma cells, with the
modified Cas9 and guide RNA led to efficient gene disruptions with
reduced off-target mutations relative to plasmid transfections.
Implantable Devices
[0668] In another embodiment, implantable devices are also
contemplated for delivery of the nucleic acid-targeting system or
component(s) thereof or nucleic acid molecule(s) coding therefor.
For example, US Patent Publication 20110195123 discloses an
implantable medical device which elutes a drug locally and in
prolonged period is provided, including several types of such a
device, the treatment modes of implementation and methods of
implantation. The device comprising of polymeric substrate, such as
a matrix for example, that is used as the device body, and drugs,
and in some cases additional scaffolding materials, such as metals
or additional polymers, and materials to enhance visibility and
imaging. An implantable delivery device can be advantageous in
providing release locally and over a prolonged period, where drug
is released directly to the extracellular matrix (ECM) of the
diseased area such as tumor, inflammation, degeneration or for
symptomatic objectives, or to injured smooth muscle cells, or for
prevention. One kind of drug is RNA, as disclosed above, and this
system may be used/and or adapted to the nucleic acid-targeting
system of the present invention. The modes of implantation in some
embodiments are existing implantation procedures that are developed
and used today for other treatments, including brachytherapy and
needle biopsy. In such cases the dimensions of the new implant
described in this invention are similar to the original implant.
Typically a few devices are implanted during the same treatment
procedure.
[0669] US Patent Publication 20110195123, provides a drug delivery
implantable or insertable system, including systems applicable to a
cavity such as the abdominal cavity and/or any other type of
administration in which the drug delivery system is not anchored or
attached, comprising a biostable and/or degradable and/or
bioabsorbable polymeric substrate, which may for example optionally
be a matrix. It should be noted that the term "insertion" also
includes implantation. The drug delivery system is preferably
implemented as a "Loder" as described in US Patent Publication
20110195123.
[0670] The polymer or plurality of polymers are biocompatible,
incorporating an agent and/or plurality of agents, enabling the
release of agent at a controlled rate, wherein the total volume of
the polymeric substrate, such as a matrix for example, in some
embodiments is optionally and preferably no greater than a maximum
volume that permits a therapeutic level of the agent to be reached.
As a non-limiting example, such a volume is preferably within the
range of 0.1 m.sup.3 to 1000 mm.sup.3, as required by the volume
for the agent load. The Loder may optionally be larger, for example
when incorporated with a device whose size is determined by
functionality, for example and without limitation, a knee joint, an
intra-uterine or cervical ring and the like.
[0671] The drug delivery system (for delivering the composition) is
designed in some embodiments to preferably employ degradable
polymers, wherein the main release mechanism is bulk erosion; or in
some embodiments, non degradable, or slowly degraded polymers are
used, wherein the main release mechanism is diffusion rather than
bulk erosion, so that the outer part functions as membrane, and its
internal part functions as a drug reservoir, which practically is
not affected by the surroundings for an extended period (for
example from about a week to about a few months). Combinations of
different polymers with different release mechanisms may also
optionally be used. The concentration gradient at the surface is
preferably maintained effectively constant during a significant
period of the total drug releasing period, and therefore the
diffusion rate is effectively constant (termed "zero mode"
diffusion). By the term "constant" it is meant a diffusion rate
that is preferably maintained above the lower threshold of
therapeutic effectiveness, but which may still optionally feature
an initial burst and/or may fluctuate, for example increasing and
decreasing to a certain degree. The diffusion rate is preferably so
maintained for a prolonged period, and it can be considered
constant to a certain level to optimize the therapeutically
effective period, for example the effective silencing period.
[0672] The drug delivery system optionally and preferably is
designed to shield the nucleotide based therapeutic agent from
degradation, whether chemical in nature or due to attack from
enzymes and other factors in the body of the subject.
[0673] The drug delivery system of US Patent Publication
20110195123 is optionally associated with sensing and/or activation
appliances that are operated at and/or after implantation of the
device, by non and/or minimally invasive methods of activation
and/or acceleration/deceleration, for example optionally including
but not limited to thermal heating and cooling, laser beams, and
ultrasonic, including focused ultrasound and/or RF (radiofrequency)
methods or devices.
[0674] According to some embodiments of US Patent Publication
20110195123, the site for local delivery may optionally include
target sites characterized by high abnormal proliferation of cells,
and suppressed apoptosis, including tumors, active and or chronic
inflammation and infection including autoimmune diseases states,
degenerating tissue including muscle and nervous tissue, chronic
pain, degenerative sites, and location of bone fractures and other
wound locations for enhancement of regeneration of tissue, and
injured cardiac, smooth and striated muscle.
[0675] The site for implantation of the composition, or target
site, preferably features a radius, area and/or volume that is
sufficiently small for targeted local delivery. For example, the
target site optionally has a diameter in a range of from about 0.1
mm to about 5 cm.
[0676] The location of the target site is preferably selected for
maximum therapeutic efficacy. For example, the composition of the
drug delivery system (optionally with a device for implantation as
described above) is optionally and preferably implanted within or
in the proximity of a tumor environment, or the blood supply
associated thereof.
[0677] For example the composition (optionally with the device) is
optionally implanted within or in the proximity to pancreas,
prostate, breast, liver, via the nipple, within the vascular system
and so forth.
[0678] The target location is optionally selected from the group
comprising, consisting essentially of, or consisting of (as
non-limiting examples only, as optionally any site within the body
may be suitable for implanting a Loder): 1. brain at degenerative
sites like in Parkinson or Alzheimer disease at the basal ganglia,
white and gray matter; 2. spine as in the case of amyotrophic
lateral sclerosis (ALS); 3. uterine cervix to prevent HPV
infection; 4. active and chronic inflammatory joints; 5. dermis as
in the case of psoriasis; 6. sympathetic and sensoric nervous sites
for analgesic effect; 7. Intra osseous implantation; 8. acute and
chronic infection sites; 9. Intra vaginal; 10. Inner ear-auditory
system, labyrinth of the inner ear, vestibular system; 11. Intra
tracheal; 12. Intra-cardiac; coronary, epicardiac; 13. urinary
bladder; 14. biliary system; 15. parenchymal tissue including and
not limited to the kidney, liver, spleen; 16. lymph nodes; 17.
salivary glands; 18. dental gums; 19. Intra-articular (into
joints); 20. Intra-ocular; 21. Brain tissue; 22. Brain ventricles;
23. Cavities, including abdominal cavity (for example but without
limitation, for ovary cancer); 24. Intra esophageal and 25. Intra
rectal.
[0679] Optionally insertion of the system (for example a device
containing the composition) is associated with injection of
material to the ECM at the target site and the vicinity of that
site to affect local pH and/or temperature and/or other biological
factors affecting the diffusion of the drug and/or drug kinetics in
the ECM, of the target site and the vicinity of such a site.
[0680] Optionally, according to some embodiments, the release of
said agent could be associated with sensing and/or activation
appliances that are operated prior and/or at and/or after
insertion, by non and/or minimally invasive and/or else methods of
activation and/or acceleration/deceleration, including laser beam,
radiation, thermal heating and cooling, and ultrasonic, including
focused ultrasound and/or RF (radiofrequency) methods or devices,
and chemical activators.
[0681] According to other embodiments of U.S. Patent Publication
20110195123, the drug preferably comprises a RNA, for example for
localized cancer cases in breast, pancreas, brain, kidney, bladder,
lung, and prostate as described below. Although exemplified with
RNAi, many drugs are applicable to be encapsulated in Loder, and
can be used in association with this invention, as long as such
drugs can be encapsulated with the Loder substrate, such as a
matrix for example, and this system may be used and/or adapted to
deliver the nucleic acid-targeting system of the present
invention.
[0682] As another example of a specific application, neuro and
muscular degenerative diseases develop due to abnormal gene
expression. Local delivery of RNAs may have therapeutic properties
for interfering with such abnormal gene expression. Local delivery
of anti apoptotic, anti inflammatory and anti degenerative drugs
including small drugs and macromolecules may also optionally be
therapeutic. In such cases the Loder is applied for prolonged
release at constant rate and/or through a dedicated device that is
implanted separately. All of this may be used and/or adapted to the
nucleic acid-targeting system of the present invention.
[0683] As yet another example of a specific application,
psychiatric and cognitive disorders are treated with gene
modifiers. Gene knockdown is a treatment option. Loders locally
delivering agents to central nervous system sites are therapeutic
options for psychiatric and cognitive disorders including but not
limited to psychosis, bi-polar diseases, neurotic disorders and
behavioral maladies. The Loders could also deliver locally drugs
including small drugs and macromolecules upon implantation at
specific brain sites. All of this may be used and/or adapted to the
nucleic acid-targeting system of the present invention.
[0684] As another example of a specific application, silencing of
innate and/or adaptive immune mediators at local sites enables the
prevention of organ transplant rejection. Local delivery of RNAs
and immunomodulating reagents with the Loder implanted into the
transplanted organ and/or the implanted site renders local immune
suppression by repelling immune cells such as CD8 activated against
the transplanted organ. All of this may be used/and or adapted to
the nucleic acid-targeting system of the present invention.
[0685] As another example of a specific application, vascular
growth factors including VEGFs and angiogenin and others are
essential for neovascularization. Local delivery of the factors,
peptides, peptidomimetics, or suppressing their repressors is an
important therapeutic modality; silencing the repressors and local
delivery of the factors, peptides, macromolecules and small drugs
stimulating angiogenesis with the Loder is therapeutic for
peripheral, systemic and cardiac vascular disease.
[0686] The method of insertion, such as implantation, may
optionally already be used for other types of tissue implantation
and/or for insertions and/or for sampling tissues, optionally
without modifications, or alternatively optionally only with
non-major modifications in such methods. Such methods optionally
include but are not limited to brachytherapy methods, biopsy,
endoscopy with and/or without ultrasound, such as ERCP,
stereotactic methods into the brain tissue, Laparoscopy, including
implantation with a laparoscope into joints, abdominal organs, the
bladder wall and body cavities.
[0687] Implantable device technology herein discussed can be
employed with herein teachings and hence by this disclosure and the
knowledge in the art, CRISPR-Cas system or components thereof or
nucleic acid molecules thereof or encoding or providing components
may be delivered via an implantable device.
Patient-Specific Screening Methods
[0688] A nucleic acid-targeting system that targets RNA, e.g.,
trinucleotide repeats can be used to screen patients or patent
samples for the presence of such repeats. The repeats can be the
target of the RNA of the nucleic acid-targeting system, and if
there is binding thereto by the nucleic acid-targeting system, that
binding can be detected, to thereby indicate that such a repeat is
present. Thus, a nucleic acid-targeting system can be used to
screen patients or patient samples for the presence of the repeat.
The patient can then be administered suitable compound(s) to
address the condition; or, can be administered a nucleic
acid-targeting system to bind to and cause insertion, deletion or
mutation and alleviate the condition.
[0689] The invention uses nucleic acids to bind target RNA
sequences.
CRISPR Effector Protein mRNA and Guide RNA
[0690] CRISPR effector protein mRNA and guide RNA might also be
delivered separately. CRISPR effector protein mRNA can be delivered
prior to the guide RNA to give time for CRISPR effector protein to
be expressed. CRISPR effector protein mRNA might be administered
1-12 hours (preferably around 2-6 hours) prior to the
administration of guide RNA.
[0691] Alternatively, CRISPR effector protein mRNA and guide RNA
can be administered together. Advantageously, a second booster dose
of guide RNA can be administered 1-12 hours (preferably around 2-6
hours) after the initial administration of CRISPR effector protein
mRNA+guide RNA.
[0692] The CRISPR effector protein of the present invention, i.e. a
C2c2 effector protein is sometimes referred to herein as a CRISPR
Enzyme. It will be appreciated that the effector protein is based
on or derived from an enzyme, so the term `effector protein`
certainly includes `enzyme` in some embodiments. However, it will
also be appreciated that the effector protein may, as required in
some embodiments, have DNA or RNA binding, but not necessarily
cutting or nicking, activity, including a dead-Cas effector protein
function.
[0693] Additional administrations of CRISPR effector protein mRNA
and/or guide RNA might be useful to achieve the most efficient
levels of genome modification. In some embodiments, phenotypic
alteration is preferably the result of genome modification when a
genetic disease is targeted, especially in methods of therapy and
preferably where a repair template is provided to correct or alter
the phenotype.
[0694] In some embodiments diseases that may be targeted include
those concerned with disease-causing splice defects.
[0695] In some embodiments, cellular targets include Hemopoietic
Stem/Progenitor Cells (CD34+); Human T cells; and Eye (retinal
cells)--for example photoreceptor precursor cells.
[0696] In some embodiments Gene targets include: Human Beta
Globin--HBB (for treating Sickle Cell Anemia, including by
stimulating gene-conversion (using closely related HBD gene as an
endogenous template)); CD3 (T-Cells); and CEP920-retina (eye).
[0697] In some embodiments disease targets also include: cancer;
Sickle Cell Anemia (based on a point mutation); HIV;
Beta-Thalassemia; and ophthalmic or ocular disease--for example
Leber Congenital Amaurosis (LCA)-causing Splice Defect.
[0698] In some embodiments delivery methods include: Cationic Lipid
Mediated "direct" delivery of Enzyme-Guide complex
(RiboNucleoProtein) and electroporation of plasmid DNA.
[0699] Inventive methods can further comprise delivery of
templates, such as repair templates, which may be dsODN or ssODN,
see below. Delivery of templates may be via the cotemporaneous or
separate from delivery of any or all the CRISPR effector protein or
guide and via the same delivery mechanism or different. In some
embodiments, it is preferred that the template is delivered
together with the guide, and, preferably, also the CRISPR effector
protein. An example may be an AAV vector.
[0700] Inventive methods can further comprise: (a) delivering to
the cell a double-stranded oligodeoxynucleotide (dsODN) comprising
overhangs complimentary to the overhangs created by said double
strand break, wherein said dsODN is integrated into the locus of
interest; or--(b) delivering to the cell a single-stranded
oligodeoxynucleotide (ssODN), wherein said ssODN acts as a template
for homology directed repair of said double strand break. Inventive
methods can be for the prevention or treatment of disease in an
individual, optionally wherein said disease is caused by a defect
in said locus of interest. Inventive methods can be conducted in
vivo in the individual or ex vivo on a cell taken from the
individual, optionally wherein said cell is returned to the
individual.
[0701] For minimization of toxicity and off-target effect, it will
be important to control the concentration of CRISPR effector
protein mRNA and guide RNA delivered. Optimal concentrations of
CRISPR effector protein mRNA and guide RNA can be determined by
testing different concentrations in a cellular or animal model and
using deep sequencing the analyze the extent of modification at
potential off-target genomic loci. For example, for the guide
sequence targeting 5'-GAGTCCGAGCAGAAGAAGAA-3' (SEQ ID NO: 24) in
the EMX1 gene of the human genome, deep sequencing can be used to
assess the level of modification at the following two off-target
loci, 1: 5'-GAGTCCTAGCAGGAGAAGAA-3' (SEQ ID NO: 25) and 2:
5'-GAGTCTAAGCAGAAGAAGAA-3' (SEQ ID NO: 26). The concentration that
gives the highest level of on-target modification while minimizing
the level of off-target modification should be chosen for in vivo
delivery.
Inducible Systems
[0702] In some embodiments, a CRISPR effector protein may form a
component of an inducible system. The inducible nature of the
system would allow for spatiotemporal control of gene editing or
gene expression using a form of energy. The form of energy may
include but is not limited to electromagnetic radiation, sound
energy, chemical energy and thermal energy. Examples of inducible
system include tetracycline inducible promoters (Tet-On or
Tet-Off), small molecule two-hybrid transcription activations
systems (FKBP, ABA, etc), or light inducible systems (Phytochrome,
LOV domains, or cryptochrome). In one embodiment, the CRISPR
effector protein may be a part of a Light Inducible Transcriptional
Effector (LITE) to direct changes in transcriptional activity in a
sequence-specific manner. The components of a light may include a
CRISPR effector protein, a light-responsive cytochrome heterodimer
(e.g. from Arabidopsis thaliana), and a transcriptional
activation/repression domain. Further examples of inducible DNA
binding proteins and methods for their use are provided in U.S.
61/736,465 and U.S. 61/721,283,and WO 2014018423 A2 which is hereby
incorporated by reference in its entirety.
Exemplary Methods of Using of CRISPR Cas System
[0703] The invention provides a non-naturally occurring or
engineered composition, or one or more polynucleotides encoding
components of said composition, or vector or delivery systems
comprising one or more polynucleotides encoding components of said
composition for use in a modifying a target cell in vivo, ex vivo
or in vitro and, may be conducted in a manner alters the cell such
that once modified the progeny or cell line of the CRISPR modified
cell retains the altered phenotype. The modified cells and progeny
may be part of a multi-cellular organism such as a plant or animal
with ex vivo or in vivo application of CRISPR system to desired
cell types. The CRISPR invention may be a therapeutic method of
treatment. The therapeutic method of treatment may comprise gene or
genome editing, or gene therapy.
Modifying a Target with CRISPR Cas System or Complex (e.g.,
C2c2-RNA Complex)
[0704] In one aspect, the invention provides for methods of
modifying a target polynucleotide in a eukaryotic cell, which may
be in vivo, ex vivo or in vitro. In some embodiments, the method
comprises sampling a cell or population of cells from a human or
non-human animal, and modifying the cell or cells. Culturing may
occur at any stage ex vivo. The cell or cells may even be
re-introduced into the non-human animal or plant. For re-introduced
cells it is particularly preferred that the cells are stem
cells.
[0705] In some embodiments, the method comprises allowing a CRISPR
complex to bind to the target polynucleotide to effect cleavage of
said target polynucleotide thereby modifying the target
polynucleotide, wherein the CRISPR complex comprises a CRISPR
effector protein complexed with a guide sequence hybridized or
hybridizable to a target sequence within said target
polynucleotide.
[0706] In one aspect, the invention provides a method of modifying
expression of a polynucleotide in a eukaryotic cell. In some
embodiments, the method comprises allowing a CRISPR complex to bind
to the polynucleotide such that said binding results in increased
or decreased expression of said polynucleotide; wherein the CRISPR
complex comprises a CRISPR effector protein complexed with a guide
sequence hybridized or hybridizable to a target sequence within
said polynucleotide. Similar considerations and conditions apply as
above for methods of modifying a target polynucleotide. In fact,
these sampling, culturing and re-introduction options apply across
the aspects of the present invention.
[0707] Indeed, in any aspect of the invention, the CRISPR complex
may comprise a CRISPR effector protein complexed with a guide
sequence hybridized or hybridizable to a target sequence. Similar
considerations and conditions apply as above for methods of
modifying a target polynucleotide.
[0708] Thus in any of the non-naturally-occurring CRISPR effector
proteins described herein comprise at least one modification and
whereby the effector protein has certain improved capabilities. In
particular, any of the effector proteins are capable of forming a
CRISPR complex with a guide RNA. When such a complex forms, the
guide RNA is capable of binding to a target polynucleotide sequence
and the effector protein is capable of modifying a target locus. In
addition, the effector protein in the CRISPR complex has reduced
capability of modifying one or more off-target loci as compared to
an unmodified enzyme/effector protein.
[0709] In addition, the modified CRISPR enzymes described herein
encompass enzymes whereby in the CRISPR complex the effector
protein has increased capability of modifying the one or more
target loci as compared to an unmodified enzyme/effector protein.
Such function may be provided separate to or provided in
combination with the above-described function of reduced capability
of modifying one or more off-target loci. Any such effector
proteins may be provided with any of the further modifications to
the CRISPR effector protein as described herein, such as in
combination with any activity provided by one or more associated
heterologous functional domains, any further mutations to reduce
nuclease activity and the like.
[0710] In advantageous embodiments of the invention, the modified
CRISPR effector protein is provided with reduced capability of
modifying one or more off-target loci as compared to an unmodified
enzyme/effector protein and increased capability of modifying the
one or more target loci as compared to an unmodified
enzyme/effector protein. In combination with further modifications
to the effector protein, significantly enhanced specificity may be
achieved. For example, combination of such advantageous embodiments
with one or more additional mutations is provided wherein the one
or more additional mutations are in one or more catalytically
active domains. In such effector proteins, enhanced specificity may
be achieved due to an improved specificity in terms of effector
protein activity.
[0711] Modifications to reduce off-target effects and/or enhance
on-target effects as described above may be made to amino acid
residues located in a positively-charged region/groove situated
between the RuvC-III and HNH domains. It will be appreciated that
any of the functional effects described above may be achieved by
modification of amino acids within the aforementioned groove but
also by modification of amino acids adjacent to or outside of that
groove.
[0712] Additional functionalities which may be engineered into
modified CRISPR effector proteins as described herein include the
following. 1. modified CRISPR effector proteins that disrupt
DNA:protein interactions without affecting protein tertiary or
secondary structure. This includes residues that contact any part
of the RNA:DNA duplex. 2. modified CRISPR effector proteins that
weaken intra-protein interactions holding C2c2 in conformation
essential for nuclease cutting in response to DNA binding (on or
off target). For example: a modification that mildly inhibits, but
still allows, the nuclease conformation of the HNH domain
(positioned at the scissile phosphate). 3. modified CRISPR effector
proteins that strengthen intra-protein interactions holding C2c2 in
a conformation inhibiting nuclease activity in response to DNA
binding (on or off targets). For example: a modification that
stabilizes the HNH domain in a conformation away from the scissile
phosphate. Any such additional functional enhancement may be
provided in combination with any other modification to the CRISPR
effector protein as described in detail elsewhere herein.
[0713] Any of the herein described improved functionalities may be
made to any CRISPR effector protein, such as a C2c2 effector
protein. However, it will be appreciated that any of the
functionalities described herein may be engineered into C2c2
effector proteins from other orthologs, including chimeric effector
proteins comprising fragments from multiple orthologs.
[0714] The invention uses nucleic acids to bind target DNA
sequences. This is advantageous as nucleic acids are much easier
and cheaper to produce than proteins, and the specificity can be
varied according to the length of the stretch where homology is
sought. Complex 3-D positioning of multiple fingers, for example is
not required. The terms "polynucleotide", "nucleotide", "nucleotide
sequence", "nucleic acid" and "oligonucleotide" are used
interchangeably. They refer to a polymeric form of nucleotides of
any length, either deoxyribonucleotides or ribonucleotides, or
analogs thereof. Polynucleotides may have any three dimensional
structure, and may perform any function, known or unknown. The
following are non-limiting examples of polynucleotides: coding or
non-coding regions of a gene or gene fragment, loci (locus) defined
from linkage analysis, exons, introns, messenger RNA (mRNA),
transfer RNA, ribosomal RNA, short interfering RNA (siRNA),
short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA,
recombinant polynucleotides, branched polynucleotides, plasmids,
vectors, isolated DNA of any sequence, isolated RNA of any
sequence, nucleic acid probes, and primers. The term also
encompasses nucleic-acid-like structures with synthetic backbones,
see, e.g., Eckstein, 1991; Baserga et al., 1992; Milligan, 1993; WO
97/03211; WO 96/39154; Mata, 1997; Strauss-Soukup, 1997; and
Samstag, 1996. A polynucleotide may comprise one or more modified
nucleotides, such as methylated nucleotides and nucleotide analogs.
If present, modifications to the nucleotide structure may be
imparted before or after assembly of the polymer. The sequence of
nucleotides may be interrupted by non-nucleotide components. A
polynucleotide may be further modified after polymerization, such
as by conjugation with a labeling component. As used herein the
term "wild type" is a term of the art understood by skilled persons
and means the typical form of an organism, strain, gene or
characteristic as it occurs in nature as distinguished from mutant
or variant forms. A "wild type" can be a base line. As used herein
the term "variant" should be taken to mean the exhibition of
qualities that have a pattern that deviates from what occurs in
nature. The terms "non-naturally occurring" or "engineered" are
used interchangeably and indicate the involvement of the hand of
man. The terms, when referring to nucleic acid molecules or
polypeptides mean that the nucleic acid molecule or the polypeptide
is at least substantially free from at least one other component
with which they are naturally associated in nature and as found in
nature. "Complementarity" refers to the ability of a nucleic acid
to form hydrogen bond(s) with another nucleic acid sequence by
either traditional Watson-Crick base pairing or other
non-traditional types. A percent complementarity indicates the
percentage of residues in a nucleic acid molecule which can form
hydrogen bonds (e.g., Watson-Crick base pairing) with a second
nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%,
60%, 70%, 80%, 90%, and 100% complementary). "Perfectly
complementary" means that all the contiguous residues of a nucleic
acid sequence will hydrogen bond with the same number of contiguous
residues in a second nucleic acid sequence. "Substantially
complementary" as used herein refers to a degree of complementarity
that is at least 60%/a, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%,
98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more
nucleotides, or refers to two nucleic acids that hybridize under
stringent conditions. As used herein, "stringent conditions" for
hybridization refer to conditions under which a nucleic acid having
complementarity to a target sequence predominantly hybridizes with
the target sequence, and substantially does not hybridize to
non-target sequences. Stringent conditions are generally
sequence-dependent, and vary depending on a number of factors. In
general, the longer the sequence, the higher the temperature at
which the sequence specifically hybridizes to its target sequence.
Non-limiting examples of stringent conditions are described in
detail in Tijssen (1993), Laboratory Techniques In Biochemistry And
Molecular Biology-Hybridization With Nucleic Acid Probes Part I,
Second Chapter "Overview of principles of hybridization and the
strategy of nucleic acid probe assay", Elsevier, N.Y. Where
reference is made to a polynucleotide sequence, then complementary
or partially complementary sequences are also envisaged. These are
preferably capable of hybridizing to the reference sequence under
highly stringent conditions. Generally, in order to maximize the
hybridization rate, relatively low-stringency hybridization
conditions are selected: about 20 to 25.degree. C. lower than the
thermal melting point (T.sub.m). The T.sub.m is the temperature at
which 50% of specific target sequence hybridizes to a perfectly
complementary probe in solution at a defined ionic strength and pH.
Generally, in order to require at least about 85% nucleotide
complementarity of hybridized sequences, highly stringent washing
conditions are selected to be about 5 to 150 C lower than the
T.sub.m. In order to require at least about 70% nucleotide
complementarity of hybridized sequences, moderately-stringent
washing conditions are selected to be about 15 to 300 C lower than
the T.sub.m. Highly permissive (very low stringency) washing
conditions may be as low as 50.degree. C. below the T.sub.m,
allowing a high level of mis-matching between hybridized sequences.
Those skilled in the art will recognize that other physical and
chemical parameters in the hybridization and wash stages can also
be altered to affect the outcome of a detectable hybridization
signal from a specific level of homology between target and probe
sequences. Preferred highly stringent conditions comprise
incubation in 50% formamide, 5.times.SSC, and 1% SDS at 42.degree.
C., or incubation in 5.times.SSC and 1% SDS at 65.degree. C., with
wash in 0.2.times.SSC and 0.1% SDS at 65.degree. C. "Hybridization"
refers to a reaction in which one or more polynucleotides react to
form a complex that is stabilized via hydrogen bonding between the
bases of the nucleotide residues. The hydrogen bonding may occur by
Watson Crick base pairing, Hoogstein binding, or in any other
sequence specific manner. The complex may comprise two strands
forming a duplex structure, three or more strands forming a multi
stranded complex, a single self-hybridizing strand, or any
combination of these. A hybridization reaction may constitute a
step in a more extensive process, such as the initiation of PCR, or
the cleavage of a polynucleotide by an enzyme. A sequence capable
of hybridizing with a given sequence is referred to as the
"complement" of the given sequence. As used herein, the term
"genomic locus" or "locus" (plural loci) is the specific location
of a gene or DNA sequence on a chromosome. A "gene" refers to
stretches of DNA or RNA that encode a polypeptide or an RNA chain
that has functional role to play in an organism and hence is the
molecular unit of heredity in living organisms. For the purpose of
this invention it may be considered that genes include regions
which regulate the production of the gene product, whether or not
such regulatory sequences are adjacent to coding and/or transcribed
sequences. Accordingly, a gene includes, but is not necessarily
limited to, promoter sequences, terminators, translational
regulatory sequences such as ribosome binding sites and internal
ribosome entry sites, enhancers, silencers, insulators, boundary
elements, replication origins, matrix attachment sites and locus
control regions. As used herein, "expression of a genomic locus" or
"gene expression" is the process by which information from a gene
is used in the synthesis of a functional gene product. The products
of gene expression are often proteins, but in non-protein coding
genes such as rRNA genes or tRNA genes, the product is functional
RNA. The process of gene expression is used by all known
life--eukaryotes (including multicellular organisms), prokaryotes
(bacteria and archaea) and viruses to generate functional products
to survive. As used herein "expression" of a gene or nucleic acid
encompasses not only cellular gene expression, but also the
transcription and translation of nucleic acid(s) in cloning systems
and in any other context. As used herein, "expression" also refers
to the process by which a polynucleotide is transcribed from a DNA
template (such as into and mRNA or other RNA transcript) and/or the
process by which a transcribed mRNA is subsequently translated into
peptides, polypeptides, or proteins. Transcripts and encoded
polypeptides may be collectively referred to as "gene product." If
the polynucleotide is derived from genomic DNA, expression may
include splicing of the mRNA in a eukaryotic cell. The terms
"polypeptide", "peptide" and "protein" are used interchangeably
herein to refer to polymers of amino acids of any length. The
polymer may be linear or branched, it may comprise modified amino
acids, and it may be interrupted by non-amino acids. The terms also
encompass an amino acid polymer that has been modified; for
example, disulfide bond formation, glycosylation, lipidation,
acetylation, phosphorylation, or any other manipulation, such as
conjugation with a labeling component. As used herein the term
"amino acid" includes natural and/or unnatural or synthetic amino
acids, including glycine and both the D or L optical isomers, and
amino acid analogs and peptidomimetics. As used herein, the term
"domain" or "protein domain" refers to a part of a protein sequence
that may exist and function independently of the rest of the
protein chain. As described in aspects of the invention, sequence
identity is related to sequence homology. Homology comparisons may
be conducted by eye, or more usually, with the aid of readily
available sequence comparison programs. These commercially
available computer programs may calculate percent (%) homology
between two or more sequences and may also calculate the sequence
identity shared by two or more amino acid or nucleic acid
sequences.
[0715] In aspects of the invention the term "guide RNA", refers to
the polynucleotide sequence comprising one or more of a putative or
identified tracr sequence and a putative or identified crRNA
sequence or guide sequence. In particular embodiments, the "guide
RNA" comprises a putative or identified crRNA sequence or guide
sequence. In further embodiments, the guide RNA does not comprise a
putative or identified tracr sequence.
[0716] As used herein the term "wild type" is a term of the art
understood by skilled persons and means the typical form of an
organism, strain, gene or characteristic as it occurs in nature as
distinguished from mutant or variant forms. A "wild type" can be a
base line.
[0717] As used herein the term "variant" should be taken to mean
the exhibition of qualities that have a pattern that deviates from
what occurs in nature.
[0718] The terms "non-naturally occurring" or "engineered" are used
interchangeably and indicate the involvement of the hand of man.
The terms, when referring to nucleic acid molecules or polypeptides
mean that the nucleic acid molecule or the polypeptide is at least
substantially free from at least one other component with which
they are naturally associated in nature and as found in nature. In
all aspects and embodiments, whether they include these terms or
not, it will be understood that, preferably, the may be optional
and thus preferably included or not preferably not included.
Furthermore, the terms "non-naturally occurring" and "engineered"
may be used interchangeably and so can therefore be used alone or
in combination and one or other may replace mention of both
together. In particular, "engineered" is preferred in place of
"non-naturally occurring" or "non-naturally occurring and/or
engineered."
[0719] Sequence homologies may be generated by any of a number of
computer programs known in the art, for example BLAST or FASTA,
etc. A suitable computer program for carrying out such an alignment
is the GCG Wisconsin Bestfit package (University of Wisconsin,
U.S.A; Devereux et al., 1984, Nucleic Acids Research 12:387).
Examples of other software than may perform sequence comparisons
include, but are not limited to, the BLAST package (see Ausubel et
al., 1999 ibid--Chapter 18), FASTA (Atschul et al., 1990, J. Mol.
Biol., 403-410) and the GENEWORKS suite of comparison tools. Both
BLAST and FASTA are available for offline and online searching (see
Ausubel et al., 1999 ibid, pages 7-58 to 7-60). However it is
preferred to use the GCG Bestfit program. Percentage (%) sequence
homology may be calculated over contiguous sequences, i.e., one
sequence is aligned with the other sequence and each amino acid or
nucleotide in one sequence is directly compared with the
corresponding amino acid or nucleotide in the other sequence, one
residue at a time. This is called an "ungapped" alignment.
Typically, such ungapped alignments are performed only over a
relatively short number of residues. Although this is a very simple
and consistent method, it fails to take into consideration that,
for example, in an otherwise identical pair of sequences, one
insertion or deletion may cause the following amino acid residues
to be put out of alignment, thus potentially resulting in a large
reduction in % homology when a global alignment is performed.
Consequently, most sequence comparison methods are designed to
produce optimal alignments that take into consideration possible
insertions and deletions without unduly penalizing the overall
homology or identity score. This is achieved by inserting "gaps" in
the sequence alignment to try to maximize local homology or
identity. However, these more complex methods assign "gap
penalties" to each gap that occurs in the alignment so that, for
the same number of identical amino acids, a sequence alignment with
as few gaps as possible-reflecting higher relatedness between the
two compared sequences--may achieve a higher score than one with
many gaps. "Affinity gap costs" are typically used that charge a
relatively high cost for the existence of a gap and a smaller
penalty for each subsequent residue in the gap. This is the most
commonly used gap scoring system. High gap penalties may, of
course, produce optimized alignments with fewer gaps. Most
alignment programs allow the gap penalties to be modified. However,
it is preferred to use the default values when using such software
for sequence comparisons. For example, when using the GCG Wisconsin
Bestfit package the default gap penalty for amino acid sequences is
-12 for a gap and -4 for each extension. Calculation of maximum %
homology therefore first requires the production of an optimal
alignment, taking into consideration gap penalties. A suitable
computer program for carrying out such an alignment is the GCG
Wisconsin Bestfit package (Devereux et al., 1984 Nuc. Acids
Research 12 p 387). Examples of other software than may perform
sequence comparisons include, but are not limited to, the BLAST
package (see Ausubel et al., 1999 Short Protocols in Molecular
Biology, 4.sup.th Ed.--Chapter 18), FASTA (Altschul et al., 1990 J.
Mol. Biol. 403-410) and the GENEWORKS suite of comparison tools.
Both BLAST and FASTA are available for offline and online searching
(see Ausubel et al., 1999, Short Protocols in Molecular Biology,
pages 7-58 to 7-60). However, for some applications, it is
preferred to use the GCG Bestfit program. A new tool, called BLAST
2 Sequences is also available for comparing protein and nucleotide
sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50; FEMS
Microbiol Lett. 1999 177(1): 187-8 and the website of the National
Center for Biotechnology information at the website of the National
Institutes for Health). Although the final % homology may be
measured in terms of identity, the alignment process itself is
typically not based on an all-or-nothing pair comparison. Instead,
a scaled similarity score matrix is generally used that assigns
scores to each pair-wise comparison based on chemical similarity or
evolutionary distance. An example of such a matrix commonly used is
the BLOSUM62 matrix--the default matrix for the BLAST suite of
programs. GCG Wisconsin programs generally use either the public
default values or a custom symbol comparison table, if supplied
(see user manual for further details). For some applications, it is
preferred to use the public default values for the GCG package, or
in the case of other software, the default matrix, such as
BLOSUM62. Alternatively, percentage homologies may be calculated
using the multiple alignment feature in DNASIS.TM. (Hitachi
Software), based on an algorithm, analogous to CLUSTAL (Higgins D G
& Sharp P M (1988), Gene 73(1), 237-244). Once the software has
produced an optimal alignment, it is possible to calculate %
homology, preferably % sequence identity. The software typically
does this as part of the sequence comparison and generates a
numerical result. The sequences may also have deletions, insertions
or substitutions of amino acid residues which produce a silent
change and result in a functionally equivalent substance.
Deliberate amino acid substitutions may be made on the basis of
similarity in amino acid properties (such as polarity, charge,
solubility, hydrophobicity, hydrophilicity, and/or the amphipathic
nature of the residues) and it is therefore useful to group amino
acids together in functional groups. Amino acids may be grouped
together based on the properties of their side chains alone.
However, it is more useful to include mutation data as well. The
sets of amino acids thus derived are likely to be conserved for
structural reasons. These sets may be described in the form of a
Venn diagram (Livingstone C. D. and Barton G. J. (1993) "Protein
sequence alignments: a strategy for the hierarchical analysis of
residue conservation" Comput. Appl. Biosci. 9: 745-756) (Taylor W.
R. (1986) "The classification of amino acid conservation" J. Theor.
Biol. 119; 205-218). Conservative substitutions may be made, for
example according to the table below which describes a generally
accepted Venn diagram grouping of amino acids.
TABLE-US-00002 Set Sub-set Hydrophobic F W Y H K M I L V A G C
Aromatic F W Y H Aliphatic I L V Polar W Y H K R E D C S T N Q
Charged H K R E D Positively H K R charged Negatively E D charged
Small V C A G S P T N D Tiny A G S
[0720] The terms "subject," "individual," and "patient" are used
interchangeably herein to refer to a vertebrate, preferably a
mammal, more preferably a human. Mammals include, but are not
limited to, murines, simians, humans, farm animals, sport animals,
and pets. Tissues, cells and their progeny of a biological entity
obtained in vivo or cultured in vitro are also encompassed.
[0721] The terms "therapeutic agent", "therapeutic capable agent"
or "treatment agent" are used interchangeably and refer to a
molecule or compound that confers some beneficial effect upon
administration to a subject. The beneficial effect includes
enablement of diagnostic determinations; amelioration of a disease,
symptom, disorder, or pathological condition; reducing or
preventing the onset of a disease, symptom, disorder or condition;
and generally counteracting a disease, symptom, disorder or
pathological condition.
[0722] As used herein, "treatment" or "treating," or "palliating"
or "ameliorating" are used interchangeably. These terms refer to an
approach for obtaining beneficial or desired results including but
not limited to a therapeutic benefit and/or a prophylactic benefit.
By therapeutic benefit is meant any therapeutically relevant
improvement in or effect on one or more diseases, conditions, or
symptoms under treatment. For prophylactic benefit, the
compositions may be administered to a subject at risk of developing
a particular disease, condition, or symptom, or to a subject
reporting one or more of the physiological symptoms of a disease,
even though the disease, condition, or symptom may not have yet
been manifested.
[0723] The term "effective amount" or "therapeutically effective
amount" refers to the amount of an agent that is sufficient to
effect beneficial or desired results. The therapeutically effective
amount may vary depending upon one or more of: the subject and
disease condition being treated, the weight and age of the subject,
the severity of the disease condition, the manner of administration
and the like, which can readily be determined by one of ordinary
skill in the art. The term also applies to a dose that will provide
an image for detection by any one of the imaging methods described
herein. The specific dose may vary depending on one or more of: the
particular agent chosen, the dosing regimen to be followed, whether
it is administered in combination with other compounds, timing of
administration, the tissue to be imaged, and the physical delivery
system in which it is carried.
[0724] The practice of the present invention employs, unless
otherwise indicated, conventional techniques of immunology,
biochemistry, chemistry, molecular biology, microbiology, cell
biology, genomics and recombinant DNA, which are within the skill
of the art. See Sambrook, Fritsch and Maniatis, MOLECULAR CLONING:
A LABORATORY MANUAL, 2nd edition (1989); CURRENT PROTOCOLS IN
MOLECULAR BIOLOGY (F. M. Ausubel, et al. eds., (1987)); the series
METHODS IN ENZYMOLOGY (Academic Press, Inc.): PCR 2: A PRACTICAL
APPROACH (M. J. MacPherson, B. D. Hames and G. R. Taylor eds.
(1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY
MANUAL, and ANIMAL CELL CULTURE (R. I. Freshney, ed. (1987)).
[0725] Several aspects of the invention relate to vector systems
comprising one or more vectors, or vectors as such. Vectors can be
designed for expression of CRISPR transcripts (e.g. nucleic acid
transcripts, proteins, or enzymes) in prokaryotic or eukaryotic
cells. For example, CRISPR transcripts can be expressed in
bacterial cells such as Escherichia coli, insect cells (using
baculovirus expression vectors), yeast cells, or mammalian cells.
Suitable host cells are discussed further in Goeddel, GENE
EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press,
San Diego, Calif. (1990). Alternatively, the recombinant expression
vector can be transcribed and translated in vitro, for example
using T7 promoter regulatory sequences and T7 polymerase.
[0726] Embodiments of the invention include sequences (both
polynucleotide or polypeptide) which may comprise homologous
substitution (substitution and replacement are both used herein to
mean the interchange of an existing amino acid residue or
nucleotide, with an alternative residue or nucleotide) that may
occur i.e., like-for-like substitution in the case of amino acids
such as basic for basic, acidic for acidic, polar for polar, etc.
Non-homologous substitution may also occur i.e., from one class of
residue to another or alternatively involving the inclusion of
unnatural amino acids such as ornithine (hereinafter referred to as
Z), diaminobutyric acid ornithine (hereinafter referred to as B),
norleucine ornithine (hereinafter referred to as O), pyriylalanine,
thienylalanine, naphthylalanine and phenylglycine. Variant amino
acid sequences may include suitable spacer groups that may be
inserted between any two amino acid residues of the sequence
including alkyl groups such as methyl, ethyl or propyl groups in
addition to amino acid spacers such as glycine or 3-alanine
residues. A further form of variation, which involves the presence
of one or more amino acid residues in peptoid form, may be well
understood by those skilled in the art. For the avoidance of doubt,
"the peptoid form" is used to refer to variant amino acid residues
wherein the a-carbon substituent group is on the residue's nitrogen
atom rather than the a-carbon. Processes for preparing peptides in
the peptoid form are known in the art, for example Simon R J et
al., PNAS (1992) 89(20), 9367-9371 and Horwell D C, Trends
Biotechnol. (1995) 13(4), 132-134.
[0727] Homology modelling: Corresponding residues in other C2c2
orthologs can be identified by the methods of Zhang et al., 2012
(Nature; 490(7421): 556-60) and Chen et al., 2015 (PLoS Comput
Biol; 11(5): e1004248)--a computational protein-protein interaction
(PPI) method to predict interactions mediated by domain-motif
interfaces. PrePPI (Predicting PPI), a structure based PPI
prediction method, combines structural evidence with non-structural
evidence using a Bayesian statistical framework. The method
involves taking a pair a query proteins and using structural
alignment to identify structural representatives that correspond to
either their experimentally determined structures or homology
models. Structural alignment is further used to identify both close
and remote structural neighbors by considering global and local
geometric relationships. Whenever two neighbors of the structural
representatives form a complex reported in the Protein Data Bank,
this defines a template for modelling the interaction between the
two query proteins. Models of the complex are created by
superimposing the representative structures on their corresponding
structural neighbor in the template. This approach is further
described in Dey et al., 2013 (Prot Sci; 22: 359-66).
[0728] For purpose of this invention, amplification means any
method employing a primer and a polymerase capable of replicating a
target sequence with reasonable fidelity. Amplification may be
carried out by natural or recombinant DNA polymerases such as
TaqGold.TM., T7 DNA polymerase, Klenow fragment of E. coli DNA
polymerase, and reverse transcriptase. A preferred amplification
method is PCR.
[0729] In certain aspects the invention involves vectors. A used
herein, a "vector" is a tool that allows or facilitates the
transfer of an entity from one environment to another. It is a
replicon, such as a plasmid, phage, or cosmid, into which another
DNA segment may be inserted so as to bring about the replication of
the inserted segment. Generally, a vector is capable of replication
when associated with the proper control elements. In general, the
term "vector" refers to a nucleic acid molecule capable of
transporting another nucleic acid to which it has been linked.
Vectors include, but are not limited to, nucleic acid molecules
that are single-stranded, double-stranded, or partially
double-stranded; nucleic acid molecules that comprise one or more
free ends, no free ends (e.g., circular); nucleic acid molecules
that comprise DNA, RNA, or both; and other varieties of
polynucleotides known in the art. One type of vector is a
"plasmid," which refers to a circular double stranded DNA loop into
which additional DNA segments can be inserted, such as by standard
molecular cloning techniques. Another type of vector is a viral
vector, wherein virally-derived DNA or RNA sequences are present in
the vector for packaging into a virus (e.g., retroviruses,
replication defective retroviruses, adenoviruses, replication
defective adenoviruses, and adeno-associated viruses (AAVs)). Viral
vectors also include polynucleotides carried by a virus for
transfection into a host cell. Certain vectors are capable of
autonomous replication in a host cell into which they are
introduced (e.g., bacterial vectors having a bacterial origin of
replication and episomal mammalian vectors). Other vectors (e.g.,
non-episomal mammalian vectors) are integrated into the genome of a
host cell upon introduction into the host cell, and thereby are
replicated along with the host genome. Moreover, certain vectors
are capable of directing the expression of genes to which they are
operatively-linked. Such vectors are referred to herein as
"expression vectors." Common expression vectors of utility in
recombinant DNA techniques are often in the form of plasmids.
[0730] Recombinant expression vectors can comprise a nucleic acid
of the invention in a form suitable for expression of the nucleic
acid in a host cell, which means that the recombinant expression
vectors include one or more regulatory elements, which may be
selected on the basis of the host cells to be used for expression,
that is operatively-linked to the nucleic acid sequence to be
expressed. Within a recombinant expression vector, "operably
linked" is intended to mean that the nucleotide sequence of
interest is linked to the regulatory element(s) in a manner that
allows for expression of the nucleotide sequence (e.g., in an in
vitro transcription/translation system or in a host cell when the
vector is introduced into the host cell). With regards to
recombination and cloning methods, mention is made of U.S. patent
application Ser. No. 10/815,730, published Sep. 2, 2004 as US
2004-0171156 A1, the contents of which are herein incorporated by
reference in their entirety.
[0731] Aspects of the invention relate to bicistronic vectors for
guide RNA and wild type, modified or mutated CRISPR effector
proteins/enzymes (e.g. C2c2). Bicistronic expression vectors guide
RNA and wild type, modified or mutated CRISPR effector
proteins/enzymes (e.g. C2c2) are preferred. In general and
particularly in this embodiment and wild type, modified or mutated
CRISPR effector proteins/enzymes (e.g. C2c2) is preferably driven
by the CBh promoter. The RNA may preferably be driven by a Pol III
promoter, such as a U6 promoter. Ideally the two are combined.
[0732] In some embodiments, a loop in the guide RNA is provided.
This may be a stem loop or a tetra loop. The loop is preferably
GAAA, but it is not limited to this sequence or indeed to being
only 4 bp in length. Indeed, preferred loop forming sequences for
use in hairpin structures are four nucleotides in length, and most
preferably have the sequence GAAA. However, longer or shorter loop
sequences may be used, as may alternative sequences. The sequences
preferably include a nucleotide triplet (for example, AAA), and an
additional nucleotide (for example C or G). Examples of loop
forming sequences include CAAA and AAAG.
[0733] In practicing any of the methods disclosed herein, a
suitable vector can be introduced to a cell or an embryo via one or
more methods known in the art, including without limitation,
microinjection, electroporation, sonoporation, biolistics, calcium
phosphate-mediated transfection, cationic transfection, liposome
transfection, dendrimer transfection, heat shock transfection,
nucleofection transfection, magnetofection, lipofection,
impalefection, optical transfection, proprietary agent-enhanced
uptake of nucleic acids, and delivery via liposomes,
immunoliposomes, virosomes, or artificial virions. In some methods,
the vector is introduced into an embryo by microinjection. The
vector or vectors may be microinjected into the nucleus or the
cytoplasm of the embryo. In some methods, the vector or vectors may
be introduced into a cell by nucleofection.
[0734] The term "regulatory element" is intended to include
promoters, enhancers, internal ribosomal entry sites (IRES), and
other expression control elements (e.g., transcription termination
signals, such as polyadenylation signals and poly-U sequences).
Such regulatory elements are described, for example, in Goeddel,
GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic
Press, San Diego, Calif. (1990). Regulatory elements include those
that direct constitutive expression of a nucleotide sequence in
many types of host cell and those that direct expression of the
nucleotide sequence only in certain host cells (e.g.,
tissue-specific regulatory sequences). A tissue-specific promoter
may direct expression primarily in a desired tissue of interest,
such as muscle, neuron, bone, skin, blood, specific organs (e.g.,
liver, pancreas), or particular cell types (e.g., lymphocytes).
Regulatory elements may also direct expression in a
temporal-dependent manner, such as in a cell-cycle dependent or
developmental stage-dependent manner, which may or may not also be
tissue or cell-type specific. In some embodiments, a vector
comprises one or more pol III promoter (e.g., 1, 2, 3, 4, 5, or
more pol III promoters), one or more pol II promoters (e.g., 1, 2,
3, 4, 5, or more pol II promoters), one or more pol I promoters
(e.g., 1, 2, 3, 4, 5, or more pol I promoters), or combinations
thereof. Examples of pol III promoters include, but are not limited
to, U6 and H1 promoters. Examples of pol II promoters include, but
are not limited to, the retroviral Rous sarcoma virus (RSV) LTR
promoter (optionally with the RSV enhancer), the cytomegalovirus
(CMV) promoter (optionally with the CMV enhancer) [see, e.g.,
Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the
dihydrofolate reductase promoter, the .beta.-actin promoter, the
phosphoglycerol kinase (PGK) promoter, and the EF1.alpha. promoter.
Also encompassed by the term "regulatory element" are enhancer
elements, such as WPRE; CMV enhancers; the R-U5' segment in LTR of
HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40
enhancer; and the intron sequence between exons 2 and 3 of rabbit
.beta.-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31,
1981). It will be appreciated by those skilled in the art that the
design of the expression vector can depend on such factors as the
choice of the host cell to be transformed, the level of expression
desired, etc. A vector can be introduced into host cells to thereby
produce transcripts, proteins, or peptides, including fusion
proteins or peptides, encoded by nucleic acids as described herein
(e.g., clustered regularly interspersed short palindromic repeats
(CRISPR) transcripts, proteins, enzymes, mutant forms thereof,
fusion proteins thereof, etc.). With regards to regulatory
sequences, mention is made of U.S. patent application Ser. No.
10/491,026, the contents of which are incorporated by reference
herein in their entirety. With regards to promoters, mention is
made of PCT publication WO 2011/028929 and U.S. application Ser.
No. 12/511,940, the contents of which are incorporated by reference
herein in their entirety.
[0735] Vectors can be designed for expression of CRISPR transcripts
(e.g., nucleic acid transcripts, proteins, or enzymes) in
prokaryotic or eukaryotic cells. For example, CRISPR transcripts
can be expressed in bacterial cells such as Escherichia coli,
insect cells (using baculovirus expression vectors), yeast cells,
or mammalian cells. Suitable host cells are discussed further in
Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185,
Academic Press, San Diego, Calif. (1990). Alternatively, the
recombinant expression vector can be transcribed and translated in
vitro, for example using T7 promoter regulatory sequences and T7
polymerase.
[0736] Vectors may be introduced and propagated in a prokaryote or
prokaryotic cell. In some embodiments, a prokaryote is used to
amplify copies of a vector to be introduced into a eukaryotic cell
or as an intermediate vector in the production of a vector to be
introduced into a eukaryotic cell (e.g., amplifying a plasmid as
part of a viral vector packaging system). In some embodiments, a
prokaryote is used to amplify copies of a vector and express one or
more nucleic acids, such as to provide a source of one or more
proteins for delivery to a host cell or host organism. Expression
of proteins in prokaryotes is most often carried out in Escherichia
coli with vectors containing constitutive or inducible promoters
directing the expression of either fusion or non-fusion proteins.
Fusion vectors add a number of amino acids to a protein encoded
therein, such as to the amino terminus of the recombinant protein.
Such fusion vectors may serve one or more purposes, such as: (i) to
increase expression of recombinant protein; (ii) to increase the
solubility of the recombinant protein; and (iii) to aid in the
purification of the recombinant protein by acting as a ligand in
affinity purification. Often, in fusion expression vectors, a
proteolytic cleavage site is introduced at the junction of the
fusion moiety and the recombinant protein to enable separation of
the recombinant protein from the fusion moiety subsequent to
purification of the fusion protein. Such enzymes, and their cognate
recognition sequences, include Factor Xa, thrombin and
enterokinase. Example fusion expression vectors include pGEX
(Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40),
pMAL (New England Biolabs, Beverly, Mass.) and pRITS (Pharmacia,
Piscataway, N.J.) that fuse glutathione S-transferase (GST),
maltose E binding protein, or protein A, respectively, to the
target recombinant protein.
[0737] Examples of suitable inducible non-fusion E. coli expression
vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and
pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN
ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990)
60-89).
[0738] In some embodiments, a vector is a yeast expression vector.
Examples of vectors for expression in yeast Saccharomyces cerivisae
include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa
(Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et
al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San
Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
[0739] In some embodiments, a vector drives protein expression in
insect cells using baculovirus expression vectors. Baculovirus
vectors available for expression of proteins in cultured insect
cells (e.g., SF9 cells) include the pAc series (Smith, et al.,
1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow
and Summers, 1989. Virology 170: 31-39).
[0740] In some embodiments, a vector is capable of driving
expression of one or more sequences in mammalian cells using a
mammalian expression vector. Examples of mammalian expression
vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC
(Kaufman, et al., 1987. EMBO J. 6: 187-195). When used in mammalian
cells, the expression vector's control functions are typically
provided by one or more regulatory elements. For example, commonly
used promoters are derived from polyoma, adenovirus 2,
cytomegalovirus, simian virus 40, and others disclosed herein and
known in the art. For other suitable expression systems for both
prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of
Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed.,
Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, N.Y., 1989.
[0741] In some embodiments, the recombinant mammalian expression
vector is capable of directing expression of the nucleic acid
preferentially in a particular cell type (e.g., tissue-specific
regulatory elements are used to express the nucleic acid).
Tissue-specific regulatory elements are known in the art.
Non-limiting examples of suitable tissue-specific promoters include
the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes
Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton,
1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell
receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and
immunoglobulins (Baneiji, et al., 1983. Cell 33: 729-740; Queen and
Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters
(e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc.
Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters
(Edlund, et al., 1985. Science 230: 912-916), and mammary
gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No.
4,873,316 and European Application Publication No. 264,166).
Developmentally-regulated promoters are also encompassed, e.g., the
murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379)
and the a-fetoprotein promoter (Campes and Tilghman, 1989. Genes
Dev. 3: 537-546). With regards to these prokaryotic and eukaryotic
vectors, mention is made of U.S. Pat. No. 6,750,059, the contents
of which are incorporated by reference herein in their entirety.
Other embodiments of the invention may relate to the use of viral
vectors, with regards to which mention is made of U.S. patent
application Ser. No. 13/092,085, the contents of which are
incorporated by reference herein in their entirety. Tissue-specific
regulatory elements are known in the art and in this regard,
mention is made of U.S. Pat. No. 7,776,321, the contents of which
are incorporated by reference herein in their entirety.
[0742] In some embodiments, a regulatory element is operably linked
to one or more elements of a CRISPR system so as to drive
expression of the one or more elements of the CRISPR system. In
general, CRISPRs (Clustered Regularly Interspaced Short Palindromic
Repeats), also known as SPIDRs (SPacer Interspersed Direct
Repeats), constitute a family of DNA loci that are usually specific
to a particular bacterial species. The CRISPR locus comprises a
distinct class of interspersed short sequence repeats (SSRs) that
were recognized in E. coli (Ishino et al., J. Bacteriol.,
169:5429-5433 [1987]; and Nakata et al., J. Bacteriol.,
171:3553-3556 [1989]), and associated genes. Similar interspersed
SSRs have been identified in Haloferax mediterranei, Streptococcus
pyogenes, Anabaena, and Mycobacterium tuberculosis (See, Groenen et
al., Mol. Microbiol., 10:1057-1065 [1993]; Hoe et al., Emerg.
Infect. Dis., 5:254-263 [1999]; Masepohl et al., Biochim. Biophys.
Acta 1307:26-30 [1996]; and Mojica et al., Mol. Microbiol.,
17:85-93 [1995]). The CRISPR loci typically differ from other SSRs
by the structure of the repeats, which have been termed short
regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ.
Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol.,
36:244-246 [2000]). In general, the repeats are short elements that
occur in clusters that are regularly spaced by unique intervening
sequences with a substantially constant length (Mojica et al.,
[2000], supra). Although the repeat sequences are highly conserved
between strains, the number of interspersed repeats and the
sequences of the spacer regions typically differ from strain to
strain (van Embden et al., J. Bacteriol., 182:2393-2401 [2000]).
CRISPR loci have been identified in more than 40 prokaryotes (See
e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and
Mojica et al., [2005]) including, but not limited to Aeropyrum,
Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula,
Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus,
Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium,
Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium,
Thermus, Bacillus, Listeria, Staphylococcus, Clostridium,
Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus,
Chromobacterium, Neisseria, Nitrosomonas, Desulfovibrio, Geobacter,
Myxococcus, Campylobacter, Wolinella, Acinetobacter, Erwinia,
Escherichia, Legionella, Methylococcus, Pasteurella,
Photobacterium, Salmonella, Xanthomonas, Yersinia, Treponema, and
Thermotoga.
[0743] In general, "nucleic acid-targeting system" as used in the
present application refers collectively to transcripts and other
elements involved in the expression of or directing the activity of
nucleic acid-targeting CRISPR-associated ("Cas") genes (also
referred to herein as an effector protein), including sequences
encoding a nucleic acid-targeting Cas (effector) protein and a
guide RNA (comprising crRNA sequence and a trans-activating
CRISPR/Cas system RNA (tracrRNA) sequence), or other sequences and
transcripts from a nucleic acid-targeting CRISPR locus. In some
embodiments, one or more elements of a nucleic acid-targeting
system are derived from a Type V/Type VI nucleic acid-targeting
CRISPR system. In some embodiments, one or more elements of a
nucleic acid-targeting system is derived from a particular organism
comprising an endogenous nucleic acid-targeting CRISPR system. In
general, a nucleic acid-targeting system is characterized by
elements that promote the formation of a nucleic acid-targeting
complex at the site of a target sequence. In the context of
formation of a nucleic acid-targeting complex, "target sequence"
refers to a sequence to which a guide sequence is designed to have
complementarity, where hybridization between a target sequence and
a guide RNA promotes the formation of a DNA or RNA-targeting
complex. Full complementarity is not necessarily required, provided
there is sufficient complementarity to cause hybridization and
promote formation of a nucleic acid-targeting complex. A target
sequence may comprise RNA polynucleotides. In some embodiments, a
target sequence is located in the nucleus or cytoplasm of a cell.
In some embodiments, the target sequence may be within an organelle
of a eukaryotic cell, for example, mitochondrion or chloroplast. A
sequence or template that may be used for recombination into the
targeted locus comprising the target sequences is referred to as an
"editing template" or "editing RNA" or "editing sequence". In
aspects of the invention, an exogenous template RNA may be referred
to as an editing template. In an aspect of the invention the
recombination is homologous recombination.
[0744] Typically, in the context of an endogenous nucleic
acid-targeting system, formation of a nucleic acid-targeting
complex (comprising a guide RNA hybridized to a target sequence and
complexed with one or more nucleic acid-targeting effector
proteins) results in cleavage of one or both RNA strands in or near
(e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base
pairs from) the target sequence. In some embodiments, one or more
vectors driving expression of one or more elements of a nucleic
acid-targeting system are introduced into a host cell such that
expression of the elements of the nucleic acid-targeting system
direct formation of a nucleic acid-targeting complex at one or more
target sites. For example, a nucleic acid-targeting effector
protein and a guide RNA could each be operably linked to separate
regulatory elements on separate vectors. Alternatively, two or more
of the elements expressed from the same or different regulatory
elements, may be combined in a single vector, with one or more
additional vectors providing any components of the nucleic
acid-targeting system not included in the first vector. nucleic
acid-targeting system elements that are combined in a single vector
may be arranged in any suitable orientation, such as one element
located 5' with respect to ("upstream" of) or 3' with respect to
("downstream" of) a second element. The coding sequence of one
element may be located on the same or opposite strand of the coding
sequence of a second element, and oriented in the same or opposite
direction. In some embodiments, a single promoter drives expression
of a transcript encoding a nucleic acid-targeting effector protein
and a guide RNA embedded within one or more intron sequences (e.g.
each in a different intron, two or more in at least one intron, or
all in a single intron). In some embodiments, the nucleic
acid-targeting effector protein and guide RNA are operably linked
to and expressed from the same promoter.
[0745] In general, a guide sequence is any polynucleotide sequence
having sufficient complementarity with a target polynucleotide
sequence to hybridize with the target sequence and direct
sequence-specific binding of a nucleic acid-targeting complex to
the target sequence. In some embodiments, the degree of
complementarity between a guide sequence and its corresponding
target sequence, when optimally aligned using a suitable alignment
algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%,
90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined
with the use of any suitable algorithm for aligning sequences,
non-limiting example of which include the Smith-Waterman algorithm,
the Needleman-Wunsch algorithm, algorithms based on the
Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner),
ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND
(Illumina, San Diego, Calif.), SOAP (available at
soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
In some embodiments, a guide sequence is about or more than about
5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in
length. In some embodiments, a guide sequence is less than about
75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in
length. The ability of a guide sequence to direct sequence-specific
binding of a nucleic acid-targeting complex to a target sequence
may be assessed by any suitable assay. For example, the components
of a nucleic acid-targeting system sufficient to form a nucleic
acid-targeting complex, including the guide sequence to be tested,
may be provided to a host cell having the corresponding target
sequence, such as by transfection with vectors encoding the
components of the nucleic acid-targeting CRISPR sequence, followed
by an assessment of preferential cleavage within or in the vicinity
of the target sequence, such as by Surveyor assay as described
herein. Similarly, cleavage of a target polynucleotide sequence (or
a sequence in the vicinity thereof) may be evaluated in a test tube
by providing the target sequence, components of a nucleic
acid-targeting complex, including the guide sequence to be tested
and a control guide sequence different from the test guide
sequence, and comparing binding or rate of cleavage at or in the
vicinity of the target sequence between the test and control guide
sequence reactions. Other assays are possible, and will occur to
those skilled in the art.
[0746] A guide sequence may be selected to target any target
sequence. In some embodiments, the target sequence is a sequence
within a gene transcript or mRNA.
[0747] In some embodiments, the target sequence is a sequence
within a genome of a cell.
[0748] In some embodiments, a guide sequence is selected to reduce
the degree of secondary structure within the guide sequence.
Secondary structure may be determined by any suitable
polynucleotide folding algorithm. Some programs are based on
calculating the minimal Gibbs free energy. An example of one such
algorithm is mFold, as described by Zuker and Stiegler (Nucleic
Acids Res. 9 (1981), 133-148). Another example folding algorithm is
the online webserver RNAfold, developed at Institute for
Theoretical Chemistry at the University of Vienna, using the
centroid structure prediction algorithm (see e.g. A. R. Gruber et
al., 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009,
Nature Biotechnology 27(12): 1151-62). Further algorithms may be
found in U.S. application Ser. No. TBA (attorney docket
44790.11.2022; Broad Reference BI-2013/004A); incorporated herein
by reference.
[0749] In some embodiments, the nucleic acid-targeting effector
protein is part of a fusion protein comprising one or more
heterologous protein domains (e.g., about or more than about 1, 2,
3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the nucleic
acid-targeting effector protein). In some embodiments, the CRISPR
effector protein/enzyme is part of a fusion protein comprising one
or more heterologous protein domains (e.g. about or more than about
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the
CRISPR enzyme). A CRISPR effector protein/enzyme fusion protein may
comprise any additional protein sequence, and optionally a linker
sequence between any two domains. Examples of protein domains that
may be fused to an effector protein include, without limitation,
epitope tags, reporter gene sequences, and protein domains having
one or more of the following activities: methylase activity,
demethylase activity, transcription activation activity,
transcription repression activity, transcription release factor
activity, histone modification activity, RNA cleavage activity and
nucleic acid binding activity. Non-limiting examples of epitope
tags include histidine (His) tags, V5 tags, FLAG tags, influenza
hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin
(Trx) tags. Examples of reporter genes include, but are not limited
to, glutathione-S-transferase (GST), horseradish peroxidase (HRP),
chloramphenicol acetyltransferase (CAT) beta-galactosidase,
beta-glucuronidase, luciferase, green fluorescent protein (GFP),
HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent
protein (YFP), and autofluorescent proteins including blue
fluorescent protein (BFP). A nucleic acid-targeting effector
protein may be fused to a gene sequence encoding a protein or a
fragment of a protein that bind DNA molecules or bind other
cellular molecules, including but not limited to maltose binding
protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4
DNA binding domain fusions, and herpes simplex virus (HSV) BP16
protein fusions. Additional domains that may form part of a fusion
protein comprising a nucleic acid-targeting effector protein are
described in US20110059502, incorporated herein by reference. In
some embodiments, a tagged nucleic acid-targeting effector protein
is used to identify the location of a target sequence.
[0750] In some embodiments, a CRISPR enzyme may form a component of
an inducible system. The inducible nature of the system would allow
for spatiotemporal control of gene editing or gene expression using
a form of energy. The form of energy may include but is not limited
to electromagnetic radiation, sound energy, chemical energy and
thermal energy. Examples of inducible system include tetracycline
inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid
transcription activations systems (FKBP, ABA, etc), or light
inducible systems (Phytochrome, LOV domains, or cryptochrome).In
one embodiment, the CRISPR enzyme may be a part of a Light
Inducible Transcriptional Effector (LITE) to direct changes in
transcriptional activity in a sequence-specific manner. The
components of a light may include a CRISPR enzyme, a
light-responsive cytochrome heterodimer (e.g. from Arabidopsis
thaliana), and a transcriptional activation/repression domain.
Further examples of inducible DNA binding proteins and methods for
their use are provided in U.S. 61/736,465 and U.S. 61/721,283 and
WO 2014/018423 and U.S. Pat. Nos. 8,889,418, 8,895,308,
US20140186919, US20140242700, US20140273234, US20140335620,
WO2014093635, which is hereby incorporated by reference in its
entirety.
[0751] In some aspects, the invention provides methods comprising
delivering one or more polynucleotides, such as or one or more
vectors as described herein, one or more transcripts thereof,
and/or one or proteins transcribed therefrom, to a host cell. In
some aspects, the invention further provides cells produced by such
methods, and organisms (such as animals, plants, or fungi)
comprising or produced from such cells. In some embodiments, a
nucleic acid-targeting effector protein in combination with (and
optionally complexed with) a guide RNA is delivered to a cell.
Conventional viral and non-viral based gene transfer methods can be
used to introduce nucleic acids in mammalian cells or target
tissues. Such methods can be used to administer nucleic acids
encoding components of a nucleic acid-targeting system to cells in
culture, or in a host organism. Non-viral vector delivery systems
include DNA plasmids, RNA (e.g. a transcript of a vector described
herein), naked nucleic acid, and nucleic acid complexed with a
delivery vehicle, such as a liposome. Viral vector delivery systems
include DNA and RNA viruses, which have either episomal or
integrated genomes after delivery to the cell. For a review of gene
therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel
& Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey,
TIBTECH 11:162-166 (1993); Dillon, TIBTECH 11:167-175 (1993);
Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology
6(10):1149-1154 (1988); Vigne, Restorative Neurology and
Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British
Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current
Topics in Microbiology and Immunology, Doerfler and Bohm (eds)
(1995); and Yu et al., Gene Therapy 1:13-26 (1994).
[0752] Methods of non-viral delivery of nucleic acids include
lipofection, nucleofection, microinjection, biolistics, virosomes,
liposomes, immunoliposomes, polycation or lipid:nucleic acid
conjugates, naked DNA, artificial virions, and agent-enhanced
uptake of DNA. Lipofection is described in e.g., U.S. Pat. Nos.
5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are
sold commercially (e.g., Transfectam.TM. and Lipofectin.TM.).
Cationic and neutral lipids that are suitable for efficient
receptor-recognition lipofection of polynucleotides include those
of Felgner, WO 91/17424; WO 91/16024. Delivery can be to cells
(e.g. in vitro or ex vivo administration) or target tissues (e.g.
in vivo administration).
[0753] The preparation of lipid:nucleic acid complexes, including
targeted liposomes such as immunolipid complexes, is well known to
one of skill in the art (see, e.g., Crystal, Science 270:404-410
(1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et
al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate
Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995);
Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos.
4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728,
4,774,085, 4,837,028, and 4,946,787).
[0754] The use of RNA or DNA viral based systems for the delivery
of nucleic acids takes advantage of highly evolved processes for
targeting a virus to specific cells in the body and trafficking the
viral payload to the nucleus. Viral vectors can be administered
directly to patients (in vivo) or they can be used to treat cells
in vitro, and the modified cells may optionally be administered to
patients (ex vivo). Conventional viral based systems could include
retroviral, lentivirus, adenoviral, adeno-associated and herpes
simplex virus vectors for gene transfer. Integration in the host
genome is possible with the retrovirus, lentivirus, and
adeno-associated virus gene transfer methods, often resulting in
long term expression of the inserted transgene. Additionally, high
transduction efficiencies have been observed in many different cell
types and target tissues.
[0755] The tropism of a retrovirus can be altered by incorporating
foreign envelope proteins, expanding the potential target
population of target cells. Lentiviral vectors are retroviral
vectors that are able to transduce or infect non-dividing cells and
typically produce high viral titers. Selection of a retroviral gene
transfer system would therefore depend on the target tissue.
Retroviral vectors are comprised of cis-acting long terminal
repeats with packaging capacity for up to 6-10 kb of foreign
sequence. The minimum cis-acting LTRs are sufficient for
replication and packaging of the vectors, which are then used to
integrate the therapeutic gene into the target cell to provide
permanent transgene expression. Widely used retroviral vectors
include those based upon murine leukemia virus (MuLV), gibbon ape
leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human
immuno deficiency virus (HIV), and combinations thereof (see, e.g.,
Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J.
Virol. 66:1635-1640 (1992); Sommnerfelt et al., Virol. 176:58-59
(1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et
al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).In applications
where transient expression is preferred, adenoviral based systems
may be used. Adenoviral based vectors are capable of very high
transduction efficiency in many cell types and do not require cell
division. With such vectors, high titer and levels of expression
have been obtained. This vector can be produced in large quantities
in a relatively simple system. Adeno-associated virus ("AAV")
vectors may also be used to transduce cells with target nucleic
acids, e.g., in the in vitro production of nucleic acids and
peptides, and for in vivo and ex vivo gene therapy procedures (see,
e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No.
4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994);
Muzyczka, J. Clin. Invest. 94:1351 (1994). Construction of
recombinant AAV vectors are described in a number of publications,
including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell.
Biol. 5:3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol.
4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81:6466-6470
(1984); and Samulski et al., J. Virol. 63:03822-3828 (1989).
Models of Genetic and Epigenetic Conditions
[0756] A method of the invention may be used to create a plant, an
animal or cell that may be used to model and/or study genetic or
epigenetic conditions of interest, such as a through a model of
mutations of interest or a disease model. As used herein, "disease"
refers to a disease, disorder, or indication in a subject. For
example, a method of the invention may be used to create an animal
or cell that comprises a modification in one or more nucleic acid
sequences associated with a disease, or a plant, animal or cell in
which the expression of one or more nucleic acid sequences
associated with a disease are altered. Such a nucleic acid sequence
may encode a disease associated protein sequence or may be a
disease associated control sequence. Accordingly, it is understood
that in embodiments of the invention, a plant, subject, patient,
organism or cell can be a non-human subject, patient, organism or
cell. Thus, the invention provides a plant, animal or cell,
produced by the present methods, or a progeny thereof. The progeny
may be a clone of the produced plant or animal, or may result from
sexual reproduction by crossing with other individuals of the same
species to introgress further desirable traits into their
offspring. The cell may be in vivo or ex vivo in the cases of
multicellular organisms, particularly animals or plants. In the
instance where the cell is in cultured, a cell line may be
established if appropriate culturing conditions are met and
preferably if the cell is suitably adapted for this purpose (for
instance a stem cell). Bacterial cell lines produced by the
invention are also envisaged. Hence, cell lines are also
envisaged.
[0757] In some methods, the disease model can be used to study the
effects of mutations on the animal or cell and development and/or
progression of the disease using measures commonly used in the
study of the disease. Alternatively, such a disease model is useful
for studying the effect of a pharmaceutically active compound on
the disease.
[0758] In some methods, the disease model can be used to assess the
efficacy of a potential gene therapy strategy. That is, a
disease-associated gene or polynucleotide can be modified such that
the disease development and/or progression is inhibited or reduced.
In particular, the method comprises modifying a disease-associated
gene or polynucleotide such that an altered protein is produced
and, as a result, the animal or cell has an altered response.
Accordingly, in some methods, a genetically modified animal may be
compared with an animal predisposed to development of the disease
such that the effect of the gene therapy event may be assessed.
[0759] In another embodiment, this invention provides a method of
developing a biologically active agent that modulates a cell
signaling event associated with a disease gene. The method
comprises contacting a test compound with a cell comprising one or
more vectors that drive expression of one or more of a CRISPR
enzyme, and a direct repeat sequence linked to a guide sequence;
and detecting a change in a readout that is indicative of a
reduction or an augmentation of a cell signaling event associated
with, e.g., a mutation in a disease gene contained in the cell.
[0760] A cell model or animal model can be constructed in
combination with the method of the invention for screening a
cellular function change. Such a model may be used to study the
effects of a genome sequence modified by the CRISPR complex of the
invention on a cellular function of interest. For example, a
cellular function model may be used to study the effect of a
modified genome sequence on intracellular signaling or
extracellular signaling. Alternatively, a cellular function model
may be used to study the effects of a modified genome sequence on
sensory perception. In some such models, one or more genome
sequences associated with a signaling biochemical pathway in the
model are modified.
[0761] Several disease models have been specifically investigated.
These include de novo autism risk genes CHD8, KATNAL2, and SCN2A;
and the syndromic autism (Angelman Syndrome) gene UBE3A. These
genes and resulting autism models are of course preferred, but
serve to show the broad applicability of the invention across genes
and corresponding models.
[0762] An altered expression of one or more genome sequences
associated with a signalling biochemical pathway can be determined
by assaying for a difference in the mRNA levels of the
corresponding genes between the test model cell and a control cell,
when they are contacted with a candidate agent. Alternatively, the
differential expression of the sequences associated with a
signaling biochemical pathway is determined by detecting a
difference in the level of the encoded polypeptide or gene
product.
[0763] To assay for an agent-induced alteration in the level of
mRNA transcripts or corresponding polynucleotides, nucleic acid
contained in a sample is first extracted according to standard
methods in the art. For instance, mRNA can be isolated using
various lytic enzymes or chemical solutions according to the
procedures set forth in Sambrook et al. (1989), or extracted by
nucleic-acid-binding resins following the accompanying instructions
provided by the manufacturers. The mRNA contained in the extracted
nucleic acid sample is then detected by amplification procedures or
conventional hybridization assays (e.g. Northern blot analysis)
according to methods widely known in the art or based on the
methods exemplified herein.
[0764] For purpose of this invention, amplification means any
method employing a primer and a polymerase capable of replicating a
target sequence with reasonable fidelity. Amplification may be
carried out by natural or recombinant DNA polymerases such as
TaqGold.TM., T7 DNA polymerase, Klenow fragment of E. coli DNA
polymerase, and reverse transcriptase. A preferred amplification
method is PCR. In particular, the isolated RNA can be subjected to
a reverse transcription assay that is coupled with a quantitative
polymerase chain reaction (RT-PCR) in order to quantify the
expression level of a sequence associated with a signaling
biochemical pathway.
[0765] Detection of the gene expression level can be conducted in
real time in an amplification assay. In one aspect, the amplified
products can be directly visualized with fluorescent DNA-binding
agents including but not limited to DNA intercalators and DNA
groove binders. Because the amount of the intercalators
incorporated into the double-stranded DNA molecules is typically
proportional to the amount of the amplified DNA products, one can
conveniently determine the amount of the amplified products by
quantifying the fluorescence of the intercalated dye using
conventional optical systems in the art. DNA-binding dye suitable
for this application include SYBR green, SYBR blue, DAPI, propidium
iodine, Hoeste, SYBR gold, ethidium bromide, acridines, proflavine,
acridine orange, acriflavine, fluorcoumanin, ellipticine,
daunomycin, chloroquine, distamycin D, chromomycin, homidium,
mithramycin, ruthenium polypyridyls, anthramycin, and the like.
[0766] In another aspect, other fluorescent labels such as sequence
specific probes can be employed in the amplification reaction to
facilitate the detection and quantification of the amplified
products. Probe-based quantitative amplification relies on the
sequence-specific detection of a desired amplified product. It
utilizes fluorescent, target-specific probes (e.g., TaqMan.RTM.
probes) resulting in increased specificity and sensitivity. Methods
for performing probe-based quantitative amplification are well
established in the art and are taught in U.S. Pat. No.
5,210,015.
[0767] In yet another aspect, conventional hybridization assays
using hybridization probes that share sequence homology with
sequences associated with a signaling biochemical pathway can be
performed. Typically, probes are allowed to form stable complexes
with the sequences associated with a signaling biochemical pathway
contained within the biological sample derived from the test
subject in a hybridization reaction. It will be appreciated by one
of skill in the art that where antisense is used as the probe
nucleic acid, the target polynucleotides provided in the sample are
chosen to be complementary to sequences of the antisense nucleic
acids. Conversely, where the nucleotide probe is a sense nucleic
acid, the target polynucleotide is selected to be complementary to
sequences of the sense nucleic acid.
[0768] Hybridization can be performed under conditions of various
stringency. Suitable hybridization conditions for the practice of
the present invention are such that the recognition interaction
between the probe and sequences associated with a signaling
biochemical pathway is both sufficiently specific and sufficiently
stable. Conditions that increase the stringency of a hybridization
reaction are widely known and published in the art. See, for
example, (Sambrook, et al., (1989); Nonradioactive In Situ
Hybridization Application Manual, Boehringer Mannheim, second
edition). The hybridization assay can be formed using probes
immobilized on any solid support, including but are not limited to
nitrocellulose, glass, silicon, and a variety of gene arrays. A
preferred hybridization assay is conducted on high-density gene
chips as described in U.S. Pat. No. 5,445,934.
[0769] For a convenient detection of the probe-target complexes
formed during the hybridization assay, the nucleotide probes are
conjugated to a detectable label. Detectable labels suitable for
use in the present invention include any composition detectable by
photochemical, biochemical, spectroscopic, immunochemical,
electrical, optical or chemical means. A wide variety of
appropriate detectable labels are known in the art, which include
fluorescent or chemiluminescent labels, radioactive isotope labels,
enzymatic or other ligands. In preferred embodiments, one will
likely desire to employ a fluorescent label or an enzyme tag, such
as digoxigenin, B-galactosidase, urease, alkaline phosphatase or
peroxidase, avidin/biotin complex.
[0770] The detection methods used to detect or quantify the
hybridization intensity will typically depend upon the label
selected above. For example, radiolabels may be detected using
photographic film or a phosphoimager. Fluorescent markers may be
detected and quantified using a photodetector to detect emitted
light. Enzymatic labels are typically detected by providing the
enzyme with a substrate and measuring the reaction product produced
by the action of the enzyme on the substrate; and finally
colorimetric labels are detected by simply visualizing the colored
label.
[0771] An agent-induced change in expression of sequences
associated with a signaling biochemical pathway can also be
determined by examining the corresponding gene products.
Determining the protein level typically involves a) contacting the
protein contained in a biological sample with an agent that
specifically bind to a protein associated with a signaling
biochemical pathway; and (b) identifying any agent:protein complex
so formed. In one aspect of this embodiment, the agent that
specifically binds a protein associated with a signaling
biochemical pathway is an antibody, preferably a monoclonal
antibody.
[0772] The reaction is performed by contacting the agent with a
sample of the proteins associated with a signaling biochemical
pathway derived from the test samples under conditions that will
allow a complex to form between the agent and the proteins
associated with a signaling biochemical pathway. The formation of
the complex can be detected directly or indirectly according to
standard procedures in the art. In the direct detection method, the
agents are supplied with a detectable label and unreacted agents
may be removed from the complex; the amount of remaining label
thereby indicating the amount of complex formed. For such method,
it is preferable to select labels that remain attached to the
agents even during stringent washing conditions. It is preferable
that the label does not interfere with the binding reaction. In the
alternative, an indirect detection procedure may use an agent that
contains a label introduced either chemically or enzymatically. A
desirable label generally does not interfere with binding or the
stability of the resulting agent:polypeptide complex. However, the
label is typically designed to be accessible to an antibody for an
effective binding and hence generating a detectable signal.
[0773] A wide variety of labels suitable for detecting protein
levels are known in the art. Non-limiting examples include
radioisotopes, enzymes, colloidal metals, fluorescent compounds,
bioluminescent compounds, and chemiluminescent compounds.
[0774] The amount of agent:polypeptide complexes formed during the
binding reaction can be quantified by standard quantitative assays.
As illustrated above, the formation of agent:polypeptide complex
can be measured directly by the amount of label remained at the
site of binding. In an alternative, the protein associated with a
signaling biochemical pathway is tested for its ability to compete
with a labeled analog for binding sites on the specific agent. In
this competitive assay, the amount of label captured is inversely
proportional to the amount of protein sequences associated with a
signaling biochemical pathway present in a test sample.
[0775] A number of techniques for protein analysis based on the
general principles outlined above are available in the art. They
include but are not limited to radioimmunoassays, ELISA (enzyme
linked immunoradiometric assays), "sandwich" immunoassays,
immunoradiometric assays, in situ immunoassays (using e.g.,
colloidal gold, enzyme or radioisotope labels), western blot
analysis, immunoprecipitation assays, immunofluorescent assays, and
SDS-PAGE.
[0776] Antibodies that specifically recognize or bind to proteins
associated with a signaling biochemical pathway are preferable for
conducting the aforementioned protein analyses. Where desired,
antibodies that recognize a specific type of post-translational
modifications (e.g., signaling biochemical pathway inducible
modifications) can be used. Post-translational modifications
include but are not limited to glycosylation, lipidation,
acetylation, and phosphorylation. These antibodies may be purchased
from commercial vendors. For example, anti-phosphotyrosine
antibodies that specifically recognize tyrosine-phosphorylated
proteins are available from a number of vendors including
Invitrogen and Perkin Elmer. Antiphosphotyrosine antibodies are
particularly useful in detecting proteins that are differentially
phosphorylated on their tyrosine residues in response to an ER
stress. Such proteins include but are not limited to eukaryotic
translation initiation factor 2 alpha (eIF-2.alpha.).
Alternatively, these antibodies can be generated using conventional
polyclonal or monoclonal antibody technologies by immunizing a host
animal or an antibody-producing cell with a target protein that
exhibits the desired post-translational modification.
[0777] In practicing the subject method, it may be desirable to
discern the expression pattern of an protein associated with a
signaling biochemical pathway in different bodily tissue, in
different cell types, and/or in different subcellular structures.
These studies can be performed with the use of tissue-specific,
cell-specific or subcellular structure specific antibodies capable
of binding to protein markers that are preferentially expressed in
certain tissues, cell types, or subcellular structures.
[0778] An altered expression of a gene associated with a signaling
biochemical pathway can also be determined by examining a change in
activity of the gene product relative to a control cell. The assay
for an agent-induced change in the activity of a protein associated
with a signaling biochemical pathway will dependent on the
biological activity and/or the signal transduction pathway that is
under investigation. For example, where the protein is a kinase, a
change in its ability to phosphorylate the downstream substrate(s)
can be determined by a variety of assays known in the art.
Representative assays include but are not limited to immunoblotting
and immunoprecipitation with antibodies such as
anti-phosphotyrosine antibodies that recognize phosphorylated
proteins. In addition, kinase activity can be detected by high
throughput chemiluminescent assays such as AlphaScreen.TM.
(available from Perkin Elmer) and eTag.TM. assay (Chan-Hui, et al.
(2003) Clinical Immunology 111: 162-174).
[0779] Where the protein associated with a signaling biochemical
pathway is part of a signaling cascade leading to a fluctuation of
intracellular pH condition, pH sensitive molecules such as
fluorescent pH dyes can be used as the reporter molecules. In
another example where the protein associated with a signaling
biochemical pathway is an ion channel, fluctuations in membrane
potential and/or intracellular ion concentration can be monitored.
A number of commercial kits and high-throughput devices are
particularly suited for a rapid and robust screening for modulators
of ion channels. Representative instruments include FLIPR.TM.
(Molecular Devices, Inc.) and VIPR (Aurora Biosciences). These
instruments are capable of detecting reactions in over 1000 sample
wells of a microplate simultaneously, and providing real-time
measurement and functional data within a second or even a
minisecond.
[0780] In practicing any of the methods disclosed herein, a
suitable vector can be introduced to a cell or an embryo via one or
more methods known in the art, including without limitation,
microinjection, electroporation, sonoporation, biolistics, calcium
phosphate-mediated transfection, cationic transfection, liposome
transfection, dendrimer transfection, heat shock transfection,
nucleofection transfection, magnetofection, lipofection,
impalefection, optical transfection, proprietary agent-enhanced
uptake of nucleic acids, and delivery via liposomes,
immunoliposomes, virosomes, or artificial virions. In some methods,
the vector is introduced into an embryo by microinjection. The
vector or vectors may be microinjected into the nucleus or the
cytoplasm of the embryo. In some methods, the vector or vectors may
be introduced into a cell by nucleofection.
[0781] The target polynucleotide of a CRISPR complex can be any
polynucleotide endogenous or exogenous to the eukaryotic cell. For
example, the target polynucleotide can be a polynucleotide residing
in the nucleus of the eukaryotic cell. The target polynucleotide
can be a sequence coding a gene product (e.g., a protein) or a
non-coding sequence (e.g., a regulatory polynucleotide or a junk
DNA).
[0782] Examples of target polynucleotides include a sequence
associated with a signaling biochemical pathway, e.g., a signaling
biochemical pathway-associated gene or polynucleotide. Examples of
target polynucleotides include a disease associated gene or
polynucleotide. A "disease-associated" gene or polynucleotide
refers to any gene or polynucleotide which is yielding
transcription or translation products at an abnormal level or in an
abnormal form in cells derived from a disease-affected tissues
compared with tissues or cells of a non disease control. It may be
a gene that becomes expressed at an abnormally high level; it may
be a gene that becomes expressed at an abnormally low level, where
the altered expression correlates with the occurrence and/or
progression of the disease. A disease-associated gene also refers
to a gene possessing mutation(s) or genetic variation that is
directly responsible or is in linkage disequilibrium with a gene(s)
that is responsible for the etiology of a disease. The transcribed
or translated products may be known or unknown, and may be at a
normal or abnormal level.
[0783] The target polynucleotide of a CRISPR complex can be any
polynucleotide endogenous or exogenous to the eukaryotic cell. For
example, the target polynucleotide can be a polynucleotide residing
in the nucleus of the eukaryotic cell. The target polynucleotide
can be a sequence coding a gene product (e.g., a protein) or a
non-coding sequence (e.g., a regulatory polynucleotide or a junk
DNA). Without wishing to be bound by theory, it is believed that
the target sequence should be associated with a PAM (protospacer
adjacent motif); that is, a short sequence recognized by the CRISPR
complex. The precise sequence and length requirements for the PAM
differ depending on the CRISPR enzyme used, but PAMs are typically
2-5 base pair sequences adjacent the protospacer (that is, the
target sequence) Examples of PAM sequences are given in the
examples section below, and the skilled person will be able to
identify further PAM sequences for use with a given CRISPR
enzyme.
[0784] The target polynucleotide of a CRISPR complex may include a
number of disease associated genes and polynucleotides as well as
signaling biochemical pathway-associated genes and polynucleotides
as listed in U.S. provisional patent applications 61/736,527 and
61/748,427 both entitled SYSTEMS METHODS AND COMPOSITIONS FOR
SEQUENCE MANIPULATION filed on Dec. 12, 2012 and Jan. 2, 2013,
respectively, and PCT Application PCT/US2013/074667, entitled
DELIVERY, ENGINEERING AND OPTIMIZATION OF SYSTEMS, METHODS AND
COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTIC
APPLICATIONS, filed Dec. 12, 2013, the contents of all of which are
herein incorporated by reference in their entirety.
[0785] Examples of target polynucleotides include a sequence
associated with a signaling biochemical pathway, e.g., a signaling
biochemical pathway-associated gene or polynucleotide. Examples of
target polynucleotides include a disease associated gene or
polynucleotide. A "disease-associated" gene or polynucleotide
refers to any gene or polynucleotide which is yielding
transcription or translation products at an abnormal level or in an
abnormal form in cells derived from a disease-affected tissues
compared with tissues or cells of a non disease control. It may be
a gene that becomes expressed at an abnormally high level; it may
be a gene that becomes expressed at an abnormally low level, where
the altered expression correlates with the occurrence and/or
progression of the disease. A disease-associated gene also refers
to a gene possessing mutation(s) or genetic variation that is
directly responsible or is in linkage disequilibrium with a gene(s)
that is responsible for the etiology of a disease. The transcribed
or translated products may be known or unknown, and may be at a
normal or abnormal level.
Genome Wide Knock-Out Screening
[0786] The CRISPR effector protein complexes described herein can
be used to perform efficient and cost effective functional genomic
screens. Such screens can utilize CRISPR effector protein based
genome wide libraries. Such screens and libraries can provide for
determining the function of genes, cellular pathways genes are
involved in, and how any alteration in gene expression can result
in a particular biological process. An advantage of the present
invention is that the CRISPR system avoids off-target binding and
its resulting side effects. This is achieved using systems arranged
to have a high degree of sequence specificity for the target DNA.
In preferred embodiments of the invention, the CRISPR effector
protein complexes are C2c2 effector protein complexes.
[0787] In embodiments of the invention, a genome wide library may
comprise a plurality of C2c2 guide RNAs, as described herein,
comprising guide sequences that are capable of targeting a
plurality of target sequences in a plurality of genomic loci in a
population of eukaryotic cells. The population of cells may be a
population of embryonic stem (ES) cells. The target sequence in the
genomic locus may be a non-coding sequence. The non-coding sequence
may be an intron, regulatory sequence, splice site, 3' UTR, 5' UTR,
or polyadenylation signal. Gene function of one or more gene
products may be altered by said targeting. The targeting may result
in a knockout of gene function. The targeting of a gene product may
comprise more than one guide RNA. A gene product may be targeted by
2, 3, 4, 5, 6, 7, 8, 9, or 10 guide RNAs, preferably 3 to 4 per
gene. Off-target modifications may be minimized by exploiting the
staggered double strand breaks generated by C2c2 effector protein
complexes or by utilizing methods analogous to those used in
CRISPR-Cas9 systems (See, e.g., DNA targeting specificity of
RNA-guided Cas9 nucleases. Hsu, P., Scott, D., Weinstein, J., Ran,
F A., Konermann, S., Agarwala, V., Li, Y., Fine, E., Wu, X.,
Shalem, O., Cradick, T J., Marraffini, L A., Bao, G., & Zhang,
F. Nat Biotechnol doi:10.1038/nbt.2647 (2013)), incorporated herein
by reference. The targeting may be of about 100 or more sequences.
The targeting may be of about 1000 or more sequences. The targeting
may be of about 20,000 or more sequences. The targeting may be of
the entire genome. The targeting may be of a panel of target
sequences focused on a relevant or desirable pathway. The pathway
may be an immune pathway. The pathway may be a cell division
pathway.
[0788] One aspect of the invention comprehends a genome or
transcriptome wide library that may comprise a plurality of C2c2
guide RNAs that may comprise guide sequences that are capable of
targeting a plurality of target sequences in a plurality of
(genomic) loci, wherein said targeting results in a
knockout/knockdown of gene function. This library may potentially
comprise guide RNAs that target each and every gene in the genome
of an organism.
[0789] In some embodiments of the invention the organism or subject
is a eukaryote (including mammal including human) or a non-human
eukaryote or a non-human animal or a non-human mammal. In some
embodiments, the organism or subject is a non-human animal, and may
be an arthropod, for example, an insect, or may be a nematode. In
some methods of the invention the organism or subject is a plant.
In some methods of the invention the organism or subject is a
mammal or a non-human mammal. A non-human mammal may be for example
a rodent (preferably a mouse or a rat), an ungulate, or a primate.
In some methods of the invention the organism or subject is algae,
including microalgae, or is a fungus.
[0790] The knockout/knockdown of gene function may comprise:
introducing into each cell in the population of cells a vector
system of one or more vectors comprising an engineered,
non-naturally occurring C2c2 effector protein system comprising I.
a C2c2 effector protein, and II. one or more guide RNAs, wherein
components I and II may be same or on different vectors of the
system, integrating components I and II into each cell, wherein the
guide sequence targets a unique gene in each cell, wherein the C2c2
effector protein is operably linked to a regulatory element,
wherein when transcribed, the guide RNA comprising the guide
sequence directs sequence-specific binding of the C2c2 effector
protein system to a target sequence corresponding to the genomic
loci of the unique gene, inducing cleavage of the RNA corresponding
to said genomic loci by the C2c2 effector protein, and confirming
different knockdown events in a plurality of unique genes in each
cell of the population of cells thereby generating a gene knockdown
cell library. The invention comprehends that the population of
cells is a population of eukaryotic cells, and in a preferred
embodiment, the population of cells is a population of embryonic
stem (ES) cells.
[0791] The one or more vectors may be plasmid vectors. The vector
may be a single vector comprising a C2c2 effector protein, a sgRNA,
and optionally, a selection marker into target cells. Not being
bound by a theory, the ability to simultaneously deliver a C2c2
effector protein and sgRNA through a single vector enables
application to any cell type of interest, without the need to first
generate cell lines that express the C2c2 effector protein. The
regulatory element may be an inducible promoter. The inducible
promoter may be a doxycycline inducible promoter. In some methods
of the invention the expression of the guide sequence is under the
control of the T7 promoter and is driven by the expression of T7
polymerase. The confirming of different knockdown events may be by
whole transcriptome sequencing. The knockout mutation may be
achieved in 100 or more unique genes. The knockdown event may be
achieved in 1000 or more unique genes. The knockdown event may be
achieved in 20,000 or more unique genes. The knockdown event may be
achieved in the entire genome. The knockdown of gene function may
be achieved in a plurality of unique genes which function in a
particular physiological pathway or condition. The pathway or
condition may be an immune pathway or condition. The pathway or
condition may be a cell division pathway or condition.
[0792] The invention also provides kits that comprise the
transcriptome wide libraries mentioned herein. The kit may comprise
a single container comprising vectors or plasmids comprising the
library of the invention. The kit may also comprise a panel
comprising a selection of unique C2c2 effector protein system guide
RNAs comprising guide sequences from the library of the invention,
wherein the selection is indicative of a particular physiological
condition. The invention comprehends that the targeting is of about
100 or more sequences, about 1000 or more sequences or about 20,000
or more sequences or the entire transcriptome. Furthermore, a panel
of target sequences may be focused on a relevant or desirable
pathway, such as an immune pathway or cell division.
[0793] In an additional aspect of the invention, the C2c2 effector
protein may comprise one or more mutations and may be used as a
generic RNA binding protein with or without fusion to a functional
domain. The mutations may be artificially introduced mutations or
gain- or loss-of-function mutations. The mutations have been
characterized as described herein. In one aspect of the invention,
the functional domain may be a transcriptional activation domain,
which may be VP64. In other aspects of the invention, the
functional domain may be a transcriptional repressor domain, which
may be KRAB or SID4X. Other aspects of the invention relate to the
mutated C2c2 effector protein being fused to domains which include
but are not limited to a transcriptional activator, repressor, a
recombinase, a transposase, a histone remodeler, a demethylase, a
DNA methyltransferase, a cryptochrome, a light
inducible/controllable domain or a chemically
inducible/controllable domain. Some methods of the invention can
include inducing expression of targeted genes. In one embodiment,
inducing expression by targeting a plurality of target sequences in
a plurality of genomic loci in a population of eukaryotic cells is
by use of a functional domain.
[0794] Useful in the practice of the instant invention utilizing
C2c2 3effector protein complexes are methods used in CRISPR-Cas9
systems and reference is made to:
[0795] Genome-Scale CRISPR-Cas9 Knockout Screening in Human Cells.
Shalem, O., Sanjana, N E., Hartenian, E., Shi, X., Scott, D A.,
Mikkelson, T., Heckl, D., Ebert, B L., Root, D E., Doench, J G.,
Zhang, F. Science Dec 12. (2013). [Epub ahead of print]; Published
in final edited form as: Science. 2014 Jan 3; 343(6166): 84-87.
[0796] Shalem et al. involves a new way to interrogate gene
function on a genome-wide scale. Their studies showed that delivery
of a genome-scale CRISPR-Cas9 knockout (GeCKO) library targeted
18,080 genes with 64,751 unique guide sequences enabled both
negative and positive selection screening in human cells. First,
the authors showed use of the GeCKO library to identify genes
essential for cell viability in cancer and pluripotent stem cells.
Next, in a melanoma model, the authors screened for genes whose
loss is involved in resistance to vemurafenib, a therapeutic that
inhibits mutant protein kinase BRAF. Their studies showed that the
highest-ranking candidates included previously validated genes NF1
and MED12 as well as novel hitsNF2, CUL3, TADA2B, and TADA1. The
authors observed a high level of consistency between independent
guide RNAs targeting the same gene and a high rate of hit
confirmation, and thus demonstrated the promise of genome-scale
screening with Cas9.
[0797] Reference is also made to US patent publication number
US20140357530; and PCT Patent Publication WO2014093701, hereby
incorporated herein by reference.
Functional Alteration and Screening
[0798] In another aspect, the present invention provides for a
method of functional evaluation and screening of genes. The use of
the CRISPR system of the present invention to precisely deliver
functional domains, to activate or repress genes or to alter
epigenetic state by precisely altering the methylation site on a a
specific locus of interest, can be with one or more guide RNAs
applied to a single cell or population of cells or with a library
applied to genome in a pool of cells ex vivo or in vivo comprising
the administration or expression of a library comprising a
plurality of guide RNAs (sgRNAs) and wherein the screening further
comprises use of a C2c2 effector protein, wherein the CRISPR
complex comprising the C2c2 effector protein is modified to
comprise a heterologous functional domain. In an aspect the
invention provides a method for screening a genome/transcriptome
comprising the administration to a host or expression in a host in
vivo of a library. In an aspect the invention provides a method as
herein discussed further comprising an activator administered to
the host or expressed in the host. In an aspect the invention
provides a method as herein discussed wherein the activator is
attached to a C2c2 effector protein. In an aspect the invention
provides a method as herein discussed wherein the activator is
attached to the N terminus or the C terminus of the C2c2 effector
protein. In an aspect the invention provides a method as herein
discussed wherein the activator is attached to a sgRNA loop. In an
aspect the invention provides a method as herein discussed further
comprising a repressor administered to the host or expressed in the
host. In an aspect the invention provides a method as herein
discussed, wherein the screening comprises affecting and detecting
gene activation, gene inhibition, or cleavage in the locus.
[0799] In an aspect, the invention provides efficient on-target
activity and minimizes off target activity. In an aspect, the
invention provides efficient on-target cleavage by C2c2 effector
protein and minimizes off-target cleavage by the C2c2 effector
protein. In an aspect, the invention provides guide specific
binding of C2c2 effector protein at a locus without DNA cleavage.
Accordingly, in an aspect, the invention provides target-specific
gene regulation. In an aspect, the invention provides guide
specific binding of C2c2 effector protein at a gene locus without
DNA cleavage. Accordingly, in an aspect, the invention provides for
cleavage at one locus and gene regulation at a different locus
using a single C2c2 effector protein. In an aspect, the invention
provides orthogonal activation and/or inhibition and/or cleavage of
multiple targets using one or more C2c2 effector protein and/or
enzyme.
[0800] In an aspect the invention provides a method as herein
discussed, wherein the host is a eukaryotic cell. In an aspect the
invention provides a method as herein discussed, wherein the host
is a mammalian cell. In an aspect the invention provides a method
as herein discussed, wherein the host is a non-human eukaryote. In
an aspect the invention provides a method as herein discussed,
wherein the non-human eukaryote is a non-human mammal. In an aspect
the invention provides a method as herein discussed, wherein the
non-human mammal is a mouse. An aspect the invention provides a
method as herein discussed comprising the delivery of the C2c2
effector protein complexes or component(s) thereof or nucleic acid
molecule(s) coding therefor, wherein said nucleic acid molecule(s)
are operatively linked to regulatory sequence(s) and expressed in
vivo. In an aspect the invention provides a method as herein
discussed wherein the expressing in vivo is via a lentivirus, an
adenovirus, or an AAV. In an aspect the invention provides a method
as herein discussed wherein the delivery is via a particle, a
nanoparticle, a lipid or a cell penetrating peptide (CPP).
[0801] In an aspect the invention provides a pair of CRISPR
complexes comprising C2c2 effector protein, each comprising a guide
RNA (sgRNA) comprising a guide sequence capable of hybridizing to a
target sequence in a genomic locus of interest in a cell, wherein
at least one loop of each sgRNA is modified by the insertion of
distinct RNA sequence(s) that bind to one or more adaptor proteins,
and wherein the adaptor protein is associated with one or more
functional domains, wherein each sgRNA of each C2c2 effector
protein complex comprises a functional domain having a DNA cleavage
activity. In an aspect the invention provides paired C2C1 or C2c3
effector protein complexes as herein-discussed, wherein the DNA
cleavage activity is due to a Fok1 nuclease.
[0802] In an aspect the invention provides a method for cutting a
target sequence in a genomic locus of interest comprising delivery
to a cell of the C2c2 effector protein complexes or component(s)
thereof or nucleic acid molecule(s) coding therefor, wherein said
nucleic acid molecule(s) are operatively linked to regulatory
sequence(s) and expressed in vivo. In an aspect the invention
provides a method as herein-discussed wherein the delivery is via a
lentivirus, an adenovirus, or an AAV. In an aspect the invention
provides a method as herein-discussed or paired C2c2 effector
protein complexes as herein-discussed wherein the target sequence
for a first complex of the pair is on a first strand of double
stranded DNA and the target sequence for a second complex of the
pair is on a second strand of double stranded DNA. In an aspect the
invention provides a method as herein-discussed or paired C2c2
effector protein complexes as herein-discussed wherein the target
sequences of the first and second complexes are in proximity to
each other such that the DNA is cut in a manner that facilitates
homology directed repair. In an aspect a herein method can further
include introducing into the cell template DNA. In an aspect a
herein method or herein paired C2c2 effector protein complexes can
involve wherein each C2c2 effector protein complex has a C2c2
effector enzyme that is mutated such that it has no more than about
5% of the nuclease activity of the C2c2 effector enzyme that is not
mutated.
[0803] In an aspect the invention provides a library, method or
complex as herein-discussed wherein the sgRNA is modified to have
at least one non-coding functional loop, e.g., wherein the at least
one non-coding functional loop is repressive; for instance, wherein
the at least one non-coding functional loop comprises Alu.
[0804] In one aspect, the invention provides a method for altering
or modifying expression of a gene product. The said method may
comprise introducing into a cell containing and expressing a DNA
molecule encoding the gene product an engineered, non-naturally
occurring CRISPR system comprising a C2c2 effector protein and
guide RNA that targets the DNA molecule, whereby the guide RNA
targets the DNA molecule encoding the gene product and the C2c2
effector protein cleaves the DNA molecule encoding the gene
product, whereby expression of the gene product is altered; and,
wherein the C2c2 effector protein and the guide RNA do not
naturally occur together. The invention comprehends the guide RNA
comprising a guide sequence linked to a direct repeat sequence. The
invention further comprehends the C2c2 effector protein being codon
optimized for expression in a Eukaryotic cell. In a preferred
embodiment the Eukaryotic cell is a mammalian cell and in a more
preferred embodiment the mammalian cell is a human cell. In a
further embodiment of the invention, the expression of the gene
product is decreased.
[0805] In some embodiments, one or more functional domains are
associated with the C2c2 effector protein. In some embodiments, one
or more functional domains are associated with an adaptor protein,
for example as used with the modified guides of Konnerman et al.
(Nature 517, 583-588, 29 Jan. 2015). In some embodiments, one or
more functional domains are associated with an dead sgRNA (dRNA).
In some embodiments, a dRNA complex with active C2c2 effector
protein directs gene regulation by a functional domain at on gene
locus while an sgRNA directs DNA cleavage by the active C2c2
effector protein at another locus, for example as described
analogously in CRISPR-Cas9 systems by Dahlman et al., `Orthogonal
gene control with a catalytically active Cas9 nuclease` (in press).
In some embodiments, dRNAs are selected to maximize selectivity of
regulation for a gene locus of interest compared to off-target
regulation. In some embodiments, dRNAs are selected to maximize
target gene regulation and minimize target cleavage
[0806] For the purposes of the following discussion, reference to a
functional domain could be a functional domain associated with the
C2c2 effector protein or a functional domain associated with the
adaptor protein.
[0807] In some embodiments, the one or more functional domains is
an NLS (Nuclear Localization Sequence) or an NES (Nuclear Export
Signal). In some embodiments, the one or more functional domains is
a transcriptional activation domain comprises VP64, p65, MyoD1,
HSF1, RTA, SET7/9 and a histone acetyltransferase. Other references
herein to activation (or activator) domains in respect of those
associated with the CRISPR enzyme include any known transcriptional
activation domain and specifically VP64, p65, MyoD1, HSF1, RTA,
SET7/9 or a histone acetyltransferase.
[0808] In some embodiments, the one or more functional domains is a
transcriptional repressor domain. In some embodiments, the
transcriptional repressor domain is a KRAB domain. In some
embodiments, the transcriptional repressor domain is a NuE domain,
NcoR domain, SID domain or a SID4X domain.
[0809] In some embodiments, the one or more functional domains have
one or more activities comprising translation activation activity,
translation repression activity, methylase activity, demethylase
activity, transcription activation activity, transcription
repression activity, transcription release factor activity, histone
modification activity, RNA cleavage activity, DNA cleavage
activity, DNA integration activity or nucleic acid binding
activity.
[0810] Histone modifying domains are also preferred in some
embodiments. Exemplary histone modifying domains are discussed
below. Transposase domains, HR (Homologous Recombination) machinery
domains, recombinase domains, and/or integrase domains are also
preferred as the present functional domains. In some embodiments,
DNA integration activity includes HR machinery domains, integrase
domains, recombinase domains and/or transposase domains. Histone
acetyltransferases are preferred in some embodiments.
[0811] In some embodiments, the DNA cleavage activity is due to a
nuclease. In some embodiments, the nuclease comprises a Fok1
nuclease. See, "Dimeric CRISPR RNA-guided FokI nucleases for highly
specific genome editing", Shengdar Q. Tsai, Nicolas Wyvekens, Cyd
Khayter, Jennifer A. Foden, Vishal Thapar, Deepak Reyon, Mathew J.
Goodwin, Martin J. Aryee, J. Keith Joung Nature Biotechnology
32(6): 569-77 (2014), relates to dimeric RNA-guided FokI Nucleases
that recognize extended sequences and can edit endogenous genes
with high efficiencies in human cells.
[0812] In some embodiments, the one or more functional domains is
attached to the C2c2 effector protein so that upon binding to the
sgRNA and target the functional domain is in a spatial orientation
allowing for the functional domain to function in its attributed
function.
[0813] In some embodiments, the one or more functional domains is
attached to the adaptor protein so that upon binding of the C2c2
effector protein to the sgRNA and target, the functional domain is
in a spatial orientation allowing for the functional domain to
function in its attributed function.
[0814] In an aspect the invention provides a composition as herein
discussed wherein the one or more functional domains is attached to
the C2c2 effector protein or adaptor protein via a linker,
optionally a GlySer linker, as discussed herein.
[0815] Endogenous transcriptional repression is often mediated by
chromatin modifying enzymes such as histone methyltransferases
(HMTs) and deacetylases (HDACs). Repressive histone effector
domains are known and an exemplary list is provided below. In the
exemplary table, preference was given to proteins and functional
truncations of small size to facilitate efficient viral packaging
(for instance via AAV). In general, however, the domains may
include HDACs, histone methyltransferases (HMTs), and histone
acetyltransferase (HAT) inhibitors, as well as HDAC and HMT
recruiting proteins. The functional domain may be or include, in
some embodiments, HDAC Effector Domains, HDAC Recruiter Effector
Domains, Histone Methyltransferase (HMT) Effector Domains, Histone
Methyltransferase (HMT) Recruiter Effector Domains, or Histone
Acetyltransferase Inhibitor Effector Domains.
TABLE-US-00003 HDAC Effector Domains Full Selected Final Subtype/
Substrate Modification size truncation size Catalytic Complex Name
(if known) (if known) Organism (aa) (aa) (aa) domain HDAC I HDAC8
-- -- X. laevis 325 1-325 325 1-272: HDAC HDAC I RPD3 -- -- S.
cerevisiae 433 19-340 322 19-331: (Vannier) HDAC HDAC IV MesoLo4 --
-- M. loti 300 1-300 300 -- (Gregoretti) HDAC IV HDAC11 -- -- H.
sapiens 347 1-347 (Gao) 347 14-326: HDAC HD2 HDT1 -- -- A. thaliana
245 1-211 (Wu) 211 -- SIRT I SIRT3 H3K9Ac -- H. sapiens 399 143-399
257 126-382: H4K16Ac (Scher) SIRT H3K56Ac SIRT I HST2 -- -- C.
albicans 331 1-331 (Hnisz) 331 -- SIRT I CobB -- -- E. coli (K12)
242 1-242 (Landry) 242 -- SIRT I HST2 -- -- S. cerevisiae 357 8-298
(Wilson) 291 -- SIRT III SIRT5 H4K8Ac -- H. sapiens 310 37-310
(Gertz) 274 41-309: H4K16Ac SIRT SIRT III Sir2A -- -- P. falciparum
273 1-273 (Zhu) 273 19-273: SIRT SIRT IV SIRT6 H3K9Ac -- H. sapiens
355 1-289 289 35-274: H3K56Ac (Tennen) SIRT
[0816] Accordingly, the repressor domains of the present invention
may be selected from histone methyltransferases (HMTs), histone
deacetylases (HDACs), histone acetyltransferase (HAT) inhibitors,
as well as HDAC and HMT recruiting proteins.
[0817] The HDAC domain may be any of those in the table above,
namely: HDAC8, RPD3, MesoLo4, HDAC11, HDT1, SIRT3, HST2, CobB,
HST2, SIRT5, Sir2A, or SIRT6.
[0818] In some embodiment, the functional domain may be a HDAC
Recruiter Effector Domain. Preferred examples include those in the
Table below, namely MeCP2, MBD2b, Sin3a, NcoR, SALL1, RCOR1. NcoR
is exemplified in the present Examples and, although preferred, it
is envisaged that others in the class will also be useful.
TABLE-US-00004 Table of HDAC Recruiter Effector Domains Full
Selected Final Subtype/ Substrate Modification size truncation size
Catalytic Complex Name (if known) (if known) Organism (aa) (aa)
(aa) domain Sin3a MeCP2 -- -- R. norvegicus 492 207-492 (Nan) 286
-- Sin3a MBD2b -- -- H. sapiens 262 45-262 (Boeke) 218 -- Sin3a
Sin3a -- -- H. sapiens 1273 524-851 (Laherty) 328 627-829: HDAC1
interaction NcoR NcoR -- -- H. sapiens 2440 420-488 (Zhang) 69 --
NuRD SALL1 -- -- M. musculus 1322 1-93 (Lauberth) 93 -- CoREST
RCOR1 -- -- H. sapiens 482 81-300 (Gu, 220 -- Ouyang)
[0819] In some embodiment, the functional domain may be a
Methyltransferase (HMT) Effector Domain. Preferred examples include
those in the Table below, namely NUE, vSET, EHMT2/G9A, SUV39H1,
dim-5, KYP, SUVR4, SET4, SET1, SETD8, and TgSET8. NUE is
exemplified in the present Examples and, although preferred, it is
envisaged that others in the class will also be useful.
TABLE-US-00005 Table of Histone Methyltransferase (HMT) Effector
Domains Full Selected Final Subtype/ Substrate Modification size
truncation size Catalytic Complex Name (if known) (if known)
Organism (aa) (aa) (aa) domain SET NUE H2B, H3, -- C. trachomatis
219 1-219 219 -- H4 (Pennini) SET vSET -- H3K27me3 P. bursaria 119
1-119 119 4-112: SET2 chlorella virus (Mujtaba) SUV39 EHMT2/
H1.4K2, H3K9me1/2, M. musculus 1263 969-1263 295 1025-1233: family
G9A H3K9, H1K25me1 (Tachibana) preSET, SET, H3K27 postSET SUV39
SUV39H1 -- H3K9me2/3 H. sapiens 412 79-412 334 172-412: (Snowden)
preSET, SET, postSET Suvar3-9 dim-5 -- H3K9me3 N. crassa 331 1-331
331 77-331: preSET, (Rathert) SET, postSET Suvar3-9 KYP --
H3K9me1/2 A. thaliana 624 335-601 267 -- (SUVH (Jackson) subfamily)
Suvar3-9 SUVR4 H3K9me1 H3K9me2/3 A. thaliana 492 180-492 313
192-462: (SUVR (Thorstensen) preSET, SET, subfamily) postSET
Suvar4-20 SET4 -- H4K20me3 C. elegans 288 1-288 (Vielle) 288 --
SET8 SET1 -- H4K20me1 C. elegans 242 1-242 (Vielle) 242 -- SET8
SETD8 -- H4K20me1 H. sapiens 393 185-393 209 256-382: SET (Couture)
SET8 TgSET8 -- H4K20me1/2/3 T. gondii 1893 1590-1893 (Sautel) 304
1749-1884: SET
[0820] In some embodiment, the functional domain may be a Histone
Methyltransferase (HMT) Recruiter Effector Domain. Preferred
examples include those in the Table below, namely Hp1a, PHF19, and
NIPP1.
TABLE-US-00006 Table of Histone Methyltransferase (HMT) Recruiter
Effector Domains Full Selected Final Subtype/ Substrate
Modification size truncation size Catalytic Complex Name (if known)
(if known) Organism (aa) (aa) (aa) domain -- Hp1a -- H3K9me3 M.
musculus 191 73-191 119 121-179: (Hathaway) chromoshadow -- PHF19
-- H3K27me3 H. sapiens 580 (1-250) + 335 163-250: PHD2 GGSG
(Ballare) linker + (500-580) -- NIPP1 -- H3K27me3 H. sapiens 351
1-329 (Jin) 329 310-329: EED
[0821] In some embodiment, the functional domain may be Histone
Acetyltransferase Inhibitor Effector Domain. Preferred examples
include SET/TAF-1.beta. listed in the Table below.
TABLE-US-00007 Table of Histone Acetyltransferase Inhibitor
Effector Domains Full Selected Final Subtype/ Substrate
Modification size truncation size Catalytic Complex Name (if known)
(if known) Organism (aa) (aa) (aa) domain -- SET/TAF-1.beta. -- --
M. musculus 289 1-289 289 -- (Cervoni)
[0822] It is also preferred to target endogenous (regulatory)
control elements, such as involved in translation, stability, or
where applicable (enhancers and silencers) in addition to a
promoter or promoter-proximal elements. Thus, the invention can
also be used to target endogenous control elements (including
enhancers and silencers) in addition to targeting of the promoter.
These control elements can be located upstream and downstream of
the transcriptional start site (TSS), starting from 200 bp from the
TSS to 100 kb away. Targeting of known control elements can be used
to activate or repress the gene of interest. In some cases, a
single control element can influence the transcription of multiple
target genes. Targeting of a single control element could therefore
be used to control the transcription of multiple genes
simultaneously.
[0823] Targeting of putative control elements on the other hand
(e.g. by tiling the region of the putative control element as well
as 200 bp up to 100 kB around the element) can be used as a means
to verify such elements (by measuring the transcription of the gene
of interest) or to detect novel control elements (e.g. by tiling
100 kb upstream and downstream of the TSS of the gene of interest).
In addition, targeting of putative control elements can be useful
in the context of understanding genetic causes of disease. Many
mutations and common SNP variants associated with disease
phenotypes are located outside coding regions. Targeting of such
regions with either the activation or repression systems described
herein can be followed by readout of transcription of either a) a
set of putative targets (e.g. a set of genes located in closest
proximity to the control element) or b) whole-transcriptome readout
by e.g. RNAseq or microarray. This would allow for the
identification of likely candidate genes involved in the disease
phenotype. Such candidate genes could be useful as novel drug
targets.
[0824] Histone acetyltransferase (HAT) inhibitors are mentioned
herein. However, an alternative in some embodiments is for the one
or more functional domains to comprise an acetyltransferase,
preferably a histone acetyltransferase. These are useful in the
field of epigenomics, for example in methods of interrogating the
epigenome. Methods of interrogating the epigenome may include, for
example, targeting epigenomic sequences. Targeting epigenomic
sequences may include the guide being directed to an epigenomic
target sequence. Epigenomic target sequence may include, in some
embodiments, include a promoter, silencer or an enhancer
sequence.
[0825] Use of a functional domain linked to a C2c2 effector protein
as described herein, preferably a dead-C2c2 effector protein, more
preferably a dead-FnC2c2 effector protein, to target epigenomic
sequences can be used to activate or repress promoters, silencer or
enhancers.
[0826] Examples of acetyltransferases are known but may include, in
some embodiments, histone acetyltransferases. In some embodiments,
the histone acetyltransferase may comprise the catalytic core of
the human acetyltransferase p300 (Gerbasch & Reddy, Nature
Biotech 6th April 2015).
[0827] In some preferred embodiments, the functional domain is
linked to a dead-C2c2 effector protein to target and activate
epigenomic sequences such as promoters or enhancers. One or more
guides directed to such promoters or enhancers may also be provided
to direct the binding of the CRISPR enzyme to such promoters or
enhancers.
[0828] In certain embodiments, the RNA targeting effector protein
of the invention can be used to interfere with co-transcriptional
modifications of DNA/chromatin structure, RNA-directed DNA
methylation, or RNA-directed silencing/activation of DNA/chromatin.
RNA-directed DNA methylation (RdDM) is an epigenetic process first
discovered in plants. During RdDM, double-stranded RNAs (dsRNAs)
are processed to 21-24 nucleotide small interfering RNAs (siRNAs)
and guide methylation of homologous DNA loci. Besides RNA
molecules, a plethora of proteins are involved in the establishment
of RdDM, like Argonautes, DNA methyltransferases, chromatin
remodelling complexes and the plant-specific PolIV and PolV. All
these act in concert to add a methyl-group at the 5' position of
cytosines. Small RNAs can modify the chromatin structure and
silence transcription by guiding Argonaute-containing complexes to
complementary nascent (non-coding) RNA transcripts. Subsequently
the recruitment of chromatin-modifying complexes, including histone
and DNA methyltransferases, is mediated. The RNA targeting effector
protein of the invention may be used to target such small RNAs and
interfere in interactions between these small RNAs and the nascent
non-coding transcripts.
[0829] The term "associated with" is used here in relation to the
association of the functional domain to the C2c2 effector protein
or the adaptor protein. It is used in respect of how one molecule
`associates` with respect to another, for example between an
adaptor protein and a functional domain, or between the C2c2
effector protein and a functional domain. In the case of such
protein-protein interactions, this association may be viewed in
terms of recognition in the way an antibody recognizes an epitope.
Alternatively, one protein may be associated with another protein
via a fusion of the two, for instance one subunit being fused to
another subunit. Fusion typically occurs by addition of the amino
acid sequence of one to that of the other, for instance via
splicing together of the nucleotide sequences that encode each
protein or subunit. Alternatively, this may essentially be viewed
as binding between two molecules or direct linkage, such as a
fusion protein. In any event, the fusion protein may include a
linker between the two subunits of interest (i.e. between the
enzyme and the functional domain or between the adaptor protein and
the functional domain). Thus, in some embodiments, the C2c2
effector protein or adaptor protein is associated with a functional
domain by binding thereto. In other embodiments, the C2c2 effector
protein or adaptor protein is associated with a functional domain
because the two are fused together, optionally via an intermediate
linker.
Saturating Mutagenesis
[0830] The C2c2 effector protein system(s) described herein can be
used to perform saturating or deep scanning mutagenesis of genomic
loci in conjunction with a cellular phenotype--for instance, for
determining critical minimal features and discrete vulnerabilities
of functional elements required for gene expression, drug
resistance, and reversal of disease. By saturating or deep scanning
mutagenesis is meant that every or essentially every DNA base is
cut within the genomic loci. A library of C2c2 effector protein
guide RNAs may be introduced into a population of cells. The
library may be introduced, such that each cell receives a single
guide RNA (sgRNA). In the case where the library is introduced by
transduction of a viral vector, as described herein, a low
multiplicity of infection (MOI) is used. The library may include
sgRNAs targeting every sequence upstream of a (protospacer adjacent
motif) (PAM) sequence in a genomic locus. The library may include
at least 100 non-overlapping genomic sequences upstream of a PAM
sequence for every 1000 base pairs within the genomic locus. The
library may include sgRNAs targeting sequences upstream of at least
one different PAM sequence. The C2c2 effector protein systems may
include more than one C2c2 protein. Any C2c2 effector protein as
described herein, including orthologues or engineered C2c2 effector
proteins that recognize different PAM sequences may be used. The
frequency of off target sites for a sgRNA may be less than 500. Off
target scores may be generated to select sgRNAs with the lowest off
target sites. Any phenotype determined to be associated with
cutting at a sgRNA target site may be confirmed by using sgRNAs
targeting the same site in a single experiment. Validation of a
target site may also be performed by using a modified C2c2 effector
protein, as described herein, and two sgRNAs targeting the genomic
site of interest. Not being bound by a theory, a target site is a
true hit if the change in phenotype is observed in validation
experiments.
[0831] With respect to the DNA-targeting proteins disclosed herein,
the genomic loci may include at least one continuous genomic
region. The at least one continuous genomic region may comprise up
to the entire genome. The at least one continuous genomic region
may comprise a functional element of the genome. The functional
element may be within a non-coding region, coding gene, intronic
region, promoter, or enhancer. The at least one continuous genomic
region may comprise at least 1 kb, preferably at least 50 kb of
genomic DNA. The at least one continuous genomic region may
comprise a transcription factor binding site. The at least one
continuous genomic region may comprise a region of DNase I
hypersensitivity. The at least one continuous genomic region may
comprise a transcription enhancer or repressor element. The at
least one continuous genomic region may comprise a site enriched
for an epigenetic signature. The at least one continuous genomic
DNA region may comprise an epigenetic insulator. The at least one
continuous genomic region may comprise two or more continuous
genomic regions that physically interact. Genomic regions that
interact may be determined by `4C technology`. 4C technology allows
the screening of the entire genome in an unbiased manner for DNA
segments that physically interact with a DNA fragment of choice, as
is described in Zhao et al. ((2006) Nat Genet 38, 1341-7) and in
U.S. Pat. No. 8,642,295, both incorporated herein by reference in
its entirety. The epigenetic signature may be histone acetylation,
histone methylation, histone ubiquitination, histone
phosphorylation, DNA methylation, or a lack thereof.
[0832] The C2c2 effector protein system(s) for saturating or deep
scanning mutagenesis can be used in a population of cells. The C2c2
effector protein system(s) can be used in eukaryotic cells,
including but not limited to mammalian and plant cells. The
population of cells may be prokaryotic cells. The population of
eukaryotic cells may be a population of embryonic stem (ES) cells,
neuronal cells, epithelial cells, immune cells, endocrine cells,
muscle cells, erythrocytes, lymphocytes, plant cells, or yeast
cells.
[0833] In one aspect, the present invention provides for a method
of screening for functional elements associated with a change in a
phenotype. The library may be introduced into a population of cells
that are adapted to contain a C2c2 effector protein. The cells may
be sorted into at least two groups based on the phenotype. The
phenotype may be expression of a gene, cell growth, or cell
viability. The relative representation of the guide RNAs present in
each group are determined, whereby genomic sites associated with
the change in phenotype are determined by the representation of
guide RNAs present in each group. The change in phenotype may be a
change in expression of a gene of interest. The gene of interest
may be upregulated, downregulated, or knocked out. The cells may be
sorted into a high expression group and a low expression group. The
population of cells may include a reporter construct that is used
to determine the phenotype. The reporter construct may include a
detectable marker. Cells may be sorted by use of the detectable
marker.
[0834] In another aspect, the present invention provides for a
method of screening for genomic sites associated with resistance to
a chemical compound. The chemical compound may be a drug or
pesticide. The library may be introduced into a population of cells
that are adapted to contain a C2c2 effector protein, wherein each
cell of the population contains no more than one guide RNA; the
population of cells are treated with the chemical compound; and the
representation of guide RNAs are determined after treatment with
the chemical compound at a later time point as compared to an early
time point, whereby genomic sites associated with resistance to the
chemical compound are determined by enrichment of guide RNAs.
Representation of sgRNAs may be determined by deep sequencing
methods.
[0835] Useful in the practice of the instant invention utilizing
C2c2effector protein complexes are methods used in CRISPR-Cas9
systems and reference is made to the article entitled BCL11A
enhancer dissection by Cas9-mediated in situ saturating
mutagenesis. Canver, M. C., Smith,E. C., Sher, F., Pinello, L.,
Sanjana, N. E., Shalem, O., Chen, D. D., Schupp, P. G., Vinjamur,
D. S., Garcia, S. P., Luc, S., Kurita, R., Nakamura, Y., Fujiwara,
Y., Maeda, T., Yuan, G., Zhang, F., Orkin, S. H., & Bauer, D.
E. DOI:10.1038/nature15521, published online Sep. 16, 2015, the
article is herein incorporated by reference and discussed briefly
below:
[0836] Canver et al. involves novel pooled CRISPR-Cas9 guide RNA
libraries to perform in situ saturating mutagenesis of the human
and mouse BCL11A erythroid enhancers previously identified as an
enhancer associated with fetal hemoglobin (HbF) level and whose
mouse ortholog is necessary for erythroid BCL11A expression. This
approach revealed critical minimal features and discrete
vulnerabilities of these enhancers. Through editing of primary
human progenitors and mouse transgenesis, the authors validated the
BCL11A erythroid enhancer as a target for HbF reinduction. The
authors generated a detailed enhancer map that informs therapeutic
genome editing.
Method of Using C2c2 Systems to Modify a Cell or Organism
[0837] The invention in some embodiments comprehends a method of
modifying a cell or organism. The cell may be a prokaryotic cell or
a eukaryotic cell. The cell may be a mammalian cell. The mammalian
cell many be a non-human primate, bovine, porcine, rodent or mouse
cell. The cell may be a non-mammalian eukaryotic cell such as
poultry, fish or shrimp. The cell may also be a plant cell. The
plant cell may be of a crop plant such as cassava, corn, sorghum,
wheat, or rice. The plant cell may also be of an algae, tree or
vegetable. The modification introduced to the cell by the present
invention may be such that the cell and progeny of the cell are
altered for improved production of biologic products such as an
antibody, starch, alcohol or other desired cellular output. The
modification introduced to the cell by the present invention may be
such that the cell and progeny of the cell include an alteration
that changes the biologic product produced.
[0838] The system may comprise one or more different vectors. In an
aspect of the invention, the effector protein is codon optimized
for expression the desired cell type, preferentially a eukaryotic
cell, preferably a mammalian cell or a human cell.
[0839] Packaging cells are typically used to form virus particles
that are capable of infecting a host cell. Such cells include 293
cells, which package adenovirus, and W2 cells or PA317 cells, which
package retrovirus. Viral vectors used in gene therapy are usually
generated by producing a cell line that packages a nucleic acid
vector into a viral particle. The vectors typically contain the
minimal viral sequences required for packaging and subsequent
integration into a host, other viral sequences being replaced by an
expression cassette for the polynucleotide(s) to be expressed. The
missing viral functions are typically supplied in trans by the
packaging cell line. For example, AAV vectors used in gene therapy
typically only possess ITR sequences from the AAV genome which are
required for packaging and integration into the host genome. Viral
DNA is packaged in a cell line, which contains a helper plasmid
encoding the other AAV genes, namely rep and cap, but lacking ITR
sequences. The cell line may also be infected with adenovirus as a
helper. The helper virus promotes replication of the AAV vector and
expression of AAV genes from the helper plasmid. The helper plasmid
is not packaged in significant amounts due to a lack of ITR
sequences. Contamination with adenovirus can be reduced by, e.g.,
heat treatment to which adenovirus is more sensitive than AAV.
Additional methods for the delivery of nucleic acids to cells are
known to those skilled in the art. See, for example, US20030087817,
incorporated herein by reference.
[0840] In some embodiments, a host cell is transiently or
non-transiently transfected with one or more vectors described
herein. In some embodiments, a cell is transfected as it naturally
occurs in a subject. In some embodiments, a cell that is
transfected is taken from a subject. In some embodiments, the cell
is derived from cells taken from a subject, such as a cell line. A
wide variety of cell lines for tissue culture are known in the art.
Examples of cell lines include, but are not limited to, C8161,
CCRF-CEM, MOLT, mIMCD-3, NHDF, HeLa-S3, Huh1, Huh4, Huh7, HUVEC,
HASMC, HEKn, HEKa, MiaPaCell, Panc1, PC-3, TF1, CTLL-2, CIR, Rat6,
CV1, RPTE, A10, T24, J82, A375, ARH-77, Calu1, SW480, SW620, SKOV3,
SK-UT, CaCo2, P388D1, SEM-K2, WEHI-231, HB56, TIB55, Jurkat,
J45.01, LRMB, Bcl-1, BC-3, IC21, DLD2, Raw264.7, NRK, NRK-52E,
MRC5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1, COS-6, COS-M6A,
BS-C-1 monkey kidney epithelial, BALB/3T3 mouse embryo fibroblast,
3T3 Swiss, 3T3-L1, 132-d5 human fetal fibroblasts; 10.1 mouse
fibroblasts, 293-T, 3T3, 721, 9L, A2780, A2780ADR, A2780cis, A172,
A20, A253, A431, A-549, ALC, B16, B35, BCP-1 cells, BEAS-2B,
bEnd.3, BHK-21, BR 293, BxPC3, C3H-10T1/2, C6/36, Cal-27, CHO,
CHO-7, CHO-IR, CHO-KI, CHO-K2, CHO-T, CHO Dhfr-/-, COR-L23,
COR-L23/CPR, COR-L23/5010, COR-L23/R23, COS-7, COV-434, CML T1,
CMT, CT26, D17, DH82, DU145, DuCaP, EL4, EM2, EM3, EMT6/AR1,
EMT6/AR10.0, FM3, H1299, H69, HB54, HB55, HCA2, HEK-293, HeLa,
Hepalclc7, HL-60, HMEC, HT-29, Jurkat, JY cells, K562 cells, Ku812,
KCL22, KG1, KYO1, LNCap, Ma-Mel 1-48, MC-38, MCF-7, MCF-10A,
MDA-MB-231, MDA-MB-468, MDA-MB-435, MDCK II, MDCK II, MOR/0.2R,
MONO-MAC 6, MTD-1A, MyEnd, NCI-H69/CPR, NCI-H69/LX10, NCI-H69/LX20,
NCI-H69/LX4, NIH-3T3, NALM-1, NW-145, OPCN/OPCT cell lines, Peer,
PNT-1A/PNT 2, RenCa, RIN-5F, RMA/RMAS, Saos-2 cells, Sf-9, SkBr3,
T2, T-47D, T84, THP1 cell line, U373, U87, U937, VCaP, Vero cells,
WM39, WT-49, X63, YAC-1, YAR, and transgenic varieties thereof.
Cell lines are available from a variety of sources known to those
with skill in the art (see, e.g., the American Type Culture
Collection (ATCC) (Manassas, Va.)). In some embodiments, a cell
transfected with one or more vectors described herein is used to
establish a new cell line comprising one or more vector-derived
sequences. In some embodiments, a cell transiently transfected with
the components of a nucleic acid-targeting system as described
herein (such as by transient transfection of one or more vectors,
or transfection with RNA), and modified through the activity of a
nucleic acid-targeting complex, is used to establish a new cell
line comprising cells containing the modification but lacking any
other exogenous sequence. In some embodiments, cells transiently or
non-transiently transfected with one or more vectors described
herein, or cell lines derived from such cells are used in assessing
one or more test compounds.
[0841] In some embodiments, one or more vectors described herein
are used to produce a non-human transgenic animal or transgenic
plant. In some embodiments, the transgenic animal is a mammal, such
as a mouse, rat, or rabbit. In certain embodiments, the organism or
subject is a plant. In certain embodiments, the organism or subject
or plant is algae. Methods for producing transgenic plants and
animals are known in the art, and generally begin with a method of
cell transfection, such as described herein.
[0842] In one aspect, the invention provides for methods of
modifying a target polynucleotide in a eukaryotic cell. In some
embodiments, the method comprises allowing a nucleic acid-targeting
complex to bind to the target polynucleotide to effect cleavage of
said target polynucleotide thereby modifying the target
polynucleotide, wherein the nucleic acid-targeting complex
comprises a nucleic acid-targeting effector protein complexed with
a guide RNA hybridized to a target sequence within said target
polynucleotide.
[0843] In one aspect, the invention provides a method of modifying
expression of a polynucleotide in a eukaryotic cell. In some
embodiments, the method comprises allowing a nucleic acid-targeting
complex to bind to the polynucleotide such that said binding
results in increased or decreased expression of said
polynucleotide; wherein the nucleic acid-targeting complex
comprises a nucleic acid-targeting effector protein complexed with
a guide RNA hybridized to a target sequence within said
polynucleotide.
C2c2 Effector Protein Complexes can be Used in Plants
[0844] The C2c2 effector protein system(s) (e.g., single or
multiplexed) can be used in conjunction with recent advances in
crop genomics. The systems described herein can be used to perform
efficient and cost effective plant gene or genome interrogation or
editing or manipulation--for instance, for rapid investigation
and/or selection and/or interrogations and/or comparison and/or
manipulations and/or transformation of plant genes or genomes;
e.g., to create, identify, develop, optimize, or confer trait(s) or
characteristic(s) to plant(s) or to transform a plant genome. There
can accordingly be improved production of plants, new plants with
new combinations of traits or characteristics or new plants with
enhanced traits. The C2c2 effector protein system(s) can be used
with regard to plants in Site-Directed Integration (SDI) or Gene
Editing (GE) or any Near Reverse Breeding (NRB) or Reverse Breeding
(RB) techniques. Aspects of utilizing the herein described C2c2
effector protein systems may be analogous to the use of the
CRISPR-Cas (e.g. CRISPR-Cas9) system in plants, and mention is made
of the University of Arizona website "CRISPR-PLANT"
(www.genome.arizona.edu/crispr/) (supported by Penn State and AGI).
Embodiments of the invention can be used in genome editing in
plants or where RNAi or similar genome editing techniques have been
used previously; see, e.g., Nekrasov, "Plant genome editing made
easy: targeted mutagenesis in model and crop plants using the
CRISPR-Cas system," Plant Methods 2013, 9:39
(doi:10.1186/1746-4811-9-39); Brooks, "Efficient gene editing in
tomato in the first generation using the CRISPR-Cas9 system," Plant
Physiology September 2014 pp 114.247577; Shan, "Targeted genome
modification of crop plants using a CRISPR-Cas system," Nature
Biotechnology 31, 686-688 (2013); Feng, "Efficient genome editing
in plants using a CRISPR/Cas system," Cell Research (2013)
23:1229-1232. doi: 10. 1038/cr.2013.114; published online 20 Aug.
2013; Xie, "RNA-guided genome editing in plants using a CRISPR-Cas
system," Mol Plant. 2013 November; 6(6): 1975-83. doi: 10.
1093/mp/sst119. Epub 2013 Aug 17; Xu, "Gene targeting using the
Agrobacterium tumefaciens-mediated CRISPR-Cas system in rice," Rice
2014, 7:5 (2014), Zhou et al., "Exploiting SNPs for biallelic
CRISPR mutations in the outcrossing woody perennial Populus reveals
4-coumarate: CoA ligase specificity and Redundancy," New
Phytologist (2015) (Forum) 1-4 (available online only at
www.newphytologist.com); Caliando et al, "Targeted DNA degradation
using a CRISPR device stably carried in the host genome, NATURE
COMMUNICATIONS 6:6989, DOI: 10.1038/ncomms7989,
www.nature.com/naturecommunications DOI: 10.1038/ncomms7989; U.S.
Pat. No. 6,603,061--Agrobacterium-Mediated Plant Transformation
Method; U.S. Pat. No. 7,868,149--Plant Genome Sequences and Uses
Thereof and US 2009/0100536--Transgenic Plants with Enhanced
Agronomic Traits, all the contents and disclosure of each of which
are herein incorporated by reference in their entirety. In the
practice of the invention, the contents and disclosure of Morrell
et al "Crop genomics: advances and applications," Nat Rev Genet.
2011 Dec 29; 13(2):85-96; each of which is incorporated by
reference herein including as to how herein embodiments may be used
as to plants. Accordingly, reference herein to animal cells may
also apply, mutatis mutandis, to plant cells unless otherwise
apparent; and, the enzymes herein having reduced off-target effects
and systems employing such enzymes can be used in plant
applications, including those mentioned herein.
[0845] Sugano et al. (Plant Cell Physiol. 2014 March; 55(3):475-81.
doi: 10.1093/pcp/pcu014. Epub 2014 Jan 18) reports the application
of CRISPR-Cas9 to targeted mutagenesis in the liverwort Marchantia
polymorpha L., which has emerged as a model species for studying
land plant evolution. The U6 promoter of M. polymorpha was
identified and cloned to express the gRNA. The target sequence of
the gRNA was designed to disrupt the gene encoding auxin response
factor 1 (ARF1) in M. polymorpha. Using Agrobacterium-mediated
transformation, Sugano et al. isolated stable mutants in the
gametophyte generation of M. polymorpha. CRISPR-Cas9-based
site-directed mutagenesis in vivo was achieved using either the
Cauliflower mosaic virus 35S or M. polymorpha EF1.alpha. promoter
to express Cas9. Isolated mutant individuals showing an
auxin-resistant phenotype were not chimeric. Moreover, stable
mutants were produced by asexual reproduction of T1 plants.
Multiple arf1 alleles were easily established using
CRIPSR/Cas9-based targeted mutagenesis. The C2c2 systems of the
present invention can be used to regulate the same as well as other
genes, and like expression control systems such as RNAi and siRNA,
the method of the invention can be inducible and reversible.
[0846] Kabadi et al. (Nucleic Acids Res. 2014 Oct 29; 42(19):e147.
doi: 10. 1093/nar/gku749. Epub 2014 Aug 13) developed a single
lentiviral system to express a Cas9 variant, a reporter gene and up
to four sgRNAs from independent RNA polymerase III promoters that
are incorporated into the vector by a convenient Golden Gate
cloning method. Each sgRNA was efficiently expressed and can
mediate multiplex gene editing and sustained transcriptional
activation in immortalized and primary human cells. The instant
invention can be used to regulate the plant genes of Kabadi.
[0847] Xing et al. (BMC Plant Biology 2014, 14:327) developed a
CRISPR-Cas9 binary vector set based on the pGreen or pCAMBIA
backbone, as well as a gRNA. This toolkit requires no restriction
enzymes besides BsaI to generate final constructs harboring
maize-codon optimized Cas9 and one or more gRNAs with high
efficiency in as little as one cloning step. The toolkit was
validated using maize protoplasts, transgenic maize lines, and
transgenic Arabidopsis lines and was shown to exhibit high
efficiency and specificity. More importantly, using this toolkit,
targeted mutations of three Arabidopsis genes were detected in
transgenic seedlings of the Ti generation. Moreover, the
multiple-gene mutations could be inherited by the next generation.
(guide RNA)module vector set, as a toolkit for multiplex genome
editing in plants. The C2c2 systems and proteins of the instant
invention may be used to target the genes targeted by Xing.
[0848] The C2c2 CRISPR systems of the invention may be used in the
detection of plant viruses. Gambino et al. (Phytopathology. 2006
November; 96(11):1223-9. doi: 10.1094/PHYTO-96-1223) relied on
amplification and multiplex PCR for simultaneous detection of nine
grapevine viruses. The C2c2 systems and proteins of the instant
invention may similarly be used to detect multiple targets in a
host. Moreover, the systems of the invention can be used to
simultaneously knock down viral gene expression in valuable
cultivars, and prevent activation or further infection by targeting
expressed vial RNA.
[0849] Murray et al. (Proc Biol Sci. 2013 Jun 26;
280(1765):20130965. doi: 10. 1098/rspb.2013.0965; published 2013
Aug 22) analyzxed 12 plant RNA viruses to investigatge
evoluationary rates and found evidence of episodic selection
possibly due to shifts between different host genotyopes or
species. The C2c2 systems and proteins of the instant invention may
be used to tarteg or immunize against such viruses in a host. For
example, the systems of the invention can be used to block viral
RNA expression hence replication. Also, the invention can be used
to target nuclic acids for cleavage as wll as to target expression
or activation. Moreover, the systems of the invention can be
multiplexed so as to hit multiple targets or multiple isolate of
the same virus.
[0850] Ma et al. (Mol Plant. 2015 Aug 3; 8(8):1274-84. doi:
10.1016/j.molp.2015.04.007) reports robust CRISPR-Cas9 vector
system, utilizing a plant codon optimized Cas9 gene, for convenient
and high-efficiency multiplex genome editing in monocot and dicot
plants. Ma et al. designed PCR-based procedures to rapidly generate
multiple sgRNA expression cassettes, which can be assembled into
the binary CRISPR-Cas9 vectors in one round of cloning by Golden
Gate ligation or Gibson Assembly. With this system, Ma et al.
edited 46 target sites in rice with an average 85.4% rate of
mutation, mostly in biallelic and homozygous status. Ma et al.
provide examples of loss-of-function gene mutations in TO rice and
T1Arabidopsis plants by simultaneous targeting of multiple (up to
eight) members of a gene family, multiple genes in a biosynthetic
pathway, or multiple sites in a single gene. Similarly, the C2c2
systems of the instant invention can deficiently target expression
of multiple genes simultaneously.
[0851] Lowder et al. (Plant Physiol. 2015 Aug 21. pii: pp.
00636.2015) also developed a CRISPR-Cas9 toolbox enables multiplex
genome editing and transcriptional regulation of expressed,
silenced or non-coding genes in plants. This toolbox provides
researchers with a protocol and reagents to quickly and efficiently
assemble functional CRISPR-Cas9 T-DNA constructs for monocots and
dicots using Golden Gate and Gateway cloning methods. It comes with
a full suite of capabilities, including multiplexed gene editing
and transcriptional activation or repression of plant endogenous
genes. T-DNA based transformation technology is fundamental to
modern plant biotechnology, genetics, molecular biology and
physiology. As such, we developed a method for the assembly of Cas9
(WT, nickase or dCas9) and gRNA(s) into a T-DNA destination-vector
of interest. The assembly method is based on both Golden Gate
assembly and MultiSite Gateway recombination. Three modules are
required for assembly. The first module is a Cas9 entry vector,
which contains promoterless Cas9 or its derivative genes flanked by
attL1 and attR5 sites. The second module is a gRNA entry vector
which contains entry gRNA expression cassettes flanked by attL5 and
attL2 sites. The third module includes attR1-attR2-containing
destination T-DNA vectors that provide promoters of choice for Cas9
expression. The toolbox of Lowder et al. may be applied to the C2c2
effector protein system of the present invention.
[0852] Organisms such as yeast and microalgae are widely used for
synthetic biology. Stovicek et al. (Metab. Eng. Comm., 2015; 2:13
describes genome editing of industrial yeast, for example,
Saccharomyces cerevisae, to efficiently produce robust strains for
industrial production. Stovicek used a CRISPR-Cas9 system
codon-optimized for yeast to simultaneously disrupt both alleles of
an endogenous gene and knock in a heterologous gene. Cas9 and gRNA
were expressed from genomic or episomal 2p-based vector locations.
The authors also showed that gene disruption efficiency could be
improved by optimization of the levels of Cas9 and gRNA expression.
Hlavova et al. (Biotechnol. Adv. 2015) discusses development of
species or strains of microalgae using techniques such as CRISPR to
target nuclear and chloroplast genes for insertional mutagenesis
and screening. The same plasmids and vectors can be applied to the
C2c2 systems of the instant invention.
[0853] Petersen ("Towards precisely glycol engineered plants,"
Plant Biotech Denmark Annual meeting 2015, Copenhagen, Denmark)
developed a method of using CRISPR/Cas9 to engineer genome changes
in Arabidopsis, for example to glyco engineer Arabidopsis for
production of proteins and products having desired
posttranslational modifications. Hebelstrup et al. (Front Plant
Sci. 2015 Apr 23; 6:247) outlines inplanta starch bioengineering,
providing crops that express starch modifying enzymes and directly
produce products that normally are made by industrial chemical
and/or physical treatments of starches. The methods of Petersen and
Hebelstrup may be applied to the C2c2 effector protein system of
the present invention.
[0854] Kurthe t al, J Virol. 2012 June; 86(11):6002-9. doi:
10.1128/JVI.00436-12. Epub 2012 Mar 21) developed an RNA
virus-based vector for the introduction of desired traits into
grapevine without heritable modifications to the genome. The vector
provided the ability to regulate expression of of endogenous genes
by virus-induced gene silencing. The C2c2 systems and proteins of
the instant invention can be used to silence genes and proteins
without heritable modification to the genome.
[0855] In an embodiment, the plant may be a legume. The present
invention may utilize the herein disclosed CRISP-Cas system for
exploring and modifying, for example, without limitation, soybeans,
peas, and peanuts. Curtin et al. provides a toolbox for legume
function genomics. (See Curtin et al., "A genome engineering
toolbox for legume Functional genomics," International Plant and
Animal Genome Conference XXII 2014). Curtin used the genetic
transformation of CRISPR to knock-out/down single copy and
duplicated legume genes both in hairy root and whole plant systems.
Some of the target genes were chosen in order to explore and
optimize the features of knock-out/down systems (e.g., phytoene
desaturase), while others were identified by soybean homology to
Arabidopsis Dicer-like genes or by genome-wide association studies
of nodulation in Medicago. The C2c2 systems and proteins of the
instant invention can be used to knockout/knockdown systems.
[0856] Peanut allergies and allergies to legumes generally are a
real and serious health concern. The C2c2 effector protein system
of the present invention can be used to identify and then edit or
silence genes encoding allergenic proteins of such legumes. Without
limitation as to such genes and proteins, Nicolaou et al.
identifies allergenic proteins in peanuts, soybeans, lentils, peas,
lupin, green beans, and mung beans. See, Nicolaou et al., Current
Opinion in Allergy and Clinical Immunology 2011; 11(3):222).
[0857] In an advantageous embodiment, the plant may be a tree. The
present invention may also utilize the herein disclosed CRISPR Cas
system for herbaceous systems (see, e.g., Belhaj et al., Plant
Methods 9: 39 and Harrison et al., Genes & Development 28:
1859-1872). In a particularly advantageous embodiment, the CRISPR
Cas system of the present invention may target single nucleotide
polymorphisms (SNPs) in trees (see, e.g., Zhou et al., New
Phytologist, Volume 208, Issue 2, pages 298-301, October 2015). In
the Zhou et al. study, the authors applied a CRISPR Cas system in
the woody perennial Populus using the 4-coumarate:CoA ligase (4CL)
gene family as a case study and achieved 100% mutational efficiency
for two 4CL genes targeted, with every transformant examined
carrying biallelic modifications. In the Zhou et al., study, the
CRISPR-Cas9 system was highly sensitive to single nucleotide
polymorphisms (SNPs), as cleavage for a third 4CL gene was
abolished due to SNPs in the target sequence. These methods may be
applied to the C2c2 effector protein system of the present
invention.
[0858] The methods of Zhou et al. (New Phytologist, Volume 208,
Issue 2, pages 298-301, October 2015) may be applied to the present
invention as follows. Two 4CL genes, 4CL1 and 4CL2, associated with
lignin and flavonoid biosynthesis, respectively are targeted for
CRISPR-Cas9 editing. The Populus tremula x alba clone 717-1B4
routinely used for transformation is divergent from the
genome-sequenced Populus trichocarpa. Therefore, the 4CL1 and 4CL2
gRNAs designed from the reference genome are interrogated with
in-house 717 RNA-Seq data to ensure the absence of SNPs which could
limit Cas efficiency. A third gRNA designed for 4CL5, a genome
duplicate of 4CL1, is also included. The corresponding 717 sequence
harbors one SNP in each allele near/within the PAM, both of which
are expected to abolish targeting by the 4CL5-gRNA. All three gRNA
target sites are located within the first exon. For 717
transformation, the gRNA is expressed from the Medicago U6.6
promoter, along with a human codon-optimized Cas under control of
the CaMV 35S promoter in a binary vector. Transformation with the
Cas-only vector can serve as a control. Randomly selected 4CL1 and
4CL2 lines are subjected to amplicon-sequencing. The data is then
processed and biallelic mutations are confirmed in all cases. These
methods may be applied to the C2c2 effector protein system of the
present invention.
[0859] In plants, pathogens are often host-specific. For example,
Fusarium oxysporum f. sp. lycopersici causes tomato wilt but
attacks only tomato, and F. oxysporum f. dianthii Puccinia graminis
f. sp. tritici attacks only wheat. Plants have existing and induced
defenses to resist most pathogens. Mutations and recombination
events across plant generations lead to genetic variability that
gives rise to susceptibility, especially as pathogens reproduce
with more frequency than plants. In plants there can be non-host
resistance, e.g., the host and pathogen are incompatible. There can
also be Horizontal Resistance, e.g., partial resistance against all
races of a pathogen, typically controlled by many genes and
Vertical Resistance, e.g., complete resistance to some races of a
pathogen but not to other races, typically controlled by a few
genes. In a Gene-for-Gene level, plants and pathogens evolve
together, and the genetic changes in one balance changes in other.
Accordingly, using Natural Variability, breeders combine most
useful genes for Yield, Quality, Uniformity, Hardiness, Resistance.
The sources of resistance genes include native or foreign
Varieties, Heirloom Varieties, Wild Plant Relatives, and Induced
Mutations, e.g., treating plant material with mutagenic agents.
Using the present invention, plant breeders are provided with a new
tool to induce mutations. Accordingly, one skilled in the art can
analyze the genome of sources of resistance genes, and in Varieties
having desired characteristics or traits employ the present
invention to induce the rise of resistance genes, with more
precision than previous mutagenic agents and hence accelerate and
improve plant breeding programs.
[0860] Aside from the plants otherwise discussed herein and above,
engineered plants modified by the effector protein and suitable
guide, and progeny thereof, as provided. These may include disease
or drought resistant crops, such as wheat, barley, rice, soybean or
corn; plants modified to remove or reduce the ability to
self-pollinate (but which can instead, optionally, hybridise
instead); and allergenic foods such as peanuts and nuts where the
immunogenic proteins have been disabled, destroyed or disrupted by
targeting via a effector protein and suitable guide.
Therapeutic Treatment
[0861] The system of the invention can be applied in areas of
former RNA cutting technologies, without undue experimentation,
from this disclosure, including therapeutic, assay and other
applications, because the present application provides the
foundation for informed engineering of the system. The present
invention provides for therapeutic treatment of a disease caused by
overexpression of RNA, toxic RNA and/or mutated RNA (such as, for
example, splicing defects or truncations). Expression of the toxic
RNA may be associated with formation of nuclear inclusions and
late-onset degenerative changes in brain, heart or skeletal muscle.
In the best studied example, myotonic dystrophy, it appears that
the main pathogenic effect of the toxic RNA is to sequester binding
proteins and compromise the regulation of alternative splicing
(Hum. Mol. Genet. (2006) 15 (suppl 2): R162-R169). Myotonic
dystrophy [dystrophia myotonica (DM)] is of particular interest to
geneticists because it produces an extremely wide range of clinical
features. A partial listing would include muscle wasting,
cataracts, insulin resistance, testicular atrophy, slowing of
cardiac conduction, cutaneous tumors and effects on cognition. The
classical form of DM, which is now called DM type 1 (DM1), is
caused by an expansion of CTG repeats in the 3'-untranslated region
(UTR) of DMPK, a gene encoding a cytosolic protein kinase.
[0862] The below table presents a list of exons shown to have
misregulated alternative splicing in DM1 skeletal muscle, heart or
brain.
TABLE-US-00008 Tissue/gene Target Reference Skeletal muscle ALP ex
5a, 5b Lin X., et al. Failure of MBNL1-dependent postnatal splicing
transitions in myotonic dystrophy. Hum. Mol. Genet 2006; 15:
2087-2097 CAPN3 ex 16 Lin X., et al. Failure of MBNL1-dependent
postnatal splicing transitions in myotonic dystrophy. Hum. Mol.
Genet 2006; 15: 2087-2097 CLCN1 int 2, ex 7a, Mankodi A., et al.
Expanded CUG repeats trigger aberrant splicing 8a of ClC-1 chloride
channel pre-mRNA and hyperexcitability of skeletal muscle in
myotonic dystrophy. Mol. Cell 2002; 10: 35-44 Charlet-B N., et al.
Loss of the muscle-specific chloride channel in type 1 myotonic
dystrophy due to misregulated alternative splicing. Mol. Cell 2002;
10: 45-53 FHOS ex 11a Lin X., et al. Failure of MBNL1-dependent
postnatal splicing transitions in myotonic dystrophy. Hum. Mol.
Genet 2006; 15: 2087-2097 GFAT1 ex 10 Lin X., et al. Failure of
MBNL1-dependent postnatal splicing transitions in myotonic
dystrophy. Hum. Mol. Genet 2006; 15: 2087-2097 IR ex 11 Savkur R.
S., et al. Aberrant regulation of insulin receptor alternative
splicing is associated with insulin resistance in myotonic
dystrophy. Nat. Genet. 2001; 29: 40-47 MBNL1 ex 7 Lin X., et al.
Failure of MBNL1-dependent postnatal splicing transitions in
myotonic dystrophy. Hum. Mol. Genet 2006; 15: 2087-2097 MBNL2 ex 7
Lin X., et al. Failure of MBNL1-dependent postnatal splicing
transitions in myotonic dystrophy. Hum. Mol. Genet 2006; 15:
2087-2097 MTMR1 ex 2.1, 2.2 Buj-Bello A., et al. Muscle-specific
alternative splicing of myotubularin-related 1 gene is impaired in
DM1 muscle cells. Hum. Mol. Genet. 2002; 11: 2297-2307 NRAP ex 12
Lin X., et al. Failure of MBNL1-dependent postnatal splicing
transitions in myotonic dystrophy. Hum. Mol. Genet 2006; 15:
2087-2097 RYR1 ex 70 Kimura T., et al. Altered mRNA splicing of the
skeletal muscle ryanodine receptor and sarcoplasmic/endoplasmic
reticulum Ca2+- ATPase in myotonic dystrophy type 1. Hum. Mol.
Genet. 2005; 14: 2189-2200 SERCA1 ex 22 Kimura T., et al. Altered
mRNA splicing of the skeletal muscle ryanodine receptor and
sarcoplasmic/endoplasmic reticulum Ca2+- ATPase in myotonic
dystrophy type 1. Hum. Mol. Genet. 2005; 14: 2189-2200 Lin X., et
al. Failure of MBNL1-dependent postnatal splicing transitions in
myotonic dystrophy. Hum. Mol. Genet 2006; 15: 2087-2097 z-Titin ex
Zr4, Zr5 Lin X., et al. Failure of MBNL1-dependent postnatal
splicing transitions in myotonic dystrophy. Hum. Mol. Genet 2006;
15: 2087-2097 m-Titin M-line ex5 Lin X., et al. Failure of
MBNL1-dependent postnatal splicing transitions in myotonic
dystrophy. Hum. Mol. Genet 2006; 15: 2087-2097 TNNT3 fetal ex
Kanadia R. N., et al. A muscleblind knockout model for myotonic
dystrophy. Science 2003; 302: 1978-1980 ZASP ex 11 Lin X., et al.
Failure of MBNL1-dependent postnatal splicing transitions in
myotonic dystrophy. Hum. Mol. Genet 2006; 15: 2087-2097 Heart TNNT2
ex 5 Philips A. V., et al. Disruption of splicing regulated by a
CUG- binding protein in myotonic dystrophy. Science 1998; 280:
737-741 ZASP ex 11 Mankodi A., et al. Nuclear RNA foci in the heart
in myotonic dystrophy. Circ. Res. 2005; 97: 1152-1155 m-Titin
M-line ex 5 Mankodi A., et al. Nuclear RNA foci in the heart in
myotonic dystrophy. Circ. Res. 2005; 97: 1152-1155 KCNAB1 ex 2
Mankodi A., et al. Nuclear RNA foci in the heart in myotonic
dystrophy. Circ. Res. 2005; 97: 1152-1155 ALP ex 5 (Mankodi A., et
al. Nuclear RNA foci in the heart in myotonic dystrophy. Circ. Res.
2005; 97: 1152-1155 Brain TAU ex 2, ex 10 Sergeant N., et al.
Dysregulation of human brain microtubule- associated tau mRNA
maturation in myotonic dystrophy type 1. Hum. Mol. Genet. 2001; 10:
2143-2155 Jiang H., et al. Myotonic dystrophy type 1 associated
with nuclear foci of mutant RNA, sequestration of muscleblind
proteins, and deregulated alternative splicing in neurons. Hum.
Mol. Genet. 2004; 13: 3079-3088 APP ex 7 Jiang H., et al. Myotonic
dystrophy type 1 associated with nuclear foci of mutant RNA,
sequestration of muscleblind proteins, and deregulated alternative
splicing in neurons. Hum. Mol. Genet. 2004; 13: 3079-3088 NMDAR1 ex
5 Jiang H., et al. Myotonic dystrophy type 1 associated with
nuclear foci of mutant RNA, sequestration of muscleblind proteins,
and deregulated alternative splicing in neurons. Hum. Mol. Genet.
2004; 13: 3079-3088
[0863] The enzymes of the present invention may target
overexpressed RNA or toxic RNA, such as for example, the DMPK gene
or any of the misregulated alternative splicing in DM1 skeletal
muscle, heart or brain in, for example, the above table.
[0864] The enzymes of the present invention may also target
trans-acting mutations affecting RNA-dependent functions that cause
disease (summarized in Cell. 2009 Feb 20; 136(4): 777-793) as
indicated in the below table.
TABLE-US-00009 DISEASE GENE / MUTATION FUNCTION Prader Willi
syndrome SNORD116 ribosome biogenesis Spinal muscular atrophy (SMA)
SMN2 splicing Dyskeratosis congenita (X-linked) DKC1
telomerase/translation Dyskeratosis congenita (autosomal TERC
telomerase dominant) Dyskeratosis congenita (autosomal TERT
telomerase dominant) Diamond-Blackfan anemia RPS19, RPS24 ribosome
biogenesis Shwachman-Diamond syndrome SBDS ribosome biogenesis
Treacher-Collins syndrome TCOF1 ribosome biogenesis Prostate cancer
SNHG5 ribosome biogenesis Myotonic dystrophy, type 1 (DM1) DMPK
(RNA gain-of- protein kinase function) Myotonic dystrophy type 2
(DM2) ZNF9 (RNA gain-of- RNA binding function) Spinocerebellar
ataxia 8 (SCA8) ATXN8/ATXN8OS unknown/noncoding (RNA
gain-of-function) RNA Huntington's disease-like 2 (HDL2) JPH3 (RNA
gain-of- ion channel function function) Fragile X-associated tremor
ataxia FMRI (RNA gain-of- translation/mRNA syndrome (FXTAS)
function) localization Fragile X syndrome FMRI translation/mRNA
localization X-linked mental retardation UPF3B translation/nonsense
mediated decay Oculopharyngeal muscular dystrophy PABPN1 3' end
formation (OPMD) Human pigmentary genodermatosis DSRAD editing
Retinitis pigmentosa PRPF31 splicing Retinitis pigmentosa PRPF8
splicing Retinitis pigmentosa HPRP3 splicing Retinitis pigmentosa
PAP1 splicing Cartilage-hair hypoplasia (recessive) RMRP splicing
Autism 7q22-q33 locus breakpoint noncoding RNA Beckwith-Wiedemann
syndrome H19 noncoding RNA (BWS) Charcot-Marie-Tooth (CMT) Disease
GRS translation Charcot-Marie-Tooth (CMT) Disease YRS translation
Amyotrophic lateral sclerosis (ALS) TARDBP splicing, transcription
Leukoencephalopathy with vanishing EIF2B1 translation white matter
Wolcott-Rallison syndrome EIF2AK3 translation (protease)
Mitochondrial myopathy and PUS1 translation sideroblastic anemia
(MLASA) Encephalomyopathy and hypertrophic TSFM translation
cardiomyopathy (mitochondrial) Hereditary spastic paraplegia SPG7
ribosome biogenesis Leukoencephalopathy DARS2 translation
(mitochondrial) Susceptibility to diabetes mellitus LARS2
translation (mitochondrial) Deafness MTRNR1 ribosome biogenesis
(mitochondrial) MELAS syndrome, deafness MTRNR2 ribosome biogenesis
(mitochondrial) Cancer SFRS1 splicing, translation, export Cancer
RBM5 splicing Multiple disorders mitochondrial tRNA translation
mutations (mitochondrial) Cancer miR-17-92 cluster RNA interference
Cancer miR-372/miR-373 RNA interference
[0865] The enzyme of the present invention may also be used in the
treatment of various tauopathies, including primary and secondary
tauopathies, such as primary age-related tauopathy
(PART)/Neurofibrillary tangle-predominant senile dementia, with
NFTs similar to AD, but without plaques, dementia pugilistica
(chronic traumatic encephalopathy), progressive supranuclear palsy,
corticobasal degeneration, frontotemporal dementia and parkinsonism
linked to chromosome 17, lytico-Bodig disease (Parkinson-dementia
complex of Guam), ganglioglioma and gangliocytoma,
meningioangiomatosis, postencephalitic parkinsonism, subacute
sclerosing panencephalitis, as well as lead encephalopathy,
tuberous sclerosis, Hallervorden-Spatz disease, and lipofuscinosis,
alzheimers disease.The enzymes of the present invention may also
target mutations disrupting the cis-acting splicing code cause
splicing defects and disease (summarized in Cell. 2009 Feb 20;
136(4): 777-793). The motor neuron degenerative disease SMA results
from deletion of the SMN1 gene. The remaining SMN2 gene has a
C->T substitution in exon 7 that inactivates an exonic splicing
enhancer (ESE), and creates an exonic splicing silencer (ESS),
leading to exon 7 skipping and a truncated protein (SMNA7). A
T->A substitution in exon 31 of the dystrophin gene
simultaneously creates a premature termination codon (STOP) and an
ESS, leading to exon 31 skipping. This mutation causes a mild form
of DMD because the mRNA lacking exon 31 produces a partially
functional protein. Mutations within and downstream of exon 10 of
the MAPT gene encoding the tau protein affect splicing regulatory
elements and disrupt the normal 1:1 ratio of mRNAs including or
excluding exon 10. This results in a perturbed balance between tau
proteins containing either four or three microtubule-binding
domains (4R-tau and 3R-tau, respectively), causing the
neuropathological disorder FTDP-17. The example shown is the N279K
mutation which enhances an ESE function promoting exon 10 inclusion
and shifting the balance toward increased 4R-tau. Polymorphic
(UG)m(U)n tracts within the 3' splice site of the CFTR gene exon 9
influence the extent of exon 9 inclusion and the level of
full-length functional protein, modifying the severity of cystic
fibrosis (CF) caused by a mutation elsewhere in the CFTR gene.
[0866] The innate immune system detects viral infection primarily
by recognizing viral nucleic acids inside an infected cell,
referred to as DNA or RNA sensing. In vitro RNA sensing assays can
be used to detect specific RNA substrates. The RNA targeting
effector protein can for instance be used for RNA-based sensing in
living cells. Examples of applications are diagnostics by sensing
of, for examples, disease-specific RNAs.
[0867] The RNA targeting effector protein of the invention can
further be used for antiviral activity, in particular against RNA
viruses. The effector protein can be targeted to the viral RNA
using a suitable guide RNA selective for a selected viral RNA
sequence. In particular, the effector protein may be an active
nuclease that cleaves RNA, such as single stranded RNA. provided is
therefore the use of an RNA targeting effector protein of the
invention as an antiviral agent.
[0868] Therapeutic dosages of the enzyme system of the present
invention to target RNA the above-referenced RNAs are contemplated
to be about 0.1 to about 2 mg/kg the dosages may be administered
sequentially with a monitored response, and repeated dosages if
necessary, up to about 7 to 10 doses per patient. Advantageously,
samples are collected from each patient during the treatment
regimen to ascertain the effectiveness of treatment. For example,
RNA samples may be isolated and quantified to determine if
expression is reduced or ameliorated. Such a diagnostic is within
the purview of one of skill in the art.
[0869] With respect to general information on CRISPR-Cas Systems,
mention is made of the following (also hereby incorporated herein
by reference): [0870] Multiplex genome engineering using CRISPR/Cas
systems. Cong, L., Ran, F. A., Cox, D., Lin, S., Barretto, R.,
Habib, N., Hsu, P. D., Wu, X., Jiang, W., Marraffini, L. A., &
Zhang, F. Science Feb 15; 339(6121):819-23 (2013); [0871]
RNA-guided editing of bacterial genomes using CRISPR-Cas systems.
Jiang W., Bikard D., Cox D., Zhang F, Marraffini L A. Nat
Biotechnol Mar; 31(3):233-9 (2013); [0872] One-Step Generation of
Mice Carrying Mutations in Multiple Genes by CRISPR/Cas-Mediated
Genome Engineering. Wang H., Yang H., Shivalila C S., Dawlaty M M.,
Cheng A W., Zhang F., Jaenisch R. Cell May 9; 153(4):910-8 (2013);
[0873] Optical control of mammalian endogenous transcription and
epigenetic states. Konermann S, Brigham M D, Trevino A E, Hsu P D,
Heidenreich M, Cong L, Platt R J, Scott D A, Church G M, Zhang F.
Nature. Aug 22; 500(7463):472-6. doi: 10.1038/Nature12466. Epub
2013 Aug 23 (2013); [0874] Double Nicking by RNA-Guided CRISPR Cas9
for Enhanced Genome Editing Specificity. Ran, F A., Hsu, P D., Lin,
C Y., Gootenberg, J S., Konermann, S., Trevino, A E., Scott, D A.,
Inoue, A., Matoba, S., Zhang, Y., & Zhang, F. Cell Aug 28. pii:
S0092-8674(13)01015-5 (2013-A); [0875] DNA targeting specificity of
RNA-guided Cas9 nucleases. Hsu, P., Scott, D., Weinstein, J., Ran,
F A., Konermann, S., Agarwala, V., Li, Y., Fine, E., Wu, X.,
Shalem, O., Cradick, T J., Marraffini, L A., Bao, G., & Zhang,
F. Nat Biotechnol doi:10.1038/nbt.2647 (2013); [0876] Genome
engineering using the CRISPR-Cas9 system. Ran, F A., Hsu, P D.,
Wright, J., Agarwala, V., Scott, D A., Zhang, F. Nature Protocols
Nov; 8(11):2281-308 (2013-B); [0877] Genome-Scale CRISPR-Cas9
Knockout Screening in Human Cells. Shalem, O., Sanjana, N E.,
Hartenian, E., Shi, X., Scott, D A., Mikkelson, T., Heckl, D.,
Ebert, B L., Root, D E., Doench, J G., Zhang, F. Science Dec 12.
(2013). [Epub ahead of print]; [0878] Crystal structure of cas9 in
complex with guide RNA and target DNA. Nishimasu, H., Ran, F A.,
Hsu, P D., Konermann, S., Shehata, S I., Dohmae, N., Ishitani, R.,
Zhang, F., Nureki, O. Cell Feb 27, 156(5):935-49 (2014); [0879]
Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian
cells. Wu X., Scott D A., Kriz A J., Chiu A C., Hsu P D., Dadon D
B., Cheng A W., Trevino A E., Konermann S., Chen S., Jaenisch R.,
Zhang F., Sharp P A. Nat Biotechnol. Apr 20. doi: 10.103 8/nbt.2889
(2014); [0880] CRISPR-Cas9 Knockin Mice for Genome Editing and
Cancer Modeling. Platt R J, Chen S, Zhou Y, Yim M J, Swiech L,
Kempton H R, Dahlman J E, Parnas O, Eisenhaure T M, Jovanovic M,
Graham D B, Jhunjhunwala S, Heidenreich M, Xavier R J, Langer R,
Anderson D G, Hacohen N, Regev A, Feng G, Sharp P A, Zhang F. Cell
159(2): 440-455 DOI: 10.1016/j.cell.2014.09.014(2014); [0881]
Development and Applications of CRISPR-Cas9 for Genome Engineering,
Hsu P D, Lander E S, Zhang F., Cell. Jun 5; 157(6):1262-78 (2014).
[0882] Genetic screens in human cells using the CRISPR/Cas9 system,
Wang T, Wei J J, Sabatini D M, Lander E S., Science. January 3;
343(6166): 80-84. doi:10.1126/science.1246981 (2014); [0883]
Rational design of highly active sgRNAs for CRISPR-Cas9-mediated
gene inactivation, Doench J G, Hartenian E, Graham D B, Tothova Z,
Hegde M, Smith I, Sullender M, Ebert B L, Xavier R J, Root D E.,
(published online 3 Sep. 2014) Nat Biotechnol. Dec; 32(12): 1262-7
(2014); [0884] In vivo interrogation of gene function in the
mammalian brain using CRISPR-Cas9, Swiech L, Heidenreich M,
Banerjee A, Habib N, Li Y, Trombetta J, Sur M, Zhang F., (published
online 19 Oct. 2014) Nat Biotechnol. Jan; 33(1): 102-6 (2015);
[0885] Genome-scale transcriptional activation by an engineered
CRISPR-Cas9 complex, Konermann S, Brigham M D, Trevino A E, Joung
J, Abudayyeh O O, Barcena C, Hsu P D, Habib N, Gootenberg J S,
Nishimasu H, Nureki O, Zhang F., Nature. Jan 29; 517(7536):583-8
(2015). [0886] A split-Cas9 architecture for inducible genome
editing and transcription modulation, Zetsche B, Volz S E, Zhang
F., (published online 2 Feb. 2015) Nat Biotechnol. Feb;
33(2):139-42 (2015); [0887] Genome-wide CRISPR Screen in a Mouse
Model of Tumor Growth and Metastasis, Chen S, Sanjana N E, Zheng K,
Shalem O, Lee K, Shi X, Scott D A, Song J, Pan J Q, Weissleder R,
Lee H, Zhang F, Sharp P A. Cell 160, 1246-1260, Mar. 12, 2015
(multiplex screen in mouse), and [0888] In vivo genome editing
using Staphylococcus aureus Cas9, Ran F A, Cong L, Yan W X, Scott D
A, Gootenberg J S, Kriz A J, Zetsche B, Shalem O, Wu X, Makarova K
S, Koonin E V, Sharp P A, Zhang F., (published online 1 Apr. 2015),
Nature. Apr 9; 520(7546):186-91(2015). [0889] Shalem et al.,
"High-throughput functional genomics using CRISPR-Cas9," Nature
Reviews Genetics 16, 299-311 (May 2015). [0890] Xu et al.,
"Sequence determinants of improved CRISPR sgRNA design," Genome
Research 25, 1147-1157 (August 2015). [0891] Parnas et al., "A
Genome-wide CRISPR Screen in Primary Immune Cells to Dissect
Regulatory Networks," Cell 162, 675-686 (Jul. 30, 2015). [0892]
Ramanan et al., CRISPR/Cas9 cleavage of viral DNA efficiently
suppresses hepatitis B virus," Scientific Reports 5:10833. doi:
10.1038/srep10833 (Jun. 2, 2015). [0893] Nishimasu et al., Crystal
Structure of Staphylococcus aureus Cas9," Cell 162, 1113-1126 (Aug.
27, 2015). [0894] BCL11A enhancer dissection by Cas9-mediated in
situ saturating mutagenesis, Canver et al., Nature 527(7577):192-7
(Nov. 12, 2015) doi: 10.1038/nature15521. Epub 2015 Sep 16. [0895]
Cpf1 Is a Single RNA-Guided Endonuclease of a Class 2 CRISPR-Cas
System, Zetsche et al., Cell 163, 759-71 (Sep. 25, 2015). [0896]
Discovery and Functional Characterization of Diverse Class 2
CRISPR-Cas Systems, Shmakov et al., Molecular Cell, 60(3), 385-397
doi: 10.1016/j.molcel.2015.10.008 Epub Oct. 22, 2015. [0897]
Rationally engineered Cas9 nucleases with improved specificity,
Slaymaker et al., Science 2016 Jan 1, 351(6268): 84-88 doi:
10.1126/science.aad5227. Epub 2015 Dec 1. [Epub ahead of print].
each of which is incorporated herein by reference, may be
considered in the practice of the instant invention, and discussed
briefly below: [0898] Cong et al. engineered type II CRISPR-Cas
systems for use in eukaryotic cells based on both Streptococcus
thermophilus Cas9 and also Streptococcus pyogenes Cas9 and
demonstrated that Cas9 nucleases can be directed by short RNAs to
induce precise cleavage of DNA in human and mouse cells. Their
study further showed that Cas9 as converted into a nicking enzyme
can be used to facilitate homology-directed repair in eukaryotic
cells with minimal mutagenic activity. Additionally, their study
demonstrated that multiple guide sequences can be encoded into a
single CRISPR array to enable simultaneous editing of several at
endogenous genomic loci sites within the mammalian genome,
demonstrating easy programmability and wide applicability of the
RNA-guided nuclease technology. This ability to use RNA to program
sequence specific DNA cleavage in cells defined a new class of
genome engineering tools. These studies further showed that other
CRISPR loci are likely to be transplantable into mammalian cells
and can also mediate mammalian genome cleavage. Importantly, it can
be envisaged that several aspects of the CRISPR-Cas system can be
further improved to increase its efficiency and versatility. [0899]
Jiang et al. used the clustered, regularly interspaced, short
palindromic repeats (CRISPR)-associated Cas9 endonuclease complexed
with dual-RNAs to introduce precise mutations in the genomes of
Streptococcus pneumoniae and Escherichia coli. The approach relied
on dual-RNA:Cas9-directed cleavage at the targeted genomic site to
kill unmutated cells and circumvents the need for selectable
markers or counter-selection systems. The study reported
reprogramming dual-RNA:Cas9 specificity by changing the sequence of
short CRISPR RNA (crRNA) to make single- and multinucleotide
changes carried on editing templates. The study showed that
simultaneous use of two crRNAs enabled multiplex mutagenesis.
Furthermore, when the approach was used in combination with
recombineering, in S. pneumoniae, nearly 100% of cells that were
recovered using the described approach contained the desired
mutation, and in E. coli, 65% that were recovered contained the
mutation. [0900] Wang et al. (2013) used the CRISPR/Cas system for
the one-step generation of mice carrying mutations in multiple
genes which were traditionally generated in multiple steps by
sequential recombination in embryonic stem cells and/or
time-consuming intercrossing of mice with a single mutation. The
CRISPR/Cas system will greatly accelerate the in vivo study of
functionally redundant genes and of epistatic gene interactions.
[0901] Konermann et al. (2013) addressed the need in the art for
versatile and robust technologies that enable optical and chemical
modulation of DNA-binding domains based CRISPR Cas9 enzyme and also
Transcriptional Activator Like Effectors [0902] Ran et al. (2013-A)
described an approach that combined a Cas9 nickase mutant with
paired guide RNAs to introduce targeted double-strand breaks. This
addresses the issue of the Cas9 nuclease from the microbial
CRISPR-Cas system being targeted to specific genomic loci by a
guide sequence, which can tolerate certain mismatches to the DNA
target and thereby promote undesired off-target mutagenesis.
Because individual nicks in the genome are repaired with high
fidelity, simultaneous nicking via appropriately offset guide RNAs
is required for double-stranded breaks and extends the number of
specifically recognized bases for target cleavage. The authors
demonstrated that using paired nicking can reduce off-target
activity by 50- to 1,500-fold in cell lines and to facilitate gene
knockout in mouse zygotes without sacrificing on-target cleavage
efficiency. This versatile strategy enables a wide variety of
genome editing applications that require high specificity. [0903]
Hsu et al. (2013) characterized SpCas9 targeting specificity in
human cells to inform the selection of target sites and avoid
off-target effects. The study evaluated >700 guide RNA variants
and SpCas9-induced indel mutation levels at >100 predicted
genomic off-target loci in 293T and 293FT cells. The authors that
SpCas9 tolerates mismatches between guide RNA and target DNA at
different positions in a sequence-dependent manner, sensitive to
the number, position and distribution of mismatches. The authors
further showed that SpCas9-mediated cleavage is unaffected by DNA
methylation and that the dosage of SpCas9 and sgRNA can be titrated
to minimize off-target modification. Additionally, to facilitate
mammalian genome engineering applications, the authors reported
providing a web-based software tool to guide the selection and
validation of target sequences as well as off-target analyses.
[0904] Ran et al. (2013-B) described a set of tools for
Cas9-mediated genome editing via non-homologous end joining (NHEJ)
or homology-directed repair (HDR) in mammalian cells, as well as
generation of modified cell lines for downstream functional
studies. To minimize off-target cleavage, the authors further
described a double-nicking strategy using the Cas9 nickase mutant
with paired guide RNAs. The protocol provided by the authors
experimentally derived guidelines for the selection of target
sites, evaluation of cleavage efficiency and analysis of off-target
activity. The studies showed that beginning with target design,
gene modifications can be achieved within as little as 1-2 weeks,
and modified clonal cell lines can be derived within 2-3 weeks.
[0905] Shalem et al. described a new way to interrogate gene
function on a genome-wide scale. Their studies showed that delivery
of a genome-scale CRISPR-Cas9 knockout (GeCKO) library targeted
18,080 genes with 64,751 unique guide sequences enabled both
negative and positive selection screening in human cells. First,
the authors showed use of the GeCKO library to identify genes
essential for cell viability in cancer and pluripotent stem cells.
Next, in a melanoma model, the authors screened for genes whose
loss is involved in resistance to vemurafenib, a therapeutic that
inhibits mutant protein kinase BRAF. Their studies showed that the
highest-ranking candidates included previously validated genes NF1
and MED12 as well as novel hits NF2, CUL3, TADA2B, and TADA1. The
authors observed a high level of consistency between independent
guide RNAs targeting the same gene and a high rate of hit
confirmation, and thus demonstrated the promise of genome-scale
screening with Cas9. [0906] Nishimasu et al. reported the crystal
structure of Streptococcus pyogenes Cas9 in complex with sgRNA and
its target DNA at 2.5 A.sup.o resolution. The structure revealed a
bilobed architecture composed of target recognition and nuclease
lobes, accommodating the sgRNA:DNA heteroduplex in a positively
charged groove at their interface. Whereas the recognition lobe is
essential for binding sgRNA and DNA, the nuclease lobe contains the
HNH and RuvC nuclease domains, which are properly positioned for
cleavage of the complementary and non-complementary strands of the
target DNA, respectively. The nuclease lobe also contains a
carboxyl-terminal domain responsible for the interaction with the
protospacer adjacent motif (PAM). This high-resolution structure
and accompanying functional analyses have revealed the molecular
mechanism of RNA-guided DNA targeting by Cas9, thus paving the way
for the rational design of new, versatile genome-editing
technologies. [0907] Wu et al. mapped genome-wide binding sites of
a catalytically inactive Cas9 (dCas9) from Streptococcus pyogenes
loaded with single guide RNAs (sgRNAs) in mouse embryonic stem
cells (mESCs). The authors showed that each of the four sgRNAs
tested targets dCas9 to between tens and thousands of genomic
sites, frequently characterized by a 5-nucleotide seed region in
the sgRNA and an NGG protospacer adjacent motif (PAM). Chromatin
inaccessibility decreases dCas9 binding to other sites with
matching seed sequences; thus 70% of off-target sites are
associated with genes. The authors showed that targeted sequencing
of 295 dCas9 binding sites in mESCs transfected with catalytically
active Cas9 identified only one site mutated above background
levels. The authors proposed a two-state model for Cas9 binding and
cleavage, in which a seed match triggers binding but extensive
pairing with target DNA is required for cleavage. [0908] Platt et
al. established a Cre-dependent Cas9 knockin mouse. The authors
demonstrated in vivo as well as ex vivo genome editing using
adeno-associated virus (AAV)-, lentivirus-, or particle-mediated
delivery of guide RNA in neurons, immune cells, and endothelial
cells. [0909] Hsu et al. (2014) is a review article that discusses
generally CRISPR-Cas9 history from yogurt to genome editing,
including genetic screening of cells.
[0910] Wang et al. (2014) relates to a pooled, loss-of-function
genetic screening approach suitable for both positive and negative
selection that uses a genome-scale lentiviral single guide RNA
(sgRNA) library. [0911] Doench et al. created a pool of sgRNAs,
tiling across all possible target sites of a panel of six
endogenous mouse and three endogenous human genes and
quantitatively assessed their ability to produce null alleles of
their target gene by antibody staining and flow cytometry. The
authors showed that optimization of the PAM improved activity and
also provided an on-line tool for designing sgRNAs. [0912] Swiech
et al. demonstrate that AAV-mediated SpCas9 genome editing can
enable reverse genetic studies of gene function in the brain.
[0913] Konermann et al. (2015) discusses the ability to attach
multiple effector domains, e.g., transcriptional activator,
functional and epigenomic regulators at appropriate positions on
the guide such as stem or tetraloop with and without linkers.
[0914] Zetsche et al. demonstrates that the Cas9 enzyme can be
split into two and hence the assembly of Cas9 for activation can be
controlled. [0915] Chen et al. relates to multiplex screening by
demonstrating that a genome-wide in vivo CRISPR-Cas9 screen in mice
reveals genes regulating lung metastasis. [0916] Ran et al. (2015)
relates to SaCas9 and its ability to edit genomes and demonstrates
that one cannot extrapolate from biochemical assays. Shalem et al.
(2015) described ways in which catalytically inactive Cas9 (dCas9)
fusions are used to synthetically repress (CRISPRi) or activate
(CRISPRa) expression, showing. advances using Cas9 for genome-scale
screens, including arrayed and pooled screens, knockout approaches
that inactivate genomic loci and strategies that modulate
transcriptional activity.
[0917] End Edits [0918] Shalem et al. (2015) described ways in
which catalytically inactive Cas9 (dCas9) fusions are used to
synthetically repress (CRISPRi) or activate (CRISPRa) expression,
showing. advances using Cas9 for genome-scale screens, including
arrayed and pooled screens, knockout approaches that inactivate
genomic loci and strategies that modulate transcriptional activity.
[0919] Xu et al. (2015) assessed the DNA sequence features that
contribute to single guide RNA (sgRNA) efficiency in CRISPR-based
screens. The authors explored efficiency of CRISPR/Cas9 knockout
and nucleotide preference at the cleavage site. The authors also
found that the sequence preference for CRISPRi/a is substantially
different from that for CRISPR/Cas9 knockout. [0920] Parnas et al.
(2015) introduced genome-wide pooled CRISPR-Cas9 libraries into
dendritic cells (DCs) to identify genes that control the induction
of tumor necrosis factor (Tnf) by bacterial lipopolysaccharide
(LPS). Known regulators of Tlr4 signaling and previously unknown
candidates were identified and classified into three functional
modules with distinct effects on the canonical responses to LPS.
[0921] Ramanan et al (2015) demonstrated cleavage of viral episomal
DNA (cccDNA) in infected cells. The HBV genome exists in the nuclei
of infected hepatocytes as a 3.2 kb double-stranded episomal DNA
species called covalently closed circular DNA (cccDNA), which is a
key component in the HBV life cycle whose replication is not
inhibited by current therapies. The authors showed that sgRNAs
specifically targeting highly conserved regions of HBV robustly
suppresses viral replication and depleted cccDNA. [0922] Nishimasu
et al. (2015) reported the crystal structures of SaCas9 in complex
with a single guide RNA (sgRNA) and its double-stranded DNA
targets, containing the 5'-TTGAAT-3' PAM and the 5'-TTGGGT-3' PAM.
A structural comparison of SaCas9 with SpCas9 highlighted both
structural conservation and divergence, explaining their distinct
PAM specificities and orthologous sgRNA recognition. [0923] Canver
et al. (2015) demonstrated a CRISPR-Cas9-based functional
investigation of non-coding genomic elements. The authors we
developed pooled CRISPR-Cas9 guide RNA libraries to perform in situ
saturating mutagenesis of the human and mouse BCL11A enhancers
which revealed critical features of the enhancers. [0924] Zetsche
et al. (2015) reported characterization of Cpf1, a class 2 CRISPR
nuclease from Francisella novicida U112 having features distinct
from Cas9. Cpf1 is a single RNA-guided endonuclease lacking
tracrRNA, utilizes a T-rich protospacer-adjacent motif, and cleaves
DNA via a staggered DNA double-stranded break. [0925] Shmakov et
al. (2015) reported three distinct Class 2 CRISPR-Cas systems. Two
system CRISPR enzymes (C2c1 and C2c3) contain RuvC-like
endonuclease domains distantly related to Cpf1. Unlike Cpf1, C2c1
depends on both crRNA and tracrRNA for DNA cleavage. The third
enzyme (C2c2) contains two predicted HEPN RNase domains and is
tracrRNA independent. [0926] Slaymaker et al (2016) reported the
use of structure-guided protein engineering to improve the
specificity of Streptococcus pyogenes Cas9 (SpCas9). The authors
developed "enhanced specificity" SpCas9 (eSpCas9) variants which
maintained robust on-target cleavage with reduced off-target
effects.
[0927] Also, "Dimeric CRISPR RNA-guided Fold nucleases for highly
specific genome editing", Shengdar Q. Tsai, Nicolas Wyvekens, Cyd
Khayter, Jennifer A. Foden, Vishal Thapar, Deepak Reyon, Mathew J.
Goodwin, Martin J. Aryee, J. Keith Joung Nature Biotechnology
32(6): 569-77 (2014), relates to dimeric RNA-guided Fold Nucleases
that recognize extended sequences and can edit endogenous genes
with high efficiencies in human cells.
[0928] With respect to general information on CRISPR-Cas Systems,
components thereof, and delivery of such components, including
methods, materials, delivery vehicles, vectors, particles, AAV, and
making and using thereof, including as to amounts and formulations,
all useful in the practice of the instant invention, reference is
made to: U.S. Pat. Nos. 8,999,641, 8,993,233, 8,945,839, 8,932,814,
8,906,616, 8,895,308, 8,889,418, 8,889,356, 8,871,445, 8,865,406,
8,795,965, 8,771,945 and 8,697,359; US Patent Publications US
2014-0310830 (U.S. application Ser. No. 14/105,031), US
2014-0287938 A1 (U.S. application Ser. No. 14/213,991), US
2014-0273234 A1 (U.S. application Ser. No. 14/293,674),
US2014-0273232 A1 (U.S. application Ser. No. 14/290,575), US
2014-0273231 (U.S. application Ser. No. 14/259,420), US
2014-0256046 A1 (U.S. application Ser. No. 14/226,274), US
2014-0248702 A1 (U.S. application Ser. No. 14/258,458), US
2014-0242700 A1 (U.S. application Ser. No. 14/222,930), US
2014-0242699 A1 (U.S. application Ser. No. 14/183,512), US
2014-0242664 A1 (U.S. application Ser. No. 14/104,990), US
2014-0234972 A1 (U.S. application Ser. No. 14/183,471), US
2014-0227787 A1 (U.S. application Ser. No. 14/256,912), US
2014-0189896 A1 (U.S. application Ser. No. 14/105,035), US
2014-0186958 (U.S. application Ser. No. 14/105,017), US
2014-0186919 A1 (U.S. application Ser. No. 14/104,977), US
2014-0186843 A1 (U.S. application Ser. No. 14/104,900), US
2014-0179770 A1 (U.S. application Ser. No. 14/104,837) and US
2014-0179006 A1 (U.S. application Ser. No. 14/183,486), US
2014-0170753 (U.S. application Ser. No. 14/183,429), US
2015-0184139 (U.S. application Ser. No. 14/324,960), Ser. No.
14/054,414; European Patents EP 2 764 103 (EP13824232.6), EP 2 784
162 (EP14170383.5) and EP 2 771 468 (EP13818570.7); and PCT Patent
Publications PCT Patent Publications WO 2014/093661
(PCT/US2013/074743), WO 2014/093694 (PCT/US2013/074790), WO
2014/093595 (PCT/US2013/074611), WO 2014/093718
(PCT/US2013/074825), WO 2014/093709 (PCT/US2013/074812), WO
2014/093622 (PCT/US2013/074667), WO 2014/093635
(PCT/US2013/074691), WO 2014/093655 (PCT/US2013/074736), WO
2014/093712 (PCT/US2013/074819), WO 2014/093701
(PCT/US2013/074800), WO 2014/018423 (PCT/US2013/051418), WO
2014/204723 (PCT/US2014/041790), WO 2014/204724
(PCT/US2014/041800), WO 2014/204725 (PCT/US2014/041803), WO
2014/204726 (PCT/US2014/041804), WO 2014/204727
(PCT/US2014/041806), WO 2014/204728 (PCT/US2014/041808), WO
2014/204729 (PCT/US2014/041809), WO 2015/089351
(PCT/US2014/069897), WO 2015/089354 (PCT/US2014/069902), WO
2015/089364 (PCT/US2014/069925), WO 2015/089427
(PCT/US2014/070068), WO 2015/089462 (PCT/US2014/070127), WO
2015/089419 (PCT/US2014/070057), WO 2015/089465
(PCT/US2014/070135), WO 2015/089486 (PCT/US2014/070175),
PCT/US2015/051691, PCT/US2015/051830. Reference is also made to
U.S. provisional patent applications 61/758,468; 61/802,174;
61/806,375; 61/814,263; 61/819,803 and 61/828,130, filed on Jan.
30, 2013; Mar. 15, 2013; Mar. 28, 2013; Apr. 20, 2013; May 6, 2013
and May 28, 2013 respectively. Reference is also made to U.S.
provisional patent application 61/836,123, filed on Jun. 17, 2013.
Reference is additionally made to U.S. provisional patent
applications 61/835,931, 61/835,936, 61/836,127, 61/836,101,
61/836,080 and 61/835,973, each filed Jun. 17, 2013. Further
reference is made to U.S. provisional patent applications
61/862,468 and 61/862,355 filed on Aug. 5, 2013; 61/871,301 filed
on Aug. 28, 2013; 61/960,777 filed on Sep. 25, 2013 and 61/961,980
filed on Oct. 28, 2013. Reference is yet further made to: PCT
Patent applications Nos: PCT/US2014/041803, PCT/US2014/041800,
PCT/US2014/041809, PCT/US2014/041804 and PCT/US2014/041806, each
filed Jun. 10, 2014; PCT/US2014/041808 filed Jun. 11, 2014; and
PCT/US2014/62558 filed Oct. 28, 2014, and U.S. Provisional Patent
Applications Ser. Nos. 61/915,148, 61/915,150, 61/915,153,
61/915,203, 61/915,251, 61/915,301, 61/915,267,61/915,260, and
61/915,397, each filed Dec. 12, 2013; 61/757,972 and 61/768,959,
filed on Jan. 29, 2013 and Feb. 25, 2013; 61/835,936, 61/836,127,
61/836,101, 61/836,080, 61/835,973, and 61/835,931, filed Jun. 17,
2013; 62/010,888 and 62/010,879, both filed Jun. 11, 2014;
62/010,329 and 62/010,441, each filed Jun. 10, 2014; 61/939,228 and
61/939,242, each filed Feb. 12, 2014; 61/980,012, filed April
15,2014; 62/038,358, filed Aug. 17, 2014; 62/054,490, 62/055,484,
62/055,460 and 62/055,487, each filed Sep. 25, 2014; and
62/069,243, filed Oct. 27, 2014. Reference is made to U.S.
provisional patent application 61/930,214 filed on Jan. 22,
2014.
[0929] Mention is also made of U.S. application 62/180,709, filed
17-Jun-15, PROTECTED GUIDE RNAS (PGRNAS); U.S. application
62/091,455, filed, 12-Dec-14, PROTECTED GUIDE RNAS (PGRNAS); U.S.
application 62/096,708, 24-Dec-14, PROTECTED GUIDE RNAS (PGRNAS);
U.S. application 62/091,462, 12-Dec-14, DEAD GUIDES FOR CRISPR
TRANSCRIPTION FACTORS; U.S. application 62/096,324, 23-Dec-14,
62/180,681, 17 Jun. 2015, and 62/237,496, 5 Oct. 2015, DEAD GUIDES
FOR CRISPR TRANSCRIPTION FACTORS; U.S. application 62/091,456,
12-Dec-14 and 62/180,692, 17 Jun. 2015, ESCORTED AND FUNCTIONALIZED
GUIDES FOR CRISPR-CAS SYSTEMS; U.S. application 62/091,461,
12-Dec-14, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE
CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR GENOME EDITING AS TO
HEMATOPOETIC STEM CELLS (HSCs); U.S. application 62/094,903,
19-Dec-14, UNBIASED IDENTIFICATION OF DOUBLE-STRAND BREAKS AND
GENOMIC REARRANGEMENT BY GENOME-WISE INSERT CAPTURE SEQUENCING;
U.S. application 62/096,761, 24-Dec-14, ENGINEERING OF SYSTEMS,
METHODS AND OPTIMIZED ENZYME AND GUIDE SCAFFOLDS FOR SEQUENCE
MANIPULATION; U.S. application 62/098,059, 30-Dec-14 and
62/181,667, 18 Jun. 2015, RNA-TARGETING SYSTEM; U.S. application
62/096,656, 24-Dec-14 and 62/181,151, 17 Jun. 2015, CRISPR HAVING
OR ASSOCIATED WITH DESTABILIZATION DOMAINS; U.S. application
62/096,697, 24-Dec-14, CRISPR HAVING OR ASSOCIATED WITH AAV; U.S.
application 62/098,158, 30-Dec-14, ENGINEERED CRISPR COMPLEX
INSERTIONAL TARGETING SYSTEMS; U.S. application 62/151,052,
22-Apr-15, CELLULAR TARGETING FOR EXTRACELLULAR EXOSOMAL REPORTING;
U.S. application 62/054,490, 24-Sep-14, DELIVERY, USE AND
THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS
FOR TARGETING DISORDERS AND DISEASES USING PARTICLE DELIVERY
COMPONENTS; U.S. application 61/939,154, 12-FEB-14, SYSTEMS,
METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH OPTIMIZED
FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/055,484,
25-Sep-14, SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE
MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S.
application 62/087,537, 4-Dec-14, SYSTEMS, METHODS AND COMPOSITIONS
FOR SEQUENCE MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS
SYSTEMS; U.S. application 62/054,651, 24-Sep-14, DELIVERY, USE AND
THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS
FOR MODELING COMPETITION OF MULTIPLE CANCER MUTATIONS IN VIVO; U.S.
application 62/067,886, 23-Oct-14, DELIVERY, USE AND THERAPEUTIC
APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR
MODELING COMPETITION OF MULTIPLE CANCER MUTATIONS IN VIVO; U.S.
application 62/054,675, 24-Sep-14 and 62/181,002, 17-Jun-2015,
DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS
SYSTEMS AND COMPOSITIONS IN NEURONAL CELLS/TISSUES; U.S.
application 62/054,528, 24-Sep-14, DELIVERY, USE AND THERAPEUTIC
APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS IN IMMUNE
DISEASES OR DISORDERS; U.S. application 62/055,454, 25-Sep-14,
DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS
SYSTEMS AND COMPOSITIONS FOR TARGETING DISORDERS AND DISEASES USING
CELL PENETRATION PEPTIDES (CPP); U.S. application 62/055,460,
25-Sep-14, MULTIFUNCTIONAL-CRISPR COMPLEXES AND/OR OPTIMIZED ENZYME
LINKED FUNCTIONAL-CRISPR COMPLEXES; U.S. application 62/087,475,
4-Dec-14, FUNCTIONAL SCREENING WITH OPTIMIZED FUNCTIONAL CRISPR-CAS
SYSTEMS; U.S. application 62/055,487, 25-Sep-14, FUNCTIONAL
SCREENING WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S.
application 62/087,546, 4-Dec-14 and 62/181,687, 18 Jun. 2015,
MULTIFUNCTIONAL CRISPR COMPLEXES AND/OR OPTIMIZED ENZYME LINKED
FUNCTIONAL-CRISPR COMPLEXES; and U.S. application 62/098,285,
30-Dec-14, CRISPR MEDIATED IN VIVO MODELING AND GENETIC SCREENING
OF TUMOR GROWTH AND METASTASIS.
[0930] Mention is made of U.S. applications 62/181,659, 18 Jun.
2015 and 62/207,318, 19 Aug. 2015, ENGINEERING AND OPTIMIZATION OF
SYSTEMS, METHODS, ENZYME AND GUIDE SCAFFOLDS OF CAS9 ORTHOLOGS AND
VARIANTS FOR SEQUENCE MANIPULATION. Mention is made of U.S.
applications 62/181,675, 18 Jun. 2015, and Attorney Docket No.
46783.01.2128, filed 22 Oct. 2015, NOVEL CRISPR ENZYMES AND
SYSTEMS, U.S. application 62/232,067, 24 Sep. 2015, U.S.
application 62/205,733, 16 Aug. 2015, U.S. application 62/201,542,
5 Aug. 2015, U.S. application 62/193,507, 16 Jul. 2015, and U.S.
application 62/181,739, 18 Jun. 2015, each entitled NOVEL CRISPR
ENZYMES AND SYSTEMS and of U.S. application 62/245,270, 22 Oct.
2015, NOVEL CRISPR ENZYMES AND SYSTEMS. Mention is also made of
U.S. application 61/939,256, 12 Feb. 2014, and WO 2015/089473
(PCT/US2014/070152), 12 Dec. 2014, each entitled ENGINEERING OF
SYSTEMS, METHODS AND OPTIMIZED GUIDE COMPOSITIONS WITH NEW
ARCHITECTURES FOR SEQUENCE MANIPULATION. Mention is also made of
PCT/US2015/045504, 15 Aug. 2015, U.S. application 62/180,699, 17
Jun. 2015, and U.S. application 62/038,358, 17 Aug. 2014, each
entitled GENOME EDITING USING CAS9 NICKASES.
[0931] Each of these patents, patent publications, and
applications, and all documents cited therein or during their
prosecution ("appln cited documents") and all documents cited or
referenced in the appln cited documents, together with any
instructions, descriptions, product specifications, and product
sheets for any products mentioned therein or in any document
therein and incorporated by reference herein, are hereby
incorporated herein by reference, and may be employed in the
practice of the invention. All documents (e.g., these patents,
patent publications and applications and the appln cited documents)
are incorporated herein by reference to the same extent as if each
individual document was specifically and individually indicated to
be incorporated by reference.
[0932] In addition, mention is made of PCT application PCT/US
14/70057, Attorney Reference 47627.99.2060 and BI-2013/107 entitled
"DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS
SYSTEMS AND COMPOSITIONS FOR TARGETING DISORDERS AND DISEASES USING
PARTICLE DELIVERY COMPONENTS (claiming priority from one or more or
all of US provisional patent applications: 62/054,490, filed Sep.
24, 2014; 62/010,441, filed Jun. 10, 2014; and 61/915,118,
61/915,215 and 61/915,148, each filed on Dec. 12, 2013) ("the
Particle Delivery PCT"), incorporated herein by reference, with
respect to a method of preparing an sgRNA-and-Cas9 protein
containing particle comprising admixing a mixture comprising an
sgRNA and Cas9 protein (and optionally HDR template) with a mixture
comprising or consisting essentially of or consisting of
surfactant, phospholipid, biodegradable polymer, lipoprotein and
alcohol; and particles from such a process. For example, wherein
Cas9 protein and sgRNA were mixed together at a suitable, e.g., 3:1
to 1:3 or 2:1 to 1:2 or 1:1 molar ratio, at a suitable temperature,
e.g., 15-30C, e.g., 20-25C, e.g., room temperature, for a suitable
time, e.g., 15-45, such as 30 minutes, advantageously in sterile,
nuclease free buffer, e.g., 1.times.PBS. Separately, particle
components such as or comprising: a surfactant, e.g., cationic
lipid, e.g., 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP);
phospholipid, e.g., dimyristoylphosphatidylcholine (DMPC);
biodegradable polymer, such as an ethylene-glycol polymer or PEG,
and a lipoprotein, such as a low-density lipoprotein, e.g.,
cholesterol were dissolved in an alcohol, advantageously a
C.sub.1-6 alkyl alcohol, such as methanol, ethanol, isopropanol,
e.g., 100% ethanol. The two solutions were mixed together to form
particles containing the Cas9-sgRNA complexes. Accordingly, sgRNA
may be pre-complexed with the Cas9 protein, before formulating the
entire complex in a particle. Formulations may be made with a
different molar ratio of different components known to promote
delivery of nucleic acids into cells (e.g.
1,2-dioleoyl-3-trimethylammonium-propane (DOTAP),
1,2-ditetradecanoyl-sn-glycero-3-phosphocholine (DMPC),
polyethylene glycol (PEG), and cholesterol) For example
DOTAP:DMPC:PEG:Cholesterol Molar Ratios may be DOTAP 100, DMPC 0,
PEG 0, Cholesterol 0; or DOTAP 90, DMPC 0, PEG 10, Cholesterol 0;
or DOTAP 90, DMPC 0, PEG 5, Cholesterol 5. DOTAP 100, DMPC 0, PEG
0, Cholesterol 0. That application accordingly comprehends admixing
sgRNA, Cas9 protein and components that form a particle; as well as
particles from such admixing. Aspects of the instant invention can
involve particles; for example, particles using a process analogous
to that of the Particle Delivery PCT, e.g., by admixing a mixture
comprising sgRNA and/or Cas9 as in the instant invention and
components that form a particle, e.g., as in the Particle Delivery
PCT, to form a particle and particles from such admixing (or, of
course, other particles involving sgRNA and/or Cas9 as in the
instant invention).
[0933] The present invention will be further illustrated in the
following Examples which are given for illustration purposes only
and are not intended to limit the invention in any way.
EXAMPLES
Example 1: Origin and Evolution of Adaptive Immunity Systems
[0934] Classification and Annotation of CRISPR-Cas Systems in
Archaeal and Bacterial Genomes.
[0935] The CRISPR-Cas loci has more than 50 gene families and there
is no strictly universal genes, fast evolution, extreme diversity
of loci architecture. Therefore, no single tree feasible and a
multi-pronged approach is needed. So far, there is comprehensive
cas gene identification of 395 profiles for 93 Cas proteins.
Classification includes signature gene profiles plus signatures of
locus architecture
[0936] A new classification of CRISPR-Cas systems is proposed in
FIG. 1. Class 1 includes multisubunit crRNA-effector complexes
(Cascade) and Class 2 includes Single-subunit crRNA-effector
complexes (Cas9-like). FIG. 2 provides a molecular organization of
CRISPR-Cas. FIG. 3 provides structures of Type I and III effector
complexes: common architecture/common ancestry despite extensive
sequence divergence. FIG. 4 shows CRISPR-Cas as a RNA recognition
motif (RRM)-centered system. FIG. 5 shows Cas1 phylogeny where
recombination of adaptation and crRNA-effector modules show a major
aspect of CRISPR-Cas evolution. FIG. 6 shows a CRISPR-Cas census,
specifically a distribution of CRISPR-Cas types/subtypes among
archaea and bacteria.
[0937] Cas1 is not always linked to CRISPR-Cas systems, therefore
it may be possible that there are two branches of "solo" Cas1 which
suggests there may be differences in function and origin and
possible novel mobile elements (see Makarova, Krupovic, Koonin,
Frontiers Genet 2014). The genome organization of three casposon
families may provide some clues. In addition to Cas1 and PolB,
casposons incorporate diverse genes including various nucleases
(Krupovic et al. BMC Biology 2014). One family has protein-primed
polymerase, another family has RNA-primed polymerase. In addition
to diverse Euryarchaeota and Thaumarchaeota, casposons found in
several bacteria which suggests horizontal mobility. Casposon Cas1
(transposase/integrase) suggests a basal clade in the Cas1
phylogeny.
[0938] Bacteria and archae utilize CRISPR for adaptive immunity in
procaryotes and eukaryotes via genome manipulation. Cas 1 provides
a ready made tool for genome manipulation. There are similar
mechanisms of integration in casposons and CRISPR, specifically
replication-dependent acquisition by copy/paste not cut-and-paste
(Krupovic et al. BMC Biology 2014). Cas1 is a bona fide integrase
(Nufiez J K, Lee A S, Engelman A, Doudna J A. Integrase-mediated
spacer acquisition during CRISPR-Cas adaptive immunity. Nature.
2015 Feb 18). There is similarity between terminal inverted repeats
of casposons and CRISPR (Krupovic et al. BMC Biology 2014).
CRISPR-Cas may have originated from a casposon and an innate
immunity locus (Koonin, Krupovic, Nature Rev Genet, 2015). The
evolution of adaptive immunity systems in prokaryotes and animals
may have been along parallel courses with transposon integration at
innate immunity loci (Koonin, Krupovic, Nature Rev Genet, 2015).
RAGI transposase (the key enzyme of V(D)J recombination in
vertebrates) may have originated from Transib transposons
(Kapitonov V V, Jurka J. RAGI core and V(D)J recombination signal
sequences were derived from Transib transposons. PLoS Biol. 2005
June; 3(6):e181), however, none of the Transibs encodes RAG2. RAG1
and RAG2 encoding transposons are described in Kapitonov, Koonin,
Biol Direct 2015 and Transib transposase phylogeny is presented in
Kapitonov, Koonin, Biol Direct 2015. Defensive DNA elimination in
ciliates evolved from a PiggyMAc transposon and RNAi, an innate
immune system (Swart EC, Nowacki M. The eukaryotic way to defend
and edit genomes by sRNA-targeted DNA deletion. Ann N Y Acad Sci.
2015).
[0939] The relative stability of the classification implies that
the most prevalent variants of CRISPR-Cas systems are already
known. However, the existence of rare, currently unclassifiable
variants implies that additional types and subtypes remain to be
characterized (Makarova et al. 2015. Evolutionary classification of
CRISPR-Cas systems and cas genes).
[0940] Transposons play a key contribution to the evolution of
adaptive immunity and other systems involved in DNA manipulation.
Class 1 CRISPR-Cas originate from transposons but only for an
adaptation module. Class 2 CRISPR-Cas have both both adaptation and
effector functions where modules may have evolved from different
transposons.
Example 2: New Predicted Class 2 CRISPR-Cas Systems and Evidence of
their Independent Origins from Transposable Elements
[0941] The CRISPR-Cas systems of bacterial and archaeal adaptive
immunity show extreme diversity of protein composition and genomic
loci architecture. These systems are broadly divided into two
classes, Class 1 with multisubunit effector complexes and Class 2
with single-subunit effector modules exemplified by the Cas9
protein (FIGS. 1A and 1B). Applicants developed a simple
computational pipeline (FIG. 7) to leverage the expanding genomic
and metagenomic databases along with our current understanding of
CRISPR-Cas systems for prediction of putative new Class 2
CRISPR-Cas systems. Analysis of the database of complete bacterial
genomes using this pipeline resulted in the identification of three
new variants, each represented in diverse bacteria and containing
cas1 and cas2 genes along with a third gene encoding a large
protein predicted to function as the effector module. In the first
of these loci, the putative effector protein (C2c1p) contains a
RuvC-like nuclease domain and resembles the previously described
Cpf1 protein, the predicted effector of Type V CRISPR-Cas systems;
accordingly, the new putative system is classified as subtype V-B.
In depth comparison of protein sequences suggests that the
RuvC-containing effector proteins, Cas9, Cpf1 and C2C1p
independently evolved from different groups of transposon-encoded
TnpB proteins. The second group of new putative CRISPR-Cas loci
encompasses a large protein containing two highly diverged HEPN
domains with predicted RNAse activity. Given the novelty of the
predicted effector protein, these loci are classified as new Type
VI CRISPR-Cas that is likely to target mRNA. Together, the results
of this analysis show that Class2 CRISPR-Cas systems evolved on
multiple, independent occasions, by combination of diverse
Cas1-Cas2-encoding adaptation modules with effector proteins
derived from different mobile elements. This route of evolution
most likely produced multiple variants of Class 2 systems that
remain to be discovered.
[0942] The CRISPR-Cas adaptive immunity systems are present in
.about.45% bacterial and .about.90% archaeal genomes and show
extreme diversity of Cas protein composition and sequence, and
genomic loci architecture. Based on the structural organization of
their crRNA-effector complexes, these systems are divided into two
classes, namely class 1, with multisubunit effector complexes, and
class 2, with single subunit effector complexes (Makarova, 2015)
(FIGS. 1A and 1B). Class 1 systems are much more common and diverse
than Class 2 systems. Class 1 currently is represented by 12
distinct subtypes encoded by numerous archaeal and bacterial
genomes, whereas class 2 systems include three subtypes of Type II
system and the putative Type V that collectively are found in about
10% of sequenced bacterial genomes (with a single archaeal genome
encompassing a putative Type system). Class 2 systems typically
contain only three or four genes in the cas operon, namely the
cas1-cas2 pair of genes that are involved in adaptation but not in
interference, a single multidomain effector protein that is
responsible for interference but also contributes to the pre-crRNA
processing and adaptation, and often a fourth gene with
uncharacterized functions that is dispensable in at least some Type
II systems. In most cases, a CRISPR array and a gene for a distinct
RNA species known as tracrRNA (trans-encoded small CRISPR RNA) are
adjacent to Class 2 cas operons (Chylinski, 2014). The tracrRNA is
partially homologous to the repeats within the respective CRISPR
array and is essential for the processing of pre-crRNA that is
catalyzed by RNAse III, a ubiquitous bacterial enzyme that is not
associated with the CRISPR-cas loci (Deltcheva, 2011)(XChylinski,
2014; Chylinski, 2013).
[0943] The Type II multidomain effector protein Cas9 has been
functionally and structurally characterized in exquisite detail. In
different bacteria, Cas9 proteins encompass from about 950 to over
1,600 amino acids, such as between about 950 and 1,400 amino acids,
and contain two nuclease domains, namely a RuvC-like (RNase H fold)
and HNH (McrA-like) nucleases (Makarova, 2011). The crystal
structure of Cas9 reveals a bilobed organization of the protein,
with distinct target recognition and nuclease lobes, with the
latter accommodating both the RuvC and the HNH domains (Nishimasu,
2014XJinek, 2014). Each of the nuclease domains of Cas9 is required
for the cleavage of one of the target DNA strands (Jinek, 2012;
Sapranauskas, 2011). Recently, Cas9 has been shown to contribute to
all three stages of the CRISPR response, that is not only target
DNA cleavage (interference) but also adaptation and pre-crRNA
processing (Jinek, 2012). More specifically, a distinct domain in
the nuclease lobe of Cas9 has been shown to recognize and bind the
Protospacer-Associated Motif (PAM) in viral DNA during the
adaptation stage (Nishimasu, 2014XJinek, 2014XHeler, 2015; Wei,
2015). At this stage of the CRISPR response, Cas9 forms a complex
with Cas1 and Cas2, the two proteins that are involved in spacer
acquisition in all CRISPR-Cas systems (Heler, 2015; Wei, 2015).
[0944] The Cas9 protein, combined with tracrRNA, has recently
become the key tool for the new generation of genome editing and
engineering methods (Gasiunas, 2013; Mali, 2013; Sampson, 2014;
Cong, 2015). This utility of Cas9 in genome editing hinges on the
fact that in Type II CRISPR-Cas systems, unlike other types of
CRISPR-Cas systems, all the activities required for the target DNA
recognition and cleavage are assembled within a single, albeit
large, multidomain protein. This feature of Type II systems greatly
facilitates the design of efficient tools for genome manipulation.
Importantly, not all variants of Cas9 are equal. Most of the work
so far has been done with Cas9 from Streptococcus pyogenes but
other Cas9 species could offer substantial advantages. As a case in
point, recent experiments with Cas9 from Staphylococcus aureus that
is about 300 amino acids shorter than the S. pyogenes protein have
allowed Cas9 packaging into the adeno-associated virus vector,
resulting in a major enhancement of CRISPR-Cas utility for genome
editing in vivo (Ran, 2015).
[0945] Type II CRISPR-Cas systems currently are classified into 3
subtypes (II-A, II-B and II-C) (Makarova, 2011) (Fonfara, 2014;
Chylinski, 2013; Chylinski, 2014). In addition to the cas1, cas2
and cas9 genes that are shared by all Type II loci, subtype II-A is
characterized by an extra gene, csn2, that encodes an inactivated
ATPase (Nam, 2011; Koo, 2012; Lee, 2012) that plays a still poorly
characterized role in spacer acquisition (Barrangou, 2007; Arslan,
2013XHeler, 2015). Subtype II-B systems lack csn2 but instead
contains the cas4 gene that is otherwise typical of Type I systems
and encodes a recB family 5'-3' exonuclease that contributes to
spacer acquisition by generating recombinogeneci DNA ends (Zhang,
2012XLemak, 2013; Lemak, 2014). The cas1 and cas2 genes of subtype
II-B are most closely related to the respective proteins of Type I
CRISPR-Cas systems which implies a recombinant origin of this Type
II subtype (Chylinski, 2014).
[0946] Subtype II-C CRISPR-Cas systems are the minimal variety that
consists only of the cas1, cas2 and cas9 genes (Chylinski, 2013;
Koonin, 2013; Chylinski, 2014). Notably, however, it has been shown
that in Campylobacter jejuni spacer acquisition by the Type II-C
systems requires the participation of Cas4 encoded by a
bacteriophage (Hooton, 2014). Another distinct feature of subtype
II-C is the formation of some of the crRNAs by transcription
involves transcription from internal alternative promoters as
opposed to processing observed in all other experimentally
characterized CRISPR-Cas systems (Zhang, 2013).
[0947] Recently, the existence of Type V CRISPR-Cas systems has
been predicted by comparative analysis of bacterial genomes. These
putative novel CRISPR-Cas systems are represented in several
bacterial genomes, in particular those from the genus Francisella
and one archaeon, Methanomethylophilus alvus (Vestergaard, 2014).
All putative Type V loci encompass cas1, cas2, a distinct gene
denoted cpf1 and a CRISPR array (Schunder, 2013XMakarova, 2015).
Cpf1 is a large protein (about 1300 amino acids) that contains a
RuvC-like nuclease domain homologous to the corresponding domain of
Cas9 along with a counterpart to the characteristic arginine-rich
cluster of Cas9. However, Cpf1 lacks the HNH nuclease domain that
is present in all Cas9 proteins, and the RuvC-like domain is
contiguous in the Cpf1 sequence, in contrast to Cas9 where it
contains long inserts including the HNH domain (Chylinski, 2014;
Makarova, 2015). These major differences in the domain
architectures of Cas9 and Cpf1 suggest that the Cpf1-containing
systems should be classified as a new type. The composition of the
putative Type V systems implies that Cpf1 is a single-subunit
effector complex, and accordingly, these systems are assigned to
Class 2 CRISPR-Cas. Some of the putative Type V loci encode Cas4
and accordingly resemble subtype II-B loci, whereas others lack
Cas4 and thus are analogous to subtype II-C.
[0948] It has been shown that the closest homologs of Cas9 and Cpf1
proteins are TnpB proteins that are encoded in IS605 family
transposons and contain the RuvC-like nuclease domain as well as a
Zn-finger that has a counterpart in Cpf1. In addition, homologs of
TnpB have been identified that contain a HNH domain inserted into
the RuvC-like domain and show high sequence similarity to Cas9. The
role of TnpB in transposons remains uncertain as it has been shown
that this protein is not required for transposition.
[0949] Given the homology of Cas9 and Cpf1 to transposon-encoded
proteins, Applicants hypothesized that Class 2 CRISPR-Cas systems
could have evolved on multiple occasions as a result of
recombination between a transposon and a cas1-cas2 locus.
Accordingly, Applicants devised a simple computational strategy to
identify genomic loci that could be candidates for novel variants
of Class 2. Here Applicants describe the first application of this
approach that resulted in the identification of three groups of
such candidates two of which appear to be distinct subtypes of Type
V whereas the third one seems to qualify at Type VI. The new
variants of Class2 CRISPR-Cas systems are of obvious interest as
potential tools for genome editing and expression regulation.
[0950] Database Search Strategy for Detection of Candidate Novel
Class 2 CRISPR-Cas Loci.
[0951] Applicants implemented a straightforward computational
approach to identify candidate novel Class 2 CRISPR-Cas systems
(FIG. 7. Pipeline). Because the vast majority of the CRISPR-Cas
loci encompass a cas1 gene (Makarova, 2011; Makarova, 2015) and the
Cas1 sequence is the most highly conserved one among all Cas
proteins (Takeuchi, 2012), Applicants reasoned that cas1 is the
best possible anchor to identify candidate new loci using
translating PSI-BLAST search with Cas1 profiles. After detecting
all contigs encoding Cas1 by searching the WGS (whole genome
shotgun) and NT (nucleotide) databases at the NCBI, the
protein-coding genes were predicted using GenemarkS within the 20
KB regions upstream and downstream of the cas1 gene. These
predicted genes were annotated using the NCBI Conserved Domain
Database (CDD) and Cas protein-specific profiles (Makarova et al.,
2015, Nat Rev Microbiol. 2015, doi: 10.1038/nrmicro3569), and
CRISPR arrays were predicted using the PILER-CR program. This
procedure provided for assignment of the detected CRISPR-Cas loci
to the known subtypes. Partial and/or unclassified candidate
CRISPR-Cas loci containing large (>500 aa) proteins were
selected as candidates for novel Class 2 systems given the
characteristic presence of such large single-subunit effector
proteins in Types II and V systems (Cas9 and Cpf1, respectively).
All 63 candidate loci detected using these criteria (listed in the
Table set forth in FIG. 40A-D) were analyzed on a case by case
basis using PSI-BLAST and HHpred. The protein sequences encoded in
the candidate loci were further used as queries to search
metagenomic databases for additional homologs, and long contigs
detected in these searches were analyzed as indicated above. This
analysis pipeline yielded a total of 53 novel loci (some of the
originally identified 63 candidate loci were discarded as spurious
whereas several incomplete loci that lacked cas1 were added) with
characteristic features of Class 2 CRISPR-Cas systems that could be
classified into three distinct groups of loci based on the nature
of the predicted effector proteins (see FIGS. 8A and 8B; FIGS. 9,
14 and 15; and FIGS. 41A-B, 42A-B, and 43A-B). Although
bacteriophages infecting bacteria that harbor the newly discovered
class 2 CRISPR-Cas systems are virtually unknown, for each of these
systems, we detected spacers that matched phages or predicted
prophages.
[0952] Using the computational strategy, the Applicants realised
three new Class 2 CRISPR-Cas systems, namely C2c1 and C2c3, which
are classified as subtypes of the previously described putative
type V, and C2c2, which the Applicants assign to a new putative
type VI on the strength of the presence of a novel predicted
effector protein. The Applicants present multiple lines of evidence
that these loci encode functional CRISPR-Cas systems. On the
comparative genomic side, we identified phage-specific spacers for
each of the three putative novel systems and also showed that the
sets of spacers are completely different in closely related
bacterial genomes suggestive of active, functioning immunity. Many
of these new systems occur in bacterial genomes that encompass no
other CRISPR-Cas loci, suggesting that type V and type VI systems
can function autonomously. Furthermore, even when other CRISPR-Cas
systems were identified in the same genomes, the associated repeat
structures were clearly distinct from those in types V and VI,
suggestive of independent functionality.
[0953] Putative Type V-B System.
[0954] The first group of candidate loci, provisionally denoted
C2c1 (Class 2 candidate 1), is represented in bacterial genomes
from four major taxa, including Bacilli, Verrucomicrobia,
alpha-proteobacteria and delta-proteobacteria (FIG. 8A-B
"Organization of complete loci of Class 2 systems"; FIG. 41A-B).
All C2c1 loci encode a Cas1-Cas4 fusion, Cas2, and the large
protein that Applicants denote C2c1p, and typically, are adjacent
to a CRISPR array (FIG. 9, C2c1 neighborhoods; FIG. 41A-B). In the
phylogenetic tree of Cas1, the respective Cas1 proteins cluster
with Type I-U system (FIGS. 10A and 10B, FIG. 10C-W, Cas1 tree),
the only one in which the Cas1-Cas4 fusion is found. The lengths of
the C2c1p proteins identified herein range from about 1100 to about
1500 amino acids, for example may consist of approximately 1200
amino acids, and HHpred search detected significant similarity
between the C-terminal portion of the C2c1p proteins and a subset
of TnpB proteins encoded in transposons of the IS605 family (FIGS.
13A and 13C). In contrast, no significant similarity was detected
between C2c1p and Cas9 or Cpf1 that are similar to other groups of
TnpB proteins (Chylinski, 2014XMakarova, 2015; Makarova, 2015).
Thus, the domain architecture of C2c1p is similar to that of Cpf1
and distinct from that of Cas9 (FIG. 13A) although all three Cas
proteins seem to have evolved from the TnpB family (FIG. 11 "Domain
organization of class 2 families"; FIG. 13A). The N-terminal region
of C2c1p shows no significant similarity to other proteins.
Secondary structure prediction indicates that this region adopts
mostly alpha-helical conformation. The two segments of similarity
with TnpB encompass the three catalytic motifs of the RuvC-like
nuclease, with the diagnostic D . . . E . . . D signature of
catalytic amino acid residues (Aravind et al., 2000, Nucleic Acids
Res, vol. 28, 3417-3432) (FIG. 12, "TnpB homology regions in Class
2 proteins"); the region corresponding to the bridge helix (also
known as arginine-rich cluster) that in Cas9 protein is involved in
crRNA-binding; and a small region that appears to be the
counterpart to the Zn finger of TnpB (however, the Zn-binding
cysteine residues are missing in the majority of C2c1 proteins
indicating that such proteins do not bind zinc; moreover, C2c1
contain multiple insertions and deletions in this region suggestive
of functional divergence (FIG. 13A, FIG. 13D-H, FIG. 13I). The
conservation of the catalytic residues (FIG. 13A) strongly suggests
that the RuvC homology domains of all these proteins are active
nucleases. The N-terminal regions of C2c1 show no significant
similarity to any known proteins. Secondary structure predictions
indicate that the N-terminal regions of C2c1 proteins adopt a mixed
.alpha./.beta. conformation (FIG. 13D-H, FIG. 13I). The similarity
of the domain architectures of C2c1p and Cpf1 suggests that the
C2c1 loci are best classified as Subtype V-B in which case the
Cpf1-encoding loci become Subtype V-A.
[0955] Despite similarity of cas1 genes associated with this
system, the CRISPR repeats in the respective arrays are highly
heterogeneous although all of them are 36-37 bp long and can be
classified as unstructured (folding energy, AG, is .about.0.5-4.5
kcal/mole whereas highly palindromic CRISPR have AG below -7
kcal/mole). According to the CRISPRmap (Lange, 2013) classification
scheme, several of the Subtype V-B repeats share some sequence or
structural similarity with Type II repeats (FIG. 41A-T). However,
most of the repeats could not be classified into the known sequence
or structure families and were variously assigned to 4 of the 6
superclasses (FIG. 41A-T).
[0956] Considering the possibility that the putative Subtype V-B
CRISPR-Cas systems are mechanistically analogous to Type II
systems, Applicants attempted to identify the tracrRNA in the
respective genomic loci
[0957] Comparison of the spacers from the Type V-B CRISPR arrays to
the non-redundant nucleotide sequence database identified several
matches to various bacterial genomes. In particular, one of the
spacers from Alicyclobacillus acidoterrestris and one of the
spacers from Brevibacillus agri matched uncharacterized genes
within predicted prophages integrated into the respective bacterial
genomes (FIG. 41A-L).
[0958] Putative type VI systems. The second group of candidate
CRISPR-Cas loci, denoted C2c2 (Class 2 candidate 2), was identified
in genomes from 5 major bacterial taxa, including
alpha-proteobacteria, Bacilli, Clostridia, Fusobacteria and
Bacteroidetes (FIG. 8A-B "Organization of complete loci of Class 2
systems"; FIG. 42A-B).A number of C2c2 loci encompass cas1 and cas2
genes, along with a large protein (C2c2p) that shows no sequence
similarity to C2c1, Cpf1, or Cas9, and a CRISPR array; however,
unlike C2c1, C2c2p is often encoded next to a CRISPR array but not
cas1-cas2 (FIG. 15, C2c2 neighborhoods; FIG. 42A-B). Although under
our computational strategy, the originally identified C2c2 loci
encompassed the cas1 and cas2 genes, subsequent searches showed
that the majority of such loci may consist only of the c2c2 gene
and a CRISPR array. Such apparently incomplete loci could either
encode defective CRISPR-Cas systems or might function with the
adaptation module encoded elsewhere in the genome, as has been
observed for some type III systems (Majumdar et al., 2015, RNA,
vol. 21, 1147-1158). In the phylogenetic tree of Cas1, the Cas1
proteins from the C2c2 loci are distributed among two clades. The
first clade includes Cas1 from Clostridia and is located within the
Type II subtree along with a small Type III-A branch (FIGS. 10A and
10B, FIG. 10C-V, Cas1 tree). The second clade consists of Cas1
proteins from C2c2 loci of Leptotrichia and is lodged inside a
mixed branch that mostly contains Cas1 proteins from Type III-A
CRISPR-Cas systems. Database searches using HHpred and PSI-BLAST
detected no sequence similarity between C2c2p and other proteins.
However, inspection of multiple alignments of C2c2p protein
sequences led to the identification of two strictly conserved
RxxxxH motifs that are characteristic of HEPN (Higher Eukaryotes
and Prokaryotes Nucleotide-binding) domains (Anantharaman et al.,
2013, Biol Direct, vol 8, 15; Grynberg et al., 2003, Trends in
biochemical sciences, vol. 28, 224-226) (FIG. 11 and FIG. 13B, FIG.
13J-N). Secondary structure predictions indicates that these motifs
are located within structural contexts compatible with the HEPN
domain structure as is the overall secondary structure prediction
for the respective portions of C2c2p. The HEPN domains are small
(.about.150 aa) alpha helical domains with diverse sequences but
highly conserved catalytic motifs that have been shown or predicted
to possess RNAse activity and are often associated with various
defense systems (Anantharaman, 2013) (FIGS. 13B and 16, HEPN RxxxxH
motif in C2c2 family). The sequences of HEPN domains show little
conservation except for the catalytic RxxxxH motif. While the
sequences of the two putative HEPN domains of C2c2 show little
similarity to other HEPN domains except for the catalytic RxxxxH
motifs, the domain identity is strongly supported by secondary
structure predictions that indicate that each motif is located
within compatible structural contexts (FIG. 13B, FIG. 13J-N).
Furthermore, the predicted secondary structure of the entire
sequence for each putative domain is also consistent with the HEPN
fold (FIG. 13J-N). Thus, it appears likely that C2c2p contains two
active HEPN domains. The HEPN domain is not new to CRISPR-Cas
systems as it is often associated with the CARF (CRISPR-Associated
Rossmann Fold) domain in Csm6 and Csx1 proteins that are present in
many Type III CRISPR-Cas systems (Makarova, 2014). These proteins
do not belong to either the adaptation modules or effector
complexes but are thought to perform some accessory, still
uncharacterized functions in cognate CRISPR, more particularly they
appear to be components of the associated immunity module that is
present in the majority of CRISPR-Cas systems and is implicated in
programmed cell death as well as regulatory functions during the
CRISPR response (Koonin, 2013; Makarova, 2012; Makarova, 2013).
However, C2c2p differs from Csm6 and Csx1 in that this much larger
protein is the only common protein encoded in the C2c2 loci, except
for Cas1 and Cas2. Thus, it appears likely that C2c2p is the
effector of these putative novel CRISPR-Cas systems and the HEPN
domains are the catalytic moieties thereof. Outside of the
predicted HEPN domains, the C2c2p sequence showed no detectable
similarity to other proteins and is predicted to adopt a mixed
alpha/beta secondary structure without discernible similarity to
any known protein folds (FIG. 13J-N).
[0959] The CRISPR arrays in the C2c2 loci are highly heterogeneous,
with the length of 35 to 39 bp, and unstructured (folding energy of
.about.0.9 to 4.7 kcal/mole). According to CRISPRmap (Lange, 2013),
these CRISPR do not belong to any of the established structural
classes and are assigned to 3 of the 6 superclasses. Only the
CRISPR from Listeria seeligeri was assigned to the sequence family
24 that is usually associated with Type II-C systems (FIG.
42A-L).
[0960] Spacer analysis of the C2c2 loci identified one 30
nucleotide region identical to a genomic sequence from Listeria
weihenstephanensis and two imperfect hits to bacteriophage genomes,
in particular, a spacer from Listeria weihenstephanensis matched
the tail gene of a Listeria bacteriophage (FIG. 42A-L).
[0961] Given the unique predicted effector complex of C2c2, these
systems seem to qualify as a putative Type VI CRISPR-Cas.
Furthermore, taking into account that all experimentally
characterized and enzymatically active HEPN domains are RNAses,
Type VI systems are likely to act at the level of RNA, such as
mRNA.
[0962] Putative Type V-C Systems.
[0963] The third group of candidate loci includes solely
metagenomic sequences and thus could not be assigned to specific
taxa. These loci encompass only two protein-coding genes that
encode Cas1 and a large protein denoted C2c3 (Class 2 candidate 3)
(FIG. 8A "Organization of complete loci of Class 2 systems"; FIG.
14, C2c3 neighbourhoods, FIG. 43A-B). The C2c3 proteins are in the
same size range as Cpf1 and C2c1, and similarly contain a
TnpB-homologous domain at their C-termini which, unlike the
respective domain of C2c1, showed a limited but significant
similarity to Cpf1 (FIGS. 13A and 13C). The TnpB homology regions
of C2c3 contain the three catalytic motifs of the RuvC-like
nuclease, with the diagnostic D . . . E . . . D triad of catalytic
amino acid residues (Aravind et al., 2000, supra), the region
corresponding to the bridge helix (also known as the arginine-rich
cluster), which is involved in crRNA-binding in Cas9, and a small
region that appears to be the counterpart to the Zn finger of TnpB
(the Zn-binding cysteine residues are conserved in C2c3). The
conservation of the catalytic residues strongly suggests that the
RuvC homology domains of all these proteins are active nucleases.
The N-terminal regions of C2c1 and C2c3 show no significant
similarity to each other or any known proteins. Secondary structure
predictions indicate that the N-terminal regions of C2c3 proteins
adopt a mixed a/(3 conformation. Thus, the overall domain
architectures of C2c1 and C2c3, and in particular the organization
of the RuvC domain, are similar to that of Cpf1 but distinct from
that of Cas9. This suggests that the C2c1 and C2c3 loci are best
classified as subtypes V-B (see above) and V-C, respectively, with
Cpf1-encoding loci now designated subtype V-A.
[0964] Among the c2c3 loci, only one contains a CRISPR array with
unusually short, 17-18 nt spacers. The repeats in this array are 25
bp long and appear to be unstructured with folding energy of
.about.1.6 kcal/mol (FIG. 43A-F).
[0965] Spacers from the only C2c3 contig containing a CRISPR array
are too short to produce statistically significant hits.
Nevertheless, several matches to sequences from predicted prophages
were identified (FIG. 43A-F).
[0966] The subsets of the TnpB proteins with significant similarity
to the one known (Cas9) and three herein disclosed putative Class 2
effectors (Cpf1, C2c1 and C2c3) did not overlap (FIGS. 13A and
13C). Although the sequence divergence among the TnpB-like domains
is too high to allow reliable phylogenetic analysis, these findings
suggest that the four currently identified large effector proteins
of Class 2, Cas9, Cpf1, C2c1 and C2c3, have evolved independently
from genes of distinct transposable elements.
[0967] Although the majority of spacers in the new CRISPR-Cas loci
described herein were not significantly similar to any available
sequences, the existence of spacers matching phage genomes implies
that these loci may encode active, functional adaptive immunity
systems. The small fraction of phage-specific spacers is typical of
CRISPR-Cas systems and is most likely indicative of their dynamic
evolution and the small fraction of virus diversity that is
represented in the current sequence databases. This interpretation
is compatible with the observation that closely related bacterial
strains encoding homologous CRISPR-Cas loci typically contain
unrelated collections of spacers, as exemplified by the C2c2 loci
from Listeria weihenstephanensis and Listeria newyorkensis (FIG.
45A-C).
[0968] Applicants applied a simple, straightforward computational
strategy to predict new Class 2 CRISPR-cas systems. The previously
described class 2 systems, namely Type II and the putative Type V,
consisted of the cas1 and cas2 genes (and in some cases also cas4)
comprising the adaptation module and a single large protein that
comprises the effector module. Therefore, Applicants surmised that
any genomic locus containing cas1 and a large protein could be a
potential candidate for a novel Class 2 system that merits detailed
investigation. Such analysis using sensitive methods for protein
sequence comparison led to the identification of three strong
candidates two of which are distinct subtypes of the previously
described putative Type V (subtypes V-B and V-C) whereas the third
one qualifies as a new putative Type VI, on the strength of the
presence of a novel predicted effector protein. Many of these new
systems occur in bacterial genomes that encompass no other
CRISPR-Cas loci (FIG. 44A-E) suggesting that Type V and Type VI
systems can function autonomously. The herein disclosed candidate
loci were validated through functional assays which revealed the
expression and processing of the respective CRISPR arrays, yielding
mature crRNAs, identification of putative tracrRNA (where present),
demonstration of interference when expressed in E. coli,
determination of the protospacer adjacent motif (PAM), and
interrogation of the minimal components necessary for lysate
cleavage.
[0969] Type V systems encode predicted effector proteins that
resemble Cas9 in their overall domain architecture, but in contrast
to Cas9, the RuvC-like domains of Cpf1, C2c1 and C2c3 are
contiguous in the protein sequence, lacking the inserts
characteristic of Cas9, particularly the HNH nuclease domain. The
presence of one instead of two nuclease domains indicates that type
V effector proteins mechanistically differ from Cas9 in which the
HNH and RuvC domains are responsible for the cleavage of the
complementary and non-complementary strands of the target DNA,
respectively (Chen et al., 2014, The Journal of biological
chemistry, vol. 289, 13284-13294; Gasiunas et al., 2012,
Proceedings of the National Academy of Sciences of the United
States of America, vol. 109, E2579-2586; Jinek et al., 2012,
Science, vol. 337, 816-821). The predicted type V effector proteins
might form dimers in which the two RuvC-like domains would cleave
the opposite strands of the target molecule.
[0970] The putative type VI CRISPR-Cas systems seem to rely on a
novel effector protein that contains two predicted HEPN domains
that, similar to the previously characterized HEPN domains, could
possess RNAse activity, suggesting that type VI systems might
target and cleave mRNA. Previously, mRNA targeting has been
reported for certain type III CRISPR-Cas systems (Hale et al.,
2014, Genes Dev, vol. 28, 2432-2443; Hale et al., 2009, Cell, vol.
139, 945-956; Peng et al., 2015, Nucleic acids research, vol. 43,
406-417). An alternative possibility is that C2c2 is the first
DNAse in the HEPN superfamily, perhaps with the two HEPN domains
each cleaving one DNA strand. Thus, it might be possible to develop
C2c1 and C2c2 into genome editing tools with different classes of
targets.
[0971] To validate the functionality of these Class2 CRISPR-Cas
systems, the Applicants showed that two C2c1 CRISPR arrays are
expressed, processed into mature crRNAs, and capable of
interference when expressed in E. coli. These experiments revealed
several characteristics of the C2c1 locus including: (i) a 5'
processed DR on the crRNA, (ii) a 5' PAM, and (iii) the presence of
a short RNA with repeat-anti-repeat homology to the processed 5'
DR, i.e., a putative tracrRNA. The discovery of a 5' processed DR
and 5' PAM supports the scenario in which C2c1 is derived from
Class 1 systems because these systems show evidence of 5' repeat
processing (type I and III) and a 5' PAM (type I) (Mojica et al.,
2009, Microbiology, vol. 155, 733-740; Makarova et al., 2011, Nat
Rev Microbioln vol. 9, 467-477). Notably, the AT-rich PAM
identified here for C2c1 is in contrast to the GC-rich PAMs of the
other well-characterized Class 2 system (type II). For C2c1 loci
experimentally characterized here, the Applicants identified crRNAs
that are processed to a length that preserves the binding and
co-folding with putative tracrRNAs, suggesting that tracrRNAs may
be involved in and possibly required for complex formation. We then
used expression of C2c1 in a human cell culture to experimentally
test that under those circumstances a tracrRNA was involved in and
necessary for the in vitro cleavage of target DNA by the particular
C2c1 nuclease tested.
[0972] The Applicants also showed that when the C2c2 locus from L.
seeligeri is expressed in E. coli, it is processed into crRNAs with
a 29-nt 5' DR; similar results were obtained for the C2c2 locus of
L. shahii. In this case, the degenerate repeat is at the beginning
of the array, rather than at the end, as is typical for most CRISPR
arrays, and the array and cas genes are transcribed
co-directionally. The Applicants did not detect the putative
tracrRNA in the C2c2 RNA-seq data. However, the predicted secondary
structure of the 29-nt DR shows a stable hairpin handle which could
be potentially important for complex formation with the C2c2
effector protein.
[0973] FIG. 94 demonstrates that processing of the C2c2 array in E.
coli requires the C2c2 protein, as evaluated with in vitro
transcribed spacer arrays incubated with C2c2 protein.
[0974] Combined with the results of previous analyses, (Chylinski,
2014; Makarova, 2011), the identification of the novel Class2
CRISPR-Cas systems reveals the dominant theme in the evolution of
Class 2 CRISPR-Cas systems. The effector proteins of two of the
three types within this class appear to have evolved from the pool
of transposable elements that encode TnpB proteins containing the
RuvC-like domain. The sequences of the RuvC-like domains of TnpB
and the homologous domains of the Class 2 effector proteins are too
diverged for reliable phylogenetic analysis. Nevertheless, for
Cas9, the effector protein of Type II systems, the specific
ancestral group seems to be readily identifiable, namely a family
of TnpB-like proteins, particularly abundant in Cyanobacteria, that
show a relatively high sequence similarity to Cas9 and share with
it the entire domain architecture, namely the RuvC-like and HNH
nuclease domains and the arginine-rich bridge helix (Chylinski,
2014) (FIG. 11, FIGS. 13A and 13B, "Domain organization of class 2
families"; FIG. 12, FIG. 13A and 13B, "TnpB homology regions in
Class 2 proteins"). Unlike Cas9, it was impossible to trace Cpf1,
C2c1, and C2c3 to a specific TnpB family; despite the conservation
of all motifs centered at the catalytic residues of the RuvC-like
nucleases, these proteins show only a limited similarity to generic
profiles of the TnpB. However, given that C2c1p shows no detectable
sequence similarity with Cpf1, that Cpf1, C2c1, and C2c3 contain
distinct insertions between the RuvC-motifs and clearly unrelated
N-terminal regions, it appears most likely that Cpf1, C2c1, and
C2c3 originated independently from different families within the
pool of TnpB-encoding elements (FIG. 13C).
[0975] It is intriguing that the TnpB proteins seem to be
"predesigned" for utilization in Class 2 CRISPR-Cas effector
complexes such that they apparently have been recruited on multiple
different occasions. Conceivably, such utility of TnpB proteins has
to do with their predicted ability to cut a single-stranded DNA
while bound to a RNA molecule via the R-rich bridge helix that in
Cas9 has been shown to bind crRNA (Jinek, 2014; Nishimasu, 2014;
Anders et al., 2014, Nature, vol. 513, 569-573). The functions of
TnpB in the life cycles of the respective transposons are poorly
understood. These proteins are not required for transposition, and
in one case, a TnpB protein has been shown to down-regulate
transposition (Pasternak, 2013) but their mechanism of action
remains unknown. Experimental study of TnpB is likely to shed light
on the mechanistic aspects of the Class 2 CRISPR-Cas systems. It
should be noted that the mechanisms of Cpf1 and C2c1 could be
similar to each other but are bound to substantially differ from
that of Cas9 because the former two proteins lack the HNH domain
that in Cas9 is responsible for nicking one of the target DNA
strands (Gasiunas, 2012XJinek, 2012) (Chen, 2014). Accordingly,
exploitation of Cpf1 and C2c1 might bring additional genome editing
possibilities.
[0976] In evolutionary terms, it is striking that Class 2
CRISPR-Cas appear to be completely derived from different
transposable elements given the recent evidence on the likely
origin of cas1 genes from a distinct transposon family (Koonin,
2015; Krupovic, 2014). Furthermore, the likely independent origin
of the effector proteins from different families of TnpB, along
with the different phylogenetic affinities of the respective cas1
proteins, strongly suggest that Class 2 systems have evolved on
multiple occasions through the combination of various adaptation
modules and transposon-derived nucleases giving rise to effector
proteins. This mode of evolution appears to be the ultimate
manifestation of the modularity that is characteristic of
CRISPR-Cas evolution (Makarova, 2015), with the implication that
additional combinations of adaptation and effector module are
likely to exist in nature.
[0977] The putative Type VI CRISPR-Cas systems encompass a
predicted novel effector protein that contains two predicted HEPN
domain that are likely to possess RNAse activity. The HEPN domains
are not parts of the effector complexes in other CRISPR-Cas systems
but are involved in a variety of defense functions including a
predicted ancillary role in various CRISPR-Cas systems
(Anantharaman, 2013XMakarova, 2015). The presence of the HEPN
domains as the catalytic moiety of the predicted effector module
implies that the Type VI systems target and cleave mRNA.
Previously, mRNA targeting has been reported for certain Type III
CRISPR-Cas systems (Hale, 2014; Hale, 2009) (Peng, 2015). Although
HEPN domains so far have not been detected in bona fide
transposable elements, they are characterized by high horizontal
mobility and are integral to mobile elements such as
toxin-antitoxin units (Anantharaman, 2013). Thus, the putative Type
VI systems seem to fit the general paradigm of the modular
evolution of Class 2 CRISPR-Cas from mobile components, and
additional variants and new types are expected to be discovered by
analysis of genomic and metagenomics data. Given that the C2c2
protein is unrelated to the other Class 2 effectors (which all
contain RuvC-like domains, even if distantly related ones), the
discovery of type VI can be considered to corroborate the case for
the independent origins of different Class 2 variants.
[0978] In view of the emerging scenario of the evolution of Class 2
systems from mobile elements, it seems instructive to examine the
overall evolution of CRISPR-Cas loci and in particular the
contributions of mobile elements to this process (FIG. 53). The
ancestral adaptive immunity system most likely originated via the
insertion of a casposon (a Cas1-encoding transposon) adjacent to a
locus that encoded a primitive innate immunity system (Koonin and
Krupovic, 2015, Nature reviews Genetics, vol. 16, 184-192; Krupovic
et al., 2014, BMC Biology, vol. 12, 36). An additional important
contribution was the incorporation of a toxin-antitoxin system that
delivered the cas2 gene and might have occurred either in the
ancestral casposon or in the evolving adaptive immunity locus (FIG.
51).
[0979] Given the extremely wide spread of Class 1 systems in
archaea and bacteria and the proliferation of the ancient RRM (RNA
Recognition Motif) domains in them, there seems to be little doubt
that the ancestral system was of Class 1 (FIG. 51). Most likely,
the ancestral architecture resembled the extant type III and in
that it encompassed an enzymatically active Cas10 protein (Makarova
et al., 2011, Biol Direct, vol. 6, 38; Makarova et al., 2013,
Biochem Soc Trans, vol. 41, 1392-1400). The Cas10 protein is a
homolog of family B DNA polymerases and nucleotide cyclases of the
GGDEF family ("GGDEF" disclosed as SEQ ID NO: 201) that shows
significant sequence similarity to these enzymes and retains all
the catalytic amino acid residues (Makarova et al., 2011, Biol
Direct, vol. 6, 38; Makarova et al., 2006, Biol Direct, vol. 1, 7).
Structural analysis has confirmed the presence of the
polymerase-cyclase-like domain in Cas10 and additionally revealed a
second, degenerate and apparently inactive domain of this family
(Khachatryan et al., 2015, Phys Rev Lett, vol. 114, 051801; Shao et
al., 2013, Structure, vol. 21, 376-384; Zhu and Ye, 2012, FEBS
Lett, vol. 586, 939-945). The exact nature of the catalytic
activity of Cas10 remains unclear but it has been shown that the
catalytic residues of the polymerase-cyclase-like domain are
essential for the target DNA cleavage (Samai et al., 2015, Cell,
vol. 161, 1164-1174). The Cas8 proteins present in type I
CRISPR-Cas systems are similar in size to Cas10 and occupy
equivalent positions in the effector complexes (Jackson et al.,
2014, Science, vol. 345, 1473-1479; Jackson and Wiedenheft, 2015,
Mol Cell, vol. 58, 722-728; Staals et al., 2014, Molecular cell,
vol. 56, 518-530), suggestive of an evolutionary relationship
between the large subunits of the type III and type I effector
complexes.. More specifically, the Cas8 proteins that have highly
diverged in sequence between type I subtypes could be catalytically
inactive derivatives of Cas10 (Makarova et al., 2011, Biol Direct,
vol. 6, 38; Makarova et al., 2015). This scenario suggests a
plausible directionality of evolution, from type III-like ancestral
Class 1 system to the type I systems. The divergence of the type
III and type I systems could have been precipitated by the
acquisition of the Cas3 helicase by the emerging type I (FIG. 53).
The different types and subtypes of Class 2 then evolved via
multiple substitutions of the gene block encoding the Class 1
effector complexes via insertion of transposable elements encoding
various nucleases (FIG. 53). This particular directionality of
evolution follows from the observation that the adaptation modules
of different Class 2 variants derive from different Class 1 types
(FIGS. 10A and 10B).
[0980] The Class 2 CRISPR-Cas systems appear to have been
completely derived from different mobile elements. Specifically,
there seem to have been at least two (in subtype V-C) but
typically, three or, in the case of type II, even four mobile
element contributors: (i) the ancestral casposon, (ii) the
toxin-antitoxin module that gave rise to Cas2, (iii) a transposable
element, in many cases a TnpB-encoding one, that was the ancestor
of the Class 2 effector complex, and (iv) in the case of type II,
the HNH nuclease could have been donated to the ancestral
transposon by a group I or group II self-splicing intron (Stoddard,
2005, Q Rev Biophys, vol. 38, 49-95) (FIG. 53). The putative type
V-C loci described here encode the ultimate minimalistic CRISPR-Cas
system, the only currently identified one that lacks Cas2;
conceivably, the highly diverged subtype V-C Cas1 proteins are
capable of forming the adaptation complex on their own, without the
accessory Cas2 subunit. The multiple originations of Class 2
systems from mobile elements present the ultimate manifestation of
the modularity that is characteristic of the evolution of
CRISPR-Cas (Makarova et al., 2015).
[0981] The demonstration that different varieties of Class 2
CRISPR-Cas systems independently evolved from different
transposable elements implies that additional variants and new
types remain to be identified. Although most if not all of the new
CRISPR-Cas systems are expected to be rare, they could employ novel
strategies and molecular mechanisms and could provide a major
resource for new, versatile applications in genome engineering and
biotechnology.
[0982] Modular evolution is a key feature of CRISPR-Cas systems.
This mode of evolution appears to be most pronounced in Class 2
systems that evolve through the combination of adaptation modules
from various other CRISPR-Cas systems with effector proteins that
seem to be recruited from mobile elements on multiple independent
occasions. Given the extreme diversity of mobile elements in
bacteria, it appears likely that effector modules of Class 2
CRISPR-Cas systems are highly diverse as well. Here Applicants
employed a simple computational approach to delineate three new
variants of CRISPR-Cas systems but many more are likely to exist
bacterial genomes that have not yet been sequenced. Although most
if not all of these new CRISPR-Cas systems are expected to be rare,
they could employ novel strategies and molecular mechanisms and
would provide a major resource for new applications in genome
engineering and biotechnology.
[0983] TBLASTN program with the E-value cut-off of 0.01 and low
complexity filtering turned off parameters was used to search with
Cas1 profile (Makarova et al., 2015) as a query against NCBI WGS
database. Sequences of contigs or complete genome partitions where
Cas1 hit has been identified were retrieved from the same database.
The region around the Cas1 gene (the region 20 kb from the start of
the Cas1 gene and 20 kb from the end of the Cas1 gene) was
extracted and translated using GeneMarkS (Besemer et al., 2001,
supra). Predicted proteins from each Cas1-encoding region were
searched against a collection of profiles from CDD database
(Marchler-Bauer, 2009) and specific Cas protein profiles (Makarova
et al., 2015) using the RPS-BLAST program (Marchler-Bauer et al.,
2002, Nucleic Acids Res, vol. 30, 281-283). Procedure to identify
completeness of CRISPR loci and to classify CRISPR-Cas systems into
the existing types and subtypes (Makarova et al., 2015) developed
previously has been applied to each locus.
[0984] CRISPRmap (Lange, 2013) was used for repeat
classification.
[0985] Partial and/or unclassified loci that encompassed proteins
larger than 500 amino acids were analyzed on a case-by-case basis.
Specifically, each predicted protein encoded in these loci was
searched using iterative profile searches with the PSI-BLAST
(Altschul, 1997), and composition based-statistics and low
complexity filtering turned off, to search for distantly similar
sequences against NCBI's non-redundant (NR) protein sequence
database. Each identified non-redundant protein was searched
against WGS database using the TBLAST program (Altschul, 1997). The
HHpred program was used with default parameters to identify remote
sequence similarity (Soding, 2005) using as the queries all
proteins identified in the BLAST searches. Multiple sequence
alignments were constructed using MUSCLE (Edgar, 2004) and MAFFT
(Katoh and Standley, 2013, Mol Biol Evol, vol. 30, 772-780).
Phylogenetic analysis was performed using the FastTree program with
the WAG evolutionary model and the discrete gamma model with 20
rate categories (Price et al., 2010, PLoS One, vol. 5, e9490).
Protein secondary structure was predicted using Jpred 4
(Drozdetskiy, 2015).
[0986] CRISPR repeats were identified using PILER-CR (Edgar, 2007,
supra) or, for degenerate repeats, CRISPRfinder (Grissa et al.,
2007, Nucleic Acids Res, vol. 35, W52-57). The Mfold program
(Zuker, 2003, Nucleic Acids Res, vol. 31, 3406-3415) was used to
identify the most stable structure for the repeat sequences.
[0987] The spacer sequences were searched against the NCBI
nucleotide NR and WGS databases using MEGABLAST (Morgulis et al.,
2008, Bioinformatics, vol. 24, 1757-1764) with default parameters
except that the word size was set at 20.
[0988] Chosen Gene Candidates
TABLE-US-00010 Gene ID: A; Gene Type: C2C1; Organism: 5.
Opitutaceae bacterium TAV5; Spacer Length-mode (range): 34 (33 to
37); DR1: GCCGCAGCGAAUGCCGUUUCACGAAUCGUCAGGCGG (SEQ ID NO: 27);
DR2: none; tracrRNA1:
GCUGGAGACGUUUUUUGAAACGGCGAGUGCUGCGGAUAGCGAGUUUCUCUUGGG
GAGGCGCUCGCGGCCACUUUU (SEQ ID NO: 28); tracrRNA2: none; Protein
Sequence: MSLNRIYQGRVAAVETGTALAKGNVEWMPAAGGDEVLWQHHELFQAAINYYLVALL
ALADKNNPVLGPLISQMDNPQSPYHVWGSFRRQGRQRTGLSQAVAPYITPGNNAPTLD
EVFRSILAGNPTDRATLDAALMQLLKACDGAGAIQQEGRSYWPKFCDPDSTANFAGDP
AMLRREQHRLLLPQVLHDPAITHDSPALGSFDTYSIATPDTRTPQLTGPKARARLEQAIT
LWRVRLPESAADFDRLASSLKKIPDDDSRLNLQGYVGSSAKGEVQARLFALLLFRHLER
SSFTLGLLRSATPPPKNAETPPPAGVPLPAASAADPVRIARGKRSFVFRAFTSLPCWHGG
DNIHPTWKSFDIAAFKYALTVINQIEEKTKERQKECAELETDFDYMHGRLAKIPVKYTTG
EAEPPPILANDLRIPLLRELLQNIKVDTALTDGEAVSYGLQRRTIRGFRELRRIWRGHAPA
GTVFSSELKEKLAGELRQFQTDNSTTIGSVQLFNELIQNPKYWPIWQAPDVETARQWAD
AGFADDPLAALVQEAELQEDIDALKAPVKLTPADPEYSRRQYDFNAVSKFGAGSRSAN
RHEPGQTERGHNTFTTEIAARNAADGNRWRATHVRIHYSAPRLLRDGLRRPDTDGNEA
LEAVPWLQPMMEALAPLPTLPQDLTGMPVFLMPDVTLSGERRILLNLPVTLEPAALVEQ
LGNAGRWQNQFFGSREDPFALRWPADGAVKTAKGKTHIPWHQDRDHFTVLGVDLGTR
DAGALALLNVTAQKPAKPVHRIIGEADGRTWYASLADARMIRLPGEDARLFVRGKLVQ
EPYGERGRNASLLEWEDARNIILRLGQNPDELLGADPRRHSYPEINDKLLVALRRAQAR
LARLQNRSWRLRDLAESDKALDEIHAERAGEKPSPLPPLARDDAIKSTDEALLSQRDIIR
RSFVQIANLILPLRGRRWEWRPHVEVPDCHILAQSDPGTDDTKRLVAGQRGISHERIEQIE
ELRRRCQSLNRALRHKPGERPVLGRPAKGEEIADPCPALLEKINRLRDQRVDQTAHAILA
AALGVRLRAPSKDRAERRHRDIHGEYERFRAPADFVVIENLSRYLSSQDRARSENTRLM
QWCHRQIVQKLRQLCETYGIPVLAVPAAYSSRFSSRDGSAGFRAVHLTPDHRHRMPWS
RILARLKAHEEDGKRLEKTVLDEARAVRGLFDRLDRFNAGHVPGKPWRTLLAPLPGGP
VFVPLGDATPMQADLNAAINIALRGIAAPDRHDIHHRLRAENKKRILSLRLGTQREKAR
WPGGAPAVTLSTPNNGASPEDSDALPERVSNLFVDIAGVANFERVTIEGVSQKFATGRG
LWASVKQRAWNRVARLNETVTDNNRNEEEDDIPM (SEQ ID NO: 29) Gene ID: B; Gene
Type: C2C1; Organism: 7. Bacillus thermoamylovorans strain B4166;
Spacer Length-mode (range): 37 (35-38); DR1:
GUCCAAGAAAAAAGAAAUGAUACGAGGCAUUAGCAC (SEQ ID NO: 30); DR2: none;
tracrRNA1: CUGGACGAUGUCUCUUUUAUUUCUUUUUUCUUGGAUCUGAGUACGAGCACCCAC
AUUGGACAUUUCGCAUGGUGGGUGCUCGUACUAUAGGUAAAACAAACCUUUUU (SEQ ID NO:
31); tracrRNA2: none; Protein Sequence:
MATRSFILKIEPNEEVKKGLWKTHEVLNHGIAYYMNILKLIRQEAIYEHHEQDPKNPKK
VSKAEIQAELWDFVLKMQKCNSFTHEVDKDVVFNILRELYEELVPSSVEKKGEANQLSN
KFLYPLVDPNSQSGKGTASSGRKPRWYNLKIAGDPSWEEEKKKWEEDKKKDPLAKILG
KLAEYGLIPLFIPFTDSNEPIVKEIKWMEKSRNQSVRRLDKDMFIQALERFLSWESWNLK
VKEEYEKVEKEHKTLEERIKEDIQAFKSLEQYEKERQEQLLRDTLNTNEYRLSKRGLRG
WREIIQKWLKMDENEPSEKYLEVFKDYQRKHPREAGDYSVYEFLSKKENHFIWRNHPE
YPYLYATFCEIDKKKKDAKQQATFTLADPINHPLWVRFEERSGSNLNKYRILTEQLHTE
KLKKKLTVQLDRLIYPTESGGWEEKGKVDIVLLPSRQFYNQIFLDIEEKGKHAFTYKDES
IKFPLKGTLGGARVQFDRDHLRRYPHKVESGNVGRIYFNMTVNIEPTESPVSKSLKIHRD
DFPKFVNFKPKELTEWIKDSKGKKLKSGIESLEIGLRVMSIDLGQRQAAAASIFEVVDQK
PDIEGKLFFPIKGTELYAVHRASFNIKLPGETLVKSREVLRKAREDNLKLMNQKLNFLRN
VLHFQQFEDITEREKRVTKWISRQENSDVPLVYQDELIQIRELMYKPYKDWVAFLKQLH
KRLEVEIGKEVKHWRKSLSDGRKGLYGISLKNIDEIDRTRKFLLRWSLRPTEPGEVRRLE
PGQRFAIDQLNHLNALKEDRLKKMANTIIMHALGYCYDVRKKKWQAKNPACQIILFED
LSNYNPYEERSRFENSKLMKWSRREIPRQVALQGEIYGLQVGEVGAQFSSRFHAKTGSP
GIRCSVVTKEKLQDNRFFKNLQREGRLTLDKIAVLKEGDLYPDKGGEKFISLSKDRKLVT
THADINAAQNLQKRFWTRTHGFYKVYCKAYQVDGQTVYIPESKDQKQKIIEEFGEGYFI
LKDGVYEWGNAGKLKIKKGSSKQSSSELVDSDILKDSFDLASELKGEKLMLYRDPSGN
VFPSDKWMAAGVFFGKLERILISKLTNQYSISTIEDDSSKQSM (SEQ ID NO: 32) Gene
ID: C; Gene Type: C2C1; Organism: 9. Bacillus sp. NSP2.1; Spacer
Length- mode (range): 36(35-42); DR1:
GUUCGAAAGCUUAGUGGAAAGCUUCGUGGUUAGCAC (SEQ ID NO: 33); DR2: none;
tracrRNA1: CACGGAUAAUCACGACUUUCCACUAAGCUUUCGAAUUUUAUGAUGCGAGCAUCCU
CUCAGGUCAAAAAA (SEQ ID NO: 34); tracrRNA2: none; Protein Sequence:
MAIRSIKLKLKTHTGPEAQNLRKGIWRTHRLLNEGVAYYMKMLLLFRQESTGERPKEEL
QEELICHIREQQQRNQADKNTQALPLDKALEALRQLYELLVPSSVGQSGDAQIISRKFLS
PLVDPNSEGGKGTSKAGAKPTWQKKKEANDPTWEQDYEKWKKRREEDPTASVITTLEE
YGIRPIFPLYTNTVTDIAWLPLQSNQFVRTWDRDMLQQAIERLLSWESWNKRVQEEYAK
LKEKMAQLNEQLEGGQEWISLLEQYEENRERELRENNITAANDKYRITKRQMKGWNEL
YELWSTFPASASHEQYKEALKRVQQRLRGRFGDAHFFQYLMEEKNRLIWKGNPQRIHY
FVARNELTKRLEEAKQSATMTLPNARKHPLWVRFDARGGNLQDYYLTAEADKPRSRRF
VTFSQLIWPSESGWMEKKDVEVELALSRQFYQQVKLLKNDKGKQKIEFKDKGSGSTFN
GHLGGAKLQLERGDLEKEEKNFEDGEIGSVYLNVVIDFEPLQEVKNGRVQAPYGQVLQ
LIRRPNEFPKVTTYKSEQLVEWIKASPQHSAGVESLASGFRVMSIDLGLRAAAATSIFSVE
ESSDKNAADFSYWIEGTPLVAVHQRSYMLRLPGEQVEKQVMEKRDERFQLHQRVKFQI
RVLAQIMRMANKQYGDRWDELDSLKQAVEQKKSPLDQTDRTFWEGIVCDLTKVLPRN
EADWEQAVVQIHRKAEEYVGKAVQAWRKRFAADERKGIAGLSMWNIEELEGLRKLLIS
WSRRTRNPQEVNRFERGHTSHQRLLTHIQNVKEDRLKQLSHAIVMTALGYVYDERKQE
WCAEYPACQVILFENLSQYRSNLDRSTKENSTLMKWAHRSIPKYVHMQAEPYGIQIGDV
RAEYSSRFYAKTGTPGIRCKKVRGQDLQGRRFENLQKRLVNEQFLTEEQVKQLRPGDIV
PDDSGELFMTLTDGSGSKEVVFLQADINAAHNLQKRFWQRYNELFKVSCRVIVRDEEE
YLVPKTKSVQAKLGKGLFVKKSDTAWKDVYVWDSQAKLKGKTTFTEESESPEQLEDFQ
EIIEEAEEAKGTYRTLFRDPSGVFFPESVWYPQKDFWGEVKRKLYGKLRERFLTKAR (SEQ ID
NO: 35) Gene ID: D; Gene Type: C2C2; Organism: 4. Lachnospiraceae
bacterium NK4A144 G619; Spacer Length-mode (range): 35; DR1:
GUUUUGAGAAUAGCCCGACAUAGAGGGCAAUAGAC (SEQ ID NO: 36); DR2:
GUUAUGAAAACAGCCCGACAUAGAGGGCAAUAGACA (SEQ ID NO: 37); tracrRNA1:
none; tracrRNA2: none; Protein Sequence:
MKISKVDHTRMAVAKGNQHRRDEISGILYKDPTKTGSIDFDERFKKLNCSAKILYHVFN
GIAEGSNKYKNIVDKVNNNLDRVLFTGKSYDRKSIIDIDTVLRNVEKINAFDRISTEEREQ
IIDDLLEIQLRKGLRKGKAGLREVLLIGAGVIVRTDKKQEIADFLEILDEDFNKTNQAKNI
KLSIENQGLVVSPVSRGEERIFDVSGAQKGKSSKKAQEKEALSAFLLDYADLDKNVRFE
YLRKIRRLINLYFYVKNDDVMSLTEIPAEVNLEKDFDIWRDHEQRKEENGDFVGCPDILL
ADRDVKKSNSKQVKIAERQLRESIREKNIKRYRFSIKTIEKDDGTYFFANKQISVFWIHRI
ENAVERILGSINDKKLYRLRLGYLGEKVWKDILNFLSIKYIAVGKAVFNFAMDDLQEKD
RDIEPGKISENAVNGLTSFDYEQIKADEMLQREVAVNVAFAANNLARVTVDIPQNGEKE
DILLWNKSDIKKYKKNSKKGILKSILQFFGGASTWNMKMFEIAYHDQPGDYEENYLYDI
IQIIYSLRNKSFHFKTYDHGDKNWNRELIGKMIEHDAERVISVEREKFHSNNLPMFYKDA
DLKKILDLLYSDYAGRASQVPAFNTVLVRKNFPEFLRKDMGYKVHFNNPEVENQWHSA
VYYLYKEIYYNLFLRDKEVKNLFYTSLKNIRSEVSDKKQKLASDDFASRCEEIEDRSLPEI
CQIIMTEYNAQNFGNRKVKSQRVIEKNKDIFRHYKMLLIKTLAGAFSLYLKQERFAFIGK
ATPIPYETTDVKNFLPEWKSGMYASFVEEIKNNLDLQEWYIVGRFLNGRMLNQLAGSLR
SYIQYAEDIERRAAENRNKLFSKPDEKIEACKKAVRVLDLCIKISTRISAEFTDYFDSEDD
YADYLEKYLKYQDDAIKELSGSSYAALDHFCNKDDLKFDIYVNAGQKPILQRNIVMAK
LFGPDNILSEVMEKVTESAIREYYDYLKKVSGYRVRGKCSTEKEQEDLLKFQRLKNAVE
FRDVTEYAEVINELLGQLISWSYLRERDLLYFQLGFHYMCLKNKSFKPAEYVDIRRNNG
TIIHNAILYQIVSMYINGLDFYSCDKEGKTLKPIETGKGVGSKIGQFIKYSQYLYNDPSYK
LEIYNAGLEVFENIDEHDNITDLRKYVDHFKYYAYGNKMSLLDLYSEFFDRFFTYDMKY
QKNVVNVLENILLRHFVIFYPKFGSGKKDVGIRDCKKERAQIEISEQSLTSEDFMFKLDD
KAGEEAKKFPARDERYLQTIAKLLYYPNEIEDMNRFMKKGETINKKVQFNRKKKITRKQ
KNNSSNEVLSSTMGYLFKNIKL (SEQ ID NO: 38) Gene ID: E; Gene Type: C2C2;
Organism: 8. Listeria seeligeri serovar 1/2b str. SLCC3954; Spacer
Length-mode (range): 30; DR1: GUUUUAGUCCUCUUUCAUAUAGAGGUAGUCUCUUAC
(SEQ ID NO: 39); DR2: none; tracrRNA1:
AUGAAAAGAGGACUAAAACUGAAAGAGGACUAAAACACCAGAUGUGGAUAACUA
UAUUAGUGGCUAUUAAAAAUUCGUCGAUAUUAGAGAGGAAACUUU (SEQ ID NO: 40);
tracrRNA2: none; Protein Sequence:
MWISIKTLIHHLGVLFFCDYMYNRREKKIIEVKTMRITKVEVDRKKVLISRDKNGGKLV
YENEMQDNTEQIMHEIKKSSFYKSVVNKTICRPEQKQMKKLVHGLLQENSQEKIKVSDV
TKLNISNFLNHRFKKSLYYFPENSPDKSEEYRIEINLSQLLEDSLKKQQGTFICWESFSKD
MELYINWAENYISSKTKLIKKSIRNNRIQSTESRSGQLMDRYMKDILNKNKPFDIQSVSE
KYQLEKLTSALKATFKEAKKNDKEINYKLKSTLQNHERQIIEELKENSELNQFNIEIRKHL
ETYFPIKKTNRKVGDIRNLEIGEIQKIVNHRLKNKIVQRILQEGKLASYEIESTVNSNSLQK
IKIEEAFALKFINACLFASNNLRNMVYPVCKKDILMIGEFKNSFKEIKHKKFIRQWSQFFS
QEITVDDIELASWGLRGAIAPIRNEIIHLKKHSWKKFFNNPTFKVKKSKIINGKTKDVTSE
FLYKETLFKDYFYSELDSVPELIINKMESSKILDYYSSDQLNQVFTIPNFELSLLTSAVPFA
PSFKRVYLKGFDYQNQDEAQPDYNLKLNIYNEKAFNSEAFQAQYSLFKMVYYQVFLPQ
FTTNNDLFKSSVDFILTLNKERKGYAKAFQDIRKMNKDEKPSEYMSYIQSQLMLYQKKQ
EEKEKINHFEKFINQVFIKGFNSFIEKNRLTYICHPTKNTVPENDNIEIPFHTDMDDSNIAF
WLMCKLLDAKQLSELRNEMIKFSCSLQSTEEISTFTKAREVIGLALLNGEKGCNDWKEL
FDDKEAWKKNMSLYVSEELLQSLPYTQEDGQTPVINRSIDLVKKYGTETILEKLFSSSDD
YKVSAKDIAKLHEYDVTEKIAQQESLHKQWIEKPGLARDSAWTKKYQNVINDISNYQW
AKTKVELTQVRHLHQLTIDLLSRLAGYMSIADRDFQFSSNYILERENSEYRVTSWILLSE
NKNKNKYNDYELYNLKNASIKVSSKNDPQLKVDLKQLRLTLEYLELFDNRLKEKRNNIS
HFNYLNGQLGNSILELFDDARDVLSYDRKLKNAVSKSLKEILSSHGMEVTFKPLYQTNH
HLKIDKLQPKKIHHLGEK S TVS SNQVSNEYCQLVRTLLTMK (SEQ ID NO: 41) Gene
ID: F; Gene Type: C2C2; Organism: 12. Leptotrichia wadei F0279;
Spacer Length-mode (range): 31; DR1:
GUUUUAGUCCCCUUCGUUUUUGGGGUAGUCUAAAUC (SEQ ID NO: 42); DR2: none;
tracrRNA1: GAUUUAGAGCACCCCAAAAGUAAUGAAAAUUUGCAAUUAAAUAAGGAAUAUUAA
AAAAAUGUGAUUUUAAAAAAAUUGAAGAAAUUAAAUGAAAAAUUGUCCAAGUAA AAAAA (SEQ
ID NO: 43); tracrRNA2:
AUUUAGAUUACCCCUUUAAUUUAUUUUACCAUAUUUUUCUCAUAAUGCAAACUA
AUAUUCCAAAAUUUUU (SEQ ID NO: 44); Protein Sequence:
MGNLFGHKRWYEVRDKKDFKIKRKVKVKRNYDGNKYILNINENNNKEKIDNNKFIRKY
INYKKNDNILKEFTRKFHAGNILFKLKGKEGIIRIENNDDFLETEEVVLYIEAYGKSEKLK
ALGITKKKIIDEAIRQGITKDDKKIEIKRQENEEEIEIDIRDEYTNKTLNDCSIILRIIENDELE
TKKSIYEIFKNINMSLYKIIEKIIENETEKVFENRYYEEHLREKLLKDDKIDVILTNFMETRE
KIKSNLEILGFVKFYLNVGGDKKKSKNKKMLVEKILNINVDLTVEDIADFVIKELEFWNI
TKRIEKVKKVNNEFLEKRRNRTYIKSYVLLDKHEKFKIERENKKDKIVKFFVENIKNNSI
KEKIEKILAEFKIDELIKKLEKELKKGNCDTEIFGIFKKHYKVNFDSKKFSKKSDEEKELY
KIIYRYLKGRIEKILVNEQKVRLKKMEKIEIEKILNESILSEKILKRVKQYTLEHIMYLGKL
RHNDIDMTTVNTDDFSRLHAKEELDLELITFFASTNMELNKIFSRENINNDENIDFFGGDR
EKNYVLDKKILNSKIKIIRDLDFIDNKNNITNNFIRKFTKIGTNERNRILHAISKERDLQGT
QDDYNKVINIIQNLKISDEEVSKALNLDVVFKDKKNIITKINDIKISEENNNDIKYLPSFSK
VLPEILNLYRNNPKNEPFDTIETEKIVLNALIYVNKELYKKLILEDDLEENESKNIFLQELK
KTLGNIDEIDENIIENYYKNAQISASKGNNKAIKKYQKKVIECYIGYLRKNYEELFDFSDF
KMNIQEIKKQIKDINDNKTYERITVKTSDKTIVINDDFEYIISIFALLNSNAVINKIRNRFFA
TSVWLNTSEYQNIIDILDEIMQLNTLRNECITENWNLNLEEFIQKMKEIEKDFDDFKIQTK
KEIFNNYYEDIKNNILTEFKDDINGCDVLEKKLEKIVIFDDETKFEIDKKSNILQDEQRKLS
NINKKDLKKKVDQYIKDKDQEIKSKILCRIIFNSDFLKKYKKEIDNLIEDMESENENKFQE
IYYPKERKNELYIYKKNLFLNIGNPNFDKIYGLISNDIKMADAKFLFNIDGKNIRKNKISEI
DAILKNLNDKLNGYSKEYKEKYIKKLKENDDFFAKNIQNKNYKSFEKDYNRVSEYKKIR
DLVEFNYLNKIESYLIDINWKLAIQMARFERDMHYIVNGLRELGIIKLSGYNTGISRAYPK
RNGSDGFYTTTAYYKFFDEESYKKFEKICYGFGIDLSENSEINKPENESIRNYISHFYIVRN
PFADYSIAEQIDRVSNLLSYSTRYNNSTYASVFEVFKKDVNLDYDELKKKFKLIGNNDIL
ERLMKPKKVSVLELESYNSDYIKNLIIELLTKIENTNDTL (SEQ ID NO: 45) Gene ID:
G; Gene Type: C2C2; Organism: 14. Leptotrichia shahii DSM 19757
B031; Spacer Length-mode (range): 30 (30-32); DR1:
GUUUUAGUCCCCUUCGAUAUUGGGGUGGUCUAUAUC (SEQ ID NO: 46); DR2: none;
tracrRNA1: AUUGAUGUGGUAUACUAAAAAUGGAAAAUUGUAUUUUUGAUUAGAAAGAUGUAA
AAUUGAUUUAAUUUAAAAAUAUUUUAUUAGAUUAAAGUAGA (SEQ ID NO: 47);
tracrRNA2: none; Protein Sequence:
MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYHQF
FIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSEKFKN
LFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWTTYFKGF
HENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIKKDLAEELT
FDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGENTKRKGINEYI
NLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTMQSFYEQIAAFKT
VEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDYSVIGTAVLEYITQQI
APKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDIDKQCRFEEILANFAAIP
MIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIKDLLDQTNNLLHKLKIFHIS
QSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYITQKPYSDEKFKLNFENSTLA
NGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFDDKAIKENKGEGYKKIVYKLLPG
ANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKNGSPQKGYEKFEFNIEDCRKFIDFYK
QSISKHPEWKDFGFRFSDTQRYNSIDEFYREVENQGYKLTFENISESYIDSVVNQGKLYL
FQIYNKDFSAYSKGRPNLHTLYWKALFDERNLQDVVYKLNGEAELFYRKQSIPKKITHP
AKEAIANKNKDNPKKESVFEYDLIKDKRFTEDKFFFHCPITINFKSSGANKFNDEINLLLK
EKANDVHILSIDRGERHLAYYTLVDGKGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDR
DSARKDWKKINNIKEMKEGYLSQVVHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQV
YQKLEKMLIEKLNYLVFKDNEFDKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFT
SKICPVTGFVNQLYPKYESVSKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGK
WTIASFGSRLINFRNSDKNHNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDK
KFFAKLTSVLNTILQMRNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDADANGA
YHIGLKGLMLLGRIKNNQEGKKLNLVIKNEEYFEFVQNRNN (SEQ ID NO: 48) Gene ID:
H; Gene Type: Cpf1; Organism: Francisella ularensis subsp. novicida
U112; Spacer Length-mode (range): 31; DR1:
GUCUAAGAACUUUAAAUAAUUUCUACUGUUGUAGAU (SEQ ID NO: 49); DR2: none;
tracrRNA1: AUCUACAAAAUUAUAAACUAAAUAAAGAUUCUUAUAAUAACUUUAUAUAUAAUC
GAAAUGUAGAGAAUUUU (SEQ ID NO: 50); tracrRNA2: none; Protein
Sequence:
MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYHQF
FIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSEKFKN
LENQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWTTYFKGF
HENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIKKDLAEELT
FDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKENTIIGGKEVNGENTKRKGINEYI
NLYSQQINDKTLKKYKMSVLEKQILSDTESKSEVIDKLEDDSDVVTTMQSFYEQIAAFKT
VEEKSIKETLSLLFDDLKAQKLDLSKIYEKNDKSLTDLSQQVFDDYSVIGTAVLEYITQQI
APKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDIDKQCRFEEILANFAAIP
MIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIKDLLDQTNNLLHKLKIFHIS
QSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYITQKPYSDEKFKLNFENSTLA
NGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFDDKAIKENKGEGYKKIVYKLLPG
ANKMLPKVFFSAKSIKEYNPSEDILRIRNHSTHTKNGSPQKGYEKFEENIEDCRKFIDEYK
QSISKHPEWKDFGFRFSDTQRYNSIDEFYREVENQGYKLTFENISESYIDSVVNQGKLYL
FQIYNKDFSAYSKGRPNLHTLYWKALFDERNLQDVVYKLNGEAELFYRKQSIPKKITHP
AKEAIANKNKDNPKKESVFEYDLIKDKRFTEDKEFFHCPITINEKSSGANKENDEINLLLK
EKANDVHILSIDRGERHLAYYTLVDGKGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDR
DSARKDWKKINNIKEMKEGYLSQVVHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQV
YQKLEKMLIEKLNYLVEKDNEFDKTGGVLRAYQLTAPFETFKKMGKQTGITYYVPAGFT
SKICPVTGEVNQLYPKYESVSKSQEFFSKEDKICYNLDKGYFEFSFDYKNEGDKAAKGK
WTIASEGSRLINFRNSDKNHNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDK
KFFAKLTSVLNTILQMRNSKTGTELDYLISPVADVNGNFEDSRQAPKNMPQDADANGA
YHIGLKGLMLLGRIKNNQEGKKLNLVIKNEEYFEFVQNRNN (SEQ ID NO: 51)
[0989] Genes for Synthesis
[0990] For genes A through H, the Applicants optimize the genes for
human expression and append the following DNA sequence to the end
of each gene. Note this DNA sequence contains a stop codon
(underlined), so no stop codon is added to the codon optimized gene
sequence: AAAAGGCCGGCGGCCACGAAAAAGGCCGGCCAGGCAAAAAAGAAAAAGggatccTAC
CCATACGATGTTCCAGATTACGCTTATCCCTACGACGTGCCTGATTATGCATACCCAT
ATGATGTCCCCGACTATGCCTAA (SEQ ID NO: 52)
[0991] For optimization, avoid the following restriction sites:
BamHI, EcoRI, HindIII, BsmBI, BsaI, BbsI, AgeI, XhoI, NdeI, NotI,
KpnI, BsrGI, SpeI, XbaI, NheI
[0992] These genes are cloned into a simple mammalian expression
vector:
TABLE-US-00011 >A (SEQ ID NO: 53)
MSLNRIYQGRVAAVETGTALAKGNVEWMPAAGGDEVLWQHHELFQAAINY
YLVALLALADKNNPVLGPLISQMDNPQSPYHVWGSFRRQGRQRTGLSQAVAPYITPGN
NAPTLDEVFRSILAGNPTDRATLDAALMQLLKACDGAGAIQQEGRSYWPKFCDPDSTA
NFAGDPAMLRREQHRLLLPQVLHDPAITHDSPALGSFDTYSIATPDTRTPQLTGPKARAR
LEQAITLWRVRLPESAADFDRLASSLKKIPDDDSRLNLQGYVGSSAKGEVQARLFALLL
FRHLERSSFTLGLLRSATPPPKNAETPPPAGVPLPAASAADPVRIARGKRSFVFRAFTSLP
CWHGGDNIHPTWKSFDIAAFKYALTVINQIEEKTKERQKECAELETDFDYMHGRLAKIP
VKYTTGEAEPPPILANDLRIPLLRELLQNIKVDTALTDGEAVSYGLQRRTIRGFRELRRIW
RGHAPAGTVFSSELKEKLAGELRQFQTDNSTTIGSVQLFNELIQNPKYWPIWQAPDVETA
RQWADAGFADDPLAALVQEAELQEDIDALKAPVKLTPADPEYSRRQYDFNAVSKFGAG
SRSANRHEPGQTERGHNTFTTEIAARNAADGNRWRATHVRIHYSAPRLLRDGLRRPDTD
GNEALEAVPWLQPMMEALAPLPTLPQDLTGMPVFLMPDVTLSGERRILLNLPVTLEPAA
LVEQLGNAGRWQNQFFGSREDPFALRWPADGAVKTAKGKTHIPWHQDRDHFTVLGVD
LGTRDAGALALLNVTAQKPAKPVHRIIGEADGRTWYASLADARMIRLPGEDARLFVRG
KLVQEPYGERGRNASLLEWEDARNIILRLGQNPDELLGADPRRHSYPEINDKLLVALRR
AQARLARLQNRSWRLRDLAESDKALDEIHAERAGEKPSPLPPLARDDAIKSTDEALLSQ
RDIIRRSFVQIANLILPLRGRRWEWRPHVEVPDCHILAQSDPGTDDTKRLVAGQRGISHE
RIEQIEELRRRCQSLNRALRHKPGERPVLGRPAKGEEIADPCPALLEKINRLRDQRVDQT
AHAILAAALGVRLRAPSKDRAERRHRDIHGEYERFRAPADFVVIENLSRYLSSQDRARSE
NTRLMQWCHRQIVQKLRQLCETYGIPVLAVPAAYSSRFSSRDGSAGFRAVHLTPDHRH
RMPWSRILARLKAHEEDGKRLEKTVLDEARAVRGLFDRLDRFNAGHVPGKPWRTLLAP
LPGGPVFVPLGDATPMQADLNAAINIALRGIAAPDRHDIHHRLRAENKKRILSLRLGTQR
EKARWPGGAPAVTLSTPNNGASPEDSDALPERVSNLFVDIAGVANFERVTIEGVSQKFA
TGRGLWASVKQRAWNRVARLNETVTDNNRNEEEDDIPM >B (SEQ ID NO: 54)
MATRSFILKIEPNEEVKKGLWKTHEVLNHGIAYYMNILKLIRQEAIYEHHEQD
PKNPKKVSKAEIQAELWDFVLKMQKCNSFTHEVDKDVVFNILRELYEELVPSSVEKKGE
ANQLSNKFLYPLVDPNSQSGKGTASSGRKPRWYNLKIAGDPSWEEEKKKWEEDKKKDP
LAKILGKLAEYGLIPLFIPFTDSNEPIVKEIKWMEKSRNQSVRRLDKDMFIQALERFLSWE
SWNLKVKEEYEKVEKEHKTLEERIKEDIQAFKSLEQYEKERQEQLLRDTLNTNEYRLSK
RGLRGWREIIQKWLKMDENEPSEKYLEVFKDYQRKHPREAGDYSVYEFLSKKENHFIW
RNHPEYPYLYATFCEIDKKKKDAKQQATFTLADPINHPLWVRFEERSGSNLNKYRILTE
QLHTEKLKKKLTVQLDRLIYPTESGGWEEKGKVDIVLLPSRQFYNQIFLDIEEKGKHAFT
YKDESIKFPLKGTLGGARVQFDRDHLRRYPHKVESGNVGRIYFNMTVNIEPTESPVSKSL
KIHRDDFPKFVNFKPKELTEWIKDSKGKKLKSGIESLEIGLRVMSIDLGQRQAAAASIFEV
VDQKPDIEGKLFFPIKGTELYAVHRASFNIKLPGETLVKSREVLRKAREDNLKLMNQKL
NFLRNVLHFQQFEDITEREKRVTKWISRQENSDVPLVYQDELIQIRELMYKPYKDWVAF
LKQLHKRLEVEIGKEVKHWRKSLSDGRKGLYGISLKNIDEIDRTRKFLLRWSLRPTEPGE
VRRLEPGQRFAIDQLNHLNALKEDRLKKMANTIIMHALGYCYDVRKKKWQAKNPACQI
ILFEDLSNYNPYEERSRFENSKLMKWSRREIPRQVALQGEIYGLQVGEVGAQFSSRFHAK
TGSPGIRCSVVTKEKLQDNRFFKNLQREGRLTLDKIAVLKEGDLYPDKGGEKFISLSKDR
KLVTTHADINAAQNLQKRFWTRTHGFYKVYCKAYQVDGQTVYIPESKDQKQKIIEEFG
EGYFILKDGVYEWGNAGKLKIKKGSSKQSSSELVDSDILKDSFDLASELKGEKLMLYRD
PSGNVFPSDKWMAAGVFFGKLERILISKLTNQYSISTIEDDSSKQSM >C (SEQ ID NO:
55) MAIRSIKLKLKTHTGPEAQNLRKGIWRTHRLLNEGVAYYMKMLLLFRQESTG
ERPKEELQEELICHIREQQQRNQADKNTQALPLDKALEALRQLYELLVPSSVGQSGDAQI
ISRKFLSPLVDPNSEGGKGTSKAGAKPTWQKKKEANDPTWEQDYEKWKKRREEDPTAS
VITTLEEYGIRPIFPLYTNTVTDIAWLPLQSNQFVRTWDRDMLQQAIERLLSWESWNKRV
QEEYAKLKEKMAQLNEQLEGGQEWISLLEQYEENRERELRENMTAANDKYRITKRQM
KGWNELYELWSTFPASASHEQYKEALKRVQQRLRGRFGDAHFFQYLMEEKNRLIWKG
NPQRIHYFVARNELTKRLEEAKQSATMTLPNARKHPLWVRFDARGGNLQDYYLTAEAD
KPRSRRFVTFSQLIWPSESGWMEKKDVEVELALSRQFYQQVKLLKNDKGKQKIEFKDK
GSGSTFNGHLGGAKLQLERGDLEKEEKNFEDGEIGSVYLNVVIDFEPLQEVKNGRVQAP
YGQVLQLIRRPNEFPKVTTYKSEQLVEWIKASPQHSAGVESLASGFRVMSIDLGLRAAA
ATSIFSVEESSDKNAADFSYWIEGTPLVAVHQRSYMLRLPGEQVEKQVMEKRDERFQLH
QRVKFQIRVLAQIMRMANKQYGDRWDELDSLKQAVEQKKSPLDQTDRTFWEGIVCDL
TKVLPRNEADWEQAVVQIHRKAEEYVGKAVQAWRKRFAADERKGIAGLSMWNIEELE
GLRKLLISWSRRTRNPQEVNRFERGHTSHQRLLTHIQNVKEDRLKQLSHAIVMTALGYV
YDERKQEWCAEYPACQVILFENLSQYRSNLDRSTKENSTLMKWAHRSIPKYVHMQAEP
YGIQIGDVRAEYSSRFYAKTGTPGIRCKKVRGQDLQGRRFENLQKRLVNEQFLTEEQVK
QLRPGDIVPDDSGELFMTLTDGSGSKEVVFLQADINAAHNLQKRFWQRYNELFKVSCR
VIVRDEEEYLVPKTKSVQAKLGKGLFVKKSDTAWKDVYVWDSQAKLKGKTTFTEESES
PEQLEDFQEIIEEAEEAKGTYRTLFRDPSGVFFPESVWYPQKDFWGEVKRKLYGKLRERF LTKAR
>D (SEQ ID NO: 56)
MKISKVDHTRMAVAKGNQHRRDEISGILYKDPTKTGSIDFDERFKKLNCSAKI
LYHVFNGIAEGSNKYKNIVDKVNNNLDRVLFTGKSYDRKSIIDIDTVLRNVEKINAFDRI
STEEREQIIDDLLEIQLRKGLRKGKAGLREVLLIGAGVIVRTDKKQEIADFLEILDEDFNK
TNQAKNIKLSIENQGLVVSPVSRGEERIFDVSGAQKGKSSKKAQEKEALSAFLLDYADL
DKNVRFEYLRKIRRLINLYFYVKNDDVMSLTEIPAEVNLEKDFDIWRDHEQRKEENGDF
VGCPDILLADRDVKKSNSKQVKIAERQLRESIREKNIKRYRFSIKTIEKDDGTYFFANKQI
SVFWIHRIENAVERILGSINDKKLYRLRLGYLGEKVWKDILNFLSIKYIAVGKAVFNFAM
DDLQEKDRDIEPGKISENAVNGLTSFDYEQIKADEMLQREVAVNVAFAANNLARVTVDI
PQNGEKEDILLWNKSDIKKYKKNSKKGILKSILQFFGGASTWNMKMFEIAYHDQPGDYE
ENYLYDIIQIIYSLRNKSFHFKTYDHGDKNWNRELIGKMIEHDAERVISVEREKFHSNNLP
MFYKDADLKKILDLLYSDYAGRASQVPAFNTVLVRKNFPEFLRKDMGYKVHFNNPEVE
NQWHSAVYYLYKEIYYNLFLRDKEVKNLFYTSLKNIRSEVSDKKQKLASDDFASRCEEI
EDRSLPEICQIIMTEYNAQNFGNRKVKSQRVIEKNKDIFRHYKMLLIKTLAGAFSLYLKQ
ERFAFIGKATPIPYETTDVKNFLPEWKSGMYASFVEEIKNNLDLQEWYIVGRFLNGRML
NQLAGSLRSYIQYAEDIERRAAENRNKLFSKPDEKIEACKKAVRVLDLCIKISTRISAEFT
DYFDSEDDYADYLEKYLKYQDDAIKELSGSSYAALDHFCNKDDLKFDIYVNAGQKPIL
QRNIVMAKLFGPDNILSEVMEKVTESAIREYYDYLKKVSGYRVRGKCSTEKEQEDLLKF
QRLKNAVEFRDVTEYAEVINELLGQLISWSYLRERDLLYFQLGFHYMCLKNKSFKPAEY
VDIRRNNGTIIHNAILYQIVSMYINGLDFYSCDKEGKTLKPIETGKGVGSKIGQFIKYSQY
LYNDPSYKLEIYNAGLEVFENIDEHDNITDLRKYVDHFKYYAYGNKMSLLDLYSEFFDR
FFTYDMKYQKNVVNVLENILLRHFVIFYPKFGSGKKDVGIRDCKKERAQIEISEQSLTSE
DFMFKLDDKAGEEAKKFPARDERYLQTIAKLLYYPNEIEDMNRFMKKGETINKKVQFN
RKKKITRKQKNNSSNEVLSSTMGYLFKNIKL >E (SEQ ID NO: 57)
MWISIKTLIHHLGVLFFCDYMYNRREKKIIEVKTMRITKVEVDRKKVLISRDK
NGGKLVYENEMQDNTEQIMEIHKKSSFYKSVVNKTICRPEQKQMKKLVHGLLQENSQE
KIKVSDVTKLNISNFLNHRFKKSLYYFPENSPDKSEEYRIEINLSQLLEDSLKKQQGTFIC
WESFSKDMELYINWAENYISSKTKLIKKSIRNNRIQSTESRSGQLMDRYMKDILNKNKPF
DIQSVSEKYQLEKLTSALKATFKEAKKNDKEINYKLKSTLQNHERQIIEELKENSELNQF
NIEIRKHLETYFPIKKTNRKVGDIRNLEIGEIQKIVNHRLKNKIVQRILQEGKLASYEIESTV
NSNSLQKIKIEEAFALKFINACLFASNNLRNMVYPVCKKDILMIGEFKNSEKEIKHKKEIR
QWSQFFSQEITVDDIELASWGLRGAIAPIRNEIIHLKKHSWKKFFNNPTFKVKKSKIINGK
TKDVTSEFLYKETLFKDYFYSELDSVPELIINKMESSKILDYYSSDQLNQVFTIPNFELSLL
TSAVPFAPSFKRVYLKGEDYQNQDEAQPDYNLKLNIYNEKAFNSEAFQAQYSLFKMVY
YQVFLPQFTTNNDLFKSSVDFILTLNKERKGYAKAFQDIRKMNKDEKPSEYMSYIQSQL
MLYQKKQEEKEKINHFEKFINQVFIKGENSFIEKNRLTYICHPTKNTVPENDNIEIPFHTD
MDDSNIAFWLMCKLLDAKQLSELRNEMIKFSCSLQSTEEISTFTKAREVIGLALLNGEKG
CNDWKELFDDKEAWKKNMSLYVSEELLQSLPYTQEDGQTPVINRSIDLVKKYGTETILE
KLFSSSDDYKVSAKDIAKLHEYDVTEKIAQQESLHKQWIEKPGLARDSAWTKKYQNVIN
DISNYQWAKTKVELTQVRHLHQLTIDLLSRLAGYMSIADRDFQFSSNYILERENSEYRVT
SWILLSENKNKNKYNDYELYNLKNASIKVSSKNDPQLKVDLKQLRLTLEYLELFDNRLK
EKRNNISHFNYLNGQLGNSILELFDDARDVLSYDRKLKNAVSKSLKEILSSHGMEVTFKP
LYQTNHHLKIDKLQPKKIHHLGEKSTVSSNQVSNEYCQLVRTLLTMK >F (SEQ ID NO:
58) MKVTKVDGISHKKYIEEGKLVKSTSEENRTSERLSELLSIRLDIYIKNPDNASE
EENRIRRENLKKFFSNKVLHLKDSVLYLKNRKEKNAVQDKNYSEEDISEYDLKNKNSFS
VLKKILLNEDVNSEELEIFRKDVEAKLNKINSLKYSFEENKANYQKINENNVEKVGGKS
KRNIIYDYYRESAKRNDYINNVQEAFDKLYKKEDIEKLFFLIENSKKHEKYKIREYYHKII
GRKNDKENFAKIIYEEIQNVNNIKELIEKIPDMSELKKSQVFYKYYLDKEELNDKNIKYA
FCHFVEIEMSQLLKNYVYKRLSNISNDKIKRIFEYQNLKKLIENKLLNKLDTYVRNCGKY
NYYLQVGEIATSDFIARNRQNEAFLRNIIGVSSVAYFSLRNILETENENDITGRMRGKTVK
NNKGEEKYVSGEVDKIYNENKQNEVKENLKMFYSYDFNMDNKNEIEDFFANIDEAISSI
RHGIVHFNLELEGKDIFAFKNIAPSEISKKMFQNEINEKKLKLKIFKQLNSANVFNYYEKD
VIIKYLKNTKENFVNKNIPFVPSFTKLYNKIEDLRNTLKFFWSVPKDKEEKDAQIYLLKNI
YYGEFLNKFVKNSKVFFKITNEVIKINKQRNQKTGHYKYQKFENIEKTVPVEYLAIIQSR
EMINNQDKEEKNTYIDFIQQIFLKGFIDYLNKNNLKYIESNNNNDNNDIFSKIKIKKDNKE
KYDKILKNYEKHNRNKEIPHEINEFVREIKLGKILKYTENLNMFYLILKLLNHKELTNLK
GSLEKYQSANKEETFSDELELINLLNLDNNRVTEDFELEANEIGKFLDFNENKIKDRKEL
KKFDTNKIYFDGENIIKHRAFYNIKKYGMLNLLEKIADKAKYKISLKELKEYSNKKNEIE
KNYTMQQNLHRKYARPKKDEKFNDEDYKEYEKAIGNIQKYTHLKNKVEFNELNLLQG
LLLKILHRLVGYTSIWERDLRFRLKGEFPENHYIEEIFNFDNSKNVKYKSGQIVEKYINFY
KELYKDNVEKRSIYSDKKVKKLKQEKKDLYIRNYIAHFNYIPHAEISLLEVLENLRKLLS
YDRKLKNAIMKSIVDILKEYGFVATFKIGADKKIEIQTLESEKIVHLKNLKKKKLMTDRN
SEELCELVKVMFEYKALE >G (SEQ ID NO: 59)
MGNLFGHKRWYEVRDKKDFKIKRKVKVKRNYDGNKYILNINENNNKEKID
NNKFIRKYINYKKNDNILKEFTRKFHAGNILFKLKGKEGIIRIENNDDFLETEEVVLYIEA
YGKSEKLKALGITKKKIIDEAIRQGITKDDKKIEIKRQENEEEIEIDIRDEYTNKTLNDCSIT
LRIIENDELETKKSIYEIFKNINMSLYKIIEKIIENETEKVFENRYYEEHLREKLLKDDKIDV
ILTNFMEIREKIKSNLEILGFVKFYLNVGGDKKKSKNKKMLVEKILNINVDLTVEDIADF
VIKELEFWNITKRIEKVKKVNNEFLEKRRNRTYIKSYVLLDKHEKFKIERENKKDKIVKF
FVENIKNNSIKEKIEKILAEFKIDELIKKLEKELKKGNCDTEIFGIFKKHYKVNFDSKKFSK
KSDEEKELYKIIYRYLKGRIEKILVNEQKVRLKKMEKIEIEKILNESILSEKILKRVKQYTL
EHIMYLGKLRHNDIDMTTVNTDDFSRLHAKEELDLELITFFASTNMELNKIFSRENINND
ENIDFFGGDREKNYVLDKKILNSKIKIIRDLDFIDNKNNITNNFIRKFTKIGTNERNRILHAI
SKERDLQGTQDDYNKVINIIQNLKISDEEVSKALNLDVVFKDKKNIITKINDIKISEENNN
DIKYLPSFSKVLPEILNLYRNNPKNEPFDTIETEKIVLNALIYVNKELYKKLILEDDLEENE
SKNIFLQELKKTLGNIDEIDENIIENYYKNAQISASKGNNKAIKKYQKKVIECYIGYLRKN
YEELFDFSDFKMNIQEIKKQIKDINDNKTYERITVKTSDKTIVINDDFEYIISIFALLNSNAV
INKIRNRFFATSVWLNTSEYQNIIDILDEIMQLNTLRNECITENWNLNLEEFIQKMKEIEKD
FDDFKIQTKKEIFNNYYEDIKNNILTEFKDDINGCDVLEKKLEKIVIFDDETKFEIDKKSNI
LQDEQRKLSNINKKDLKKKVDQYIKDKDQEIKSKILCRIIFNSDFLKKYKKEIDNLIEDME
SENENKFQEIYYPKERKNELYIYKKNLFLNIGNPNFDKIYGLISNDIKMADAKFLFNIDGK
NIRKNKISEIDAILKNLNDKLNGYSKEYKEKYIKKLKENDDFFAKNIQNKNYKSFEKDYN
RVSEYKKIRDLVEFNYLNKIESYLIDINWKLAIQMARFERDMHYIVNGLRELGIIKLSGY
NTGISRAYPKRNGSDGFYTTTAYYKFFDEESYKKFEKICYGFGIDLSENSEINKPENESIR
NYISHFYIVRNPFADYSIAEQIDRVSNLLSYSTRYNNSTYASVFEVFKKDVNLDYDELKK
KFKLIGNNDILERLMKPKKVSVLELESYNSDYIKNLIIELLTKIENTNDTL >H (SEQ ID
NO: 60) MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQII
DKYHQFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKD
SEKFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT
TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIKKD
LAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGENTKRK
GINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTMQSFYEQI
AAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDYSVIGTAVLE
YITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDIDKQCRFEEILA
NFAAIPMIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIKDLLDQTNNLLHK
LKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYITQKPYSDEKFKLNFE
NSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFDDKAIKENKGEGYKKIVY
KLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKNGSPQKGYEKFEFNIEDCRKF
IDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVENQGYKLTFENISESYIDSVVNQG
KLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDERNLQDVVYKLNGEAELFYRKQSIPK
KITHPAKEAIANKNKDNPKKESVFEYDLIKDKRFTEDKFFFHCPITINFKSSGANKFNDEI
NLLLKEKANDVHILSIDRGERHLAYYTLVDGKGNIIKQDTFNIIGNDRMKTNYHDKLAAI
EKDRDSARKDWKKINNIKEMKEGYLSQVVHEIAKLVIEYNAIVVFEDLNFGFKRGRFKV
EKQVYQKLEKMLIEKLNYLVFKDNEFDKTGGVLRAYQLTAPFETFKKMGKQTGITYYV
PAGFTSKICPVTGFVNQLYPKYESVSKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKA
AKGKWTIASFGSRLINFRNSDKNHNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAIC
GESDKKFFAKLTSVLNTILQMRNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDAD
ANGAYHIGLKGLMLLGRIKNNQEGKKLNLVIKNEEYFEFVQNRNN
[0993] A-locus through G-locus are cloned and inserted into a
low-copy plasmid. A vector that does not contain Amp resistance is
used.
TABLE-US-00012 >A-locus (SEQ ID NO: 61)
TATCCGGTCGAATCGAGAATGACGACCGCTACGTCTTGGACTACGAAGCC
GTGGCCCTTGCCGATGCTCTCGGTGTGGATGTTGCCGACCTGTTCCGCAAGATCGAT
TGCCCCAAGAACCTGCTGCGCAGGCGGGCAGGGTAGGGGAGCGGTTTCCGGCGGAG
ATTTTCGGAGGCGCCGGTAACGTTATGTCGGGGAATTTGCTATACATCGACGATAAT
TAGTTTTGTTGATTCAGGATCGAAATGCGCTCAAACAAAGAACGTTCCGCGTTTCCC
TCATGCGCTACTACGCCCACACCGCCATCTTTCGGCACGCAAACAAAGCAGATGGGT
TGCCTGTCAATGGGTGATCATTGCCTGAAGTTACCATCCATCAATAATATAAATCAT
CCTTACTCCGAATGTCCCTCAATCGCATCTATCAAGGCCGCGTGGCGGCCGTCGAAA
CAGGAACGGCCTTAGCGAAAGGTAATGTCGAATGGATGCCTGCCGCAGGAGGCGAC
GAAGTTCTCTGGCAGCACCACGAACTTTTCCAAGCTGCCATCAACTACTATCTCGTC
GCCCTGCTCGCACTCGCCGACAAAAACAATCCCGTACTTGGCCCGCTGATCAGCCAG
ATGGATAATCCCCAAAGCCCTTACCATGTCTGGGGAAGTTTCCGCCGCCAAGGACGT
CAGCGCACAGGTCTCAGTCAAGCCGTTGCACCTTATATCACGCCGGGCAATAACGCT
CCCACCCTTGACGAAGTTTTCCGCTCCATTCTTGCGGGCAACCCAACCGACCGCGCA
ACTTTGGACGCTGCACTCATGCAATTGCTCAAGGCTTGTGACGGCGCGGGCGCTATC
CAGCAGGAAGGTCGTTCCTACTGGCCCAAATTCTGCGATCCTGACTCCACTGCCAAC
TTCGCGGGAGATCCGGCCATGCTCCGGCGTGAACAACACCGCCTCCTCCTTCCGCAA
GTTCTCCACGATCCGGCGATTACTCACGACAGTCCTGCCCTTGGCTCGTTCGACACTT
ATTCGATTGCTACCCCCGACACCAGAACTCCTCAACTCACCGGCCCCAAGGCACGCG
CCCGTCTTGAGCAGGCGATCACCCTCTGGCGCGTCCGTCTTCCCGAATCGGCTGCTG
ACTTCGATCGCCTTGCCAGTTCCCTCAAAAAAATTCCGGACGACGATTCTCGCCTTA
ACCTTCAGGGCTACGTCGGCAGCAGTGCGAAAGGCGAAGTTCAGGCCCGTCTTTTCG
CCCTTCTGCTATTCCGTCACCTGGAGCGTTCCTCCTTTACGCTTGGCCTTCTCCGTTCC
GCCACCCCGCCGCCCAAGAACGCTGAAACACCTCCTCCCGCCGGCGTTCCTTTACCT
GCGGCGTCCGCAGCCGATCCGGTGCGGATAGCCCGTGGCAAACGCAGTTTTGTTTTT
CGCGCATTCACCAGTCTCCCCTGCTGGCATGGCGGTGATAACATCCATCCCACCTGG
AAGTCATTCGACATCGCAGCGTTCAAATATGCCCTCACGGTCATCAACCAGATCGAG
GAAAAGACGAAAGAACGCCAAAAAGAATGTGCGGAACTTGAAACTGATTTCGACTA
CATGCACGGACGGCTCGCCAAGATTCCGGTAAAATACACGACCGGCGAAGCCGAAC
CGCCCCCCATTCTCGCAAACGATCTCCGCATCCCCCTCCTCCGCGAACTTCTCCAGA
ATATCAAGGTCGACACCGCACTCACCGATGGCGAAGCCGTCTCCTATGGTCTCCAAC
GCCGCACCATTCGCGGTTTCCGCGAGCTGCGCCGCATCTGGCGCGGCCATGCCCCCG
CTGGCACGGTCTTTTCCAGCGAGTTGAAAGAAAAACTAGCCGGCGAACTCCGCCAG
TTCCAGACCGACAACTCCACCACCATCGGCAGCGTCCAACTCTTCAACGAACTCATC
CAAAACCCGAAATACTGGCCCATCTGGCAGGCTCCTGACGTCGAAACCGCCCGCCA
ATGGGCCGATGCCGGTTTTGCCGACGATCCGCTCGCCGCCCTTGTGCAAGAAGCCGA
ACTCCAGGAAGACATCGACGCCCTCAAGGCTCCAGTCAAACTCACTCCGGCCGATC
CTGAGTATTCAAGAAGGCAATACGATTTCAATGCCGTCAGCAAATTCGGGGCCGGCT
CCCGCTCCGCCAATCGCCACGAACCCGGGCAGACGGAGCGCGGCCACAACACCTTT
ACCACCGAAATCGCCGCCCGTAACGCGGCGGACGGGAACCGCTGGCGGGCAACCCA
CGTCCGCATCCATTACTCCGCTCCCCGCCTTCTTCGTGACGGACTCCGCCGACCTGAC
ACCGACGGCAACGAAGCCCTGGAAGCCGTCCCTTGGCTCCAGCCCATGATGGAAGC
CCTCGCCCCTCTCCCGACGCTTCCGCAAGACCTCACAGGCATGCCGGTCTTCCTCAT
GCCCGACGTCACCCTTTCCGGTGAGCGTCGCATCCTCCTCAATCTTCCTGTCACCCTC
GAACCAGCCGCTCTTGTCGAACAACTGGGCAACGCCGGTCGCTGGCAAAACCAGTT
CTTCGGCTCCCGCGAAGATCCATTCGCTCTCCGATGGCCCGCCGACGGTGCTGTAAA
AACCGCCAAGGGGAAAACCCACATACCTTGGCACCAGGACCGCGATCACTTCACCG
TACTCGGCGTGGATCTCGGCACGCGCGATGCCGGGGCGCTCGCTCTTCTCAACGTCA
CTGCGCAAAAACCGGCCAAGCCGGTCCACCGCATCATTGGTGAGGCCGACGGACGC
ACCTGGTATGCCAGCCTTGCCGACGCTCGCATGATCCGCCTGCCCGGGGAGGATGCC
CGGCTCTTTGTCCGGGGAAAACTCGTTCAGGAACCCTATGGTGAACGCGGGCGAAA
CGCGTCTCTTCTCGAATGGGAAGACGCCCGCAATATCATCCTTCGCCTTGGCCAAAA
TCCCGACGAACTCCTCGGCGCCGATCCCCGGCGCCATTCGTATCCGGAAATAAACGA
TAAACTTCTCGTCGCCCTTCGCCGCGCTCAGGCCCGTCTTGCCCGTCTCCAGAACCG
GAGCTGGCGGTTGCGCGACCTTGCAGAATCGGACAAGGCCCTTGATGAAATCCATG
CCGAGCGTGCCGGGGAGAAGCCTTCTCCGCTTCCGCCCTTGGCTCGCGACGATGCCA
TCAAAAGCACCGACGAAGCCCTCCTTTCCCAGCGTGACATCATCCGGCGATCCTTCG
TTCAGATCGCCAACTTGATCCTTCCCCTTCGCGGACGCCGATGGGAATGGCGGCCCC
ATGTCGAGGTCCCGGATTGCCACATCCTTGCGCAGAGCGATCCCGGTACGGATGAC
ACCAAGCGTCTTGTCGCCGGACAACGCGGCATCTCTCACGAGCGTATCGAGCAAAT
CGAAGAACTCCGTCGTCGCTGCCAATCCCTCAACCGTGCCCTGCGTCACAAACCCGG
AGAGCGTCCCGTGCTCGGACGCCCCGCCAAGGGCGAGGAAATCGCCGATCCCTGTC
CCGCGCTCCTCGAAAAGATCAACCGTCTCCGGGACCAGCGCGTTGACCAAACCGCG
CATGCCATCCTCGCCGCCGCTCTCGGTGTTCGACTCCGCGCCCCCTCAAAAGACCGC
GCCGAACGCCGCCATCGCGACATCCATGGCGAATACGAACGCTTTCGTGCGCCCGCT
GATTTTGTCGTCATCGAAAACCTCTCCCGTTATCTCAGCTCGCAGGATCGTGCTCGTA
GTGAAAACACCCGTCTCATGCAGTGGTGCCATCGCCAGATCGTGCAAAAACTCCGTC
AGCTCTGCGAGACCTACGGCATCCCCGTCCTCGCCGTCCCGGCGGCCTACTCATCGC
GTTTTTCTTCCCGGGACGGCTCGGCCGGATTCCGGGCCGTCCATCTGACACCGGACC
ACCGTCACCGGATGCCATGGAGCCGCATCCTCGCCCGCCTCAAGGCCCACGAGGAA
GACGGAAAAAGACTCGAAAAGACGGTGCTCGACGAGGCTCGCGCCGTCCGGGGACT
CTTTGACCGGCTCGACCGGTTCAACGCCGGGCATGTCCCGGGAAAACCTTGGCGCAC
GCTCCTCGCGCCGCTCCCCGGCGGCCCTGTGTTTGTCCCCCTCGGGGACGCCACACC
CATGCAGGCCGATCTGAACGCCGCCATCAACATCGCCCTCCGGGGCATCGCGGCTCC
CGACCGCCACGACATCCATCACCGGCTCCGTGCCGAAAACAAAAAACGCATCCTGA
GCTTGCGTCTCGGCACTCAGCGCGAGAAAGCCCGCTGGCCTGGAGGAGCTCCGGCG
GTGACACTCTCCACTCCGAACAACGGCGCCTCTCCCGAAGATTCCGATGCGTTGCCC
GAACGGGTATCCAACCTGTTTGTGGACATCGCCGGTGTCGCCAACTTCGAGCGAGTC
ACGATCGAAGGAGTCTCGCAAAAATTCGCCACCGGGCGTGGCCTTTGGGCCTCCGTC
AAGCAACGTGCATGGAACCGCGTTGCCAGACTCAACGAGACAGTAACAGATAACAA
CAGGAACGAAGAGGAGGACGACATTCCGATGTAACCATTGCTTCATTACATCTGAG
TCTCCCCTCAATCCCTCTGCCCCATGCGTGATATAACCTCCACCTCATGTCCCGGATC
GGCGCCGGCAACCTGTAGTTCCCTTCCATCCTCCAACACTCCCGCAGATCGCGATCC
GCTGCCGCCGATGCCGGTGCGCCGCCTTCACAACTATCTCTACTGTCCGCGGCTTTTT
TATCTCCAGTGGGTCGAGAATCTCTTTGAGGAAAATGCCGACACCATTGCCGGCAGC
GCCGTGCATCGTCACGCCGACAAACCTACGCGTTACGATGATGAAAAAGCCGAGGC
ACTTCGCACTGGTCTCCCTGAAGGCGCGCACATACGCAGCCTTCGCCTGGAAAACGC
CCAACTCGGTCTCGTTGGCGTGGTGGATATCGTGGAGGGAGGCCCCGACGGACTCG
AACTCGTCGACTACAAAAAAGGTTCCGCCTTCCGCCTCGACGACGGCACGCTCGCTC
CCAAGGAAAACGACACCGTGCAACTTGCCGCCTACGCTCTTCTCCTGGCTGCCGATG
GTGCGCGCGTTGCGCCCATGGCGACGGTCTATTACGCTGCCGATCGCCGGCGTGTCA
CCTTCCCGCTCGATGACGCCCTCTACGCCCGCACCCGTTCCGCCCTCGAAGAGGCCC
GCGCCGTTGCAACCTCGGGGCGCATACCTCCGCCGCTCGTCTCTGACGTCCGCTGCC
TCCATTGTTCCTCCTATGCGCTTTGCCTTCCCCGCGAGTCCGCCTGGTGGTGCCGCCA
TCGCAGCACGCCGCGGGGAGCCGGCCACACCCCCATGTTGCCGGGCTTTGAGGATG
ACGCCGCCGCCATTCACCAAATCTCCGAACCTGACACCGAGCCACCACCCGATCTTG
CCAGCCAGCCTCCCCGTCCCCCGCGGCTCGATGGAGAATTGTTGGTTGTCCAGACTC
CGGGAGCGATGATCGGACAAAGCGGCGGTGAGTTTACCGTGTCCGTCAAGGGTGAG
GTTTTGCGCAAGCTTCCGGTTCATCAACTCCGGGCCATTTACGTTTACGGAGCCGTG
CAACTCACGGCGCATGCTGTGCAGACCGCCCTTGAGGAGGATATCGACGTCTCCTAT
TTTGCGCCCAGCGGCCGCTTTCTTGGCCTCCTCCGCGGCCTGCCCGCATCCGGCGTG
GATGCGCGTCTCGGGCAATACACCCTGTTTCGCGAACCCTTTGGCCGTCTCCGTCTC
GCCTGCGAGGCGATTCGGGCCAAGATCCATAACCAGCGCGTCCTCCTCATGCGTAAC
GGCGAGCCCGGGGAGGGCGTCTTGCGCGAACTCGCCCGTCTGCGCGACGCCACCAG
TGAGGCGACTTCGCTCGACGAACTCCTCGGCATCGAGGGCATCGCCGCGCATTTCTA
TTTCCAGTATTTTCCCACCATGCTGAAAGAACGGGCGGCCTGGGCCTTTGATTTTTCC
GGACGCAATCGCCGCCCGCCGCGCGACCCGGTCAACGCCCTGCTTTCGTTCGGTTAC
AGCGTGTTGTCCAAGGAACTTGCCGGCGTCTGCCACGCTGTTGGCCTAGACCCGTTT
TTCGGCTTCATGCACCAGCCGCGTTACGGGCGCCCCGCACTCGCTCTCGATCTGATG
GAGGAGTTTCGCCCTCTCATCGCCGACAGTGTTGCCCTGAATCTCATCAACCGTGGC
GAACTCGACGAAGGGGACTTTATCCGGTCGGCCAATGGCACCGCGCTCAATGATCG
GGGCCGCCGGCGTTTTTGGGAGGCATGGTTCCGGCGTCTCGACAGCGAAGTCAGCC
ATCCTGAATTTGGTTACAAGATGAGCTATCGACGGATGCTTGAAGTGCAGGCGCGCC
AGCTATGGCGCTATGTGCGCGGTGACGCCTTCCGCTACCACGGATTCACCACCCGTT
GATTCCGATGTCAGATCCCCGCCGCCGTTATCTTGTGTGTTACGACATCGCCAATCC
GAAGCGATTGCGCCAAGTGGCCAAGCTGCTGGAGAGCTATGGCACGCGTCTGCAAT
ACTCGGTTTTCGAATGTCCTTTGGACGATCTTCGTCTTGAACAGGCGAAGGCTGATTT
GCGCGACACGATTAATGCCGACCAAGACCAGGTGTTATTTGTTTCGCTTGGCCCCGA
AGCCAACGATGCCACGTTGATCATCGCCACGCTTGGGCTCCCTTATACCGTGCGCTC
GCGAGTGACGATTATCTGACCCATAACCCACGTGTTGAAGAGGCTGAAAACAGACG
GACCTCTATGAAGAACAATTGACGTTTTGGCCGAACTCAGCAGACCTTTATGCGGCT
AAGGCCAATGATCATCCATCCTACCGCCATTGGGCTGGAGACGTTTTTTGAAACGGC
GAGTGCTGCGGATAGCGAGTTTCTCTTGGGGAGGCGCTCGCGGCCACTTTTACAGAG
GAGATGTTCGGGCGAACTGGCCGACCTAACAAGGCGTACCCGGCTCAAAATCGAGG
CACGCTCGCACGGGATGATGTAATTCGTTGTTTTTCAGCATACCGTGCGAGCACGGG
CCGCAGCGAATGCCGTTTCACGAATCGTCAGGCGGCGGGGAGAAGTCATTTAATAA
GGCCACTGTTAAAAGCCGCAGCGAATGCCGTTTCACGAATCGTCAGGCGGGCAGTG
GATGTTTTTCCATGAGGCGAAGAATTTCATCGCCGCAGTGAATGCCGTTTCACCATT
GATGAAGAATGCGAGGTGAAAACAGAGAAATTGGGTCAACTCTATCACTCTTATTC
AGCCATCGTTTCAAGAAAGGATACCTCGTATTGGATACAACACAGCTCGTTCGTTCT
CTCTACCTCCCTCGACAATCTCAAGGA >B-locus (SEQ ID NO: 62)
TAATAAAATTGAAATATCACTATGGATTATTGTAATATTACCATAAAGAT
AGGTGACGTTTTTTTGAAAATTGTAAACCTAATTTGAAGAAAACCAATTAAAAATCG
CTTCGGCTTTTTTTTAAGTGCCAGGTAGCATTGATGCTAACCCATGTGTAATAAAGGT
TTGTTTTCCTTCGGGGCACGAACACATTATAAGGGAAACCTAAAGATTCCCTTTCTT
GTTTAATATTATAACCAGTGAAAATAAGAATAATGCACCTAAAACTAATATACAGA
AAATAAGAATTAAAAGTACTAATATATACATCATATGTTATCCTCCAATGCTTTATTT
TTTAATAATTGATGTTAGTATTAGTTTTATTTTAATTTCTAAACATAAGAATTTGAAA
AGGATGTGTTTATTATGGCGACACGCAGTTTTATTTTAAAAATTGAACCAAATGAAG
AAGTTAAAAAGGGATTATGGAAGACGCATGAGGTATTGAATCATGGAATTGCCTAC
TACATGAATATTCTGAAACTAATTAGACAGGAAGCTATTTATGAACATCATGAACAA
GATCCTAAAAATCCGAAAAAAGTTTCAAAAGCAGAAATACAAGCCGAGTTATGGGA
TTTTGTTTTAAAAATGCAAAAATGTAATAGTTTTACACATGAAGTTGACAAAGATGT
TGTTTTTAACATCCTGCGTGAACTATATGAAGAGTTGGTCCCTAGTTCAGTCGAGAA
AAAGGGTGAAGCCAATCAATTATCGAATAAGTTTCTGTACCCGCTAGTTGATCCGAA
CAGTCAAAGTGGGAAAGGGACGGCATCATCCGGACGTAAACCTCGGTGGTATAATT
TAAAAATAGCAGGCGACCCATCGTGGGAGGAAGAAAAGAAAAAATGGGAAGAGGA
TAAAAAGAAAGATCCCCTTGCTAAAATCTTAGGTAAGTTAGCAGAATATGGGCTTAT
TCCGCTATTTATTCCATTTACTGACAGCAACGAACCAATTGTAAAAGAAATTAAATG
GATGGAAAAAAGTCGTAATCAAAGTGTCCGGCGACTTGATAAGGATATGTTTATCC
AAGCATTAGAGCGTTTTCTTTCATGGGAAAGCTGGAACCTTAAAGTAAAGGAAGAG
TATGAAAAAGTTGAAAAGGAACACAAAACACTAGAGGAAAGGATAAAAGAGGACA
TTCAAGCATTTAAATCCCTTGAACAATATGAAAAAGAACGGCAGGAGCAACTTCTTA
GAGATACATTGAATACAAATGAATACCGATTAAGCAAAAGAGGATTACGTGGTTGG
CGTGAAATTATCCAAAAATGGCTAAAGATGGATGAAAATGAACCATCAGAAAAATA
TTTAGAAGTATTTAAAGATTATCAACGGAAACATCCACGAGAAGCCGGGGACTATT
CTGTCTATGAATTTTTAAGCAAGAAAGAAAATCATTTTATTTGGCGAAATCATCCTG
AATATCCTTATTTGTATGCTACATTTTGTGAAATTGACAAAAAAAAGAAAGACGCTA
AGCAACAGGCAACTTTTACTTTGGCTGACCCGATTAACCATCCGTTATGGGTACGAT
TTGAAGAAAGAAGCGGTTCGAACTTAAACAAATATCGAATTTTAACAGAGCAATTA
CACACTGAAAAGTTAAAAAAGAAATTAACAGTTCAACTTGATCGTTTAATTTATCCA
ACTGAATCCGGCGGTTGGGAGGAAAAAGGTAAAGTAGATATCGTTTTGTTGCCGTC
AAGACAATTTTATAATCAAATCTTCCTTGATATAGAAGAAAAGGGGAAACATGCTTT
TACTTATAAGGATGAAAGTATTAAATTCCCCCTTAAAGGTACACTTGGTGGTGCAAG
AGTGCAGTTTGACCGTGACCATTTGCGGAGATATCCGCATAAAGTAGAATCAGGAA
ATGTTGGACGGATTTATTTTAACATGACAGTAAATATTGAACCAACTGAGAGCCCTG
TTAGTAAGTCTTTGAAAATACATAGGGACGATTTCCCCAAGTTCGTTAATTTTAAAC
CGAAAGAGCTCACCGAATGGATAAAAGATAGTAAAGGGAAAAAATTAAAAAGTGG
TATAGAATCCCTTGAAATTGGTCTACGGGTGATGAGTATCGACTTAGGTCAACGTCA
AGCGGCTGCTGCATCGATTTTTGAAGTAGTTGATCAGAAACCGGATATTGAAGGGA
AGTTATTTTTTCCAATCAAAGGAACTGAGCTTTATGCTGTTCACCGGGCAAGTTTTAA
CATTAAATTACCGGGTGAAACATTAGTAAAATCACGGGAAGTATTGCGGAAAGCTC
GGGAGGACAACTTAAAATTAATGAATCAAAAGTTAAACTTTCTAAGAAATGTTCTAC
ATTTCCAACAGTTTGAAGATATCACAGAAAGAGAGAAGCGTGTAACTAAATGGATT
TCTAGACAAGAAAATAGTGATGTTCCTCTTGTATATCAAGATGAGCTAATTCAAATT
CGTGAATTAATGTATAAACCCTATAAAGATTGGGTTGCCTTTTTAAAACAACTCCAT
AAACGGCTAGAAGTCGAGATTGGCAAAGAGGTTAAGCATTGGCGAAAATCATTAAG
TGACGGGAGAAAAGGTCTTTACGGAATCTCCCTAAAAAATATTGATGAAATTGATC
GAACAAGGAAATTCCTTTTAAGATGGAGCTTACGTCCAACAGAACCTGGGGAAGTA
AGACGCTTGGAACCAGGACAGCGTTTTGCGATTGATCAATTAAACCACCTAAATGCA
TTAAAAGAAGATCGATTAAAAAAGATGGCAAATACGATTATCATGCATGCCTTAGG
TTACTGTTATGATGTAAGAAAGAAAAAGTGGCAGGCAAAAAATCCAGCATGTCAAA
TTATTTTATTTGAAGATTTATCTAACTACAATCCTTACGAGGAAAGGTCCCGTTTTGA
AAACTCAAAACTGATGAAGTGGTCACGGAGAGAAATTCCACGACAAGTCGCCTTAC
AAGGTGAAATTTACGGATTACAAGTTGGGGAAGTAGGTGCCCAATTCAGTTCAAGA
TTCCATGCGAAAACCGGGTCGCCGGGAATTCGTTGCAGTGTTGTAACGAAAGAAAA
ATTGCAGGATAATCGCTTTTTTAAAAATTTACAAAGAGAAGGACGACTTACTCTTGA
TAAAATCGCAGTTTTAAAAGAAGGAGACTTATATCCAGATAAAGGTGGAGAAAAGT
TTATTTCTTTATCAAAGGATCGAAAGTTGGTAACTACGCATGCTGATATTAACGCGG
CCCAAAATTTACAGAAGCGTTTTTGGACAAGAACACATGGATTTTATAAAGTTTACT
GCAAAGCCTATCAGGTTGATGGACAAACTGTTTATATTCCGGAGAGCAAGGACCAA
AAACAAAAAATAATTGAAGAATTTGGGGAAGGCTATTTTATTTTAAAAGATGGTGT
ATATGAATGGGGTAATGCGGGGAAACTAAAAATTAAAAAAGGTTCCTCTAAACAAT
CATCGAGTGAATTAGTAGATTCGGACATACTGAAAGATTCATTTGATTTAGCAAGTG
AACTTAAGGGAGAGAAACTCATGTTATATCGAGATCCGAGTGGAAACGTATTTCCTT
CCGACAAGTGGATGGCAGCAGGAGTATTTTTTGGCAAATTAGAAAGAATATTGATTT
CTAAGTTAACAAATCAATACTCAATATCAACAATAGAAGATGATTCTTCAAAACAAT
CAATGTAAAAGTTTGCCCGTATAAGAACTTAATTAATTAGGATGGTAGGATGTTACT
AAATATGTCTGTAGGCATCATTCCTACTATCCGTTTTGTCCGAATATCAGAGCATTAG
GTGAGGAATGGTAAGAAAGGAAAATTTATATGAACCAACCGATTCCTATTCGAATG
TTAAATGAAATACAATATTGTGAGCGACTTTTTTACTTTATGCATGTCCAAAAGCTAT
TTGATGAGAATGCAGATACAGTTGAAGGAAGTGCACAGCATGAGCGGGCAGAAAG
AAGCAAAAGACCAAGTAAAATGGGACCAAAGGAATTATGGGGTGAGGCGCCAAGA
AGTCTTAAGCTTGGTGATGAGCTGTTAAATATTACCGGTGTTCTTGATGCCATAAGT
CATGAAGAGAACAGTTGGATCCCGGTTGAATCAAAACACAGTTCCGCACCGGATGG
ATTGAACCCTTTTAAAGTAGATGGCTTTCTACTTGACGGGTCTGCATGGCCAAACGA
TCAAATTCAACTTTGTGCACAAGGCTTGCTCTTGAATGCCAATGGATACCCGTGTGA
TTATGGGTATTTATTTTATCGTGGTAATAAGAAAAAGGTGAAAATTTATTTTACTGA
AGATTTAATCGCTGCCACAAAGTACTATATTAAAAAAGCACACGAGATACTAGTATT
ATCTGGTGATGAATCAGCTATTCCTAAGCCTTTAATTGATTCTAATAAGTGTTTTCGC
TGTTCTTTAAACTATATCTGTCTTCCGGATGAAACGAACTATCTATTAGGGGCAAGTT
CAACAATTCGTAAAATTGTGCCTTCAAGGACAGATGGTGGCGTTTTATATGTATCAG
AGTCTGGTACAAAATTAGGAAAATCGGGTGAGGAGTTAATCATTCAGTATAAAGAT
GGCCAAAAGCAGGGTGTTCCTATAAAAGATATTATTCAAGTTTCGTTAATTGGAAAT
GTTCAATGCTCAACGCAATTACTTCATTTTTTAATGCAATCAAATATTCCTGTAAGTT
ATTTATCATCCCACGGTCGTTTGATTGGTGTCAGTTCATCTTTAGTTACAAAAAATGT
TTTAACAAGGCAGCAACAGTTCATTAAATTTACAAATCCTGAGTTTGGACTAAATCT
AGCAAAACAAATTGTTTATGCCAAGATTCGAAATCAACGAACTTTACTTAGAAGAA
ATGGGGGGAGTGAGGTAAAGGAGATTTTAACAGATTTAAAATCTTTAAGTGACAGT
GCACTGAACGCAATATCAATAGAACAATTACGGGGTATTGAAGGGATTTCTGCAAA
ACATTATTTCGCAGGATTTCCGTTTATGTTGAAAAATGAATTACGTGAATTGAATTTA
ATGAAAGGGCGTAATAGGAGACCGCCAAAAGATCCTGTAAATGTACTTCTTTCTCTT
GGTTATACTTTATTGACACGTGATATTCATGCTGCGTGTGGTTCAGTCGGATTGGATC
CGATGTTTGGTTGTTACCATCGTCCAGAAGCAGGTCGACCGGCTCTAGTATTAGATG
TTATGGAAACATTTCGACCACTTATTGTAGACAGTATTGTCATCCGAGCTTTGAATA
CGGGTGAAATCTCATTAAAAGATTTTTATATAGGAAAAGATAGTTGTCAATTATTAA
AACATGGCCGCGATTCCTTTTTTGCCATTTATGAAAGAAGAATGCATGAAACTATTA
CCGATCCAATTTTCGGCTATAAGATTAGCTATCGCCGTATGCTCGATTTGCACATTCG
AATGCTTGCAAGGTTTATTGAAGGGGAACTGCCGGAATATAAACCATTAATGACCC
GGTGAGTTTGTTTATTAGGTTAAAAGAAGGTGAAGACATGCAGCAATACGTCCTTGT
TTCTTATGATATTTCGGACCAAAAAAGATGGAGAAAAGTATTTAAACTGATGAAAG
GATACGGAGAACATGTTCAATATTCCGTATTCATATGCCAGTTAACTGAATTACAGA
AGGCAAAATTACAAGCCTCTTTAGAAGACATTATCCATCATAAGAATGACCAAGTA
ATGTTTGTTCACATCGGGCCAGTGAAAGATGGTCAACTATCTAAAAAAATCTCAACA
ATTGGGAAAGAATTTGTTCCATTGGATTTAAAGCGGCTTATATTTTGAAAAGATATA
GCAAAGAAATCTTATGAAAAAAATACAAAAATATATTGTTAAAAAATAGGGAATAT
TATATAATGGACTTACGAGGTTCTGTCTTTTGGTCAGGACAACCGTCTAGCTATAAG
TGCTGCAGGGGTGTGAGAAACTCCTATTGCTGGACGATGTCTCTTTTATTTCTTTTTT
CTTGGATCTGAGTACGAGCACCCACATTGGACATTTCGCATGGTGGGTGCTCGTACT
ATAGGTAAAACAAACCTTTTTAAGAAGAATACAAAAATAACCACAATATTTTTTAAA
AGGAATTTTGATGGATTTACATAACCTCTCGCAACATGCTTCTAAAACCCAAGCCCA
CCATAGCCCAAAACCCCCTGCGGTCCAAGAAAAAAGAAATGATACGAGGCATTAGC
ACCGGGGAGAAGTCATTTAATAAGGCCACTGTTAAAAGTCCAAGAAAAAAGAAATG
ATACGAGGCATTAGCACAACAATATAAACGACTACTTTACCGTGTTCAAGAAAAAA
GAAATGATATGAGGCATTAGCACGATGGGATGGGAGAGAGAGGACAGTTCTACTCT
TGCTGTATCCAGCTTCTTTTACTTTATCCGGTATCATTTCTTCACTTCTTTCTGCACAT
AAAAAAGCACCTAACTATTTGGATAAGTTAAGTGCTTTTATTTCCGTTTGAAGTTGTC
TATTGCTTTTTTCTTCATATCTTCAAATTTTTTCTGTTTCTCAGAGTCAACTTTACCAA
CTGTAATCCCTTTTCTTTTTGGCATTGGGGTATCTTTCCACCTTAGTGTGTTCATAAG
GCTTATATTTATCACTCATTGTATTCCTCCAACACAATTATAATTTTTCCGTCATCCTC
AATCCAACCGTCAACTGTGACAAAAGACGAATCTCTCTTAT >C-locus (SEQ ID NO:
63) GTTTCATTTGGAAAGGGAGAGCATTGGCTTTTCTCTTTGTAAATAAAGTGC
AAGCTTTGTAATAAGCTTCTAGTGGAGAAGTGATTGTTTGAATCACCCAATGCACAC
GCACTAAAGTTAGACGAACCTATAATTCGTATTAGTAAGTATAGTACATGAAGAAA
AATGCAACAAGCATTTACTCTCTTTTAAATAAAGAATTGATAGCTGTTAATATTGAT
AGTATATTATACCTTATAGATGTTCGATTTTTTTTGAAATTCAAAAATCATACTTAGT
AAAGAAAGGAAATAACGTCATGGACAAGCGAAAGCGTAGAAGTTACGAGTTTAGGT
GGGAAGCGGGAGGCACCAGTCATGGCAATCCGTAGCATAAAACTAAAACTAAAAAC
CCACACAGGCCCGGAAGCGCAAAACCTCCGAAAAGGAATATGGCGGACGCATCGGT
TGTTAAATGAAGGCGTCGCCTATTACATGAAAATGCTCCTGCTCTTTCGTCAGGAAA
GCACTGGTGAACGGCCAAAAGAAGAACTACAGGAAGAACTGATTTGTCACATACGC
GAACAGCAACAACGAAATCAGGCAGATAAAAATACGCAAGCGCTTCCGCTAGATAA
GGCACTGGAAGCTTTGCGCCAACTATATGAACTGCTTGTCCCCTCCTCGGTCGGACA
AAGTGGCGACGCCCAGATCATCAGCCGAAAGTTTCTCAGCCCGCTCGTCGATCCGA
ACAGCGAAGGCGGCAAAGGTACTTCGAAGGCAGGGGCAAAACCCACTTGGCAGAA
GAAAAAAGAAGCGAACGACCCAACCTGGGAACAGGATTACGAAAAATGGAAAAAA
AGACGCGAGGAAGACCCAACCGCTTCTGTGATTACTACTTTGGAGGAATACGGCATT
AGACCGATCTTTCCCCTGTACACGAACACCGTAACAGATATCGCGTGGTTGCCACTT
CAATCCAATCAGTTTGTGCGAACCTGGGACAGAGACATGCTTCAACAAGCGATTGA
AAGACTGCTCAGTTGGGAGAGCTGGAACAAACGTGTCCAGGAAGAGTATGCCAAGC
TGAAAGAAAAAATGGCTCAACTGAACGAGCAACTCGAAGGCGGTCAGGAATGGATC
AGCTTGCTAGAGCAGTACGAAGAAAACCGAGAGCGAGAGCTTAGGGAAAACATGA
CCGCTGCCAATGACAAGTATCGGATTACCAAGCGGCAAATGAAAGGCTGGAACGAG
CTGTACGAGCTATGGTCAACCTTTCCCGCCAGTGCCAGTCACGAGCAATACAAAGA
GGCGCTCAAGCGTGTGCAGCAGCGACTGAGAGGGCGGTTTGGGGATGCTCATTTCTT
CCAGTATCTGATGGAAGAGAAGAACCGCCTGATCTGGAAGGGGAATCCGCAGCGTA
TCCATTATTTTGTCGCGCGCAACGAACTGACGAAACGGCTGGAGGAAGCCAAGCAA
AGCGCCACGATGACGTTGCCCAATGCCAGGAAGCATCCATTGTGGGTGCGCTTCGAT
GCACGGGGAGGAAATTTGCAAGACTACTACTTGACGGCTGAAGCGGACAAACCGAG
AAGCAGACGTTTTGTAACGTTTAGTCAGTTGATATGGCCAAGCGAATCGGGATGGAT
GGAAAAGAAAGACGTCGAGGTCGAGCTAGCTTTGTCCAGGCAGTTTTACCAGCAGG
TGAAGTTGCTGAAAAATGACAAAGGCAAGCAGAAAATCGAGTTCAAGGATAAAGGT
TCGGGCTCGACGTTTAACGGACACTTGGGGGGAGCAAAGCTACAACTGGAGCGGGG
CGATTTGGAGAAGGAAGAAAAAAACTTCGAGGACGGGGAAATCGGCAGCGTTTACC
TTAACGTTGTCATTGATTTCGAACCTTTGCAAGAAGTGAAAAATGGCCGCGTGCAGG
CGCCGTATGGACAAGTACTGCAACTCATTCGTCGCCCCAACGAGTTTCCCAAGGTCA
CTACCTATAAGTCGGAGCAACTTGTTGAATGGATAAAAGCTTCGCCACAACACTCGG
CTGGGGTGGAGTCGCTGGCATCCGGTTTTCGTGTAATGAGCATAGACCTTGGGCTGC
GCGCGGCTGCAGCGACTTCTATTTTTTCTGTAGAAGAGAGTAGCGATAAAAATGCGG
CTGATTTTTCCTACTGGATTGAAGGAACGCCGCTGGTCGCTGTCCATCAGCGGAGCT
ATATGCTCAGGTTGCCTGGTGAACAGGTAGAAAAACAGGTGATGGAAAAACGGGAC
GAGCGGTTCCAGCTACACCAACGTGTGAAGTTTCAAATCAGAGTGCTCGCCCAAATC
ATGCGTATGGCAAATAAGCAGTATGGAGATCGCTGGGATGAACTCGACAGCCTGAA
ACAAGCGGTTGAGCAGAAAAAGTCGCCGCTCGATCAAACAGACCGGACATTTTGGG
AGGGGATTGTCTGCGACTTAACAAAGGTTTTGCCTCGAAACGAAGCGGACTGGGAA
CAAGCGGTAGTGCAAATACACCGAAAAGCAGAGGAATACGTCGGAAAAGCCGTTCA
GGCATGGCGCAAGCGCTTTGCTGCTGACGAGCGAAAAGGCATCGCAGGTCTGAGCA
TGTGGAACATAGAAGAATTGGAGGGCTTGCGCAAGCTGTTGATTTCCTGGAGCCGC
AGGACGAGGAATCCGCAGGAGGTTAATCGCTTTGAGCGAGGCCATACCAGCCACCA
GCGTCTGTTGACCCATATCCAAAACGTCAAAGAGGATCGCCTGAAGCAGTTAAGTC
ACGCCATTGTCATGACTGCCTTGGGGTATGTTTACGACGAGCGGAAACAAGAGTGGT
GCGCCGAATACCCGGCTTGCCAGGTCATTCTGTTTGAAAATCTGAGCCAGTACCGTT
CTAACCTGGATCGCTCGACCAAAGAAAACTCCACCTTGATGAAGTGGGCGCATCGC
AGCATTCCGAAATACGTCCACATGCAGGCGGAGCCATACGGGATTCAGATTGGCGA
TGTCCGGGCGGAATATTCCTCTCGTTTTTACGCCAAGACAGGAACGCCAGGCATTCG
TTGTAAAAAGGTGAGAGGCCAAGACCTGCAGGGCAGACGGTTTGAGAACTTGCAGA
AGAGGTTAGTCAACGAGCAATTTTTGACGGAAGAACAAGTGAAACAGCTAAGGCCC
GGCGACATTGTCCCGGATGATAGCGGAGAACTGTTCATGACCTTGACAGACGGAAG
CGGAAGCAAGGAGGTCGTGTTTCTCCAGGCCGATATTAACGCGGCGCACAATCTGC
AAAAACGTTTTTGGCAGCGATACAATGAACTGTTCAAGGTTAGCTGCCGCGTCATCG
TCCGAGACGAGGAAGAGTATCTCGTTCCCAAGACAAAATCGGTGCAGGCAAAGCTG
GGCAAAGGGCTTTTTGTGAAAAAATCGGATACAGCCTGGAAAGATGTATATGTGTG
GGACAGCCAGGCAAAGCTTAAAGGTAAAACAACCTTTACAGAAGAGTCTGAGTCGC
CCGAACAACTGGAAGACTTTCAGGAGATCATCGAGGAAGCAGAAGAGGCGAAAGG
AACATACCGTACACTGTTCCGCGATCCTAGCGGAGTCTTTTTTCCCGAATCCGTATG
GTATCCCCAAAAAGATTTTTGGGGCGAGGTGAAAAGGAAGCTGTACGGAAAATTGC
GGGAACGGTTTTTGACAAAGGCTCGGTAAGGGTGTGCAAGGAGAGTGAATGGCTTG
TCCTGGATACCTGTCCGCATGCTAAATGAAATTCAGTATTGTGAGCGACTGTACCAT
ATTATGCATGTGCAGGGGCTGTTTGAGGAAAGCGCAGACACGGTCGAAGGAGCAGC
ACAACACAAGCGTGCAGAGACACATCTGCGCAAAAGCAAGGCAGCGCCGGAAGAG
ATGTGGGGGGACGCTCCGTTTAGCTTGCAGCTCGGCGACCCTGTGCTTGGCATTACG
GGAAAGCTGGATGCCGTCTGTCTGGAAGAAGGTAAGCAGTGGATTCCGGTAGAAGG
AAAGCATTCGGCGTCGCCAGAAGGCGGGCAGATGTTCACTGTAGGCGTGTATTCGCT
GGACGGTTCTGCCTGGCCCAACGACCAAATCCAATTGTGTGCGCAAGGCTTGCTGCT
TCGCGCGAATGGATATGAATCCGATTATGGCTACTTATACTACCGTGGCAATAAAAA
GAAGGTTCGCATTCCTTTTTCGCAGGAACTCATAGCGGCTACTCACGCCTGCATTCA
AAAAGCTCATCAGCTTCGGGAAGCCGAAATTCCCCCTCCGTTGCAGGAGTCGAAAA
AGTGCTTTCGATGCTCGTTAAATTACGTATGCATGCCTGACGAGACGAATTACATGT
TGGGGTTGAGCGCAAACATCAGAAAGATTGTGCCCAGTCGTCCAGATGGCGGGGTA
CTGTATGTTACAGAGCAGGGGGCAAAACTGGGCAGAAGCGGAGAAAGCTTGACCAT
CACCTGCCGGGGCGAAAAGATAGACGAAATCCCGATCAAAGACTTGATTCACGTGA
GCTTGATGGGGCATGTGCAATGCTCTACGCAGCTTCTGCACACCTTGATGAACTGTG
GCGTCCACGTCAGCTACTTGACTACGCATGGCACATTGACAGGAATAATGACTCCCC
CTTTATCGAAAAACATTCGAACAAGAGCCAAGCAGTTTATCAAATTTCAGCACGCGG
AGATCGCCCTTGGAATCGCGAGAAGGGTCGTGTATGCGAAAATTTCCAATCAGCGC
ACGATGCTGCGCCGCAATGGCTCACCAGATAAAGCAGTTTTAAAAGAGTTAAAAGA
GCTTAGAGATCGCGCGTGGGAGGCGCCATCACTGGAAATAGTGAGAGGTATCGAGG
GACGTGCAGCACAGTTGTACATGCAGTTTTTCCCTACCATGTTAAAGCACCCAGTAG
TAGACGGTATGGCGATCATGAACGGTCGCAACCGTCGCCCGCCCAAAGATCCGGTC
AATGCGCTGCTCTCCCTCGGCTATACGCTTCTTTCACGGGATGTTTACTCCGCATGTG
CCAATGTCGGACTCGATCCACTGTTCGGCTTTTTCCATACGATGGAGCCGGGCAGAC
CAGCTTTGGCACTCGATCTGATGGAACCGTTCCGCGCCTTGATTGCCGATAGCGTAG
CGATACGTACCTTGAATACGGAGGAACTCACCCTCGGGGACTTTTATTGGGGAAAA
GACAGTTGTTATTTGAAAAAGGCAGGAAGACAAACGTATTTCGCTGCCTATGAAAG
ACGGATGAACGAGACGCTGACGCATCCGCAATTTGGGTATAAGCTCAGCTATCGCC
GTATGCTGGAGCTGGAAGCAAGGTTTTTGGCCCGGTATCTGGATGGAGAGCTGGTG
GAATATACGCCGCTCATGACAAGGTAGGAAATGACCATGCGACAATTTGTTCTGGTA
AGCTATGATATTGCCGATCAAAAACGTTGGAGAAAAGTATTCAAGCTGATGAAGGG
GCAAGGCGAGCACGTCCAGTACTCGGTGTTTCTGTGCCAACTCACCGAGATTCAGCA
AGCCAAGCTAAAGGTAAGCCTGGCGGAGCTGGTTCACCATGGAGAAGACCAGGTCA
TGTTTGTAAAAATCGGCCCAGTGACGAGAGATCAACTGGACAAGCGGATATCTACT
GTTGGCAGGGAGTTTCTGCCTCGCGATTTGACCAAATTTATCTATTAAGGAATGAAG
AAAGCTAGTTGTAACAAAAGTGGAAAAAGAGTAAAATAAAGGTGTCAGTCGCACGC
TATAGGCCATAAGTCGACTTACATATCCGTGCGTGTGCATTATGGGCCCATCCACAG
GTCTATTCCCACGGATAATCACGACTTTCCACTAAGCTTTCGAATTTTATGATGCGAG
CATCCTCTCAGGTCAAAAAAGCCGGGGGATGCTCGAACTCTTTGTGGGCGTAGGCTT
TCCAGAGTTTTTTAGGGGAAGAGGCAGCCGATGGATAAGAGGAATGGCGATTGAAT
TTTGGCTTGCTCGAAAAACGGGTCTGTAAGGCTTGCGGCTGTAGGGGTTGAGTGGGA
AGGAGTTCGAAAGCTTAGTGGAAAGCTTCGTGGTTAGCACCGGGGAGAAGTCATTT
AATAAGGCCACTGTTAAAAGTTCGAAAGCTTAGTGGAAAGCTTCGTGGTTAGCACG
CTAAAGTCCGTCTAAACTACTGAGATCTTAAATCGGCGCTCAAATAAAAAACCTCGC
TAATGCGAGGTTTCAGC >D-locus (SEQ ID NO: 64)
GAAGTTATGTTGATAAAATGGTTTATGAAAACGTGAGTCTGTGGTAGTAT
TATAAACAATGATGGAATAAAGTGTTTTTTGCGCCGCACGGCATGAATTCAGGGGTT
AGCTTGGTTTTGTGTATAAATAAATGTTCTACATATTTATTTTGTTTTTTGCGCCGCA
AAATGCAACTGAAAGCCGCATCTAGAGCACCCTGTAGAAGACAGGGTTTTGAGAAT
AGCCCGACATAGAGGGCAATAGACACGGGGAGAAGTCATTTAATAAGGCCACTGTT
AAAAGTTTTGAGAATAGCCCGACATAGAGGGCAATAGACTTTTGCTTCGTCACGGAT
GGACTTCACAATGGCAACAACGTTTTGAGAATAGCCCGACATAGTTATAGAGATGT
ATAAATATAACCGATAAACATTGACTAATTTGTTGAAGTCAGTGTTTATCGGTTTTTT
GTGTAAATATAGGAGTTGTTAGAATGATACTTTTTGCCTAATTTTGGAACTTTATGAG
GATATAAGATAGACTTGATAAAAAGGTAAAAGAAAGGTTAAAGAGCATGGCAGGA
ATAGTGACCTGTGATGAAGATGATGGTAGAATTAAAAGTGTTCTTAAAGAAAAACA
ATATTGGATAAGGAAAATAATTCAATAGATAAAAAATTTAGGGGGAAAAATGAAAA
TATCAAAAGTCGATCATACCAGAATGGCGGTTGCTAAAGGTAATCAACACAGGAGA
GATGAGATTAGTGGGATTCTCTATAAGGATCCGACAAAGACAGGAAGTATAGATTT
TGATGAACGATTCAAAAAACTGAATTGTTCGGCGAAGATACTTTATCATGTATTCAA
TGGAATTGCTGAGGGAAGCAATAAATACAAAAATATTGTTGATAAAGTAAATAACA
ATTTAGATAGGGTCTTATTTACAGGTAAGAGCTATGATCGAAAATCTATCATAGACA
TAGATACTGTTCTTAGAAATGTTGAGAAAATTAATGCATTTGATCGAATTTCAACAG
AGGAAAGAGAACAAATAATTGACGATTTGTTAGAAATACAATTGAGGAAGGGGTTA
AGGAAAGGAAAAGCTGGATTAAGAGAGGTATTACTAATTGGTGCTGGTGTAATAGT
TAGAACCGATAAGAAGCAGGAAATAGCTGATTTTCTGGAGATTTTAGATGAAGATTT
CAATAAGACGAATCAGGCTAAGAACATAAAATTGTCTATTGAGAATCAGGGGTTGG
TGGTCTCGCCTGTATCAAGGGGAGAGGAACGGATTTTTGATGTCAGTGGCGCACAA
AAGGGAAAAAGCAGCAAAAAAGCGCAGGAGAAAGAGGCACTATCTGCATTTCTGTT
AGATTATGCTGATCTTGATAAGAATGTCAGGTTTGAGTATTTACGTAAAATTAGAAG
ACTGATAAATCTATATTTCTATGTCAAAAATGATGATGTTATGTCTTTAACTGAAATT
CCGGCAGAAGTGAATCTGGAAAAAGATTTTGATATCTGGAGAGATCACGAACAAAG
AAAGGAAGAGAATGGAGATTTTGTTGGATGTCCGGACATACTTTTGGCAGATCGTG
ATGTGAAGAAAAGTAACAGTAAGCAGGTAAAAATTGCAGAGAGGCAATTAAGGGA
GTCAATACGTGAAAAAAATATAAAACGATATAGATTTAGCATAAAAACGATTGAAA
AGGATGATGGAACATACTTTTTTGCAAATAAGCAGATAAGTGTATTTTGGATTCATC
GCATTGAAAATGCTGTAGAACGTATATTAGGATCTATTAATGATAAAAAACTGTATA
GATTACGTTTAGGATATCTAGGAGAAAAAGTATGGAAGGACATACTCAATTTTCTCA
GCATAAAATACATTGCAGTAGGCAAGGCAGTATTCAATTTTGCAATGGATGATCTGC
AGGAGAAGGATAGAGATATAGAACCCGGCAAGATATCAGAAAATGCAGTAAATGG
ATTGACTTCGTTTGATTATGAGCAAATAAAGGCAGATGAGATGCTGCAGAGAGAAG
TTGCTGTTAATGTAGCATTCGCAGCAAATAATCTTGCTAGAGTAACTGTAGATATTC
CGCAAAATGGAGAAAAAGAGGATATCCTTCTTTGGAATAAAAGTGACATAAAAAAA
TACAAAAAGAATTCAAAGAAAGGTATTCTGAAATCTATACTTCAGTTTTTTGGTGGT
GCTTCAACTTGGAATATGAAAATGTTTGAGATTGCATATCATGATCAGCCAGGTGAT
TACGAAGAAAACTACCTATATGACATTATTCAGATCATTTACTCGCTCAGAAATAAG
AGCTTTCATTTCAAGACATATGATCATGGGGATAAGAATTGGAATAGAGAACTGAT
AGGAAAGATGATTGAGCATGATGCTGAAAGAGTCATTTCTGTTGAGAGGGAAAAGT
TTCATTCCAATAACCTGCCGATGTTTTATAAAGACGCTGATCTAAAGAAAATATTGG
ATCTCTTGTATAGCGATTATGCAGGACGTGCATCTCAGGTTCCGGCATTTAACACTG
TCTTGGTTCGAAAGAACTTTCCGGAATTTCTTAGGAAAGATATGGGCTACAAGGTTC
ATTTTAACAATCCTGAAGTAGAGAATCAGTGGCACAGTGCGGTGTATTACCTATATA
AAGAGATTTATTACAATCTATTTTTGAGAGATAAAGAGGTAAAGAATCTTTTTTATA
CTTCATTAAAAAATATAAGAAGTGAAGTTTCGGACAAAAAACAAAAGTTAGCTTCA
GATGATTTTGCATCCAGGTGTGAAGAAATAGAGGATAGAAGTCTTCCGGAAATTTGT
CAGATAATAATGACAGAATACAATGCGCAGAACTTTGGTAATAGAAAAGTTAAATC
TCAGCGTGTTATTGAAAAAAATAAGGATATTTTCAGACATTATAAAATGCTTTTGAT
AAAGACTTTAGCAGGTGCTTTTTCTCTTTATTTGAAGCAGGAAAGATTTGCATTTATT
GGTAAGGCAACACCTATACCATACGAAACAACCGATGTTAAGAATTTTTTGCCTGAA
TGGAAATCCGGAATGTATGCATCGTTTGTAGAGGAGATAAAGAATAATCTTGATCTT
CAAGAATGGTATATCGTCGGACGATTCCTTAATGGGAGGATGCTCAATCAATTGGCA
GGAAGCCTGCGGTCATACATACAGTATGCGGAAGATATAGAACGTCGTGCTGCAGA
AAATAGGAATAAGCTTTTCTCCAAGCCTGATGAAAAGATTGAAGCATGTAAAAAAG
CGGTCAGAGTGCTTGATTTGTGTATAAAAATTTCAACTAGAATATCTGCGGAATTTA
CTGACTATTTTGATAGTGAAGATGATTATGCAGATTATCTTGAAAAATATCTCAAGT
ATCAGGATGATGCCATTAAGGAATTGTCAGGATCTTCGTATGCTGCGTTGGATCATT
TTTGCAACAAGGATGATCTGAAATTTGATATCTATGTAAATGCCGGACAGAAGCCTA
TCTTACAGAGAAATATCGTGATGGCAAAGCTTTTTGGACCAGATAACATTTTGTCTG
AAGTTATGGAAAAGGTAACAGAAAGTGCCATACGAGAATACTATGACTATCTGAAG
AAAGTTTCAGGATATCGGGTAAGGGGAAAATGTAGTACAGAGAAAGAACAGGAAG
ATCTGCTAAAGTTCCAAAGATTGAAAAACGCAGTAGAATTCCGGGATGTTACTGAAT
ATGCTGAGGTTATTAATGAGCTTTTAGGACAGTTGATAAGTTGGTCATATCTTAGGG
AGAGGGATCTATTATATTTCCAGCTGGGATTCCATTACATGTGTCTGAAAAACAAAT
CTTTCAAACCGGCAGAATATGTGGATATTCGTAGAAATAATGGTACGATTATACATA
ATGCGATACTTTACCAGATTGTTTCGATGTATATTAATGGACTGGATTTCTATAGTTG
TGATAAAGAAGGGAAAACGCTCAAACCAATTGAAACAGGAAAGGGCGTAGGAAGT
AAGATAGGACAATTTATAAAGTATTCCCAGTATTTATACAATGATCCGTCATATAAG
CTTGAGATCTATAATGCAGGATTAGAAGTTTTTGAAAACATTGATGAACATGATAAT
ATTACAGATCTTAGAAAGTATGTGGATCATTTTAAGTATTATGCATATGGTAATAAA
ATGAGCCTGCTTGATCTGTATAGTGAATTCTTCGATCGTTTCTTTACATATGATATGA
AGTATCAGAAGAATGTAGTGAATGTGTTGGAGAATATCCTTTTAAGGCATTTTGTAA
TTTTCTATCCGAAGTTTGGATCAGGAAAAAAAGATGTTGGAATTAGGGATTGTAAAA
AAGAAAGAGCTCAGATTGAAATAAGTGAGCAGAGCCTCACATCGGAAGACTTCATG
TTTAAGCTTGACGACAAAGCAGGAGAAGAAGCAAAGAAGTTTCCGGCAAGGGATGA
ACGTTATCTCCAGACAATAGCCAAGTTGCTCTATTATCCTAACGAAATTGAGGATAT
GAACAGATTCATGAAGAAAGGAGAAACGATAAATAAAAAAGTTCAGTTTAATAGAA
AAAAGAAGATAACCAGGAAACAAAAGAATAATTCATCAAACGAGGTATTGTCTTCA
ACTATGGGTTATTTATTTAAGAACATTAAATTGTAAAAAAGATTCGTTGTAGATAAT
TGATAGGTAAAAGCTGACCGGAGCCTTTGGCTCCGGACAGTTGTATATAAGAGGAT
ATTAATGACTGAAAATGATTTTTGTTGGAAGTCAGTTTTTTCTGTGGAAAGCGAAAT
CGAATATGATGAGTATGCATATGGCAGAAGAGCTGTAGAAGGCGAGAATACATATG
ATTACATTACTAAGGAAGAAAGACCGGAACTTAATGACGAATATGTAGCGAGACGT
TGCATTTTCGGTAAAAAAGCAGGAAAAATATCCAGGTCGGATTTTAGTAGGATAAG
ATCTGCGTTGGATCATGCGATGATAAATAATACACATACAGCATTTGCCAGATTTAT
CACTGAAAATCTGACGAGACTCAATCACAAAGAACATTTTCTGAATGTGACACGTGC
ATATTCTAAACCTGATTCTGAAAAATTGATACAACCGAGATACTGGCAGTCGCCTGT
AGTTCCAAAGGATAAACAAATATATTATAGCAAGAATGCGATTAAAAAATGGTGTG
GTTACGAAGATGATATTCCGCCTCGTTCTGTGATAGTTCAGATGTGTCTATTGTGGG
GGACTGATCATGAAGAGGCAGATCATATCCTTCGCAGTTCAGGATACGCGGCGCTTA
GTCCTGTTGTACTTCGAGATCTTATCTATATGTATTATCTGGATCATCAGGATTTGCA
AAAAAATGAGTTGATATGGGAAGTAAAAAAGCAGTTGGATCACTTCGATTTGACAA
ATAGAAATTATGATACAAATCCTTTTGATGTAGGGGGCAGCGTAAATGATCATATCT
GTGAACTGAGCGAGCATATAGCGAAGGCTCATTATATTTATGAGAGGGCTAAGGAA
GGACCATTGCAAAATGTAATTCGGGATATTTTGGGAGATACACCTGCCCTTTATTCT
GAAATGGCATTTCCTCAGCTAGCATCTATAAACAGGTGTGCTTGCAATTCGCTTTCTT
CATATCAAAAAAATATTTTTGATACTGACATAGCTATATATGCAGATGAAAAGGACA
CAAGAGGTAAATCAGACCGTATCCTTGTTGAGGGCGCATCTTCGAAATGGTATGAAT
TGAAGAAACGCGATGCTAATAATGTCAAAATTTCTGAAAAGCTGAGTATACTCAAT
ACTATTCTTAAATTTAATAGTGTTTTTTGGGAAGAATGTTACCTTGATGGAAATATAA
AACAATCGAGCGGAAAGCGATCTGAGGCAGGAAAAATTCTTTATGGTCGCGACAAC
GGAAAAGAAAATGTCGGAGTTTCAAAATTGGAATTGGTGCGGTATATGATAGCTGC
AGGTCAGGAACAAAATCTGGGAAATTACCTGGTGAGTTCAGGATTTTGGAGAAAAA
ATCATATGCTGTCATTTATACAAGGCAATGATATAGCGCTTGATGAGATGGATGAAT
TGGATCTCTTAGACTATATTCTGATATATGCATGGGGATTTAGGGAAAATATCATTA
AAAAGAACAGTAATGTGAATTCTTTGGATGAAAAGACTAGAAAAGTGCAGTTTCCG
TTTATAAAGTTACTCATGGCAATTGCAAGAGATATCCAGATACTTATATGTTCAGCA
CATGAAAAAACAGTCGATGAGTCATCTCGAAATGCAGCAAAGAAGATAGATATATT
GGGAAATTATATTCCTTTTCAGATTCATCTTCAGAGAACTAAAAAAGATGGTGGAAG
AGTGGTAATGGATACATTGTGTGCTGATTGGATTGCGGATTATGAATGGTACATTGA
TCTTGAGAAAGGAACACTTGGATGAGCAGTGATGAAAGGATATTTAAAAAATTTTT
GGAAAAAGGATCGATTTCTGAGCAGAAAAAGATGCTTTTAGAAGAAAAGAAATGTT
CGGATAAACTAACTGCACTGCTTGGGAATTACTGCATACCGATAGACAATATTTCAG
AGTCAGACGGAAAAATATATGCGGTCTATAAGCTTCCAAAAAATGTTAAACCTTTGT
CCGAAATCATTAATGATGTATCCTTTTCTGATTGTACGATGAGAGTACGTTTGCTTCT
CATAAAGAGAATTCTGGAACTCGTGTGTGCTTTTCACGAAAAAAAATGGTATTGTCT
CAGTATTTCACCGGGAATGCTCATGGTTGAAGATTTTGATATACCGATGGGAAATGT
CGGAAAAGTATTGATATATGATTTCAGAAATCCTGTTCCGTTCGAGTCAGTAAATGA
AAGACATAATTTTAACGTTTCAAATAAATACACTTCACCGGAGCTGCTCATCCATTC
AAGATATGACGAGTCGAAATCTGTGAGTGAAAAATCAGATTTGTATTCTGTTGCAAA
AATTGCGGAAACAATAATAGGAGATTTTAACAGTATTATTGCAAATGGAAATTTGAT
ACTACTTGCAATGCTTAGAGTTTTTATCAGTACAGGGAAAAGTCCGGAACCTGAGTA
TCGGTTTGAATCGTCGGAAAATATGCTTTCAGTATTTGAAAATTTGATCAAAGAAAA
TTGTTTTTTTGAAAAAAACGATTATACATCTATGTTTCATCAGGCGTATGACAATTTT
TTTGAATGGCAGGAATGTTTGATATCACCGGATCACTTGGATAAAAATATGTTCGAG
GCAGCTTTATCAAATCTTGAGGATCAGCTGCTTAGGGTTGATATTGATAAGTATAGA
GCAGAGTACTTCTATAAGCTTCTCCGAGAGTTGTCTAATAAATATAAAAATACAATT
ACTGATGAACAAAAGGTAAGGTTGGCAATACTTGGAATCAGAGCGAAAAATAATCT
GGGAAAAAGTTTTGATGCATTGGAAATATATGAGTCAGTACGTGATTTAGAAACTAT
GTTGGAGGAGATGGCAGAGCTTAGTCCTGTCATTGCTTCGACATATATGGATTGCTA
CCGATATGCAGATGCGCAGAAAGTGGCGGAAGAAAACATTATCAGGCTTCATAATA
GTAATATTCGTATGGAGAAAAAAAGAATACTGCTTGGAAGGTCATATAGTTCAAAA
GGGTGCAGCATGGGGTTTCAGCATATTCTTGGTGCGGATGAGTCATTTGAACAGGCT
TTATATTTCTTTAACGAAAAGGACAATTTTTGGAAAGAAATATTTGAGAGCAGAAAT
TTAGAGGACAGCGATAGACTTATAAAGTCTTTACGAAGCAATACGCATATTACGCTG
TTTCATTACATGCAATATGCATGTGAAACAAGGAGAAAGGAATTATATGGAGCACTT
TCAGACAAATATTTTATAGGTAAAGAATGGACAGAAAGACTCAAAGCATATATAAG
CAACAAGGATATATGGAAAAACTATTATGAGATATATATTCTGCTAAAGGGTATTTA
TTGCTTCTATCCAGAAGTCATGTGTTCGTCTGCGTTTTATGATGAAATCCAAAAAATG
TACGATCTTGAATTTGAAAAGGAAAAAATGTTTTACCCATTGAGTCTGATAGAACTG
TATCTTGCTCTGATAGAGATAAAAGTTAATGGGAGTCTGACGGAGAATGCCGAGAA
GTTGTTTAAACAGGCATTGACACATGACAATGAAGTCAAAAAAGGAAATATGAATA
TTCAGACCGCCATTTGGTATCGAATATATGCACTGTATAACGATGTAAAAGATGAAA
CTGATAAGAATAAAAGGCTTTTAAAACGGCTTATGATTCTTTGCCGACGATTTGGTT
GGGCGGATATGTATAGTGCTTTGGAGAAGGATGGGAAGTTAATTGATTTTTTGAGAT
TTGAGGTATGTTAAATGATAACACTTGCATTAGATGAAAATGGCAAATTTGAAGATG
CTTTTTCTAAAAAAAATGAAAAACCGATAATGATTGCGGGGATAATCTATGATGACA
AGGGGAAAGAGTATGATGCTGAGAATGAACGCTACAGGATATCCAGTTATCTGCGA
GCAGTATGTGACAGTTTGGGTGCGAAATACCCTCAGGATCTACATTCAAATAGTAAT
GGAAATAAGGCGACTGTTGGGAAAGTAAAATGTAAAATTGGTGAAACACTAAAGGA
ATTCTTGAGAGAAGGAACCTATGAAAAAAAGGAATTGCCGACAAAGAACGGTTATT
TAAATAAGAGATCTGGAAAATATGTAATGTTTGCAGAACTCAGGAGTAGTCAGGGA
GTTAAAAAGCGTGTTAGTGGTTGGAATGACAATGATCTGACTCAGGATGAAAAGGT
CAGCAATCTGTACCTTCATATGGCAGAAAATGCCGTTGTCAGAATGCTCTTCCATAA
TCCTATATATGAAGATGTAACAGATGTAAATCTCTATTTTCCCACGCGAAAAGTTGT
TCTGAAAGATAGAGATAGAGAATACGATAAACAAGATTTCAAAATATATGGTGATA
AGGACAAGTGCGAAGCAGAAAGCGGGAGATTGGTGCATTATGATATCGTGTCATCG
GATTTTTACCGTACGATAATGGAGAACGAATGTACAAGAATTAATAAAAAGCAATT
AAATGTTCATTATATGAACACAAGCCCAATTTCGTACTGGGAGAAAAATGAAAAAT
ATAATACATTTTTATATTTGGCTGACATAGTTTGTTCTATGCTGGATTATTACAAAAA
GGGTTCGAGTCCGGCAGAGTGGATGGATTCTTTTGCCGAATGGGGAAACAAATATTT
TGGTGATGATCAGATAATCTTATTTGGGTATGATGATATAGATGACAAATACATGGA
GGCTGTAGATGCAGTAGGACAGGGAGAGTATTTTCATGCGCTGGATATTATATATGA
TGCGGAATGTAGTGGAAGTGAATTTGAGAAGCACTACAAAGATTATTGGTTTCCAA
AGCTTATAAAAAAGATACGAATAACAGCAACTGTGGATAATTTATGCAGATCGATC
TCAGATCTGGAGAGTTTTACATATCGAAGTAATCTTGATCAGCAGAAACTTTTGTGG
ATTTTTGAGGAAATCAAAGCTATCGTCGATAAGGGAGATTTTGGAAAGAAATATCAT
ACAGATCAGGTTATGTTTGATATGTGTAATGCCGGTATTGCTGTGTACAATCATATC
GGAGATTTTGGGACTGCAAAGGAATACTATGATGAGTGCATGAAACACACTGGGGA
TGTGGATCTGGTAAAGATACTTCGTGCATCAAATAAAATGGTGGTCTTTCTTGACGA
TGCTTTTAGGTATGGTGACGCGACAGAACGTGCCAGGAAGAATGTTGAATACCAAA
AAGCTTTGCACGATATAAAGAGTGAGATTTGTCCGGAAAAGAAAGATGAAGACTTG
AACTATGCCATATCGCTCAGTCAATTTGGACAGGCGCTTGCGTGTGAAAAAAATTCT
GATGCAGAGAGTGTTTTCCTAGAGTCGTTGCGGCATATGAGGAAAGGGACTGCCAA
TTATCAGATTACTCTTTCATATTTACTCCATTTTTATCTGGATATGGGAATGACAGAT
TCTTATCGAGAAAAAACAAAGGACTATTTTGGAAGTGAAAAACCAAAGGAACAGCT
GAAAGAATTGCTGAAGTTATCGGGAAAGGATGATAGTATAGTTACTTTCAAATTTGC
AATGTATGTCTATTTACGTGCACTTTGGGTATTACAGGAACCGCTTACTGATTTTATC
AGAACAAGATTAGAGGACATACGTGAGACTCTTGTAAAGAAGAAAATGAGTGAACA
TATGGTTGGACATCCGTGGGAGTTGATTTATAAATATCTGGCATTTCTTTTTTATCGT
GATGGAAATTGTGAAGCTGCTGAAAAATATATTCATAAAAGTGAAGAGTGCTTGGA
AACACAAGGACTGACTATAGATGCGATTATTCATAATGGTAAGTATGAATATGCAG
AATTGTCAGGTGACGAGGAGATGATGGCAAGAGAGAAAGCGTACTTTGATGAAAAA
GGGATAGATAGAAAAAATGTTTGTACTTTTATGTATCATTGATGTTTAATAAGATTT
GACCGAGGAGTGACAGGTAATCGCCGGTATATCTGGTATTACCTGTCATTTTTTGAT
GAAATAAGCTACTTTTTGCCTAAAAAACGAAACTGTTGGTGTTTTATGATGATTGTG
TCAACAAAAGAGAGCAAAAGAAGAGGAGAAAAGTAATGTCAATGATTTCATGTCCG
AATTGTGGTGGAGAGATATCTGAAAGGTCAAAGAAATGTGTTCATTGTGGATATGTG
TTAGTCGAAGAAGCTAAAGTAGTGTGCACAGAATGTGGAACTGAGGTAGAGAGTGG
CGCTGCTGTATGTCCGAAGTGCGGCTGTCCTGTAAATGATAGTGAGACGCCTCAGAA
AGTTGAAGTGACTAGGGTAAATGTATCTTCCGTAATCAGCAAAAAAGTCGTTGTAAG
CATACTGATCGCAGTGATTACAATTGCAGGTTTTTTCTATGGAGTGAAGTATTCGCA
GGAAAAGAAAGCAATTGAAGAGTCAGTAAAGCAGAAGGAAGACTATCAAAGTACG
CTAGAGCTTGCTTCGCTAATGATGCTTCAAGGAGCTTCGGATGCAGAAACTTGTGGG
AATTTGGTTAGGAAAGTGTGGAGCAACTGCATTTATAAGGAGAGGGATGAAGAAAC
CGACAAGTATACGTGTGATAGCAGGGGTGCAGGATGGTTTTATGATGATTTTAATGA
TGCATTAATGGCTCTTTACAGTGACAGCAGTTTTGGCAAGAAGATAAATGAAATCAA
AAACGGTCAGGAAACCGTTGCGGCGATGATGAAAGATCTGAAAAATCCGCCGGATG
AGATGGCAGATGCCTATGAGGATATTCAAAATTTTTATGTGTCCTATCTAACGCTGA
CAGAAATGGTTGTGAATCCAACTGGAAGTTTGAGTTCTTTTTCATCTGATTTTTCCGA
TGCGGATACGGAGGTGTCCAATGCCTATAGCCGGATGAAGTTGTATTTAGATTAAAC
TATTGAGGAAAAAATGGAGGTGCTTTAATGCGGGGGAGAAACTGTGGAGGGTCATC
AGGCGACGGACTGCTGGTACTTCTCGTACTGCTTGTCCTTTTTTATAAAATCATGCCA
TTCATAGGTTTATGGATTTTAATTTTTGGTGATGCTGAACGTAAAGATCTGGGTATGG
GTATGATTATTGTCGGGATAGTTCTATATGTATTATTAGAGGTTTTTTAATGTGAGTT
TCTGTGGTAAACTATAAAAGTACAAGCTTTTGCGCCGCACCGCATAAATAGCGGATT
TATGACCATTATTTGGTGAAAAAAATGGTGTACACCTGTGTTTTTTTGTTTTGCGCCG
CAAAATGCGCCACGGAACCGCATGCAGAGCACCCTGCAAGAGACAGGGTTATGAAA
ACAGCCCGACATAGAGGGCAATAGACACGGGGAGAAGTCATTTAATAAGGCCACTG
TTAAAAGTTATGAAAACAGCCCGACATAGAGGGCAATAGACATAAAGACCAAAAAC
AGGTCATCTGCATACTGTGTTATGAAAACAGCCCGATATAGAGGGTGTGAGAGATA
TAGTTCTCGTCACAGTGCAGAAAATGACCTATTATGTGCCGAAAAACAAAATGAAA
AAAGAATGGAAAGGCGTATTTAATGAAATGCTGATCTGTTGATTTGAATTAACAAA
AAAAGGTCGCCCCACGGATGACAAAAACATCCGGGGGCGACCCTTTT >E-locus (SEQ ID
NO: 65) TACTGTGTGCATAAGTCTTCCTTAGATCCATAGGTACAGCAGTTTTATTTA
TTAGCCTTAGAAAATGGAAAATAGAGCTTATAAATGATATGATATTTATGAATAAAA
TGATTGCATTCTCGTGCAAACTTTAAATATATTGATTATATCCTTTACATTGGTTGTT
TTAATTACTATTATTAAGTAGGAATACGATATACCTCTAAATGAAAGAGGACTAAAA
CCCGCCAAAAGTATCAGAAAATGTTATTGCAGTAAGAGACTACCTCTATATGAAAG
AGGACTAAAACTTTTAACAGTGGCCTTATTAAATGACTTCTGTAAGAGACTACCTCT
ATATGAAAGAGGACTAAAACGTCTAATGTGGATAAGTATAAAAACGCTTATCCATC
ATTTAGGTGTTTTATTTTTTTGTGATTATATGTACAATAGAAGAGAGAAAAAAATCA
TTGAGGTGAAAACTATGAGAATTACTAAAGTAGAGGTTGATAGAAAAAAAGTACTA
ATTTCTAGGGATAAAAACGGGGGCAAGTTAGTTTATGAAAATGAAATGCAAGATAA
TACAGAACAAATCATGCATCACAAAAAAAGTTCTTTTTACAAAAGTGTGGTAAACA
AAACTATTTGTCGTCCTGAACAAAAACAAATGAAAAAATTAGTTCATGGATTATTAC
AAGAAAATAGTCAAGAAAAAATAAAAGTTTCAGATGTCACTAAACTTAATATCTCA
AATTTCTTAAATCATCGTTTCAAAAAAAGTTTATATTATTTTCCTGAAAATAGTCCTG
ACAAAAGCGAAGAATACAGAATAGAAATAAATCTCTCCCAATTGTTAGAAGATAGC
TTAAAAAAACAGCAAGGGACATTTATATGTTGGGAATCTTTTAGCAAAGACATGGA
ATTATACATTAATTGGGCGGAAAATTATATTTCATCAAAAACGAAGCTAATAAAAA
AATCCATTCGAAACAATAGAATTCAATCTACTGAATCAAGAAGTGGACAACTAATG
GATAGATATATGAAAGACATTTTAAATAAAAACAAACCTTTCGATATCCAATCAGTT
AGCGAAAAGTACCAACTTGAAAAATTGACTAGTGCTTTAAAAGCTACTTTTAAAGA
AGCGAAGAAAAACGACAAAGAGATTAACTATAAGCTTAAGTCCACTCTCCAAAACC
ATGAAAGACAAATAATAGAAGAATTGAAGGAAAATTCCGAACTGAACCAATTTAAT
ATAGAAATAAGAAAACATCTTGAAACTTATTTTCCTATTAAGAAAACAAACAGAAA
AGTTGGAGATATAAGGAATTTAGAAATAGGAGAAATCCAAAAAATAGTAAATCATC
GGTTGAAAAATAAAATAGTTCAACGCATTCTCCAAGAAGGGAAATTAGCTTCTTATG
AGATTGAATCAACAGTTAACTCTAATTCCTTACAAAAAATTAAAATTGAAGAAGCAT
TTGCCTTAAAGTTTATCAATGCTTGTTTATTTGCTTCTAACAATTTAAGGAATATGGT
ATATCCTGTTTGCAAAAAGGATATATTAATGATAGGTGAATTTAAAAATAGTTTTAA
AGAAATAAAACACAAAAAATTCATTCGTCAATGGTCGCAATTCTTCTCTCAAGAAAT
AACTGTTGATGACATTGAATTAGCTTCATGGGGGCTGAGAGGAGCCATTGCACCAAT
AAGAAATGAAATAATTCATTTAAAGAAGCATAGCTGGAAAAAATTTTTTAATAACC
CTACTTTCAAAGTGAAAAAAAGTAAAATAATAAATGGGAAAACGAAAGATGTTACA
TCTGAATTCCTTTATAAAGAAACTTTATTTAAGGATTATTTCTATAGTGAGTTAGATT
CTGTTCCAGAATTGATTATTAATAAAATGGAAAGTAGCAAAATTTTAGATTATTATT
CCAGTGACCAGCTTAACCAAGTTTTTACAATTCCGAATTTCGAATTATCTTTACTGAC
TTCGGCCGTTCCCTTTGCACCTAGCTTTAAACGAGTTTATTTGAAAGGCTTTGATTAT
CAGAATCAAGATGAAGCACAACCGGATTATAATCTTAAATTAAATATCTATAACGA
AAAAGCCTTTAATTCGGAGGCATTTCAGGCGCAATATTCATTATTTAAAATGGTTTA
TTATCAAGTCTTTTTACCGCAATTCACTACAAATAACGATTTATTTAAGTCAAGTGTG
GATTTTATTTTAACATTAAACAAAGAACGGAAAGGTTACGCCAAAGCATTTCAAGAT
ATTCGAAAGATGAATAAAGATGAAAAGCCCTCAGAATATATGAGTTACATTCAGAG
TCAATTAATGCTCTATCAAAAAAAGCAAGAAGAAAAAGAGAAAATTAATCATTTTG
AAAAATTTATAAATCAAGTGTTTATTAAAGGTTTCAATTCTTTTATAGAAAAGAATA
GATTAACCTATATTTGCCATCCAACCAAAAACACAGTGCCAGAAAATGATAATATA
GAAATACCTTTCCACACGGATATGGATGATTCCAATATTGCATTTTGGCTTATGTGTA
AATTATTAGATGCTAAACAACTTAGCGAATTACGTAATGAAATGATAAAATTCAGTT
GTTCCTTACAATCAACTGAAGAAATAAGCACATTTACCAAGGCGCGAGAAGTGATT
GGTTTAGCTCTTTTAAATGGCGAAAAAGGATGTAATGATTGGAAAGAACTTTTTGAT
GATAAAGAAGCTTGGAAAAAGAACATGTCCTTATATGTTTCCGAGGAATTGCTTCAA
TCATTGCCGTACACACAAGAAGATGGTCAAACACCTGTAATTAATCGAAGTATCGAT
TTAGTAAAAAAATACGGTACAGAAACAATACTAGAGAAATTATTTTCCTCCTCAGAT
GATTATAAAGTTTCAGCTAAAGATATCGCAAAATTACATGAATATGATGTAACGGA
GAAAATAGCACAGCAAGAGAGTCTACATAAGCAATGGATAGAAAAGCCCGGTTTAG
CCCGTGACTCAGCATGGACAAAAAAATACCAAAATGTGATTAATGATATTAGTAATT
ACCAATGGGCTAAGACAAAGGTCGAATTAACACAAGTAAGGCATCTTCATCAATTA
ACTATTGATTTGCTTTCAAGGTTAGCAGGATATATGTCTATCGCTGACCGTGATTTCC
AGTTTTCTAGTAATTATATTTTAGAAAGAGAGAACTCTGAGTATAGAGTTACAAGTT
GGATATTATTAAGTGAAAATAAAAATAAAAATAAATATAACGACTACGAATTGTAT
AATCTAAAAAATGCCTCTATAAAAGTATCATCAAAAAATGATCCCCAGTTAAAAGTT
GATCTTAAGCAATTACGATTAACCTTAGAGTACTTAGAACTTTTTGATAACCGATTG
AAAGAAAAACGAAATAACATTTCACATTTTAATTACCTTAACGGACAGTTAGGGAA
CTCTATTTTAGAATTATTTGACGATGCTCGAGATGTACTTTCCTATGATCGTAAACTA
AAGAATGCGGTGTCTAAATCTTTGAAAGAAATTTTAAGCTCTCATGGAATGGAAGTG
ACATTTAAACCACTATATCAAACCAATCATCATTTAAAAATTGATAAACTCCAACCT
AAAAAAATACACCACTTAGGTGAAAAAAGTACTGTTTCTTCAAATCAAGTTTCTAAT
GAATACTGTCAACTAGTAAGAACGCTATTAACGATGAAGTAATTCTTTTAAAGCACA
TTAATTACCTCTAAATGAAAAGAGGACTAAAACTGAAAGAGGACTAAAACACCAGA
TGTGGATAACTATATTAGTGGCTATTAAAAATTCGTCGATATTAGAGAGGAAACTTT
AGATGAAGATGAAATGGAAATTAAAAGAAAATGACGTTCGCAAAGGGGTGGTGGTC
ATTGAGTAAAATTGACATCGGAGAAGTAACCCACTTTTTACAAGGTCTAAAGAAAA
GTAACGAAAACGCCCGAAAAATGATAGAAGACATTCAATCGGCTGTCAAAGCCTAC
GCTGATGATACAACTTTAAAAGGAAAAGCAGTGGATTCTTCACAAAGATACTTTGAT
GAAACGTATACTGTTATTTGTAAAAGTATCATAGAAGCATTAGATGAAAGCGAAGA
GAGATTACAACAATATATTCATGATTTTGGAGATCAAGTGGATTCTTCACCTAACGC
ACGAATTGATGCGGAATTACTACAAGAAGCAATGAGTAGGTTAGCTGACATAAAGC
GGAAGCAAGAAGCACTTATGCAATCCTTATCTTCTTCTACAGCAACGCTTTACGAAG
GCAAGCAACAAGCGTTACACACTCAATTCACGGATGCGCTGGAGCAAGAAAAAATA
TTGGAACGCTATATTACTTTTGAACAAACTCACGGGAATTTTTTTGACTCATTTGGAG
AACTTGTCTATCGAACGGGACAAGCAGTGCGTGAATTAGCTAATAACGTCACATTCG
AGAGCCAAACAGGAAGCTATCATTTTGATAAAATAGATGCTTCTAGATTCCAAACTT
TGCAAGAAATGTTGCCAAAGGCAAAGAAAAAAGCATTTAATTTTAATGACTACCAA
ATAACATGGAATGGCACCACGCACCTTTTATGGAAAAATGGTAAAGTGGATGCAGA
AGCAACCAAAGCTTATAACGAGGCGAAACTGAATGGAAAGCTACCAAAGGAAGGT
AATGTAGCAACACAAGATGCAGAACTATTAAAAGGCATTTTGGCTTCACTGAAAAA
CAAGAAAGATCCTATCACTGGAGCAGATATAAGCAGTGTGCATGTATTATCTATCCT
TAGCGGGCTCGCATTCTCCTATACAGCTGGGAATTATAAGGGAAGAAAACTTACTGT
TCCAAAAAGTTTCTTAGACAAATTAAAGAAAAACCGAAAATCTAAAGTACCTAAAC
TATCTAGTTTATCAGAAAAACAACAACTAAAACTCGCAAATAAATACAAGAAAAAA
TCACCTATTCCAATTCCAGATGATGCTAAAATCAAAGCTCAGACGAAAAAGGCTGGT
TATGAACAAATATCTTATAAATGGAAAGAGAATGGGATAACCTTTGAAGTTAGATG
GCATACTAGGACACCAGGTGCACCAAAGGAACAAGGAAATACGTTTGTTATAGAAA
GAAAAATTCAGGGTACAGCAGAAGGGAAAACAAAAGTTCAACAAATATTGGTTGGA
GATAATAAGTGGGTGAGTAAAAGTGAGTGGCAAAAGGCTATAACTGATAAGAAAA
ATGGTGTAAGTACCTCGGAGCAAAATAAAATGTTGTCTGATGGACATTGGAAAGAA
TAGAAAGGAGCAAAATGATGGAAGATTATTATAAAGGTTTTGAGGGATATCCAGAG
ATAGATTTTTATACGTATATAGATGATATGAAATTGGGTATAGCAATGTGGGAAGGA
TACTTTGACAACATTATGAAAGAAATTAATCCAAGTAACGGAAGATGGACTTCATTA
GCGTATTATTATCATTTAGATGAGGGGTGGTATGATGAAAGTCCTTGGGAAATACCA
AGTAATACAGAAGCATTAGAATTATTGGAAACAATCCATATATCTAATCTAGATACT
ATCACACAAGAGATATTACTTAAATTAATAAATTTATTAAAGAAGAATATAAATAG
ACAAGTTTATATTGAATACTCATAAAAAAGATGATTATGATATATTATAGAACAAAC
GAACAAGCCCCAAATACGAGGTTTGTTCGTTTGTTTTCAATATAATTATTTGCCACCA
AGTGAGATATTACGGTTTTAAATAGCTTATTTGACGATACCAAACCCTGATAAGAGA
AAGAAGAAAGAGAAAGCTGGTGTAGTTGTTTTAAGTGAACTAGATAAAAAATTAAT
AGCAAAACTTGAAAAAGATGGTGTGAAAATATCAAAAGAAGATGTTATAGGAATAA
AATAATTGCCAGATGATGAGAAATCGTTTGGCTGGAAAAAGGAAATCCATCCGCTG
GATTTGAGCATATTCTTATTGAACATGGTGAACAATTTGCTAAATAGGGAATTTCAA
AAGCTGAGTTACCTGATTTTTTGATGACTGCTTTAGAAAAGGAAA >F-locus (SEQ ID
NO: 66) ATTCTTTAAAAATATCTAATAATTTATTTACTATATACTCTAATACATCTTT
TAACCTATCTAAAACATCATCACCTACAACATCCCAAAAATCATCTAAAAAGTTAAA
AAAATCCATCTTTATCAACTCCTATATCTATTTTTTATTGTGTAATTCCTGAGTTACA
AAACCATTATAACACGTATTACACACGTAGTCAATACTTCAAAAAAATTTTTTGTAT
ATTTTTTTGAATAAGTAAATAAAAAGAGCTGTGTAGCTCTTTATTAAAATCAATATTT
TTATTTTGTTAACAAACTTAGACAACATTAAATTTAGAAACCTATATATATTTCAGTA
CTTTTCATTTTTAGGTAGTCTAAATCAGAAATGGTTTTGTCTAAATGATGTATGTAAG
TTTTAGTCCCCTTCGTTTTTAGGGTAGTCTAAATCAGAAGTCATTTAATAAGGCCACT
GTTAAAAGTTTTAGTCCCCTTCGTTTTTAGGGTAGTCTAAATCCCATCCAAATTATGG
GATAATATGTTACTTTTTATTTTAATATTTGATTATTTATTGTTTTTTTACTGATTTAG
ATTACCCCTTTAATTTATTTTACCATATTTTTCTCATAATGCAAACTAATATTCCAAA
ATTTTTGTTTCTTTTCTTATGATCTTTTCTCCGATAGTTATTTCTCCAGATAAGATTTT
CATTTTTTTGAATTGATCTTCTGTTAGAATTAATGTTCTTACTGATGAATTTTCTGGA
ACTATCATTGACAACTGATTTTCATAGGAAATTATTTTTTCTTTTGTGCTAGAACTTA
CAATGTATACTGATTTTTGTACCTGATAATATCCTTTTCTTATAATTTCTTTTCTAAAT
TTTGCATATTCTTTTTTTTCTTTTCCTGTTTGCATTGGAAAATCATACATTAGAATCCC
TACATAATTAGTACTCATAATCCTCTATCCTTAACTCAGGAATTTCTACTTCTGACAT
TTCTCCTGTAAAATAATTTCTAATATTATCTAAAAAATAATCAATCACTTGAGCCAAT
TCATATTTTTTATTTTTCCAATAAACTTTTTGTGTTAATACCAATAACAATTTTTGTCT
TAATGATTTATTCAAACTTACTTCTTCCTGTTGATTAAAATATACGATATAATCTACC
ATTGGACGAAATATTTCAATAATATCATCTGCAAAATTATAATTATTAAATTGTGAA
CTGTGATGTATTCCCAAACTTGGATGAAATCCTTTAGCCACAATTTTTGAAGAGATT
AAGCTTCTCAAAACCATATACCCATAATTTAATGCCGAATTTGTCCCGTCTTCACCA
AATCTCTTAAATTTTTTCCCAAAAAGTTCACCAAAATACATTCTTGCAGCAATTGCTT
CCTGATGTTCCGCTTCTTTTCCTTTTAATCTAATATTATTTTCATATGCTTCCAACTTA
TATGATACTTCCTGAGATTTTTTCAAAAACTGCAATAAATTTCTTTGATTTTCTATTTT
TCTCATTACAATTTTTCTCCAGATTTCTTCTTTTTTATCGTCAATCCAGCTCACTTGCT
CATTAATTCTTGTTGTTACTTGAAAATGATTATACAGTCCTAATGAATGTAAAACTG
GCTGATGTTTTTCATTACAAATTATCAGTGGAATATTATGTTCTGATAATCTTAACTG
TAATATTCCGCTAATTTTACATCTGCAATTTTCAACTACAATTGCCATGATATCATTT
AAAGATACTTTATCAGCCTTATTTTCATCATCTTCATTTATCATCACAAGCTGGTTAT
TTAAAACTGATAATTCATTGACTCTTGTTACATGGATAATATTAGACATTTTTATTAC
TCCTTTACTCTAAAGCTTTATATTCAAACATAACTTTCACAAGTTCACACAATTCTTC
TGAATTTCTATCAGTCATTAATTTTTTCTTTTTTAAATTTTTCAAATGTACAATTTTTT
CCGATTCTAAAGTCTGAATTTCTATTTTCTTATCTGCTCCTATTTTAAATGTTGCTACA
AAACCATATTCCTTTAATATATCCACTATTGATTTCATAATTGCATTTTTAAGTTTTCT
ATCATAAGAAAGTAATTTTCTTAAATTTTCCAGCACTTCTAAAAGTGAAATTTCAGC
ATGCGGAATATAGTTAAAATGTGCAATATAGTTTCGTATATACAAATCTTTTTTCTCT
TGTTTTAATTTTTTTACTTTTTTATCAGAATAGATGCTTCTTTTTTCTACATTATCTTTG
TATAATTCTTTATAAAAATTTATATATTTTTCAACAATTTGCCCACTTTTATATTTTAC
ATTTTTACTGTTATCAAAATTAAATATTTCTTCAATATAATGATTTTCAGGAAATTCA
CCTTTCAATCTAAATCTTAAGTCCCTTTCCCAGATCGAAGTATATCCCACAAGTCTGT
GGAGTATTTTTAATAACAAGCCTTGCAACAAGTTTAATTCATTAAATTCCACTTTATT
TTTCAAATGAGTATATTTTTGTATATTTCCAATTGCTTTTTCATATTCTTTATAATCTT
CATCATTAAATTTTTCATCTTTTTTAGGTCTTGCATATTTTCTATGTAAATTTTGCTGC
ATTGTATAATTTTTTTCTATTTCATTTTTTTTATTGCTGTATTCTTTCAATTCTTTTAAA
CTTATTTTATACTTCGCTTTATCAGCTATTTTTTCAAGTAAATTTAACATCCCATATTT
TTTTATATTATAAAAAGCTCTATGCTTTATAATATTTTCTCCATCAAAATATATTTTAT
TTGTGTCAAATTTCTTCAATTCTTTCCTATCTTTTATTTTATTTTCATTAAAATCTAAA
AATTTTCCAATTTCATTCGCTTCTAATTCAAAATCTTCTGTTACTCTATTATTATCTAA
ATTTAAAAGATTTATAAGTTCAAGTTCATCTGAAAAAGTTTCTTCTTTATTTGCACTC
TGATATTTTTCAAGACTTCCCTTCAAATTAGTCAATTCTTTATGATTAAGCAATTTTA
AAATTAAATAAAACATATTCAAATTTTCAGTGTATTTTAATATCTTTCCTAATTTTAT
CTCTCTTACAAATTCATTTATTTCATGTGGAATTTCTTTATTCCTATTATGTTTTTCAT
AATTTTTTAAAATTTTATCATATTTTTCTTTATTATCTTTTTTTATTTTTATTTTAGAAA
ATATATCATTATTATCATTGTTATTATTACTTTCTATATATTTTAAATTATTTTTATTC
AAATAATCTATAAAACCTTTTAAAAATATTTGTTGTATAAAATCAATGTATGTATTTT
TTTCTTCTTTATCTTGATTATTAATCATCTCCCTACTTTGTATAATAGCAAGATATTCT
ACTGGTACAGTTTTTTCTATATTTTCAAATTTTTGATATTTATAATGTCCTGTTTTTTG
ATTTCTTTGTTTATTTATTTTTATTACTTCATTAGTTATTTTAAAAAAAACTTTACTAT
TTTTAACAAATTTATTAAGAAATTCACCATAATAAATATTTTTCAAAAGATATATTTG
AGCATCTTTTTCTTCTTTATCCTTAGGAACACTCCAAAAAAATTTTAAAGTATTTCTT
AAATCTTCTATTTTATTATATAATTTCGTAAAAGAAGGAACAAAAGGAATATTCTTA
TTTACAAAATTAAATTTTGTATTTTTTAAATATTTAATTATCACATCCTTTTCATAATA
ATTAAATACATTTGCACTATTTAACTGCTTAAATATCTTCAATTTCAATTTTTTCTCAT
TTATTTCATTTTGAAACATTTTTTTTGAAATTTCAGAAGGAGCTATATTTTTAAATGC
AAATATATCTTTCCCTTCTAATTCCAAATTAAAATGCACAATCCCATGTCTAATACTG
CTAATAGCTTCATCAATATTTGCAAAAAAATCTTCTATCTCATTTTTATTATCCATAT
TAAAATCATAACTATAGAACATTTTTAAATTTTCTTTTACTTCATTTTGCTTGTTTTCA
TTATATATTTTATCAACTTCTCCAGAAACATATTTTTCTTCGCCCTTATTATTTTTTAC
AGTTTTTCCTCTCATTCTACCTGTAATATCATTCTCATTTTCAGTTTCAAGAATATTTC
TCAATGAAAAATATGCAACCGAAGAAACTCCAATTATATTTCGTAAAAATGCTTCAT
TTTGTCTATTCCTAGCAATAAAATCACTTGTTGCAATCTCTCCAACTTGTAAATAATA
ATTGTATTTCCCACAATTTCTTACATAAGTATCCAATTTATTTAGTAATTTGTTTTCAA
TTAATTTTTTTAAATTTTGATATTCAAATATTCTCTTAATTTTATCGTTACTTATGTTA
CTCAGTCTTTTATACACATAATTTTTCAAAAGCTGACTCATTTCAATTTCCACAAAAT
GACAAAAAGCATATTTTATATTTTTATCATTAAGTTCTTCTTTATCCAAATAATATTT
ATAAAACACTTGTGATTTTTTTAATTCACTCATATCCGGAATTTTTTCAATTAATTCTT
TTATATTATTTACATTTTGTATTTCTTCGTAAATAATTTTAGCAAAATTTTCTTTATCA
TTTTTTCTTCCAATTATTTTGTGATAGTATTCTCTTATTTTATATTTTTCATGTTTTTTT
GAATTTTCTATTAAAAAAAATAACTTCTCAATATCTTCTTTTTTATACAATTTATCAA
ATGCTTCCTGTACATTATTTATATAATCATTACGCTTTGCTGATTCTCTATAATAATC
ATAAATAATATTTCTTTTGCTCTTCCCTCCAACTTTTTCAACATTATTTTCATTAATTT
TCTGATAATTAGCCTTATTTTCTTCAAATGAATATTTTAAAGAATTTATCTTATTCAA
TTTTGCCTCAACATCTTTTCTAAATATTTCTAATTCTTCAGAGTTCACATCTTCATTTA
ACAATATTTTCTTTAAAACTGAAAAACTATTTTTATTTTTTAAATCATATTCTGAAAT
ATCTTCTTCAGAATAATTTTTATCCTGTACTGCATTTTTCTCTTTCCTATTCTTTAAAT
ACAGAACACTATCTTTTAGATGCAATACTTTATTTGAAAAAAACTTTTTTAAATTTTC
TCTTCTTATTCTATTTTCTTCTTCACTTGCATTATCAGGATTTTTTATATATATATCCA
GTCTTATACTTAAAAGCTCTGACAATCTCTCACTAGTCCTATTTTCTTCGCTCGTACT
TTTTACTAATTTTCCCTCTTCAATATATTTTTTATGCGAAATTCCATCAACTTTTGTAA
CTTTCATATATAAAAACCTCCTAATATCTATATTTTTTACTCAATACCTAATTCTTTTT
TCAATGCTTTTTGTAAAATTTGTGAAAAATTCAGATTTTTTTCCTGTGCCAATATATC
TAACCAAACAGGAATTGTTAAAGTTTTCTTTTTAAGTGCATTTGTAACTTTTGCCACT
TCATACACTGGATCAACAGATAAAATATACAAATACTGATTTTCTTTCAGTTTCACA
TCCTCCACTTTTGAAGGCTCAGGAAATTTTTTTCTTACATCCAAAAAATCAGCCAAAT
GCAGACCCAATGTCTCTCTCAAATTGGAAACAGCCTCCTCCATGCTATCTCCAAATG
TAGCATAATAATTTATCTCTCCATCTTCAAACTTATCAAAATCAACAATACAACCAT
AATAAGTCCCATCTTCCTTAGTTACCACTGCTGGATAAAATACATCCATTTTAATTAT
CTCCAATCTATACCACGTGTTAAATACGTGTTTAAAAATATTTATAAAATTTTTTAGC
ATCTCTGCTAAAATAAAACAATTATTTCAAATTTTTCTATTCCTTAATCACTCATTGT
TAGTGATTCTTTTTTTACTTGGACAATTTTTCATTTAATTTCTTCAATTTTTTTAAAAT
CACATTTTTTTAATATTCCTTATTTAATTGCAAATTTTCATTACTTTTGGGGTGCTCTA
AATCCCATCCAAATTATGGGATAATAATTTTTAGTGAAAGCAAGAAGGGACTAGAA
TTTAATCCCAACTTGTTTTTCAATACTTCTTAATGTTCCTACAGGTATATCTTTTGAAT
ATGGTACTGTGACCACACCTTCCACACCTGGGATCATCCATTGATAATGACTACCTC
TTATACGCACAACTTTTCCGCCTAATTTTCTAAATCTTTTTTCGAT >G-locus (SEQ ID
NO: 67) CTTTCTATCTTTTTCAAATAAAATTAGGCTCTAGTTAGCCTAATCGCATAA
TTATTTATTATAGTATAATTCTTATTTTTTTTCAACCTAAAAATTTAAAACATCTCCA
AAAATTTTCGTTTCAGAACAACCAAGCAACCATATTCAAAAAACAATAAAAAATGA
GCAAGAATTGAAATTTTATTCTCACTCAGAAGTTATTTTTATTAAATATCACTTTTCG
ATATTGGGGTGGTCTATATCAATTTAAAAGACAGAATAGATAATTCTTTAGAGTTTT
AGTCCCCTTCGATATTGGGGTGGTCTATATCAGAAGTCATTTAATAAGGCCACTGTT
AAAAGTTTTAGTCCCCTTCGATATTGGGGTGGTCTATATCCCATCCTAATTTCTTGCT
GATGAGATATTTATTTCTAATTTTTCTATTTTGTCTTTATTTTCAATACTTTCAATCCT
ATTTTTCTCTTTATTAATAATATAGAACCACCCTATACTATTATACCATATTTTTTGAT
TTTTCAAAATTCCAATATTTTGTTTTGTGAAATTTTTTCTCCCATTGTCACTTCTCCTG
CAAGTACCTTCATTTTTTGAAACTGATCTTCTGTCAGGATAATGGAACGGATTGATG
AATTTTCTGGAGCGAGCATTGATAACTGTTTTTCTGCCAGTTCGATTTTTTCTTTTGTT
TTCGACCTCATTATATATACCGATTTTTGAAGCTGATAATATCCCTTTTCTATCAATT
TTTTCCTAAAAGTCCTATATTCAAATCTCTCAACATCTGTCTGCATAGGAAAATCATA
CATAAGCAGACCAAAATACTCAATACTCATAGTCCATCACGCTCAATGTCGGAATTA
TCACTTCTTCATCTTTTACAAAATAATTTCGTATACTATCCAAATAATAGTCTACCGC
TTGGAAAAAATCATATTTCTTATTGTTAAATAATACCTTCTGCTGTGCTACAAGAAGT
ATTTTTTGCCTTATTTCCTTACTTAATTTCACTTCATTCAAAATATCCTTGTACATATA
AACAAGATAATCCACCATAGGACGAAAAACCTCTATTATATCATCAGAAAAATTAT
AGGCATTAAACTGTGACTTATGATGTAATCCTAAACTTGGATGAAATCCTTTTGCTA
CAATCTTTGATGATATTATAGCTCTTAAAATCATATATCCATAATTAAGTGCAGAATT
CACTCCATCTTCATCAAATCTTTTAAAACTATTACTATACAATTCCTGAAAATATATC
CTTGAAGCTATTGCTTCCTGATGTTCTGCACTCGCATCATCTTTTTTCAAGTTTTCCTT
ATATGTTTTCAGTCTTTCAATGGAAATATCACTTTTTTCAAGATACTCTAACAATGCT
CTTTGATTTTCAATCTTATTCTCCACTATCCTGCTCCACAATTTTTCCTTTTTCTCTTTT
TCCCACTCAATCTGCTCATTTATTCGTAAAGTCACTTGAAAATGATTAAATAATCCCA
GCGAATGAATTTCAGGCTGATGTTTCTCGTTGCAAATAATAATCGGAATGTTATTTTC
CACCAGCCTCAACTGCAAAATCGCACTAATCTTACAATAGCAGTTTTCAATAACTAT
CGCAGATATATCATTCAAAGAAATCTTATTTTTCTCATCATTATTGTCTTCATCAACC
ATTATAAGCTGATTATTCGATATTGACAAATCATCAGCCCTTGTTATGTGAATTATAT
TGGGCATTTTAATCATACTCCTTATAAATTTCATTCTTATAACGTATCATTCGTATTTT
CTATTTTTGTTAAAAGTTCTATTATCAAGTTTTTAATATAATCAGAATTATAACTTTC
TAATTCTAAAACAGAAACTTTTTTAGGTTTCATTAATCTTTCAAGTATATCATTATTA
CCGATAAGTTTAAATTTTTTCTTTAATTCATCATAATCTAAATTCACATCTTTTTTAAA
TACTTCAAATACACTTGCATAAGTTGAATTATTATAACGTGTACTATATGATAATAA
ATTAGAAACTCTATCAATTTGTTCTGCAATACTGTAATCAGCAAACGGATTTCTTAC
AATATAGAAATGTGAAATATAGTTTCTAATACTTTCATTTTCCGGCTTATTAATTTCA
GAATTTTCAGACAAATCAATTCCAAATCCATAACATATTTTCTCAAATTTTTTATAAG
ATTCTTCATCAAAAAATTTATAGTATGCTGTTGTTGTATAAAAGCCATCAGATCCATT
ACGCTTAGGATAAGCTCTACTTATTCCAGTATTGTAGCCACTTAACTTAATAATTCCT
AATTCTCTTAGCCCATTTACAATATAGTGCATATCTCTTTCAAATCTAGCCATTTGAA
TAGCAAGTTTCCAATTTATATCTATCAAATAACTTTCTATTTTATTCAAATAATTAAA
TTCTACCAAATCTCTAATTTTTTTGTATTCAGAAACTCTATTATAATCTTTTTCAAATG
ATTTATAGTTTTTATTTTGTATATTTTTTGCAAAAAAGTCATCATTTTCTTTCAATTTT
TTTATATACTTCTCTTTGTATTCTTTAGAATATCCATTTAGTTTATCATTTAGATTTTT
CAATATTGCATCAATTTCAGATATTTTATTTTTTCTAATATTTTTACCATCAATATTAA
ATAAAAATTTTGCATCAGCCATTTTAATATCATTTGAAATTAATCCATAAATTTTATC
AAAATTTGGATTTCCAATATTTAAAAATAAATTCTTTTTATAAATATATAATTCATTC
TTACGTTCTTTAGGATAATATATTTCTTGAAATTTATTTTCATTCTCTGATTCCATATC
TTCTATTAAATTATCTATTTCTTTTTTGTATTTTTTTAAAAAATCAGAATTAAATATTA
TTCTACACAATATTTTACTCTTTATTTCCTGATCTTTATCTTTTATATACTGATCAACC
TTTTTTTTCAAATCCTTTTTATTTATGTTTGATAACTTTCTTTGTTCATCTTGTAATATA
TTCGATTTTTTATCTATCTCAAATTTAGTTTCATCATCAAAAATTACAATTTTTTCTAA
TTTTTTCTCTAAAACATCACAACCATTAATATCATCTTTAAATTCAGTTAATATATTA
TTTTTTATATCCTCATAATAATTATTAAAAATTTCTTTTTTAGTTTGTATTTTAAAATC
ATCAAAGTCTTTTTCTATCTCTTTCATTTTTTGAATAAATTCTTCTAAATTAAGATTCC
AATTTTCAGTTATACATTCATTTCTCAAAGTATTTAATTGCATTATTTCATCTAAAAT
ATCTATAATATTTTGATATTCTGAAGTATTTAACCAAACTGATGTTGCAAAAAATCT
ATTTCTAATTTTATTTATAACCGCATTACTATTTAACAGTGCAAATATTGAAATTATA
TATTCAAAATCATCATTTATTACTATAGTTTTATCACTAGTCTTTACAGTTATTCTTTC
GTAAGTTTTATTATCATTAATGTCTTTTATTTGTTTCTTAATTTCTTGAATATTCATTT
TAAAATCTGAAAAATCAAAAAGTTCCTCATAATTTTTTCTCAAATATCCAATATAAC
ATTCTATTACTTTTTTCTGATATTTTTTAATAGCTTTATTATTACCTTTTGAAGCAGAA
ATCTGAGCATTTTTATAATAATTTTCTATAATATTTTCATCTATTTCATCAATGTTTCC
TAAAGTTTTCTTTAATTCTTGTAAAAATATATTCTTACTTTCATTTTCTTCTAAATCAT
CTTCTAAAATTAATTTCTTATACAATTCTTTATTCACATATATTAAAGCATTTAATAC
TATTTTTTCTGTTTCTATAGTATCAAATGGTTCATTCTTAGGATTATTCCTATATAAAT
TTAATATTTCAGGAAGTACTTTAGAAAAGGATGGTAAATATTTAATATCATTATTAT
TTTCTTCTGAAATTTTAATATCATTTATTTTAGTAATTATATTTTTTTTATCTTTAAAT
ACTACATCTAAATTTAATGCTTTTGACACTTCTTCATCTGATATTTTTAAATTTTGAAT
TATATTTATGACTTTATTATAGTCATCTTGCGTTCCTTGTAAATCTCTTTCCTTGCTAA
TCGCATGTAATATCCTGTTTCTTTCATTTGTTCCTATCTTTGTAAATTTCCTAATAAAA
TTATTTGTAATGTTATTTTTATTATCTATAAAATCTAAGTCTCTTATTATTTTTATTTTT
GAATTTAAAATTTTTTTATCAAGTACGTAATTTTTTTCTCGATCTCCTCCAAAGAAAT
CTATATTTTCATCATTATTTATATTTTCTCTAGAAAAAATCTTATTTAATTCCATATTG
GTAGAAGCAAAAAAAGTAATCAATTCTAAATCCAATTCCTCTTTAGCGTGAAGTCTA
GAAAAATCATCAGTATTTACTGTTGTCATATCTATATCATTATGTCTTAATTTCCCTA
AATACATAATATGCTCTAACGTATATTGCTTAACTCTTTTTAAAATTTTTTCAGATAA
TATACTTTCATTTAAAATTTTTTCTATTTCTATTTTTTCCATTTTCTTTAATCTGACTTT
TTGTTCATTTACCAATATTTTTTCAATTCTTCCTTTCAAATATCGATATATGATTTTAT
ATAGTTCTTTTTCTTCATCAGATTTCTTTGAAAATTTTTTCGAATCAAAATTAACTTTA
TAATGTTTTTTAAATATTCCAAAAATTTCTGTATCACAATTTCCTTTTTTTAGTTCTTT
TTCTAATTTTTTTATTAATTCATCTATTTTAAATTCTGCTAAAATTTTTTCTATTTTTTC
TTTTATACTATTATTTTTTATATTTTCTACAAAAAATTTTACAATTTTATCTTTTTTATT
TTCTCTTTCTATTTTAAATTTTTCGTGCTTATCTAATAGTACATAAGATTTTATATATG
TTCTATTTCTTCTCTTTTCAAGAAATTCATTATTAACTTTTTTTACTTTTTCAATTCTTT
TAGTAATATTCCAAAATTCTAACTCTTTTATAACAAAATCAGCTATATCTTCTACTGT
TAAATCTACATTTATATTTAAAATTTTTTCAACAAGCATTTTTTTATTTTTAGATTTCT
TTTTATCACCACCAACATTAAGATAAAATTTTACAAAACCCAGAATTTCTAAATTAC
TTTTTATTTTTTCTCTTATTTCCATAAAATTAGTCAAAATAACATCTATTTTATCATCT
TTCAATAATTTTTCTCTTAAATGTTCTTCATAATATCGATTTTCAAATACTTTTTCTGT
TTCATTTTCAATTATTTTTTCTATAATCTTATATAAACTCATGTTAATATTTTTAAAAA
TTTCGTAAATTGATTTTTTTGTTTCTAATTCATCATTTTCTATTATTCTTAATATTATTG
AACAATCATTTAGTGTTTTATTAGTATACTCATCTCTGATATCTATCTCTATTTCTTCT
TCATTCTCTTGTCTCTTTATTTCTATTTTTTTATCATCTTTAGTTATTCCTTGCCTAATT
GCTTCATCTATTATTTTCTTTTTTGTAATCCCCAATGCTTTCAATTTCTCAGATTTTCC
ATATGCTTCTATATATAATACAACTTCTTCTGTTTCCAAAAAATCATCATTATTTTCT
ATTCTTATGATTCCTTCTTTACCTTTCAACTTAAATAGAATATTTCCTGCATGAAATTT
TCTTGTAAATTCTTTAAGAATATTATCATTTTTTTTGTAATTAATATATTTTCTAATAA
ATTTATTATTATCAATTTTTTCTTTATTATTATTTTCATTAATATTTAAAATGTATTTG
TTTCCATCATAGTTCCTTTTAACTTTTACTTTCCGTTTTATTTTAAAATCTTTTTTATCA
CGAACTTCATACCATCTCTTATGTCCAAATAAATTTCCCATTCCAATCTCCTCGTTTC
TACTTTAATCTAATAAAATATTTTTAAATTAAATCAATTTTACATCTTTCTAATCAAA
AATACAATTTTCCATTTTTAGTATACCACATCAATATTAAATCTCAAAAAAATAAGG
AGCCGTCAAACATAGCTCCCTACTTCTATTTACTCATAATCCCCATCTATCCTTACTT
TTCGTAAAATCAATCCTTCTTTCGCCTTTAGATCCAACTTAATTTTCCCATTTGAACC
TGTTCTAAATGTTCTGCCTTCTGTTACCAAATCAATAAATCTTTCATCCTGATAATTT
GTTTCAAATTCCACATTTTCCCAGCTGTTAAACGAATTATTTATTACAACAATAATTA
AATGATCCTCGATTACTCTTTCATACACAATTATTT
Example 3: Further evaluation of C2c2p and associated
components
[0994] Applicants isolated both C2c2 loci from Carnobacterium
gallinarum (FIG. 46) and have studied domain structure and
organization as well as expression of the CRISPR array. At the
first C2c2 locus, there is low expression of the two CRISPR arrays
in the direction of the C2c2 gene. (See FIG. 47). The second locus
also has low expression with direction of transcription in the
direction of the C2c2 gene. (See FIG. 48). Applicants determined
that both loci may have minimal expression since neither locus has
associated Cas genes (Cas1/Cas2). Such associated genes may be
needed for a functional CRISPR locus. Applicants have optimized
methods to obtain C2c2 loci from other bacterial strains.
[0995] Applicants perform RNA-sequencing on the following strains
that are grown: Clostridium aminophilum DSM10710, Carnobacterium
gallinarum DSM4847, Leptotrichia wade F0279, Leptotrichia shahii
DSM19757, and Rhodobacter capsulatus SB 1003.
[0996] Applicants design pACYC cloning from the following sources
of DNA. Applicants clone the entire C2c2 locus into this backbone
for DNA/RNA cutting experiments in E. coli.
1) Isolated genomic bacterial DNA: Lachnospiraceae bacterium
MA2020, Lachnospiraceae bacterium NK4A179, Lachnospiraceae
bacterium NK4A144 2) From growing the strain: Clostridium
aminophilum DSM10710, Carnobacterium gallinarum DSM4847,
Leptotrichia wade F0279, Leptotrichia shahii DSM19757, Rhodobacter
capsulatus SB1003
[0997] Applicants design PAM bait libraries for DNA cutting to
evaluate the cutting ability of the C2c2p effector protein.
Applicants design RNA cutting experiments based on the cutting of a
resistance gene transcript.
[0998] Applicants test for function in mammalian cells using U6 PCR
products: spacer (DR-spacer-DR) (in certain aspects spacers may be
referred to as crRNA or guide RNA or an analogous term as described
in this application) and tracr for following strains:
Lachnospiraceae bacterium, Listeria seeligeri serovar 12b,
Leptotrichia wadei, Leptotrichia shahii. Applicants mammalian codon
optimized the DNA encoding the C2c2 protein and cloned it into a
plasmid from Genscript.
[0999] Applicants analyzed a representative C2c2 locus, i.e., the
Listeria seeligeri serovar 1/2b str. SLCC3954 C2c2 (LseC2c2) CRIPSR
locus. Applicants performed RNA-sequencing on the L. seeligeri C2c2
locus which was cloned into E. coli. The LseC2c2 locus was
synthesized by Genscript into a pET-28 vector. Cells harboring
plasmids were made competent using the Z-competent kit (Zymo). E.
coli containing heterologous constructs were cultured in Luria
broth supplemented with appropriate antibiotics in suspension at
37.degree. C. and 300 rpm. The bacteria were grown in aerobic
conditions and harvested in stationary growth phase.
[1000] RNA was isolated from stationary phase bacteria by first
resuspending the bacteria in TRIzol and then homogenizing the
bacteria with zirconia/silica beads (BioSpec Products) in a
BeadBeater (BioSpec Products) for 7 one-minute cycles. Total RNA
was purified from homogenized samples with the Direct-Zol RNA
miniprep protocol (Zymo), DNase treated with TURBO DNase (Life
Technologies) and 3' dephosphorylated with T4 Polynucleotide Kinase
(New England Biolabs). rRNA was removed with the bacterial
Ribo-Zero rRNA removal kit (Illumina). RNA sequencing libraries
were prepared from rRNA-depleted RNA using a derivative of the
previously described CRISPR RNA sequencing method (Heidrich et al.,
2015, Methods Mol Biol, vol. 1311, 1-21). Briefly, transcripts were
poly-A tailed with E. coli Poly(A) Polymerase (New England
Biolabs), ligated with 5' RNA adapters using T4 RNA Ligase 1 (ssRNA
Ligase), High Concentration (New England Biolabs), and reverse
transcribed with AffinityScript Multiple Temperature Reverse
Transcriptase (Agilent Technologies). cDNA was PCR amplified with
barcoded primers using Herculase II polymerase (Agilent
Technologies).
[1001] The prepared cDNA libraries were sequenced on an MiSeq
(Illumina). Reads from each sample were identified on the basis of
their associated barcode and aligned to the appropriate RefSeq
reference genome using BWA (Li and Durbin, 2009, Bioinformatics,
vol. 25, 1754-1760). Paired-end alignments were used to extract
entire transcript sequences using Picard tools
(broadinstitute.github.io/picard) and these sequences were analyzed
using Geneious 8.1.5.
[1002] The Applicants observed a high level of expression of the
locus and the formation of small crRNAs with a 5' 29-nt DR and
15-18-nt spacers (FIG. 49A). Although the LseC2c2 locus contains a
predicted putative tracrRNA (FIG. 15), the Applicants did not
observe its expression (FIG. 49A). These findings suggest that the
secondary structure present in the pre-crRNA of the LseC2c2 locus
could be sufficient for processing yielding the mature crRNA as
well as crRNA loading onto the C2c2 protein. The RNA-folding of the
processed crRNA shows a strongly predicted stem loop within the
direct repeat that potentially could serve as a handle for the C2c2
protein (FIG. 49A).
[1003] The Applicants also expressed the Leptotrichia shahii str.
SLCC3954 C2c2 locus in E. coli and analyzed its expression using
Northern blotting. The procedure was performed essentially as
described in Pougach and Severinov, 2012 (Methods Mol Biol, vol.
905, 73-86). E. coli BL21 AI cells were transformed with the
plasmid pACYCduet-1 containing under inducible T7 promoter
Leptotrichia shahii cas operon and plasmid pCDF-1b containing the
minimal CRISPR cassette with a single spacer. Total RNA was
extracted from 5 mL of E. coli cells induced with 1 mM
arabinose/0.2 mM IPTG and grown until OD.sub.600 0.8-1.0. The cells
were lysed by 5-minute treatment using Max Bacterial Enhancement
Reagent followed by RNA purification with the TRIzol reagent
(Thermo Fisher Scientific). 15 .mu.g of total RNA were separated on
a denaturing 8 M urea-12% polyacrylamide gel and
electrophoretically transferred to Hybond-XL membrane (GE
Healthcare) using a Mini Trans-Blot Electrophoretic Transfer Cell
(Bio-Rad). The membrane was dried and then UV cross-linked. ExpHyb
hybridization solution (Clontech) was used for hybridization
according to manufacturer's instructions for 1 hour at 40.degree.
C. with .sup.32P-end labeled oligonucleotide probes. The Applicants
found that the CRISPR array is expressed and processed into 44-nt
crRNAs (FIG. 49B). The expression and crRNA formation was thus
demonstrated herein in at least two distinct C2c2 loci using
independent methods.
[1004] The Applicants sought to predict potential tracrRNAs for the
rest of the identified C2c2 loci by searching for anti-repeat
sequences within each locus. In many CRISPR-Cas loci, the repeat
located at the promoter-distal end of the CRISPR array is
degenerate and has a sequence that is clearly different from the
rest of repeats (Biswas et al., 2014, Bioinformatics, vol. 30,
1805-1813). Such degenerate repeats were detected in several C2c2
and C2c1 systems, allowing the Applicants to predict the direction
of the array transcription. By integrating this information,
putative tracrRNAs for 4 of the 17 C2c2 loci and 4 of the 13 C2c1
loci were identified. In some subtype II-B and II-C loci, the
CRISPR array is transcribed in the opposite direction, starting
from the degenerate repeat (Sampson et al., 2013, Nature, vol. 497,
254-257; Zhang et al., 2013, Mol Cell, vol. 50, 488-503).
Accordingly, we attempted to predict the tracrRNA in different
positions with respect to the CRISPR array but were unable to
identify additional candidate tracrRNA sequences. Conceivably, the
prediction of tracrRNA for other loci was hampered by a combination
of factors such as imperfect complementarity to repeats, lack of an
associated CRISPR array, and/or potential incompleteness of the
loci. Furthermore, the possibility remains that not all Class 2
CRISPR systems require tracrRNA.
[1005] The Applicants identified depleted sequence motifs in order
to identify PAM nucleotides. A PAM library was prepared in a
bacterial vector and transformed into a strain of E coli expressing
LshC2c2 (FIG. 54). In further detail, the assay is as follows for a
RNA target, provided that a PAM sequence is required to direct
recognition. Two E. coli strains are used in this assay. One
carries a plasmid that encodes the endogenous effector protein
locus from the bacterial strain. The other strain carries an empty
plasmid (e.g. pACYC 184, control strain). All possible 7 or 8 bp
PAM sequences are presented on an antibiotic resistance plasmid
(pUC19 with ampicillin resistance gene). The PAM is located next to
the sequence of proto-spacer 1 (the RNA target to the first spacer
in the endogenous effector protein locus). Two PAM libraries were
cloned. One has a 8 random bp 5' of the proto-spacer (e.g. total of
65536 different PAM sequences=complexity). The other library has 7
random bp 3' of the proto-spacer (e.g. total complexity is 16384
different PAMs). Both libraries were cloned to have in average 500
plasmids per possible PAM. Test strain and control strain were
transformed with 5'PAM and 3'PAM library in separate
transformations and transformed cells were plated separately on
ampicillin plates. Recognition and subsequent cutting/interference
with the plasmid renders a cell vulnerable to ampicillin and
prevents growth. Approximately 12h after transformation, all
colonies formed by the test and control strains where harvested and
plasmid RNA was isolated. Plasmid RNA was used as template for PCR
amplification and subsequent deep sequencing. Representation of all
PAMs in the untransfomed libraries showed the expected
representation of PAMs in transformed cells. Representation of all
PAMs found in control strains showed the actual representation.
Representation of all PAMs in test strain showed which PAMs are not
recognized by the enzyme and comparison to the control strain
allows extracting the sequence of the depleted PAM. CRISPR
interference results in ineffective transformation by plasmids
containing an effective target sequence. Transformant plasmids were
sequenced to identify non-target sequences. Depleted sequences
identify the 5' PAM nucleotides (FIG. 55). Heterologous targeting
in E. coli was observed for three targets. Increased interference
was observed for more highly transcribed targets. In particular, a
target in a transcribed region ("RNA)" coincided with increased
interference compared to minimally transcribed target "DNA1" and
"DNA2" (FIG. 56). A 5' DNA PAM screen showed no DNA cleavage (FIG.
85). LshC2c2 does not cleave untranscribed or transcribed DNA in an
E. coli RNAP in-vitro assay (FIG. 83). LshC2c2 does not cleave
ssDNA or dsDNA in vitro (FIG. 84).
[1006] LshC2c2 components were purified for in vitro tests (FIG.
57). Initially, it was observed in test reactions that crRNA is
cleaved by C2c2. Cleavage of crRNA is not Mg.sup.2+ dependent, and
may be elevated in the absence of target (FIG. 58). It was further
found that there is reduced cleavage in absence of Mg (FIG.
108)
[1007] After showing the capability of the LshC2c2 CRISPR locus to
mediate ssRNA interference, we wanted to demonstrate two additional
aspects of C2c2 activity: 1) RNA interference using an orthogonal
assay, and 2) the ability to retarget C2c2 to endogenously
expressed transcripts in a cell. We developed a fluorescent readout
for LshC2c2 activity by expressing RFP from a transfected plasmid
in E. coli (FIG. 63A). We then designed three spacers for each of
the three possible H PAMs (9 spacers total) targeting the RFP mRNA
and cloned them into the pLshC2c2 backbone as before. We
transfected these plasmids into E. coli already expressing the RFP
plasmid and grew them under double selection over night. By
analyzing the RFP levels in E. coli by flow cytometry, we observed
robust RFP knockdown for all three PAMs and no RFP knockdown for
spacers targeting the anti-sense DNA strand or non-targeting
spacers (FIG. 63B-C).To further investigate LshC2c2 targeting and
cleavage activity, spacers targeting RFP were cloned into the
LshC2c2 locus and the locus was expressed in E. coli carrying a
plasmid encoding expressible RFP or a pUC19 control plasmid. FIG.
61 shows C2c2 targeted the transcribed RFP. Strand-dependency of
interference was investigated by selecting target sequences
coinciding with or complementary to transcribed regions. High
levels of interference were observed using targeting sequences
complementary to transcribed RNA (FIG. 62). The extent of
interference was also observed to vary among transcribed targets,
possibly in relation to transcription levels (FIG. 63).
[1008] RNA targeting and target selection was investigated using a
model transcript and testing different targets (FIG. 65). Cleavage
of RNA was tested using RNA targets (FIGS. 66 and 67) and RNA
transcribed from DNA templates (FIGS. 68 and 69). Observed RNA
cleavage products coincided in size with those expected from the
model transcript (FIG. 70). FIG. 87 demonstrates that LshC2c2 does
not require the small RNA for RNA cleavage.
Example 4: C2C2 Targets and Cuts RNA In Vitro
[1009] Leptrichia shahii C2c2 is Capable of Interference Against
ssRNA MS2 Phage
[1010] C2c2 was first discovered in a computational search of
conserved unknown proteins near the adaptation protein Cas2 in
order to uncover novel Class 2 CRISPR systems (Shmakov et al) and
is hypothesized to be the functional effector of a novel CRISPR
sub-type VI group because of little homology to other known CRISPR
proteins. The C2c2 proteins has two conserved HEPN domains that
show strong conservation of the active residues but little homology
to any other known HEPN superfamily proteins or CRISPR effectors.
However, C2c2 differs from other HEPN proteins, particularly
CRISPR-associated type III proteins Csx1 and Csm6, which typically
dimerize prior to cleavage of RNA, because it has two HEPN domains
rather than one. Many of these unique features have prompted the
classification of C2c2 as a putative type VI. Given these
observations and the prevalence of C2c2-family proteins across
diverse bacterial species, we sought to determine whether C2c2
CRISPR-Cas loci are biologically active and can mediate
interference against RNA.
[1011] To determine whether the Leptotrichia shahii C2c2 (LshC2c2)
is a functional RNA-targeting system, we cloned the entire LshC2c2
CRISPR-Cas locus into low-copy plasmids (pLshC2c2) to allow
heterologous reconstitution in E. coli. With currently
characterized DNA- and RNA-targeting CRISPR systems, target
cleavage is dependent on two factors: 1) complementarity between
the crRNA spacer sequence and target site (protospacer) and 2) the
presence of the appropriate proximal adjacent motif (PAM) flanking
the protospacer. Because the PAM requirement is meant to
discriminate self vs. non-self recognition, it is unclear whether a
uniquely RNA-targeting system would require a PAM since presumably
there would be no self-RNA to even target.
[1012] To investigate the PAM requirements and activity of LshC2c2,
we used the MS2 phage restriction assay (FIG. 73). MS2 phage is an
ideal model to investigate RNA cleavage because it is a lytic
single-stranded RNA phage that has no DNA intermediates during its
life cycle. It readily infects E. coli via attachment to the F.
pilus and can thus be used for testing heterologous interference
against ssRNA. We synthesized a library of crRNA sequences to tile
every possible 28nt target site in the MS2 phage genome in order to
identify which target sites were more significantly depleted than
others. The crRNA library was cloned into pLshC2c2 such that each
unique spacer was the first spacer of a two-spacer array. We
transformed this library into E. coli NovaBlue (DE3, F+) and grew
the cultures with or without MS2 phage overnight. Using this assay,
we were able to identify a single-nucleotide PAM by analyzing the
flanking regions of the crRNA target sequences that were enriched
due to resistance against MS2 infection. The analysis revealed a 3'
H PAM (not G) on the RNA target indicative that there is some
sequence preference by the LshC2c2 complex (FIG. 75 A-B). Beyond
the identification of a PAM, the screen revealed that the
heterologously expressed LshC2c2 locus was capable of significant
ssRNA interference and protection against MS2 phage infection.
[1013] To validate the screen findings, we cloned four of the top
enriched spacers and showed 3- to 4-log reduction in plaquing
efficiency consistent with the level of enrichment observed in the
screen. Moreover, we wanted to further validate the PAM finding and
so we cloned a series of four guides per possible single nucleotide
PAM (16 guides in total) all targeting a region of the MS2 mat
gene. We found that all 16 targets were efficiently targeted with a
stronger preference for C, A, and U. Because G PAMs are still
targeted and there were a minority enriched in the interference
screen, the PAM may be more relaxed than a 3' H PAM.
[1014] The C2C2 protein from leptotrichia shahii was expressed in
E. coli and purified using His-tag affinity purification followed
by three rounds of gel filtration on an Akta FPLC using a Superdex
200 column. For in vitro cleavage experiments, a 175 nucleotide RNA
target (labeled t1 and t3 respectively, see below for sequences)
was combined with a 5.times. molar excess of C2c2 protein and crRNA
(using a 28 nucleotide spacer and a 28 nucleotide direct repeat,
see below for sequence) and incubated at 37C for 15 minutes in the
buffers indicated in the figure panels. The reaction was quenched
with proteinase K incubation for 15 min at 37C and subsequently
denatured in TBE-Urea loading buffer at 85C for 5 min. Samples were
resolved on a denaturing TBE Urea PAGE gel.
[1015] The results indicate that C2C2 mediates efficient
degradation of the RNA target in a crRNA-dependent manner. (FIG.
71, FIG. 79, FIG. 80) Notably, the crRNA itself is also cleaved
during this process.
[1016] Targeting of RFT transcripts in bacteria showed that growth
rate is reduced (FIG. 77). Without wishing to be bound by theory,
this may suggest that the HEPN system is a suicidal phage defense
system.
[1017] Cleavage fragments were mapped as indicated in FIGS. 81 and
114.
[1018] RNA-sequencing of IVC (in vitro cleavage) was performed as
indicated in FIG. 82.
[1019] RNA Target 1 Sequence
TABLE-US-00013 (SEQ ID NO: 68)
aatatggattacttggtagaacagcaatctaCGCCAGTGAATTCGAGCTC
GGTACCCGGGGATCCTCTAGAGTCGACCTGCAGGCATGCAAGCTTGGCGT
AATCATGGTCATAGCTGTTTCCTGTGTttatccgctcacaattccacaca
acatacgagccggaagcataaag
[1020] RNA Target 3 Sequence
TABLE-US-00014 (SEQ ID NO: 69)
GGCCAGTGAATTCGAGCTCGGTACCCGGGGATCCTCTAGAaatatggatt
acttggtagaacagcaatctaCTCGACCTGCAGGCATGCAAGCTTGGCGT
AATCATGGTCATAGCTGTTTCCTGTGTttatccgctcacaattccacaca
acatacgagccggaagcataaag
[1021] crRNA Sequence
TABLE-US-00015 (SEQ ID NO: 70)
CCACCCCAATATCGAAGGGGACTAAAACtagattgctgttctaccaagta atccat
[1022] L. shahii C2c2Protein Sequence
TABLE-US-00016 (SEQ ID NO: 71)
MGNLFGHKRWYEVRDKKDFKIKRKVKVKRNYDGNKYILNINENNNKEKID
NNKFIRKYINYKKNDNILKEFTRKFHAGNILFKLKGKEGIIRIENNDDFL
ETEEVVLYIEAYGKSEKLKALGITKKKIIDEAIRQGITKDDKKIEIKRQE
NEEEIEIDIRDEYTNKTLNDCSIILRIIENDELETKKSIYEIFKNINMSL
YKIIEKIIENETEKVFENRYYEEHLREKLLKDDKIDVILTNFMEIREKIK
SNLEILGFVKFYLNVGGDKKKSKNKKMLVEKILNINVDLTVEDIADFVIK
ELEFWNITKRIEKVKKVNNEFLEKRRNRTYIKSYVLLDKHEKFKIERENK
KDKIVKFFVENIKNNSIKEKIEKILAEFKIDELIKKLEKELKKGNCDTEI
FGIFKKHYKVNFDSKKFSKKSDEEKELYKIIYRYLKGRIEKILVNEQKVR
LKKMEKIEIEKILNESILSEKILKRVKQYTLEHIMYLGKLRHNDIDMTTV
NTDDFSRLHAKEELDLELITFFASTNMELNKIFSRENINNDENIDFFGGD
REKNYVLDKKILNSKIKIIRDLDFIDNKNNITNNFIRKFTKIGTNERNRI
LHAISKERDLQGTQDDYNKVINIIQNLKISDEEVSKALNLDVVFKDKKNI
ITKINDIKISEENNNDIKYLPSFSKVLPEILNLYRNNPKNEPFDTIETEK
IVLNALIYVNKELYKKLILEDDLEENESKNIFLQELKKTLGNIDEIDENI
IENYYKNAQISASKGNNKAIKKYQKKVIECYIGYLRKNYEELFDFSDFKM
NIQEIKKQIKDINDNKTYERITVKTSDKTIVINDDFEYIISIFALLNSNA
VINKIRNRFFATSVWLNTSEYQNIIDILDEIMQLNTLRNECITENWNLNL
EEFIQKMKEIEKDFDDFKIQTKKEIFNNYYEDIKNNILTEFKDDINGCDV
LEKKLEKIVIFDDETKFEIDKKSNILQDEQRKLSNINKKDLKKKVDQYIK
DKDQEIKSKILCRIIFNSDFLKKYKKEIDNLIEDMESENENKFQEIYYPK
ERKNELYIYKKNLFLNIGNPNFDKIYGLISNDIKMADAKFLFNIDGKNIR
KNKISEIDAILKNLNDKLNGYSKEYKEKYIKKLKENDDFFAKNIQNKNYK
SFEKDYNRVSEYKKIRDLVEFNYLNKIESYLIDINWKLAIQMARFERDMH
YIVNGLRELGIIKLSGYNTGISRAYPKRNGSDGFYTTTAYYKFFDEESYK
KFEKICYGFGIDLSENSEINKPENESIRNYISHFYIVRNPFADYSIAEQI
DRVSNLLSYSTRYNNSTYASVFEVFKKDVNLDYDELKKKFKLIGNNDILE
RLMKPKKVSVLELESYNSDYIKNLIIELLTKIENTNDTLKRPAATKKAGQ
AKKKKGSYPYDVPDYAYPYDVPDYAYPYDVPDYA
[1023] RNA PAM screen using MS2 phage interference identified PAMs,
see FIGS. 73-78. It was determined that LshC2c2 has a 3' PAM for
RNA cleavage (FIG. 86). FIGS. 88 and 89 also demonstrate that
LshC2c2 is reprogrammable and PAM sensitive.
[1024] FIG. 90 demonstrates that LshC2c2 cannot use spacers less
than 18-22nt.
[1025] FIGS. 91-93 show the influence of stem loop (modifications)
on cleavage. It is shown that crRNAs without stem loop do not allow
for cleavage (FIG. 91) and that Stem is amenable to individual base
swaps but activity is disrupted by secondary structure changes. DR
Truncation experiments also indicate that disruption of the stem
abolishes cleavage (FIG. 92 and FIG. 93).
[1026] FIG. 100 shows the effects of divalent cations on C2c2
activity.
[1027] It was shows that C2c2 cuts 3' of the target site (FIG. 102
and FIG. 103)
[1028] FIGS. 104-106 show that C2c2 can be reprogrammed with
crRNAs.
[1029] Without wishing to be bound by theory, it seems that one
active, C2c2 becomes active and degrades other RNAs (FIG. 98; FIG.
108).
[1030] It was shown that C2c2 may be reprogrammed with crRNAs
(FIGS. 104-106), and that long targets may be targeted (FIG.
107)
[1031] FIG. 112 suggests that C2c2 crRNAs have a seed region, as
indicated by single and double mismatch analysis. Indeed, double
mismatch in nt 1-11 of target significantly affects cleavage while
less so if in region region spanning nt 16-26. These figures also
demonstrate specificity of cleavage of C2c2 effector protein.
[1032] FIG. 113 and FIG. 114. Suggest that changing sequence
contexts affects cleavage patterns. Indeed target sequences
provided in different context are cleaved differently.
Example 5: Mutation of Either HEPN Domain Abolishes Targeted
Cleavage
[1033] Cpc2 variants were created comprising the mutations R597A
and R1278A. As shown in FIG. 72, both mutations abolished RNA
cleavage, see also FIG. 97, demonstrating that R597A, H602A,
R1278A, and H1283A abolish RNA cleavage
[1034] HEPN mutants however still process natural array (FIG.
95).
[1035] HEPN mutants still retain targeted binding activity, as
demonstrated by FIG. 111 (EMSA analysis). Top panel: binding of
wild type C2c2. Bottom panel: binding of R1278A mutated Lsh
C2c2.
Example 6
[1036] Corresponding residues in other C2c2 orthologs were
identified by structural alignment to identify structural
representatives that correspond to either their experimentally
determined structures or homology models. FIG. 109 illustrates the
sequences alignment of the following orthologs of the Leptotrichia
shahii DSM 19757 C2c2; Rhodobacter capsulatus SB 1003 (RcS);
Rhodobacter capsulatus R121 (RcR); Rhodobacter capsulatus DE442
(RcD); Lachnospiraceae bacterium MA2020 (Lb(X)); Lachnospiraceae
bacterium NK4A179 (Lb(X); [Clostridium]aminophilum DSM 10710 (CaC);
Lachnospiraceae bacterium NK4A144 (Lb(X); Leptotrichia wadei F0279
(Lew); Leptotrichia wadei F0279 (Lew); Carnobacterium gallinarum
DSM 4847 (Cg); Carnobacterium gallinarum DSM 4847 (Cg);
Paludibacter propionicigenes WB4 (Pp); Listeria seeligeri serovar
1/2b (Ls); Listeria weihenstephanensis FSL R9-0317 (Liw); and
Listeria bacterium FSL M6-0635 (Lib). FIG. 110 demonstrates that
C2c2 orthologues have conserved HEPN domains.
[1037] Using the numbering from a consensus sequence obtained using
MUSCLE alignment (www.ebi.ac.uk/Tools/msa/muscle/), the following
conserved residues were identified. K36, K39, V40, E479, L514,
V518, N524, G534, K535, E580, L597, V602, D630, F676, L709, I713,
R717 (HEPN), N718, H722 (HEPN), E773, P823, V828, I879, Y880, F884,
Y997, L1001, F1009, L1013, Y1093, L1099, L111, Y1114, L1203, D1222,
Y1244, L1250, L1253, K1261, I11334, L1355, L1359, R1362, Y1366,
E1371, R1372, D1373, R1509 (HEPN), H1514 (HEPN), Y1543, D1544,
K1546, K1548, V1551, I11558. The pairwise match up of conserved
residues in the consensus sequence with amino acids of Leptotrichia
wadei C2c2 (sequence F herein) is: K36,K2; K39,K5; V40,V6;
E479,E301; L514,L331; V518,I335; N524,N341; G534,G351; K535,K352;
E580,E375; L597,L392; V602,L396; D630,D403; F676,F446; L709,I466;
I713,I470; R717 (HEPN),R474; N718,H475; H722 (HEPN),H479;
E773,E508; P823,P556; V828,L561; I879,I595; Y880,Y596; F884,F600;
Y997,Y669; L1001,I673; F1009,F681; L1013,L685; Y1093,Y761;
L1099,L676; L1111,L779; Y1114,Y782; L1203,L836; D1222,D847;
Y1244,Y863; L1250,L869; L1253,I872; K1261,K879; I11334,I933;
L1355,L954; L1359,I958; R1362,R961; Y1366,Y965; E1371,E970;
R1372,R971; D1373,D972; R1509 (HEPN),R1046; H1514 (HEPN),H1051;
Y1543,Y1075; D1544,D1076; K1546,K1078; K1548,K1080; V1551,I1083;
I1558,I1090.
Example 7: Generation of C2c2 Mutants with Enhanced Specificity
[1038] Recently a method was described for the generation of Cas9
orthologs with enhanced specificity (Slaymaker et al. 2015). This
strategy can be used to enhance the specificity of C2c2 orthologs.
Primary residues for mutagenesis are all positive charges residues
within the HEPN domain, since this is the only known structure in
the absence of a crystal and we know that specificity mutants in
RuvC worked in Cas9. The conserved Arginine residues within HEPN
domain are R717 and R1509.
[1039] Additional candidates are positive charged residues that are
conserved between different orthologs such as K2, K39, K535, K1261,
R1362, R1372, K1546 and K1548.
[1040] These can be used to generate C2c2 mutants with enhanced
specificity.
Example 8: C2c2 is a Single-Component Programmable RNA-Guided
RNA-Targeting CRISPR Effector
TABLE-US-00017 [1041] TABLE A crRNA sequences used for in vitro
experiments. SEQ 1st ID Name Sequence Fig. NO: crRNA 14
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 117B 72 GUAAUCCAU
crRNA 15 CCACCCCAAUAUCGAAGGGGACUAAAACUUUCUAGAGGAUCCCCGGG 117D 73
UACCGAGCU crRNA 16 CCACCCCAAUAUCGAAGGGGACUAAAACAGUAAUCCAUAUUUCUAGA
117D 74 GGAUCCCCG crRNA 17
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 117D 75 GUAAUCCAU
crRNA 18 CCACCCCAAUAUCGAAGGGGACUAAAACCAUGCCUGCAGGUCGAGUA 117D 76
GAUUGCUGU crRNA 19 CCACCCCAAUAUCGAAGGGGACUAAAACGCAUGCCUGCAGGUCGAGU
117D 77 AGAUUGCUG crRNA 20
CCACCCCAAUAUCGAAGGGGACUAAAACAAGCUUGCAUGCCUGCAGG 117D 78 UCGAGUAGA
crRNA 21 CCACCCCAAUAUCGAAGGGGACUAAAACCGCCAAGCUUGCAUGCCUG 117D 79
CAGGUCGAG crRNA 22 CCACCCCAAUAUCGAAGGGGACUAAAACGAUUACGCCAAGCUUGCAU
117D 80 GCCUGCAGG crRNA 23
CCACCCCAAUAUCGAAGGGGACUAAAACUGAUUACGCCAAGCUUGCA 117D 81 UGCCUGCAG
crRNA 24 CCACCCCAAUAUCGAAGGGGACUAAAACAUGACCAUGAUUACGCCAA 117D 82
GCUUGCAUG crRNA 25 CCACCCCAAUAUCGAAGGGGACUAAAACUAUGACCAUGAUUACGCCA
117D 83 AGCUUGCAU crRNA 26
CCACCCCAAUAUCGAAGGGGACUAAAACAGCUAUGACCAUGAUUACG 117D 84 CCAAGCUUG
crRNA 27 CCACCCCAAUAUCGAAGGGGACUAAAACGAAACAGCUAUGACCAUGA 117D 85
UUACGCCAA crRNA 28 CCACCCCAAUAUCGAAGGGGACUAAAACACAGGAAACAGCUAUGACC
117D 86 AUGAUUACG crRNA 29
CCACCCCAAUAUCGAAGGGGACUAAAACAACACAGGAAACAGCUAUG 117D 87 ACCAUGAUU
crRNA 30 CCACCCCAAUAUCGAAGGGGACUAAAACAAACACAGGAAACAGCUAU 117D 88
GACCAUGAU crRNA 31 CCACCCCAAUAUCGAAGGGGACUAAAACAUAAACACAGGAAACAGCU
117D 89 AUGACCAUG crRNA 32
CCACCCCAAUAUCGAAGGGGACUAAAACGGAUAAACACAGGAAACAG 117D 90 CUAUGACCA
crRNA 33 CCACCCCAAUAUCGAAGGGGACUAAAACAGCGGAUAAACACAGGAAA 117D 91
CAGCUAUGA crRNA 34 CCACCCCAAUAUCGAAGGGGACUAAAACGAGCGGAUAAACACAGGAA
117D 92 ACAGCUAUG Lsh_crRNA_DR_
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 120B 93 28
GUAAUCCAU Lsh_crRNA_DR_
ACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGU 120B 94 26 AAUCCAU
Lsh_crRNA_DR_ CCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUAA 120B
95 24 UCCAU Lsh_crRNA_DR_
CAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUAAUC 120B 96 22 CAU
Lsh_crRNA_DR_ AUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUAAUCCA 120B
97 20 U Lsh_crRNA_DR_
UAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUAAUCCAU 120B 98 19
Lsh_crRNA_DR_ AUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUAAUCCAU 120B
99 18 Lsh_crRNA_24 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA
120A 100 GUAAU Lsh_crRNA_23
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 120A 101 GUAA
Lsh_crRNA_22 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 120A
102 GUA Lsh_crRNA_21
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 120A 103 GU
Lsh_crRNA_20 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 120A
104 G Lsh_crRNA_19 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA
120A 105 Lsh_crRNA_18
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCA 120A 106
Lsh_crRNA_17 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACC 120A 107
Lsh_crRNA_16 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUAC 120A 108
Lsh_crRNA_12 CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUU 120A 109
Lsh_stem_1 CCACCCGAAUAUCGAACGGGACUAAAACUAGAUUGCUGUUCUACCAA 121A 110
GUAAUCCAU Lsh_stem_2
CCACCGCAAUAUCGAAGCGGACUAAAACUAGAUUGCUGUUCUACCAA 121A 111 GUAAUCCAU
Lsh_stem_3 CCACGCCAAUAUCGAAGGCGACUAAAACUAGAUUGCUGUUCUACCAA 121A 112
GUAAUCCAU Lsh_stem_4
CCAGCCCAAUAUCGAAGGGCACUAAAACUAGAUUGCUGUUCUACCAA 121A 113 GUAAUCCAU
Lsh_stem_5 CCAGGGGGAAUAUCGAACCCCACUAAAACUAGAUUGCUGUUCUACCA 121A 114
AGUAAUCCAU Lsh_stem_6
CCACCACCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCA 121A 115 AGUAAUCCAU
Lsh_stem_7 CCAACCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 121A 116
GUAAUCCAU Lsh_stem_8
CCACCCAAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 121A 117 GUAAUCCAU
Lsh_stem_9 CCACCCCCAAUAUCGAAGGGGGACUAAAACUAGAUUGCUGUUCUACC 121A 118
AAGUAAUCCAU Lsh_loop_1
CCACCCCAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAG 121B 119 UAAUCCAU
Lsh_loop_2 CCACCCCAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUA 121B 120
AUCCAU Lsh_loop_3 CCACCCCAAGGGGACUAAAACUAGAUUGCUGUUCUACCAAGUAAUCC
121B 121 AU Lsh_loop_4
CCACCCCAAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCA 121B 122 AGUAAUCCAU
Lsh_loop_5 CCACCCCAAAAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUAC 121B 123
CAAGUAAUCCAU Lsh_loop_6
CCACCCCAAAAAAAAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUU 121B 124
CUACCAAGUAAUCCAU Lsh_loop_7
CCACCCCGAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 121B 125 GUAAUCCAU
Lsh_loop_8 CCACCCCAAAAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 121B 126
GUAAUCCAU Lsh_loop_9
CCACCCCAAUAUCCAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 121B 127 GUAAUCCAU
Lsh single_mis- CCACCCCAAUAUCGAAGGGGACUAAAACAAGAUUGCUGUUCUACCAA
122C 128 match_pos1 GUAAUCCAU Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAAUGCUGUUCUACCAA 122C 129 match_pos5
GUAAUCCAU Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCAGUUCUACCAA 122C 130 match_pos9
GUAAUCCAU Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUGUACCAA 122C 131
match_pos13 GUAAUCCAU Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACGAA 122C 132
match_pos17 GUAAUCCAU Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA match_pos21
GAAAUCCAU 122C 133 Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 122C 134
match_pos25 GUAAUGCAU Lsh_single_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 122C 135
match_pos28 GUAAUCCAA Lsh_double_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACAUGAUUGCUGUUCUACCAA 122D 136 match_pos1
GUAAUCCAU Lsh_double_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUACCUGUUCUACCAA 122D 137 match_pos6
GUAAUCCAU Lsh_double_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGAACUACCAA 122D 138
match_pos11 GUAAUCCAU Lsh_double_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUAGGAA 122D 139
match_pos16 GUAAUCCAU Lsh_double_mis-
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 122D 140
match_pos21 GAUAUCCAU Lsh_double_mis
CCACCCCAAUAUCGAAGGGGACUAAAACUAGAUUGCUGUUCUACCAA 122D 141
match_pos26 GUAAUCGUU
TABLE-US-00018 TABLE B ssRNA targets used in this study. SEQ 1st ID
Name Target Fig. NO: ssRNA 1 (C
GGCCAGUGAAUUCGAGCUCGGUACCCGGGGAUCCUCUAGAAAUAUGG 117B 142 PAM)
AUUACUUGGUAGAACAGCAAUCUACUCGACCUGCAGGCAUGCAAGCUU
GGCGUAAUCAUGGUCAUAGCUGUUUCCUGUGUUUAUCCGCUCACAAU
UCCACACAACAUACGAGCCGGAAGCAUAAAG ssRNA 2
AAUAUGGAUUACUUGGUAGAACAGCAAUCUACAAAAAAAAAAAAAAA 118B 143
AAAAGAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAAAAGAA
AAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAAAAGAAAAAAAAA AAAAAAAAAAG ssRNA 3
AAUAUGGAUUACUUGGUAGAACAGCAAUCUACUUUUUUUUUUUUUUU 118B 144
UUUUCUUUUUUUUUUUUUUUUUUUCUUUUUUUUUUUUUUUUUUUCUU
UUUUUUUUUUUUUUUUUCUUUUUUUUUUUUUUUUUUUCUUUUUUUUU UUUUUUUUUUC ssRNA 4
GGGUAGGUGUUCCACAGGGUAGCCAGCAGCAUCCUGCGAUGCAAAUA 118C 145
UGGAUUACUUGGUAGAACAGCAAUCUAAUCCGGAACAUAAUGGUGCA
GGGCGCUGACUUCCGCGUUUCCAGACUUUACGAAACACGGAAACCGAA
GACCAUUCAUGUUGUUGCUGCCGGAAGCAUAAAG ssRNA 5
GGGCCCCUCCGUUCGCGUUUACGCGGACGGUGAGACUGAAGAUAAUAU 118C 146
GGAUUACUUGGUAGAACAGCAAUCUAAACUCAUUCUCUUUAAAAUAU
CGUUCGAACUGGACUCCCGGUCGUUUUAACUCGACUGGGGCCAAAACG
AAACAGUGGCACUACCCCGCCGGAAGCAUAAAG ssRNA 1 (G
GGCCAGUGAAUUCGAGCUCGGUACCCGGGGAUCCUCUAGAAAUAUGG 117C 147 PAM)
AUUACUUGGUAGAACAGCAAUCUAGUCGACCUGCAGGCAUGCAAGCU
UGGCGUAAUCAUGGUCAUAGCUGUUUCCUGUGUUUAUCCGCUCACAA
UUCCACACAACAUACGAGCCGGAAGCAUAAAG ssRNA 1 (A
GGCCAGUGAAUUCGAGCUCGGUACCCGGGGAUCCUCUAGAAAUAUGG 117C 148 PAM)
AUUACUUGGUAGAACAGCAAUCUAAUCGACCUGCAGGCAUGCAAGCU
UGGCGUAAUCAUGGUCAUAGCUGUUUCCUGUGUUUAUCCGCUCACAA
UUCCACACAACAUACGAGCCGGAAGCAUAAAG ssRNA 1 (U
GGCCAGUGAAUUCGAGCUCGGUACCCGGGGAUCCUCUAGAAAUAUGG 117C 149 PAM)
AUUACUUGGUAGAACAGCAAUCUAUUCGACCUGCAGGCAUGCAAGCU
UGGCGUAAUCAUGGUCAUAGCUGUUUCCUGUGUUUAUCCGCUCACAA
UUCCACACAACAUACGAGCCGGAAGCAUAAAG ssRNA 6
ACCGAUCGUCGUUGUUUGGGCAAUGCACGUUCUCCAACGGUGCUCCUA 124B 150
UGGGGCACAAGUUGCAGGAUGCAGCGCCUUACAAGAAGUUCGCUGAA
CAAGCAACCGUUACCCCCCGCGCUCUGAGAGCGGCUCUAUUGGUCCGA
GACCAAUGUGCGCCGUGGAUCAGACACGCGGU ssRNA 7
ACUGUUGGUGGUGUAGAGCUUCCUGUAGCCGCAUGGCGUUCGUACUU 124B 151
AAAUAUGGAACUAACCAUUCCAAUUUUCGCUACGAAUUCCGACUGCGA
GCUUAUUGUUAAGGCAAUGCAAGGUCUCCUAAAAGAUGGAAACCCGA
UUCCCUCAGCAAUCGCAGCAAACUCCGGCAUCU ssRNA 8
GGUAACAUGCUCGAGGGCCUUACGGCCCCCGUGGGAUGCUCCUACAUG 124B 152
UCAGGAACAGUUACUGACGUAAUAACGGGUGAGUCCAUCAUAAGCGU
UGACGCUCCCUACGGGUGGACUGUGGAGAGACAGGGCACUGCUAAGGC
CCAAAUCUCAGCCAUGCAUCGAGGGGUACAAU ssRNA 9
UUCGUAAAACGUUCGUGUCCGGGCUCUUUCGCGAGAGCUGCGGCGCGC 124B 153
ACUUUUACCGUGGUGUCGAUGUCAAACCGUUUUACAUCAAGAAACCU
GUUGACAAUCUCUUCGCCCUGAUGCUGAUAUUAAAUCGGCUACGGGG
UUGGGGAGUUGUCGGAGGUAUGUCAGAUCCACG ssRNA 10
AUAGGCCAGUGAAUUCGAGCUCGAAUAUGGAUUACUUGGUAGAACAG 119D 154
CAAUCUACGCCGGAAGCAUAAAG ssRNA 10(rc)
CUUUAUGCUUCCGGCGUAGAUUGCUGUUCUACCAAGUAAUCCAUAUUC 119D 155
GAGCUCGAAUUCACUGGCCUAU ssDNA target
ctttatgcttccggctcgtatgttgtgtggaattgtgagcggataaac 134D 156
acaggaaacagctatgaccatgattacgccaagcttgcatgcctgcag
gtcgagaatatggattacttggtagaacagcaatctatctagaggatc
cccgggtaccgagctcgaattcactggccccctatagtgagtcgtatt aatttc
TABLE-US-00019 TABLE C Spacers used for in vivo experiments. SEQ
1st ID Name Sequence Fig. NO: spacer 1 GAAGUUUGCAGCUGGAUACGACAGACGG
1116D 157 spacer 2 UGUCUGGAAGUUUGCAGCUGGAUACGAC 1116D 158 spacer 3
AGCUGGAUACGACAGACGGCCAUCUAAC 1116D 159 spacer 4
UACGUCGCGAUAUGUUGCACGUUGUCUG 1116D 160 spacer 5
UACGGACGACCUUCACCUUCACCUUCGA 123A 161 UUU spacer 6
UCGUACGGACGACCUUCACCUUCACCUU 123A 162 CGA spacer 7
CGGUCUGGGUACCUUCGUACGGACGACC 123A 163 UUC spacer 8
GCGGUCUGGGUACCUUCGUACGGACGAC 123A 164 CUU spacer 9
AGCGGUCUGGGUACCUUCGUACGGACGA 123A 165 CCU spacer 10
AGUUCAUAACACGUUCCCAUUUGAAACC 123A 166 UUC spacer 11
UUAACUUUGUAGAUGAACUCACCGUCUU 123A 167 GCA spacer 12
UUUAACUUUGUAGAUGAACUCACCGUCU 123A 168 UGC spacer 13
GUUUAACUUUGUAGAUGAACUCACCGUC 123A 169 UUG spacer 35
AAGUUUGCAGCUGGAUACGACAGACGGC 119B 170 spacer 36
ACAGGAUGUCCCAAGCGAACGGCAGCGG 139 171 spacer 37
GCUUGUUCAGCGAACUUCUUGUAAGGCG 129A 172 spacer 38
UAAGCUCGCAGUCGGAAUUCGUAGCGAA 129A 173 spacer 39
CGUCAACGCUUAUGAUGGACUCACCCGU 129A 174 spacer 40
UCAACAGGUUUCUUGAUGUAAAACGGUU 129A 175 spacer 41
AAGUUUGCAGCUGGAUACGACAGACGGC 130 176 spacer 42
UUUGCAGCUGGAUACGACAGACGGCCAU 130 177 spacer 43
CAGCUGGAUACGACAGACGGCCAUCUAA 130 178 spacer 44
GUUGUCUGGAAGUUUGCAGCUGGAUACG 130 179 spacer 45
GCGAUAUGUUGCACGUUGUCUGGAAGUU 130 180 spacer 46
ACGUUGUCUGGAAGUUUGCAGCUGGAUA 130 181 spacer 47
AUGUUGCACGUUGUCUGGAAGUUUGCAG 130 182 spacer 48
UGCAGCUGGAUACGACAGACGGCCAUCU 130 183 spacer 49
CUGGAAGUUUGCAGCUGGAUACGACAGA 130 184 spacer 50
AGUUUGCAGCUGGAUACGACAGACGGCC 130 185 spacer 51
GCUGGAUACGACAGACGGCCAUCUAACU 130 186 spacer 52
GUUUGCAGCUGGAUACGACAGACGGCCA 130 187 spacer_41_
UAGUUUGCAGCUGGAUACGACAGACGGC 122A 188 single_ mismatch_pos1
spacer_41_ AAGUAUGCAGCUGGAUACGACAGACGGC 122A 189 single_
mismatch_pos5 spacer_41_ AAGUUUGCUGCUGGAUACGACAGACGGC 122A 190
single_ mismatch_pos9 spacer_41_ AAGUUUGCAGCUCGAUACGACAGACGGC 122A
191 single_ mismatch_pos13 spacer_41_ AAGUUUGCAGCUGGAUUCGACAGACGGC
122A 192 single_ mismatch_pos17 spacer_41_
AAGUUUGCAGCUGGAUACGAGAGACGGC 122A 193 single_ mismatch_pos21
spacer_41_ AAGUUUGCAGCUGGAUACGACAGAGGGC 122A 194 single_
mismatch_pos25 spacer_41_ UUGUUUGCAGCUGGAUACGACAGACGGC 122B 195
double_ mismatch_pos1 spacer_41_ AAGUUACCAGCUGGAUACGACAGACGGC 122B
196 double_ mismatch_pos6 spacer_41_ AAGUUUGCAGGAGGAUACGACAGACGGC
122B 197 double_ mismatch_pos11 spacer_41_
AAGUUUGCAGCUGGAAUCGACAGACGGC 122B 198 double_ mismatch_pos16
spacer_41_ AAGUUUGCAGCUGGAUACGAGUGACGGC 122B 199 double_
mismatch_pos21
Heterologous Reconstitution of the L. shahii C2c2 Locus in
Escherichia coli Confers RNA-Guided Immunity Against a RNA
Bacteriophage
[1042] As a first step, we explored whether LshC2c2 could be used
to confer immunity to MS2 (G. Tamulaitis et al., Programmable RNA
shredding by the type III-A CRISPR-Cas system of Streptococcus
thermophilus. Mol Cell 56, 506-517 (2014)), a lytic single-stranded
(ss) RNA phage without DNA intermediates in its life cycle that
readily infects E. coli. We constructed a low-copy plasmid carrying
the entire LshC2c2 locus (pLshC2c2) to allow for heterologous
reconstitution in E. coli (FIG. 126A). Given that expressed mature
crRNAs from the LshC2c2 locus have a maximum spacer length of 28nt
(FIG. 126A) (S. Shmakov et al., Discovery and Functional
Characterization of Diverse Class 2 CRISPR-Cas Systems. Mol Cell
60, 385-397 (2015)), we synthesized a library of 3,473 spacer
sequences tiling all possible 28-nt target sites in the MS2 phage
genome and cloned them as spacers into the pLshC2c2 CRISPR array.
After transformation in E. coli, cells were infected with MS2 and
spacer sequences in cells that survived the infection were
determined. Cells carrying spacers that confer robust interference
against MS2 will proliferate more rapidly, leading to enrichment of
these spacers following growth for 16 hours. A number of spacers
were consistently enriched across two independent replicas,
suggesting that they enabled strong interference against MS2 (107
spacers showed >1.3 log 2-fold enrichment in both replicas; FIG.
116B and FIG. 127A-B). By analyzing the flanking regions of
protospacer on the MS2 genome corresponding to the 107 enriched
spacers, we found that spacers with G immediately adjacent to the
3' end of the protospacer performed more poorly than those with an
H (i.e. A, U, or C), indicating a single nucleotide PAM, H (FIG.
116C and FIG. 127C-D, 128).
[1043] To validate the interference activity of enriched spacers,
we individually cloned four top-enriched spacers into pLshC2c2
CRISPR arrays and observed a 3- to 4-log reduction in plaque
formation, consistent with the level of enrichment observed in the
screen (FIG. 116B and FIG. 129). To confirm the PAM, we cloned
sixteen guides targeting distinct regions of the MS2 mat gene (4
guides per possible single-nucleotide PAM). We found that all 16
crRNAs mediated MS2 interference, although higher levels of
resistance were observed for the C, A, and U PAM-targeting guides
(FIGS. 116D, 116E and FIG. 130), indicating that C2c2 can be
effectively retargeted in a crRNA-dependent fashion to sites within
the MS2 genome.
C2c2 is a Single-Effector endoRNase that Mediates ssRNA Cleavage
with a Single crRNA Guide
[1044] To test whether LshC2c2 mediated phage interference by
facilitating crRNA-guided ssRNA cleavage, we purified the LshC2c2
protein (FIG. 13I) and assayed its ability to cleave an in vitro
transcribed 173-nt ssRNA target (FIG. 117A and FIG. 132) containing
a C PAM protospacer (ssRNA target 1 with protospacer 14).
Previously, we found that mature LshC2c2 crRNAs contain a 28-nt
direct repeat (DR) and a 28 nt spacer (FIG. 126A) (S. Shmakov et
al., Discovery and Functional Characterization of Diverse Class 2
CRISPR-Cas Systems. Mol Cell 60, 385-397 (2015)), and we therefore
generated an in-vitro-transcribed crRNA with 28-nt spacer
complementary to protospacer 14 on ssRNA target 1. We found that
LshC2c2 efficiently cleaved ssRNA in a Mg2+- and crRNA-dependent
manner (FIG. 117B and FIG. 133). To investigate cleavage of dsRNA
substrates, we annealed complementary RNA oligos to regions
flanking the crRNA target site. This partially double-stranded RNA
substrate was not cleaved by LshC2c2, indicating it is specific for
ssRNA (figs. 134A-B).
[1045] To further characterize the sequence constraints of RNA
cleavage by LshC2c2, we tested additional crRNAs complementary to
different versions of ssRNA target 1 where protospacer 14 is
preceded by each PAM variant. The results of this experiment
confirmed the preference for C, A, and U PAMs, with little cleavage
activity detected for the G PAM target (FIG. 117C). Additionally,
we designed 5 crRNAs for each possible PAM (20 total) across ssRNA
target 1 and evaluated cleavage activity for LshC2c2 paired with
each of these crRNAs. As expected, we found less cleavage activity
for G PAM-targeting crRNAs compared to other crRNAs tested (FIG.
117D).
[1046] LshC2c2 was tested for DNA cleavage activity in vitro. We
generated a dsDNA plasmid library with protospacer 14 preceded by 7
random nucleotides to account for any PAM requirements. When
incubated with LshC2c2 protein and a crRNA complementary to
protospacer 14, no cleavage of the dsDNA plasmid library was
observed (FIG. 134C). We also did not observe cleavage when
targeting a ssDNA version of ssRNA target 1 (FIG. 134D). To rule
out co-transcriptional DNA cleavage which has been observed in type
III CRISPR-Cas systems (P. Samai et al., Co-transcriptional DNA and
RNA Cleavage during Type III CRISPR-Cas Immunity. Cell 161,
1164-1174 (2015)), we recapitulated the E. coli RNA polymerase
co-transcriptional cleavage assay (P. Samai et al.,
Co-transcriptional DNA and RNA Cleavage during Type III CRISPR-Cas
Immunity. Cell 161, 1164-1174 (2015)) (FIG. 135A), expressing ssRNA
target 1 from a DNA substrate. Using this assay with the purified
LshC2c2 and crRNA targeting ssRNA target 1, we still did not
observe any DNA cleavage (FIG. 135B). Together, these results
indicate that C2c2 cleaves specific ssRNA sites directed by the
target complementarity encoded in the crRNA, with a 3' H PAM
requirement.
C2c2 Cleavage Depends on Local Target Sequence and Secondary
Structure
[1047] Given that C2c2 did not efficiently cleave dsRNA substrates
and that ssRNA forms complex secondary structures, we reasoned that
cleavage by C2c2 might be affected by secondary structure of the
ssRNA target. In tiling ssRNA target 1 with different crRNAs (FIG.
117D), the same cleavage pattern was observed regardless of the
crRNA position along the target RNA, suggesting that the
crRNA-dependent cleavage pattern was determined by some features of
the target sequence rather than the distance from the binding site.
We hypothesized that the LshC2c2-crRNA complex binds the target and
cleaves exposed regions of ssRNA within the secondary structure
elements, with a potential preference for certain nucleotides. We
analyzed the cleavage efficiencies of homopolymer RNA targets (a
28-nt protospacer extended with 120 As or Us regularly interspaced
by single bases of G or C to enable oligo synthesis) and found that
LshC2c2 preferentially cleaved the uracil target compared to
adenine (FIG. 118A-B). To assess the impact of the target RNA on
the cleavage pattern, we tested cleavage of three ssRNA targets
with different sequences flanking a constant 28-nt protospacer and
found three distinct patterns of cleavage (FIG. 118C).
RNA-sequencing of the cleavage products for the three targets
revealed that cleavage sites mainly localized to uracil-rich
regions of ssRNA or ssRNA-dsRNA junctions within the in silico
predicted co-folds of the target sequence with the crRNA (FIG.
118D-I).
The HEPN Domains of C2c2 Mediate RNA-Guided ssRNA-Cleavage
[1048] Previous bioinformatics analysis of C2c2 suggested that the
HEPN domains are potentially responsible for the catalytic activity
we observed (S. Shmakov et al., Discovery and Functional
Characterization of Diverse Class 2 CRISPR-Cas Systems. Mol Cell
60, 385-397 (2015)). Each of the two HEPN domains of C2c2 contains
a dyad of conserved arginine and histidine residues (FIG. 119A), in
agreement with the catalytic mechanism of the HEPN endoRNAse (V.
Anantharaman, K. S. Makarova, A. M. Burroughs, E. V. Koonin, L.
Aravind, Comprehensive analysis of the HEPN superfamily:
identification of novel roles in intra-genomic conflicts, defense,
pathogenesis and RNA processing. Biol Direct 8, 15 (2013); O.
Niewoehner, M. Jinek, Structural basis for the endoribonuclease
activity of the type III-A CRISPR-associated protein Csm6. RNA 22,
318-329 (2016); N. F. Sheppard, C. V. Glover, 3rd, R M. Terns, M.
P. Terns, The CRISPR-associated Csx1 protein of Pyrococcus furiosus
is an adenosine-specific endoribonuclease. RNA 22, 216-224 (2016)).
To test whether these predicted catalytic residues were required
for ssRNA depletion in vivo, we mutated each residue separately to
alanine (R597A, H602A, R1278A, H1283A) in the LshC2c2 locus
plasmids and assayed for MS2 interference. None of the four mutant
plasmids were able to protect E. coli from phage infection (FIG.
119B and FIG. 136).
[1049] In order to validate these findings in vitro, the four
single-point mutant proteins were purified and assayed their
ability to cleave 5'-end-labeled ssRNA target 1 (FIG. 119C). In
agreement with our in vivo results, all four mutations abolished
cleavage activity. The inability of either of the two wild-type
HEPN domains to compensate for inactivation of the other implies
cooperation between the two domains, which agrees with observations
that several bacterial and eukaryotic single-HEPN proteins function
as dimers (O. Niewoehner, M. Jinek, Structural basis for the
endoribonuclease activity of the type III-A CRISPR-associated
protein Csm6. RNA 22, 318-329 (2016); N. F. Sheppard, C. V. Glover,
3rd, R. M. Terns, M. P. Terns, The CRISPR-associated Csx1 protein
of Pyrococcus furiosus is an adenosine-specific endoribonuclease.
RNA 22, 216-224 (2016); G. Kozlov et al., Structural Basis of
Defects in the Sacsin HEPN Domain Responsible for Autosomal
Recessive Spastic Ataxia of Charlevoix-Saguenay (ARSACS). J Biol
Chem 286, 20407-20412 (2011)).
[1050] Catalytically inactive variants of Cas9 retain target DNA
binding, allowing for the creation of programmable DNA-binding
proteins (G. Gasiunas, R. Barrangou, P. Horvath, V. Siksnys,
Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage
for adaptive immunity in bacteria. Proc Natl Acad Sci USA 109,
E2579-2586 (2012); M. Jinek et al., A programmable dual-RNA-guided
DNA endonuclease in adaptive bacterial immunity. Science 337,
816-821 (2012)). To determine if target binding and cleavage
activity of LshC2c2 are likewise separable, electrophoretic
mobility shift assays (EMSA) were performed on both the wild-type
(FIG. 119D) and R1278A mutant LshC2c2 (FIG. 119E) in complex with
crRNA. The wild-type LshC2c2 complex bound strongly (KD.about.46
nM, FIG. 137A) and specifically to ssRNA target 10, but not to the
non-target ssRNA (the reverse complement of ssRNA target 10). The
R1278A mutant C2c2 complex showed an even stronger (KD.about.7 nM,
FIG. 137B) specific binding, indicating that this HEPN mutation
results in a catalytically inactive, RNA-programmable RNA-binding
protein. The LshC2c2 protein or crRNA alone showed substantially
reduced levels of target affinity as expected (FIG. 137C-E).
[1051] These results demonstrate that C2c2 cleaves RNA using a
catalytic mechanism distinct from other known CRISPR-associated
RNases. In particular, the type III Csm and Cmr multiprotein
complexes rely on acidic residues of RRM domains for catalysis,
whereas C2c2 achieves RNA cleavage through conserved basic residues
of its two HEPN domains.
Sequence and Structural Requirements of C2c2 crRNA
[1052] Similar to the type V-B (Cpf1) systems (B. Zetsche et al.,
Cpf1 is a single RNA-guided endonuclease of a class 2 CRISPR-Cas
system. Cell 163, 759-771 (2015)), the LshC2c2 crRNA contains a
single stem loop in the direct repeat (DR), suggesting that the
secondary structure of the crRNA could facilitate interaction with
LshC2c2. To explore this possibility, we first investigated the
length requirements of the spacer sequence for ssRNA cleavage and
found that LshC2c2 requires spacers of at least 22 nt length to
efficiently cleave ssRNA target 1 (FIG. 120A). We also found that
the stem-loop structure of the crRNA is critical for ssRNA cleavage
because DR truncations that disturbed the stem loop abrogated
target cleavage (FIG. 120B). Thus, a DR longer than 24 nt is
required to maintain the stem loop necessary for LshC2c2 to mediate
ssRNA cleavage.
[1053] Next, we studied the effects of modifications in the stem
and loop of the crRNA DR on the cleavage activity. Single basepair
inversions in the stem that preserved the stem structure did not
affect the activity of the LshC2c2 complex but inverting all four
G-C pairs in the stem eliminated the cleavage despite maintaining
the duplex structure (FIG. 121A). Other perturbations that
introduced kinks and reduced or increased base-pairing in the stem
also eliminated or significantly suppressed cleavage, suggesting
that the crRNA stem length is important for complex formation and
activity (FIG. 121A). Through a series of modifications, we found
that loop deletions eliminated cleavage, whereas insertions and
substitutions mostly maintained some level of cleavage activity
(FIG. 121B). Together, these results demonstrate that LshC2c2
recognizes structural characteristics of its cognate crRNA but is
amenable to loop insertions and most tested base substitutions.
These results have implications for the future application of
C2c2-based tools that require guide engineering for recruitment of
effectors or modulation of activity (S. Kiani et al., Cas9 gRNA
engineering for genome editing, activation and repression. Nat
Methods 12, 1051-1054 (2015); S. Konermann et al., Genome-scale
transcriptional activation by an engineered CRISPR-Cas9 complex.
Nature 517, 583-588 (2015); J. E. Dahlman et al., Orthogonal gene
knockout and activation with a catalytically active Cas9 nuclease.
Nat Biotechnol 33, 1159-1161 (2015)).
C2c2 Cleavage is Sensitive to Double Mismatches in the crRNA-Target
Duplex
[1054] We tested the sensitivity of the LshC2c2 system to single
mismatches between the crRNA guide and target RNA by mutating
single bases across the spacer to the respective complementary
bases (e.g., A to U) and quantified plaque formation with these
mismatched spacers in the MS2 infection assay (FIG. 122A and FIG.
138). We found that C2c2 was fully tolerant to single mismatches
across the spacer as such mismatched spacers interfered with phage
propagation with similar efficiency as fully matched spacers.
However, when we introduced consecutive double substitutions in the
spacer, we found .about.3 log-fold reduction in the protection for
mismatches in the center, but not at the 5'- or 3'-end, of the
crRNA (FIG. 122B and FIG. 138). This observation indicates the
presence of a mismatch-sensitive "seed region" in the center of the
crRNA-target duplex.
[1055] We further evaluated the requirements of LshC2c2 for the
guide and target to match in vitro. To this end, we generated a set
of in vitro transcribed crRNAs with mismatches similarly positioned
across the spacer region. When incubated with LshC2c2 protein, all
single mismatched crRNA supported cleavage (FIG. 122C), in
agreement with our in vivo findings. When tested with a set of
consecutive double mutant crRNAs, LshC2c2 was unable to cleave the
target RNA if the mismatches were positioned in the center, but not
at the 5'- or 3'-end of the crRNA (FIG. 122D), supporting the
existence of a core seed region.
[1056] Sensitivity of the LshC2c2 system to double and triple
mismatches was also evaluated. Double mismatches were spaced apart
(FIG. 143A) whereas triple mismatches were consecutive (FIG. 143B).
Cleavage sensitivity was position dependent. Mismatches proximal to
the DR region did not support cleavage whereas distal mismatches
supported detectable cleavage.
[1057] The LshC2c2 system is also sensitive to mismatches and
deletions in the direct repeat region. Single mismatches and single
base deletions were generally sufficient to disrupt ssRNA cleavage.
Only one mismatch (mutant 7) supported a low level of cleavage
activity (FIG. 144).
C2c2 can be Reprogrammed to Mediate Specific mRNA Knockdown In
Vivo
[1058] Given the ability of C2c2 to cleave target ssRNA in a crRNA
sequence-specific manner, we tested whether LshC2c2 can be
reprogrammed to degrade selected non-phage ssRNA targets, and
particularly mRNAs, in vivo. To this end, we co-transformed E. coli
with a plasmid encoding LshC2c2 and a crRNA targeting the mRNA of
red fluorescent protein (RFP) as well as a compatible plasmid
expressing RFP (FIG. 123A). We observed an approximately 20% to 92%
decrease in RFP positive cells for crRNAs targeting protospacers
flanked by C, A, or U PAMs for OD-matched samples (FIG. 123B, C).
As a control, we tested crRNAs containing reverse complements
(targeting the dsDNA plasmid) of the top performing RFP
mRNA-targeting spacers. As expected, we observed no decrease in RFP
fluorescence by these crRNAs (FIG. 123B). We also confirmed that
mutation of the catalytic arginine residues in either HEPN domain
to alanine precluded RFP knockdown (FIG. 139). Thus, C2c2 is
capable of general retargeting to arbitrary ssRNA substrates,
governed exclusively by predictable nucleic-acid interactions.
[1059] When we examined the growth rate of cells carrying the
RFP-targeting spacer with the greatest level of RFP knockdown, we
noted that the rate was significantly reduced (FIG. 123A, spacer
7). To determine the cause for this growth restriction, we
investigated whether the effect on growth was mediated by the RFP
mRNA-targeting activity of LshC2c2 by introducing an inducible-RFP
plasmid and an RFP-targeting LshC2c2 locus into E. coli. Using this
system, we found that upon induction of RFP transcription, cells
with RFP knockdown showed substantial growth suppression, which was
not observed in non-targeting controls (FIG. 123D, E). However, in
the absence of RFP transcription, we did not observe any growth
restriction nor did we observe any transcription-dependent DNA
targeting in our biochemical experiment (FIG. 135), which suggests
that RNA-targeting is likely the primary driver of this growth
restriction phenotype. Without wishing to be bound by theory, one
possible explanation for this effect is that C2c2 CRISPR systems
might function to prevent virus reproduction by indiscriminately
cleaving cellular mRNAs and causing reduced cell division,
programmed cell death (PCD) or dormancy (K. S. Makarova, Y. I.
Wolf, E. V. Koonin, Comprehensive comparative-genomic analysis of
type 2 toxin-antitoxin systems and related mobile stress response
systems in prokaryotes. Biol Direct 4, 19 (2009); F. Hayes, L. Van
Melderen, Toxins-antitoxins: diversity, evolution and function.
Crit Rev Biochem Mol Biol 46, 386-408 (2011)).
C2c2 Cleaves Collateral RNA in Addition to crRNA-Targeted ssRNA
[1060] In contrast to Cas9 and Cpf1, which cleave DNA within the
crRNA-target heteroduplex at a defined position, reverting into an
inactive state after cleavage, C2c2 cleaves the target RNA outside
of the crRNA binding site at varying distances depending on
flanking sequence, presumably within exposed ssRNA loop regions
(FIG. 118D-I). This observed flexibility in cleavage distance lead
us to consider the possibility of cleavage of nearby non-target
ssRNAs upon C2C2 target binding and activation. Accordingly, C2c2
could cause PCD through a two-part mechanism: a priming stage in
which C2c2-crRNA complexes bind to target sites and cleave ssRNA in
a crRNA-guided fashion and a second stage in which primed C2c2
cleaves non-targeted, collateral RNA non-specifically. To test this
hypothesis, we carried out in vitro cleavage reactions that
included, in addition to LshC2c2, crRNA and its target RNA, one of
four unrelated RNA molecules without any complementarity to the
crRNA guide (FIG. 124A). These experiments showed that, whereas the
LshC2c2-crRNA complex did not mediate cleavage of any of the four
collateral RNAs in the absence of the target RNA, all four were
efficiently degraded in the presence of the target RNA (FIG. 124B
and FIG. 140A). Furthermore, R597A and R1278A HEPN mutants were
unable to cleave collateral RNA (FIG. 140B). These results indicate
a HEPN-dependent mechanism whereby C2c2 in a complex with crRNA is
activated upon binding to target RNA and subsequently cleaves any
nearby ssRNA targets. Such promiscuous RNA cleavage may cause
cellular toxicity, resulting in the observed growth rate
inhibition. These findings imply that, in addition to their role in
direct suppression of RNA viruses, type VI CRISPR-Cas systems could
function as mediators of a distinct variety of PCD/dormancy
induction that is specifically triggered by the cognate invader
genomes (FIG. 125). Under this scenario, dormancy would slow the
infection and supply additional time for adaptive immunity to
succeed; when adaptive immunity fails, the suicidal role of C2c2
would prevail and spread of the infection would be limited. Such a
mechanism falls within the previously proposed scheme of coupling
between adaptive immunity and PCD during the CRISPR-Cas defensive
response (K. S. Makarova, V. Anantharaman, L. Aravind, E. V.
Koonin, Live virus-free or die: coupling of antivirus immunity and
programmed suicide or dormancy in prokaryotes. Biol Direct 7, 40
(2012)).
Example 8: Expression of C2c2 in Eukaryotic Cells
[1061] A number of C2c2 orthologues were codon optimized for
expression in mammalian cells using a mammalian expression vector.
The various C2c2 orthologues were transfected in HEK293T cells and
cellular localization was evaluated based on mCerry expression.
Cytoplasmic localization as well as nuclear localization of the
C2c2 protein was observed.
Example 9: Activity of C2c2 in Eukaryotic Cells
[1062] A luciferase targeting assay was performed with different
gRNAs directed against the C2c2 protein. Efficient knockdown was
observed.
[1063] A targeting assay based on GFP expression was performed with
gRNAs directed against EGFP. Expression of GFP was determined and
compared to non-targeting (NT) gRNA. Here too efficient knockdown
was observed.
[1064] A targeting assay was performed on different endogenous
target genes in HEK293 cells with gRNAs directed against endogenous
target genes. C2c2. Expression protein expression of the respective
target genes was determined (compared to non-targeting (NT) gRNA).
Efficient knockdown of the different target genes was observed.
Methodology for the Examples
Cloning of C2c2 Locus and Screening Library
[1065] Genomic DNA from Leptotrichia shahii DSM 19757 (ATCC) was
extracted using the Blood & Cell Culture DNA Mini Kit (Qiagen)
and the C2c2 CRISPR locus was PCR amplified and cloned into a
pACYC184 backbone with chloramphenicol resistance. For retargeting
of the locus to MS2 phage or endogenous targets, the wild type
spacers in the array were removed and replaced with a Eco31I
landing site an additional spacer and a degenerate repeat,
compatible with Golden Gate cloning.
[1066] A custom library consisting of all possible spacers
targeting the genome of the bacteriophage MS2, excluding spacers
containing the Eco31I restriction site, was synthesized by Twist
Biosciences, cloned into the retargeting backbone with Golden Gate
cloning, transformed into Endura Duo electrocompetent cells
(Lucigen) and subsequently purified using a NucleoBond Xtra
MaxiPrep EF (Machery-Nagel).
Bacterial Interference Assay
[1067] For the phage screen, 50 ng of the plasmid library were
transformed into NovaBlue(DE3) Competent Cells (EMD Millipore)
followed by an outgrowth at 37.degree. C. for 30 minutes. Cells
were then grown in Luria broth (LB) supplemented with 25 .mu.g/mL
chloramphenicol (Sigma) in a volume of 4.5 mL. Phage conditions
were treated with 7*10{circumflex over ( )}10 PFU of Bacteriophage
MS2 (ATCC). After 3 hours of shaking incubation at 37.degree. C.,
samples were plated on LB-agar plates supplemented with
chloramphenicol and harvested after 16 hours. DNA was extracted
using NucleoBond Xtra MaxiPrep EF (Machery-Nagel), PCR amplified,
and sequenced using a MiSeq (Illumina) with a paired-end 150 cycle
kit.
[1068] To determine enriched spacers, spacer regions were
extracted, counted, and normalized to total reads for each sample.
For a given PAM, enrichment was measured as the log ratio compared
to input library, with a 0.01 psuedocount adjustment. PAMs above a
1.3 enrichment threshold that occurred in both biological
replicates were used to generate sequence logos (G. E. Crooks, G.
Hon, J. M. Chandonia, S. E. Brenner, WebLogo: a sequence logo
generator. Genome research 14, 1188-1190 (2004)).
[1069] To test individual spacers for MS2 interference, the oligos
were ordered from IDT, annealed and phosphorylated with
polynucleotide kinase (New England Biosciences) and cloned into the
locus backbone with Golden Gate cloning. Plasmids were transformed
into C3000 strain E. coli, made competent with the Mix and Go kit
(Zymo Research). C3000 cells were seeded from an overnight culture
grown to OD600 of 2, at which point they were diluted 1:13 in Top
Agar and poured on LB-chloramphenicol plates. Dilutions of MS2
phage were then spotted on the plates using a multichannel pipette,
and the creation of plaques was recorded after overnight
incubation.
RFP Targeting Assay
[1070] An ampicillin resistant RFP-expressing plasmid (pRFP) was
transformed into DH5-alpha cells (New England Biolabs). Cells
containing pRFP were then made chemically competent (Zymo Research
Mix and Go) to be used for downstream targeting experiments with
pLshC2c2. Spacers targeting RFP mRNA were cloned into pLshC2c2 and
these plasmids were transformed into the chemically competent
DH5-alpha pRFP cells. Cells were then grown overnight under double
selection in LB and subjected to analysis by flow cytometry when
they reached an OD600 of 4.0. Knockdown efficiency was quantified
as the percent of RFP positive cells compared to a non-targeting
spacer control (the endogenous LshC2c2 locus in pACYC 184).
[1071] To interrogate the effect of LshC2c2 activity on the growth
of the host cells, we created a TetR-inducible version of the RFP
plasmid in pBR322 (pBR322_RFP). We transformed E. coli cells with
this vector and then made them chemically competent (Zymo Research
Mix and Go) to prepare them for downstream experiments. We cloned
pLshC2c2 plasmids with various spacers targeting RFP mRNA as well
as their reverse complement controls and transformed them into E.
coli cells carrying pBR322_RFP and streaked them on
double-selection plates to maintain both plasmids. Colonies were
then picked and grown overnight in LB with double selection.
Bacteria were diluted to an OD600 of 0.1 and grown at 37C for 1
hour with chloramphenicol selection only. RFP expression was then
induced using 350 ng/mL of anhydrotetracycline and OD measurements
were taken every 5 minutes under continuous shaking in a BioTek
Synergy 2 microplate reader.
C2c2 Nucleic Acid Preparation
[1072] The mammalian codon-optimized gene for C2c2 (Leptotrichia
shahii) was synthesized (GenScript) and cloned into a bacterial
expression plasmid. E. coli cells (BL21(DE3)) were transformed and
grown overnight at 37.degree. C. The protein was then purified
using histidine-tags and Ni-NTA affinity columns and then further
purified using FPLC gel filtration.
[1073] Nucleic acid templates for T7 transcription were synthesized
from IDT. Templates for crRNAs were annealed to a short T7 primer
and incubated with T7 polymerase overnight at 37.degree. C.
Templates for targeting in nuclease assays were made double
stranded using PCR and then incubated with T7 polymerase at
30.degree. C. overnight.
[1074] 5' end labeling was accomplished using the 5'
oligonucleotide kit (VectorLabs) and with a maleimide-IR800 probe
(Licor). 3' end labeling was performed using a 3' oligonucleotide
labeling kit (Sigma) using ddUTP-Cy5. Labeled probes were purified
using Clean and Concentrator columns (Zymo).
C2c2 Protein Purification
[1075] The mammalian codon-optimized gene for C2c2 (Leptotrichia
shahii) was synthesized (GenScript) and cloned into a bacterial
expression vector (6-His-MBP-TEV-Cpf1, a pET based vector kindly
given to us by Doug Daniels ("6-His" disclosed as SEQ ID NO: 200)).
12 liters of Terrific Broth growth media with 100 .mu.g/mL
ampicillin was inoculated with 10 mL overnight culture One
Shot.RTM. BL21(DE3)pLysE (Invitrogen) cells containing the LshC2c2
expression construct. Growth media plus inoculant was grown at
37.degree. C. until the cell density reached 0.2 OD600, then the
temperature was decreased to 21.degree. C. Growth was continued
until OD600 reached 0.6 when a final concentration of 500 .mu.M
IPTG was added to induce MBP-C2c2 expression. The culture was
induced for 14-18 hours before harvesting cells and freezing at
-80.degree. C. until purification.
[1076] Cell paste was resuspended in 200 mL of Lysis Buffer (50 mM
Hepes pH 7, 2M NaCl, 5 mM MgCl2, 20 mM imidazole) supplemented with
protease inhibitors (Roche cOmplete, EDTA-free) and lysozyme. Once
homogenized, cells were lysed by sonication (Branson Sonifier 450)
then centrifuged at 10,000g for 1 hour to clear the lysate. The
lysate was filtered through 0.22 micron filters (Millipore,
Stericup) applied to a Ni-NTA superflow nickel resin (Qiagen),
washed, and then eluted with a gradient of imidazole. Fractions
containing protein of the expected size were pooled, TEV protease
(Sigma) was added, and the sample was dialyzed overnight into TEV
buffer (500 mM NaCl, 50 mM Hepes pH 7, 5 mM MgCl, 2 mM DTT). After
dialysis, TEV cleavage was confirmed by SDS-PAGE, and the sample
was concentrated to 500 pLL prior to loading on a gel filtration
column (HiLoad 16/600 Superdex 200) via FPLC (AKTA Pure). Fractions
from gel filtration were analyzed by SDS-PAGE; fractions containing
C2c2 were pooled and concentrated to 200 .mu.L and either used
directly for biochemical assays or frozen at -80.degree. C. for
storage. Gel filtration standards were run on the same column
equilibrated in 2M NaCl, Hepes pH 7.0 to calculate the approximate
size of LshC2c2.
Nucleic Acid Target Preparation
[1077] DNA oligo templates for T7 transcription were ordered from
IDT. Templates for crRNAs were annealed to a short T7 primer and
incubated with T7 polymerase overnight at 30.degree. C. using the
HiScribe T7 Quick High Yield RNA Synthesis kit (New England
Biolabs). Target templates were PCR amplified to yield dsDNA and
then incubated with T7 polymerase at 30.degree. C. overnight using
the same kit.
[1078] 5' end labeling was accomplished using the 5'
oligonucleotide kit (VectorLabs) and with a maleimide-IR800 probe
(Licor). 3' end labeling was performed using a 3' oligonucleotide
labeling kit (Sigma) using ddUTP-Cy5. Labeled probes were purified
using Clean and Concentrator columns (Zymo Research).
Nuclease Assay
[1079] Nuclease assays were performed with 160 nM of end-labeled
ssRNA target, 200 nM purified LshC2c2, and 100 nM crRNA, unless
otherwise indicated, in nuclease assay buffer (40 mM Tris-HCl, 60
mM NaCl, 6 mM MgCl2, pH 7.3). Reactions were allowed to proceed for
1 hour at 37.degree. C. (unless otherwise indicated) and were then
quenched with proteinase K and EDTA for 15 minutes at 37.degree. C.
The reactions were then denatured with 6M urea denaturing buffer at
95.degree. C. for 5 minutes. Samples were analyzed by gel
electrophoresis on 10% PAGE TBE-Urea run at 45.degree. C. Gels were
imaged using a Licor Odyssey scanner.
Electrophoretic Mobility Shift Assay
[1080] Target ssRNA binding experiments were performed with a
series of half-log complex dilutions (crRNA and LshC2c2) from 2
.mu.M to 0.2 .mu.M (or 11 .mu.M to 0.1 .mu.M in the case of R1278A
LshC2c2). Binding assays were performed in nuclease assay buffer
supplemented with 10 mM EDTA to prevent cutting, 5% glycerol, and
10 .mu.g/mL heparin in order to avoid non-specific interactions of
the complex with target RNA. Reactions were incubated at 37.degree.
C. for 20 minutes and then resolved on 6% PAGE TBE gels at
4.degree. C. (using 0.5X TBE buffer). Gels were imaged using the
Licor Odyssey scanner.
NGS of In Vitro Cleaved RNA
[1081] In vitro nuclease assays were performed as described above
using unlabeled ssRNA targets. After one hour, samples were
quenched with proteinase K+EDTA and then column purified (Zymo
Clean and Concentrator). The RNA samples were then PNK and 5'
polyphosphatase treated (Epicentre) before preparing a library for
NGS using NEBNext Small RNA Library Prep Set for Illumina
sequencing. Libraries were sequenced on an Illumina MiSeq to
sufficient depth and analyzed using the alignment tool BWA (H. Li,
R. Durbin, Fast and accurate short read alignment with
Burrows-Wheeler transform. Bioinformatics 25, 1754-1760
(2009)).
In Vitro Co-Transcriptional DNA Cleavage Assay
[1082] The E. coli RNAP co-transcriptional DNA cleavage assay was
performed essentially as described previously (Samai et al., Cell,
2015). Briefly, 0.8 .mu.mol of ssDNA template strand were annealed
with 1.6 .mu.mol of RNA in transcription buffer (from E. coli RNAP
core enzyme New England Biolabs) without magnesium to prevent RNA
hydrolysis. 0.75 ul of E. coli RNAP core enzyme and Magnesium were
added and the reaction incubated at 25.degree. C. for 30 min and
then transferred to 37.degree. C. l.mu.mol of freshly denatured
nontemplate strand (NTS) were added and incubated at 37.degree. C.
for 15 min to obtain elongation complexes (ECs). 4 .mu.mol of
LshC2C2-crRNA complexes along with 1.25 mM of RNTPs were added to
the ECs and transcription was allowed to proceed for 1 h at
37.degree. C. DNA was resolved on a 10% PAGE TBE-Urea gels
following RNase and proteinase K treatment.
[1083] Aspects of the Invention are Further Described in the
Following Numbered Paragraphs:
1. A method of modifying a target locus of interest, the method
comprising delivering to said locus a non-naturally occurring or
engineered composition comprising a C2c2 effector protein and one
or more nucleic acid components, wherein the effector protein forms
a complex with the one or more nucleic acid components, the one or
more nucleic acid components directs the complex to the target
locus of interest and the complex binds to the target locus of
interest. 2. The method of numbered paragraph 1, wherein the target
locus of interest comprises RNA. 3. The method of numbered
paragraph 1 or 2, wherein the modification of the target locus of
interest comprises a nucleotide strand break. 4. The method of
numbered paragraph 1 or 2, wherein the C2c2 effector protein is
codon optimized for expression in a eukaryotic cell. 5. The method
of numbered paragraph 1 or 2, wherein the C2c2 effector protein is
associated with one or more functional domains; and optionally the
effector protein contains one or more mutations optionally within
an HEPN Domain, such as R597A, H602A, R1278A, and/or H1283A,
whereby the complex can deliver an epigenentic modifier or a
transcriptional or translational activation or repression signal.
6. The method of numbered paragraph 5, wherein the functional
domain modifies transcription or translation of the target locus.
7. The method of any one of numbered paragraphs 1 to 6, wherein the
C2c2 effector protein comprises at least one or more nuclear
localization signals. 8. The method of numbered paragraph 1,
wherein the target locus of interest is provided via a nucleic acid
molecule in vitro. 9. The method of numbered paragraph 1, wherein
the target locus of interest is provided via a nucleic acid
molecule within a cell. 10. The method of numbered paragraph 9,
wherein the cell comprises a prokaryotic cell. 11. The method of
numbered paragraph 9, wherein the cell comprises a eukaryotic cell.
12. The method of any one of the preceding numbered paragraph,
wherein when in complex with the effector protein the nucleic acid
component(s) is capable of effecting sequence specific binding of
the complex to a target sequence of the target locus of interest.
13. The method of any one of the preceding numbered paragraphs,
wherein the nucleic acid component(s) comprise a dual direct repeat
sequence. 14. The method of any one of the preceding numbered
paragraphs, wherein the effector protein and nucleic acid
component(s) are provided via one or more polynucleotide molecules
encoding the polypeptides and/or the nucleic acid component(s), and
wherein the one or more polynucleotide molecules are operably
configured to express the polypeptides and/or the nucleic acid
component(s). 15. The method of numbered paragraph 14, wherein the
one or more polynucleotide molecules comprise one or more
regulatory elements operably configured to express the polypeptides
and/or the nucleic acid component(s), optionally wherein the one or
more regulatory elements comprise a promoter(s) or inducible
promotor(s). 16. The method of numbered paragraph 14 or 15, wherein
the one or more polynucleotide molecules are comprised within one
or more vectors. 17. The method of numbered paragraph 14 or 15,
wherein the one or more polynucleotide molecules are comprised
within one vector. 18. The method of numbered paragraph 16 or 17,
wherein the one or more vectors comprise viral vectors. 19. The
method of numbered paragraph 18, wherein the one or more viral
vectors comprise one or more retroviral, lentiviral, adenoviral,
adeno-associated or herpes simplex viral vectors. 20. The method of
any one of numbered paragraph 14 to 15 wherein the one or more
polynucleotide molecules are comprised in a delivery system, or the
method of numbered paragraph 16 or 17 wherein the one or more
vectors are comprised in a delivery system, or the method of any
one of numbered paragraphs 1-13 wherein the assembled complex are
comprised in a delivery system. 21. The method of any one of the
preceding numbered paragraphs, wherein the non-naturally occurring
or engineered composition is delivered via a delivery vehicle
comprising liposome(s), particle(s), exosome(s), microvesicle(s), a
gene-gun or one or more viral vector(s). 22. A non-naturally
occurring or engineered composition which is a composition having
the characteristics as defined in any one of the preceding numbered
paragraphs. 23. A non-naturally occurring or engineered composition
comprising a C2c2 effector protein and one or more nucleic acid
components, wherein the effector protein forms a complex with the
one or more nucleic acid components, the one or more nucleic acid
components directs the complex to the target of interest and the
complex binds to the target locus of interest. 24. The composition
of numbered paragraph 23, wherein the target locus of interest
comprises RNA. 25. The composition of numbered paragraph 23 or 24,
wherein the modification of the target locus of interest comprises
a nucleotide strand break. 26. The composition of numbered
paragraph 23 or 24, wherein the C2c2 effector protein is codon
optimized for expression in a eukaryotic cell. 27. The composition
of numbered paragraph 23 or 24, wherein the C2c2 effector protein
is associated with one or more functional domains; and optionally
the effector protein contains one or more mutations optionally
within an HEPN Domain, such as R597A, H602A, R1278A, and/or H1283A,
whereby the complex can deliver an epigenentic modifier or a
transcriptional or translational activation or repression signal.
28. The composition of numbered paragraph 27, wherein the
functional domain modifies transcription or translation of the
target locus. 29. The composition of any one of numbered paragraphs
23 to 28, wherein the C2c2 effector protein comprises at least one
or more nuclear localization signals. 30. The composition of
numbered paragraph 23, wherein the target locus of interest is
comprised in a nucleic acid molecule in vitro. 31. The composition
of numbered paragraph 23, wherein the target locus of interest is
comprised in a nucleic acid molecule within a cell. 32. The
composition of numbered paragraph 31, wherein the cell comprises a
prokaryotic cell. 33. The composition of numbered paragraph 31,
wherein the cell comprises a eukaryotic cell. 34. The composition
of any one of numbered paragraphs 23-33, wherein when in complex
with the effector protein the nucleic acid component(s) is capable
of effecting sequence specific binding of the complex to a target
sequence of the target locus of interest. 35. The composition of
any one of numbered paragraphs 23-34, wherein the nucleic acid
component(s) comprise a dual direct repeat sequence. 36. The
composition of any one of numbered paragraphs 23-34, wherein the
effector protein and nucleic acid component(s) are provided via one
or more polynucleotide molecules encoding the polypeptides and/or
the nucleic acid component(s), and wherein the one or more
polynucleotide molecules are operably configured to express the
polypeptides and/or the nucleic acid component(s). 37. The
composition of numbered paragraph 36, wherein the one or more
polynucleotide molecules comprise one or more regulatory elements
operably configured to express the polypeptides and/or the nucleic
acid component(s), optionally wherein the one or more regulatory
elements comprise a promoter(s) or inducible promotor(s). 38. The
composition of numbered paragraph 36 or 37, wherein the one or more
polynucleotide molecules are comprised within one or more vectors.
39. The composition of numbered paragraph 36 or 37, wherein the one
or more polynucleotide molecules are comprised within one vector.
40. The composition of numbered paragraph 38 or 39, wherein the one
or more vectors comprise viral vectors. 41. The composition of
numbered paragraph 40, wherein the one or more viral vectors
comprise one or more retroviral, lentiviral, adenoviral,
adeno-associated or herpes simplex viral vectors. 42. The
composition of any one of numbered paragraphs 36 to 37 wherein the
one or more polynucleotide molecules are comprised in a delivery
system, or the composition of numbered paragraph 38 or 39 wherein
the one or more vectors are comprised in a delivery system, or the
composition of any one of numbered paragraphs 23-35 wherein the
assembled complex are comprised in a delivery system. 43. The
composition of any one of the preceding numbered paragraphs,
wherein the non-naturally occurring or engineered composition is
delivered via a delivery vehicle comprising liposome(s),
particle(s), exosome(s), microvesicle(s), a gene-gun or one or more
viral vector(s). 44. A vector system comprising one or more
vectors, the one or more vectors comprising one or more
polynucleotide molecules encoding components of a non-naturally
occurring or engineered composition which is a composition having
the characteristics as defined in any one of the preceding numbered
paragraphs. 45. A delivery system configured to deliver a C2c2
effector protein and one or more nucleic acid components of a
non-naturally occurring or engineered composition which is a
composition having the characteristics as defined in any one of the
preceding numbered paragraphs. 46. The delivery system of numbered
paragraph 45, which comprises one or more vectors or one or more
polynucleotide molecules, the one or more vectors or polynucleotide
molecules comprising one or more polynucleotide molecules encoding
the C2c2 effector protein and one or more nucleic acid components
of the non-naturally occurring or engineered composition having the
characteristics as defined in any one of the preceding numbered
paragraphs. 47. The non-naturally occurring or engineered
composition, vector system, or delivery system of any of the
preceding or subsequent numbered paragraphs for use in a
therapeutic method of treatment. 48. A cell modified according to
the method, or engineered to comprise or express, optionally
inducibly or constituently, the composition or a component thereof
of any one of the preceding or subsequent numbered paragraphs. 49.
The cell according to numbered paragraph 48, wherein the
modification results in: [1084] the cell comprising altered
transcription or translation of at least one RNA product; [1085]
the cell comprising altered transcription or translation of at
least one RNA product, wherein the expression of the at least one
product is increased; or [1086] the cell comprising altered
transcription or translation of at least one RNA product, wherein
the expression of the at least one product is decreased. 50. The
cell of numbered paragraph 49, wherein the cell comprises a
eukaryotic cell. 51. The cell according to any one of numbered
paragraph 48 or 49, wherein the comprises a mammalian cell. 52. The
cell of numbered paragraph 48 wherein the cell comprises a
prokaryotic cell. 53. The non-naturally occurring or engineered
composition, vector system, or delivery system of any preceding
claim, for use in: [1087] RNA sequence specific interference,
[1088] RNA sequence specific gene regulation, [1089] screening of
RNA or RNA products or lincRNA or non-coding RNA, or nuclear RNA,
or mRNA, [1090] mutagenesis, [1091] Fluorescence in situ
hybridization, [1092] breeding, [1093] in vitro or in vivo
induction of cell dormancy, [1094] in vitro or in vivo induction of
cell cycle arrest, [1095] in vitro or in vivo reduction of cell
growth and/or cell proliferation, [1096] in vitro or in vivo
induction of cell anergy, [1097] in vitro or in vivo induction of
cell apoptosis, [1098] in vitro or in vivo induction of cell
necrosis, [1099] in vitro or in vivo induction of cell death, or
[1100] in vitro or in vivo induction of programmed cell death. 54.
A cell line of or comprising the cell according to any one of
numbered paragraphs 48-52, or progeny thereof. 55. A multicellular
organism comprising one or more cells according to numbered
paragraph 50 or 51. 56. A plant or animal model comprising one or
more cells according to any one of numbered paragraphs 48-51; said
cell(s) optionally inducibly or constituently expressing the
composition or a component thereof of any one of the preceding
numbered paragraphs. 57. A product from a cell of any one of
numbered paragraphs, or cell line or the organism of claim or the
plant or animal model of any of numbered paragraphs 47-52, 54-56;
said cell or cell(s) of the cell line or organism or plant or
animal model optionally inducibly or constituently expressing the
composition or a component thereof of any one of the preceding
numbered paragraphs. 58. The product of numbered paragraph 57,
wherein the amount of product is greater than or less than the
amount of product from a cell that has not had alteration or
modification by a method or composition of any of the preceding
numbered paragraphs. 59. The product of numbered paragraph 57,
wherein the product is altered in comparison with the product from
a cell that has not had alteration or modification by a method or
composition of any of the preceding numbered paragraphs. 60. An
assay, screening method or mutagenesis method comprising a system
or method or cells of any one of the preceding or subsequent
numbered paragraphs. 61. In an RNA-based assay, screening method or
mutagenesis method wherein the improvement comprises, instead of
using RNA, the method comprises using a composition as in any of
the preceding numbered paragraphs. 62. The method of numbered
paragraph 61 wherein the RNA-based assay, screening method or
mutagenesis method is an RNAi or Fluorescence in situ hybridization
method. 63. Use of the non-naturally occurring or engineered
composition, vector system, or delivery system of any preceding
numbered paragraph for: [1101] RNA sequence specific interference,
[1102] RNA sequence specific gene regulation, [1103] screening of
RNA or RNA products or lincRNA or non-coding RNA, or nuclear RNA,
or mRNA, [1104] mutagenesis, [1105] Fluorescence in situ
hybridization, [1106] breeding, [1107] in vitro or in vivo
induction of cell dormancy, [1108] in vitro or in vivo induction of
cell cycle arrest, [1109] in vitro or in vivo reduction of cell
growth and/or cell proliferation, [1110] in vitro or in vivo
induction of cell anergy, [1111] in vitro or in vivo induction of
cell apoptosis, [1112] in vitro or in vivo induction of cell
necrosis, [1113] in vitro or in vivo induction of cell death, or
[1114] in vitro or in vivo induction of programmed cell death. 64.
The method according to any of numbered paragraphs 1 to 21, wherein
said method results in: [1115] RNA sequence specific interference,
[1116] RNA sequence specific gene regulation, [1117] screening of
RNA or RNA products or lincRNA or non-coding RNA, or nuclear RNA,
or mRNA, [1118] mutagenesis, [1119] Fluorescence in situ
hybridization, [1120] breeding, [1121] in vitro or in vivo
induction of cell dormancy, [1122] in vitro or in vivo induction of
cell cycle arrest, [1123] in vitro or in vivo reduction of cell
growth and/or cell proliferation,
[1124] in vitro or in vivo induction of cell anergy, [1125] in
vitro or in vivo induction of cell apoptosis, [1126] in vitro or in
vivo induction of cell necrosis, [1127] in vitro or in vivo
induction of cell death, or [1128] in vitro or in vivo induction of
programmed cell death. 65. A method for: [1129] RNA sequence
specific interference, [1130] RNA sequence specific gene
regulation, [1131] screening of RNA or RNA products or lincRNA or
non-coding RNA, or nuclear RNA, or mRNA, [1132] mutagenesis, [1133]
Fluorescence in situ hybridization, [1134] breeding, [1135] in
vitro or in vivo induction of cell dormancy, [1136] in vitro or in
vivo induction of cell cycle arrest, [1137] in vitro or in vivo
reduction of cell growth and/or cell proliferation, [1138] in vitro
or in vivo induction of cell anergy, [1139] in vitro or in vivo
induction of cell apoptosis, [1140] in vitro or in vivo induction
of cell necrosis, [1141] in vitro or in vivo induction of cell
death, or [1142] in vitro or in vivo induction of programmed cell
death comprising introducing or inducing in vitro or in vivo in a
target cell the non-naturally occurring or engineered composition,
vector system, or delivery system of any preceding numbered
paragraph. 66. An engineered, non-naturally occurring CRISPR-Cas
system comprising one or more vectors comprising:
[1143] a) a first regulatory element operable in a eukaryotic or
prokaryotic cell operably linked to at least one nucleotide
sequence encoding a CRISPR-Cas system guide RNA that hybridizes
with a target sequence of an RNA molecule encoded by a DNA molecule
in a eukaryotic or prokaryotic cell, wherein the DNA molecule
encodes and the eukaryotic or prokaryotic cell expresses at least
one gene product, and
[1144] b) a second regulatory element operable in a eukaryotic or
prokaryotic cell operably linked to a nucleotide sequence encoding
a Type-II C2c2 effector protein, wherein components (a) and (b) are
located on same or different vectors of the system,
[1145] whereby the guide RNA targets and hybridizes with the target
sequence and the C2c2 effector protein cleaves the RNA
molecule,
[1146] whereby expression of the at least one gene product is
altered; and, wherein the C2c2 effector protein and the guide RNA
do not naturally occur together.
67. An engineered, non-naturally occurring composition comprising a
CRISPR-Cas system, said system comprising a functional CRISPR C2c2
effector protein and guide RNA (gRNA);
[1147] wherein the gRNA comprises a dead guide sequence;
[1148] whereby the gRNA is capable of hybridizing to a target
sequence;
[1149] whereby the CRISPR-Cas system is directed to the target
sequence with reduced indel activity resultant from nuclease
activity of a non-mutant C2c2 effector protein of the system.
68. A method of inhibiting cell growth, the method comprising
delivering to the cell a non-naturally occurring or engineered
composition comprising a functional CRISPR C2c2 effector protein
and guide RNA (gRNA);
[1150] whereby the gRNA is capable of hybridizing to a target RNA
sequence of the cell;
[1151] whereby the CRISPR-Cas system is directed to the target RNA
sequence with reduced indel activity resultant from nuclease
activity of a non-mutant C2c2 effector protein of the system.
69. A CRISPR associated Cas vector system comprising one or more
vectors comprising:
[1152] a) a first regulatory element operable in a eukaryotic or
prokaryotic cell operably linked to at least one nucleotide
sequence encoding a CRISPR-Cas system guide RNA that hybridizes
with a target sequence of an RNA molecule encoded by a DNA molecule
in a eukaryotic or prokaryotic cell, wherein the DNA molecule
encodes and the eukaryotic or prokaryotic cell expresses at least
one gene product, and
[1153] b) a second regulatory element operable in a eukaryotic or
prokaryotic cell operably linked to a nucleotide sequence encoding
a Type-II C2c2 effector protein, wherein components (a) and (b) are
located on same or different vectors of the system,
[1154] whereby the guide RNA targets and hybridizes with the target
sequence and the C2c2 effector protein cleaves the RNA
molecule,
[1155] whereby expression of the at least one gene product is
altered; and, wherein the C2c2 effector protein and the guide RNA
do not naturally occur together.
[1156] While preferred embodiments of the present invention have
been shown and described herein, it will be obvious to those
skilled in the art that such embodiments are provided by way of
example only. Numerous variations, changes, and substitutions will
now occur to those skilled in the art without departing from the
invention. It should be understood that various alternatives to the
embodiments of the invention described herein may be employed in
practicing the invention. It is intended that the following claims
define the scope of the invention and that methods and structures
within the scope of these claims and their equivalents be covered
thereby.
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20190382801A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20190382801A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References