U.S. patent application number 16/406415 was filed with the patent office on 2019-12-12 for polypeptides.
The applicant listed for this patent is AFFIBODY AB. Invention is credited to Lars Abrahmsen, Caroline Ekblad.
Application Number | 20190375799 16/406415 |
Document ID | / |
Family ID | 44630120 |
Filed Date | 2019-12-12 |
View All Diagrams
United States Patent
Application |
20190375799 |
Kind Code |
A1 |
Ekblad; Caroline ; et
al. |
December 12, 2019 |
POLYPEPTIDES
Abstract
The present disclosure relates to a class of engineered
polypeptides having a binding affinity for albumin. It also relates
to new methods and uses that exploit binding by these and other
compounds to albumin in different contexts, some of which have
significance for treatment or diagnosis of disease in mammals
including humans.
Inventors: |
Ekblad; Caroline;
(Saltsjo-Boo, SE) ; Abrahmsen; Lars; (Bromma,
SE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AFFIBODY AB |
Solna |
|
SE |
|
|
Family ID: |
44630120 |
Appl. No.: |
16/406415 |
Filed: |
May 8, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14955647 |
Dec 1, 2015 |
10329331 |
|
|
16406415 |
|
|
|
|
13808713 |
Aug 20, 2013 |
9211344 |
|
|
PCT/EP2011/061623 |
Jul 8, 2011 |
|
|
|
14955647 |
|
|
|
|
61403561 |
Sep 17, 2010 |
|
|
|
61399285 |
Jul 9, 2010 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2319/31 20130101;
A61P 43/00 20180101; Y02A 50/30 20180101; C07K 14/001 20130101;
C07K 2319/21 20130101; C07K 14/315 20130101; A61K 51/081 20130101;
Y02A 50/473 20180101; A61P 35/00 20180101; C07K 2319/50 20130101;
A61K 38/00 20130101; C07K 2319/70 20130101 |
International
Class: |
C07K 14/315 20060101
C07K014/315; C07K 14/00 20060101 C07K014/00; A61K 51/08 20060101
A61K051/08 |
Claims
1-84. (canceled)
85. An albumin binding polypeptide comprising an amino acid
sequence selected from: TABLE-US-00008 i) (SEQ ID NO: 204)
LAX.sub.3AKX.sub.6X.sub.7ANX.sub.10ELDX.sub.14YGVSDFYKRLIX.sub.26KAKTVEGVE-
ALKX.sub.39X.sub.40 ILX.sub.43X.sub.44LP
wherein independently of each other X.sub.3 is selected from E, S,
Q and C; X.sub.6 is selected from E, S and C; X.sub.7 is selected
from A and S; X.sub.10 is selected from A, S and R; X.sub.14 is
selected from A, S, C and K; X.sub.26 is selected from D and E;
X.sub.39 is selected from D and E; X.sub.40 is selected from A and
E; X.sub.43 is selected from A and K; X.sub.44 is selected from A,
S and E; L in position 45 is present or absent; and P in position
46 is present or absent; and ii) an amino acid sequence which has
at least 95% identity to the sequence defined in i), provided that
X.sub.7 is neither L, E nor D.
86. The albumin binding polypeptide according to claim 85, wherein
X.sub.6 is E.
87. The albumin binding polypeptide according to claim 85, wherein
X.sub.3 is S.
88. The albumin binding polypeptide according to claim 85, wherein
X.sub.3 is E.
89. The albumin binding polypeptide according to claim 85, wherein
X.sub.7 is A.
90. The albumin binding polypeptide according to claim 85, wherein
X.sub.14 is S.
91. The albumin binding polypeptide according to claim 85, wherein
X.sub.14 is C.
92. The albumin binding polypeptide according to claim 85, wherein
X.sub.10 is A.
93. The albumin binding polypeptide according to claim 85, wherein
X.sub.10 is S.
94. The albumin binding polypeptide according to claim 85, wherein
X.sub.26 is D.
95. The albumin binding polypeptide according to claim 85, wherein
X.sub.26 is E.
96. The albumin binding polypeptide according to claim 85, wherein
X.sub.39 is D.
97. The albumin binding polypeptide according to claim 85, wherein
X.sub.39 is E.
98. The albumin binding polypeptide according to claim 85, wherein
X.sub.40 is A.
99. The albumin binding polypeptide according to claim 85, wherein
X.sub.43 is A.
100. The albumin binding polypeptide according to claim 85, wherein
X.sub.44 is A.
101. The albumin binding polypeptide according to claim 85, wherein
X.sub.44 is S.
102. The albumin binding polypeptide according to claim 85, wherein
L in position 45 is present.
103. The albumin binding polypeptide according to claim 85, wherein
P in position 46 is present.
104. The albumin binding polypeptide according to claim 85, which
binds to albumin such that the k.sub.off value of the interaction
is at most 5.times.10.sup.-5 s.sup.-1.
105. The albumin binding polypeptide according to claim 104, which
binds to albumin such that the k.sub.off value of the interaction
is at most 5.times.10.sup.-6 s.sup.-1.
106. The albumin binding polypeptide according to claim 85, whose
amino acid sequence is selected from any one of SEQ ID NO:1-144 and
SEQ ID NO:164-203.
107. The albumin binding polypeptide according to claim 106, whose
amino acid sequence is selected from any one of SEQ ID NO:4-5, SEQ
ID NO:7-8, SEQ ID NO:10-11, SEQ ID NO:13-14, SEQ ID NO:16-17, SEQ
ID NO:19-20, SEQ ID NO:22-23, SEQ ID NO:25-26, SEQ ID NO:28-29, SEQ
ID NO:31-32, SEQ ID NO:34-35, SEQ ID NO:37-38, SEQ ID NO:41-42, SEQ
ID NO:49-50, SEQ ID NO:164-170 and SEQ ID NO:192-203.
108. The albumin binding polypeptide according to claim 106, whose
amino acid sequence is selected from any one of SEQ ID
NO:1-144.
109. The albumin binding polypeptide according to claim 108, whose
amino acid sequence is selected from any one of SEQ ID NO:4-5, SEQ
ID NO:7-8, SEQ ID NO:10-11, SEQ ID NO:13-14, SEQ ID NO:16-17, SEQ
ID NO:19-20, SEQ ID NO:22-23, SEQ ID NO:25-26, SEQ ID NO:28-29, SEQ
ID NO:31-32, SEQ ID NO:34-35, SEQ ID NO:37-38, SEQ ID NO:41-42 and
SEQ ID NO:49-50.
110. The albumin binding polypeptide according to claim 85, further
comprising one or more additional amino acid residues positioned at
the N- and/or the C-terminal of the sequence defined in i).
111. The albumin binding polypeptide according to claim 110, in
which the additional amino acids comprise at least one serine
residue at the N-terminal of the polypeptide.
112. The albumin binding polypeptide according to claim 110, in
which the additional amino acids comprise a glycine residue at the
N-terminal of the polypeptide.
113. The albumin binding polypeptide according to claim 110, in
which the additional amino acids comprise a cysteine residue at the
N-terminal of the polypeptide.
114. The albumin binding polypeptide according to claim 110, in
which the additional amino acids comprise a lysine residue at the
C-terminal of the polypeptide.
115. The albumin binding polypeptide according to claim 110, in
which the additional amino acids comprise a glycine residue at the
C-terminal of the polypeptide.
116. The albumin binding polypeptide according to claim 110, in
which the additional amino acids comprise a cysteine residue at the
C-terminal of the polypeptide.
117. The albumin binding polypeptide according to claim 110, whose
amino acid sequence is selected from any one of SEQ ID NO:145-150
and SEQ ID NO:162-163.
118. The albumin binding polypeptide according to claim 85,
comprising no more than two cysteine residues.
119. The albumin binding polypeptide according to claim 118,
comprising no more than one cysteine residue.
120. The albumin binding polypeptide according to claim 85, which
binds to human serum albumin.
121. A fusion protein or conjugate comprising i) a first moiety
consisting of the albumin binding polypeptide according to claim
85; and ii) a second moiety consisting of a polypeptide having a
desired biological activity.
122. The fusion protein or conjugate according to claim 121, in
which the second moiety having a desired biological activity is a
therapeutically active polypeptide.
123. The fusion protein or conjugate according to claim 122, in
which the second moiety having a desired biological activity is
selected from the group consisting of human endogenous enzymes,
hormones, growth factors, chemokines, cytokines and
lymphokines.
124. The fusion protein or conjugate according to claim 123, in
which the second moiety is selected from the group consisting of
interleukin-2 (IL-2), glucagon-like peptide 1 (GLP-1), brain
natriuretic peptide (BNP), interleukin-1 receptor antagonist
(IL-1-RA), keratinocyte growth factor (KGF), ancestim, growth
hormone (GH), granulocyte-colony stimulating factor (G-CSF),
cytotoxic T lymphocyte-associated protein 4 (CTLA-4), myostatin,
Factor VII, Factor VIII and Factor IX.
125. The fusion protein or conjugate according to claim 122, in
which the second moiety having a desired biological activity is a
non-human biologically active protein, selected from the group
consisting of bacterial toxins, enzymes and activating
proteins.
126. The fusion protein or conjugate according to claim 121, in
which the second moiety having a desired biological activity is a
binding polypeptide capable of selective interaction with a target
molecule.
127. The fusion protein or conjugate according to claim 126, in
which the binding polypeptide is selected from the group consisting
of antibodies and fragments and domains thereof substantially
retaining antibody binding activity; microbodies, maxybodies,
avimers, other small disulfide-bonded proteins; binding proteins
derived from a scaffold selected from the group consisting of
staphylococcal protein A and domains thereof, other three helix
domains, lipocalins, ankyrin repeat domains, cellulose binding
domains, y crystallines, green fluorescent protein, human cytotoxic
T lymphocyte-associated antigen 4, protease inhibitors, Kunitz
domains, PDZ domains, SH3 domains, peptide aptamers, staphylococcal
nuclease, tendamistats, fibronectin type III domain, transferrin,
zinc fingers and conotoxins.
128. The fusion protein or conjugate according to claim 127, in
which said target molecule is selected from the group consisting of
amyloid B (AB) peptide of Alzheimer's disease; other
disease-associated amyloid peptides; toxins, bacterial toxins,
snake venoms; blood clotting factors, von Willebrand factor;
interleukins, interleukin-13 (IL-13); myostatin; pro-inflammatory
factors, tumor necrosis factor alpha (TNF-.alpha.), TNF-.alpha.
receptor, IL-1, IL-23 and IL-8; complement factors, complement
component 3 (C3), C5; hypersensitivity mediators, histamine,
immunoglobulin E (IgE); tumor-related antigens, cluster of
differentiation molecule 19 (CD19), CD20, CD22, CD30, CD33, CD40,
CD52, CD70, oncogene MET (cMet), epidermal growth factor receptor 1
(HER1), HER2, HER3, HER4, carbonic anhydrase IX (CAIX),
carcinoembryonic antigen (CEA), IL-2 receptor, mucin 1 (MUC1),
prostate-specific membrane antigen (PSMA), tumor-associated
glycoprotein 72 (TAG-72), granulocyte-colony stimulating factor
(G-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF),
growth hormone (GH), insulin and somatostatin.
129. The fusion protein or conjugate according to claim 121,
comprising a further moiety consisting of a polypeptide having a
further, desired biological activity, which may be the same as or
different from that of the second moiety.
130. The fusion protein or conjugate according to claim 129,
wherein the second moiety is a therapeutically active polypeptide,
and the further moiety is a binding polypeptide capable of
selective interaction with a target molecule.
131. The fusion protein or conjugate according to claim 121, in
which the second moiety is conjugated to the albumin binding
polypeptide via the thiol group of any cysteine residue present at
position X.sub.14 of the polypeptide.
132. The albumin binding polypeptide according to claim 85, further
comprising a cytotoxic agent.
133. The albumin binding polypeptide according to claim 132,
wherein the cytotoxic agent is selected from calicheamycin,
auristatin, doxorubicin, maytansinoid, taxol, ecteinascidin,
geldanamycin, methotrexate and their derivatives, and combinations
thereof.
134. The albumin binding polypeptide according to claim 85 further
comprising a label.
135. The albumin binding polypeptide according to claim 134, in
which said label is selected from the group consisting of
fluorescent dyes and metals, chromophoric dyes, chemiluminescent
compounds and bioluminescent proteins, enzymes, radionuclides and
particles.
136. The albumin binding polypeptide according to claim 135,
comprising a chelating environment provided by a
polyaminopolycarboxylate chelator conjugated to the albumin binding
polypeptide via a thiol group of a cysteine residue or an amine
group of a lysine residue.
137. The albumin binding polypeptide according to claim 136,
wherein the polyaminopolycarboxylate chelator is
1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid or a
derivative thereof.
138. The albumin binding polypeptide according to claim 137,
wherein the 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic
acid derivative is 1,4,7,10-tetraazacyclododecane-1,4,7-tris-acetic
acid-10-maleimidoethylacetamide.
139. The albumin binding polypeptide according to claim 136,
wherein the polyaminopolycarboxylate chelator is
diethylenetriaminepentaacetic acid or derivatives thereof.
140. A polynucleotide encoding the albumin binding polypeptide
according to claim 85.
141. A method of producing a polypeptide, comprising expressing the
polynucleotide according to claim 140.
142. An expression vector comprising the polynucleotide according
to claim 140.
143. A host cell comprising the expression vector according to
claim 142.
144. A method of producing the albumin binding polypeptide
according to claim 85 by non-biological peptide synthesis using
amino acids and/or amino acid derivatives having protected reactive
side-chains, the non-biological peptide synthesis comprising
step-wise coupling of the amino acids and/or the amino acid
derivatives to form the albumin binding polypeptide; deprotecting
the protected reactive side-chains of the albumin binding
polypeptide; and folding of the albumin binding polypeptide in
aqueous solution.
145. The method of producing a polypeptide according to claim 144,
further comprising conjugating the albumin binding polypeptide with
a therapeutically active polypeptide.
146. The fusion protein or conjugate according to claim 121,
further comprising a cytotoxic agent.
147. The fusion protein or conjugate according to claim 146,
wherein the cytotoxic agent is selected from calicheamycin,
auristatin, doxorubicin, maytansinoid, taxol, ecteinascidin,
geldanamycin, methotrexate and their derivatives, and combinations
thereof.
148. The fusion protein or conjugate according to claim 121 further
comprising a label.
149. The fusion protein or conjugate according to claim 148, in
which said label is selected from the group consisting of
fluorescent dyes and metals, chromophoric dyes, chemiluminescent
compounds and bioluminescent proteins, enzymes, radionuclides and
particles.
150. The fusion protein or conjugate according to claim 149,
comprising a chelating environment provided by a
polyaminopolycarboxylate chelator conjugated to the albumin binding
polypeptide via a thiol group of a cysteine residue or an amine
group of a lysine residue.
151. The fusion protein or conjugate according to claim 150,
wherein the polyaminopolycarboxylate chelator is
1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid or a
derivative thereof.
152. The fusion protein or conjugate according to claim 151,
wherein the 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic
acid derivative is 1,4,7,10-tetraazacyclododecane-1,4,7-tris-acetic
acid-10-maleimidoethylacetamide.
153. The fusion protein or conjugate according to claim 150,
wherein the polyaminopolycarboxylate chelator is
diethylenetriaminepentaacetic acid or derivatives thereof.
154. A polynucleotide encoding the fusion protein according to
claim 121.
155. A method of producing a polypeptide, comprising expressing the
polynucleotide according to claim 154.
156. An expression vector comprising the polynucleotide according
to claim 154.
157. A host cell comprising the expression vector according to
claim 156.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a Continuation of U.S. application Ser.
No. 14/955,647 filed Dec. 1, 2015, now U.S. Pat. No. 10,329,331,
which is a continuation of U.S. application Ser. No. 13/808,713
filed Aug. 20, 2013, now U.S. Pat. No. 9,211,344, which is a U.S.
National Stage application of International Patent Application No.
PCT/EP2011/061623 filed Jul. 8, 2011, which claims priority to U.S.
Ser. No. 61/399,285 filed Jul. 9, 2010 and U.S. Ser. No. 61/403,561
filed Sep. 17, 2010. All of these applications are incorporated by
reference herein in their entireties.
TECHNICAL FIELD
[0002] The present disclosure relates to a class of engineered
polypeptides having a binding affinity for albumin. It also relates
to new methods and uses that exploit binding by these and other
compounds to albumin in different contexts, some of which have
significance for the treatment of disease in mammals including
humans.
BACKGROUND
Serum Albumin
[0003] Serum albumin is the most abundant protein in mammalian sera
(40 g/l, approximately 0.7 mM in humans), and one of its functions
is to bind molecules such as lipids and bilirubin (Peters, Advances
in Protein Chemistry 37:161, 1985). Serum albumin is devoid of any
enzymatic or immunological function. Furthermore, human serum
albumin (HSA) is a natural carrier involved in the endogenous
transport and delivery of numerous natural as well as therapeutic
molecules (Sellers and Koch-Weser, Albumin Structure, Function and
Uses, eds Rosenoer et al, Pergamon, Oxford, p 159, 1977). The half
life of serum albumin is directly proportional to the size of the
animal, where for example human serum albumin has a half life of 19
days and rabbit serum albumin has a half life of about 5 days
(McCurdy et al, J Lab Clin Med 143:115, 2004). HSA is widely
distributed throughout the body, in particular in the interstitial
and blood compartments, where it is mainly involved in the
maintenance of osmolarity. Structurally, albumins are single-chain
proteins comprising three homologous domains and in total 584 or
585 amino acids (Dugaiczyk et al, Proc Natl Acad Sci USA 79:71,
1982). Albumins contain 17 disulfide bridges and a single reactive
thiol, cysteine in position 34, but lack N-linked and O-linked
carbohydrate moieties (Peters, 1985, supra; Nicholson et al, Br J
Anaesth 85:599, 2000).
Fusion or Association with HSA Results in Increased In Vivo Half
Life of Proteins
[0004] Several strategies have been reported to either covalently
couple proteins directly to serum albumins or to a peptide or
protein that will allow in vivo association to serum albumins.
Examples of the latter approach have been described e.g. in
WO91/01743, in WO01/45746 and in Dennis et al (J Biol Chem
277:35035-43, 2002). The first document describes inter alia the
use of albumin binding peptides or proteins derived from
streptococcal protein G (SpG) for increasing the half life of other
proteins. The idea is to fuse the bacterially derived, albumin
binding peptide/protein to a therapeutically interesting
peptide/protein, which has been shown to have a rapid elimination
from blood. The thus generated fusion protein binds to serum
albumin in vivo, and benefits from its longer half life, which
increases the net half life of the fused therapeutically
interesting peptide/protein. WO01/45746 and Dennis et al relate to
the same concept, but here, the authors utilize relatively short
peptides to bind serum albumin. The peptides were selected from a
phage displayed peptide library. In Dennis et al, earlier work is
mentioned in which the enhancement of an immunological response to
a recombinant fusion of the albumin binding domain of streptococcal
protein G to human complement receptor Type 1 was found. US patent
application published as US2004/0001827 (Dennis) also discloses the
use of constructs comprising peptide ligands, again identified by
phage display technology, which bind to serum albumin and which are
conjugated to bioactive compounds for tumor targeting.
Albumin Binding Domains of Bacterial Receptor Proteins
[0005] Streptococcal protein G (SpG) is a bi-functional receptor
present on the surface of certain strains of streptococci and is
capable of binding to both IgG and serum albumin (Bjorck et al, Mol
Immunol 24:1113, 1987). The structure is highly repetitive with
several structurally and functionally different domains (Guss et
al, EMBO J 5:1567, 1986), more precisely three Ig-binding domains
and three serum albumin binding domains (Olsson et al, Eur J
Biochem 168:319, 1987). The structure of one of the three serum
albumin binding domains in SpG has been determined, showing a
three-helix bundle fold (Kraulis et al, FEBS Lett 378:190, 1996,
Johansson et al, J. Biol. Chem. 277:8114-20, 2002). A 46 amino acid
motif was defined as ABD (albumin binding domain) and has
subsequently also been designated G148-GA3 (GA for protein
G-related albumin binding). In for example WO09/016043, albumin
binding variants of the 46 amino acid motif ABD are disclosed.
[0006] Other bacterial albumin binding domains than the ones in
protein G have also been identified, some of which are structurally
similar to the ones of protein G. Examples of proteins containing
such albumin binding domains are the PAB, PPL, MAG and ZAG proteins
(Rozak et al, Biochemistry 45:3263-3271, 2006). Studies of
structure and function of such albumin binding domains have been
carried out and reported e.g. by Johansson and co-workers
(Johansson et al, J Mol Biol 266:859-865, 1997). Furthermore, Rozak
et al have reported on the creation of artificial variants of
G148-GA3, which were selected and studied with regard to different
species specificity and stability (Rozak et al, Biochemistry
45:3263-3271, 2006), whereas Jonsson et al developed artificial
variants of G148-GA3 having very much improved affinity for human
serum albumin (Jonsson et al, Prot Eng Des Sel 21:515-27, 2008).
For some of the variants a higher affinity was achieved at the cost
of reduced thermal stability.
[0007] In addition to the three-helix containing proteins described
above, there are also other unrelated bacterial proteins that bind
albumin.
ABD and Immunization
[0008] Recently, a few T- and B-cell epitopes were experimentally
identified within the albumin binding region of Streptococcal
protein G strain 148 (G148) (Goetsch et al, Clin Diagn Lab Immunol
10:125-32, 2003). The authors behind the study were interested in
utilizing the T-cell epitopes of G148 in vaccines, i.e. to utilize
the inherent immune-stimulatory property of the albumin binding
region. Goetsch et al additionally found a B-cell epitope, i.e. a
region bound by antibodies after immunization, in the sequence of
G148.
[0009] In pharmaceutical compositions for human administration no
immune-response is desired. Therefore, the albumin binding domain
G148 is as such unsuitable for use in such compositions due to its
abovementioned immune-stimulatory properties.
DESCRIPTION
[0010] The above drawbacks and deficiencies of the prior art are
overcome or alleviated by, in a first aspect, an albumin binding
polypeptide, comprising an amino acid sequence selected from
TABLE-US-00001 i) (SEQ ID NO: 204)
LAX.sub.3AKX.sub.6X.sub.7ANX.sub.10ELDX.sub.14YGVSDFYKRLIX.sub.26KAKTVEGVE-
ALKX.sub.39X.sub.40 ILX.sub.43X.sub.44LP
wherein independently of each other X.sub.3 is selected from E, S,
Q and C; X.sub.6 is selected from E, S and C; X.sub.7 is selected
from A and S, X.sub.10 is selected from A, S and R; X.sub.14 is
selected from A, S, C and K; X.sub.26 is selected from D and E;
X.sub.39 is selected from D and E; X.sub.40 is selected from A and
E; X.sub.43 is selected from A and K; X.sub.44 is selected from A,
S and E; L in position 45 is present or absent; and P in position
46 is present or absent; and ii) an amino acid sequence which has
at least 95% identity to the sequence defined in i).
[0011] The above defined class of sequence related polypeptides
having a binding affinity for albumin is derived from a common
parent polypeptide sequence, which folds into a three alpha helix
bundle domain. More specifically, the polypeptides as described
above are derived from a model building based on a structure of a
complex between serum albumin and the albumin binding domain
G148-GA3 (Lejon et al, J Biol Chem 279:42924-8, 2004), as well as
analyses of binding and structural properties of a number of
mutational variants of the common parent polypeptide sequence. The
above defined amino acid sequence i) comprises amino acid
substitutions as compared to the parent polypeptide sequence that
result in a class of polypeptides which are expected to fold into
an almost identical three helix bundle domain. While the parent
polypeptide sequence already comprises a binding surface for
interaction with albumin, that binding surface is modified by some
of the substitutions according to the above definition. The
substitutions according to the above definition provide an improved
albumin binding ability as compared to the parent polypeptide
sequence.
[0012] The albumin binding polypeptides according to the first
aspect of the disclosure exhibit a set of characteristics, which,
for example, make them suitable for use as fusion or conjugate
partners for therapeutic molecules for human administration. The
albumin binding polypeptides according to the present disclosure
demonstrate, for example in comparison with related albumin binding
polypeptides such as the albumin binding domain G148-GA3 and the
albumin binding polypeptides disclosed in WO09/016043, at least
five of the following six characteristics: [0013] The polypeptides
display a different surface compared to, for example, G148-GA3 and
other bacterially derived albumin binding domains. The difference
may decrease or eliminate any risk for antibody reactions in a
subject, such as a human, which has been previously exposed to such
bacterial proteins. [0014] The polypeptides comprise fewer
potential T-cell epitopes than, for example, G148-GA3 and other
related, but different, mutational variants of the common parent
polypeptide sequence, and hence exhibit low immunogenicity when
administered to a subject, such as a human. [0015] The polypeptides
display a lower reactivity with circulating antibodies when
administered to a subject, such as a human. Thus, by amino acid
substitutions in the surface of the polypeptides exposed to
circulating antibodies, i.e. in the polypeptide surface not
involved in the binding interaction with albumin, antibody
cross-reactivity is reduced as compared to, for example, antibody
cross-reactivity caused by G148-GA3 as measured in a test set of
human sera. [0016] The polypeptides have a high albumin binding
ability, both in terms of a higher binding affinity, as defined by
a K.sub.D value, and in terms of a slower off-rate, as defined by a
k.sub.off value, than, for example, known naturally occurring
albumin binding polypeptides, such as the albumin binding domains
derived from bacterial proteins. [0017] The polypeptides comprise
fewer amino acid residues that are associated with stability
problems of polypeptides than, for example, known naturally
occurring albumin binding polypeptides, such as the albumin binding
domains derived from bacterial proteins. Thus, the polypeptides
comprise, for example, no oxidation-prone methionines or
tryptophanes and only one asparagine. [0018] The polypeptides have
a higher structural stability, as defined by a melting point of
above 55.degree. C., than previous albumin binding polypeptides,
such as those disclosed in WO09/016043.
[0019] In one embodiment, the albumin binding polypeptide according
to the first aspect display all six of the above listed
characteristics. In another embodiment, the albumin binding
polypeptide according to the first aspect displays, when bound to
albumin, a more hydrophilic profile than, for example, previous
albumin binding polypeptides, such as those disclosed in
WO09/016043. The surface of the albumin binding polypeptide which
is exposed to the surroundings when the polypeptide interacts with
albumin comprises fewer amino acid residues that confer surface
hydrophobicity.
[0020] As the skilled person will realize, the function of any
polypeptide, such as the albumin binding capacity of the
polypeptides according to the first aspect, is dependent on the
tertiary structure of the polypeptide. It is however possible to
make changes to the sequence of amino acids in an .alpha.-helical
polypeptide without affecting the structure thereof (Taverna and
Goldstein, J Mol Biol 315(3):479-84, 2002; He et al, Proc Natl Acad
Sci USA 105(38):14412-17, 2008). Thus, modified variants of i),
which are such that the resulting sequence is at least 95%
identical to a sequence belonging to the class defined by i), are
also encompassed by the first aspect. For example, it is possible
that an amino acid residue belonging to a certain functional
grouping of amino acid residues (e.g. hydrophobic, hydrophilic,
polar etc) could be exchanged for another amino acid residue from
the same functional group.
[0021] The term "% identical" or "% identity", as used in the
specification and claims, is calculated as follows. The query
sequence is aligned to the target sequence using the CLUSTAL W
algorithm (Thompson, J. D., Higgins, D. G. and Gibson, T. J.,
Nucleic Acids Research, 22: 4673-4680 (1994)). A comparison is made
over the window corresponding to the shortest of the aligned
sequences. The shortest of the aligned sequences may in some
instances be the target sequence, such as the albumin binding
polypeptide disclosed herein. In other instances, the query
sequence may constitute the shortest of the aligned sequences. The
query sequence may for example consist of at least 10 amino acid
residues, such as at least 20 amino acid residues, such as at least
30 amino acid residues, such as at least 40 amino acid residues,
for example 45 amino acid residues. The amino acid residues at each
position are compared, and the percentage of positions in the query
sequence that have identical correspondences in the target sequence
is reported as % identity.
[0022] In one embodiment of the albumin binding polypeptide
according to the first aspect, X.sub.6 is E.
[0023] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.3 is S.
[0024] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.3 is E.
[0025] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.7 is A.
[0026] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.14 is S.
[0027] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.14 is C.
[0028] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.10 is A.
[0029] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.10 is S.
[0030] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.26 is D.
[0031] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.26 is E.
[0032] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.39 is D.
[0033] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.39 is E.
[0034] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.40 is A.
[0035] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.43 is A.
[0036] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.44 is A.
[0037] In another embodiment of the albumin binding polypeptide
according to this aspect, X.sub.44 is S.
[0038] In another embodiment of the albumin binding polypeptide
according to this aspect, the L residue in position 45 is
present.
[0039] In another embodiment of the albumin binding polypeptide
according to this aspect, the P residue in position 46 is
present.
[0040] In another embodiment of the albumin binding polypeptide
according to this aspect, the P residue in position 46 is
absent.
[0041] In another embodiment, the albumin binding polypeptide
according to this aspect is subject to the proviso that X.sub.7 is
neither L, E nor D.
[0042] The albumin binding polypeptide according to the first
aspect may be prepared for conjugation with a suitable conjugation
partner by the replacement of surface exposed amino acid residues
with, for example, either a cysteine or a lysine. These
replacements may be introduced into the N-terminal helix, i.e.
helix one, of the polypeptide, which is the helix situated furthest
away from the serum albumin when the albumin binding polypeptide is
bound to serum albumin. Thus, a lysine residue in position X.sub.14
of the sequence defined in i) may be used to enable site-directed
conjugation. This may furthermore be advantageous when the molecule
is made by chemical peptide synthesis, since orthogonal protection
of the epsilon-amino group of said lysine may be utilized.
Furthermore, a cysteine residue may be introduced into the amino
acid sequence to enable site-directed conjugation. For example, a
cysteine residue may be introduced into any one of the positions
X.sub.3, X.sub.6 and/or X.sub.14 in accordance with the above
definition.
[0043] Coupling of a conjugation partner to the epsilon-amine of a
lysine or the thiol group of a cysteine represents two chemically
different alternatives to obtain site-directed conjugation using an
amino acid residue within the amino acid sequence i). As the
skilled person understands, other chemical alternatives for
preparing an amino acid sequence for conjugation exist, and are as
such also within the scope of the present disclosure. One example
of such a chemistry is the click-like chemistry enabled by the
introduction of a tyrosine as presented by Ban et al (J Am Chem Soc
132:1523-5, 2009).
[0044] The terms "albumin binding" and "binding affinity for
albumin" as used in this specification refer to a property of a
polypeptide which may be tested for example by the use of surface
plasmon resonance technology, such as in a Biacore instrument. For
example as described in the examples below, albumin binding
affinity may be tested in an experiment in which albumin, or a
fragment thereof, is immobilized on a sensor chip of the
instrument, and the sample containing the polypeptide to be tested
is passed over the chip. Alternatively, the polypeptide to be
tested is immobilized on a sensor chip of the instrument, and a
sample containing albumin, or a fragment thereof, is passed over
the chip. Albumin may, in this regard, be a serum albumin from a
mammal, such as human serum albumin. The skilled person may then
interpret the results obtained by such experiments to establish at
least a qualitative measure of the binding affinity of the
polypeptide for albumin. If a quantitative measure is desired, for
example to determine a K.sub.D value for the interaction, surface
plasmon resonance methods may also be used. Binding values may for
example be defined in a Biacore2000 instrument (GE Healthcare).
Albumin is suitably immobilized on a sensor chip of the
measurement, and samples of the polypeptide whose affinity is to be
determined are prepared by serial dilution and injected. K.sub.D
values may then be calculated from the results using for example
the 1:1 Langmuir binding model of the BIAevaluation 4.1 software
provided by the instrument manufacturer (GE Healthcare).
[0045] In one embodiment, the albumin binding polypeptide according
to this aspect binds to albumin such that the k.sub.off value of
the interaction is at most 5.times.10.sup.-5 s.sup.-1, such as at
most 5.times.10.sup.-6 s.sup.-1.
[0046] As described above, the albumin binding polypeptides as
defined by the amino acid sequence i) are derived from a common
parent polypeptide sequence which folds into a three alpha helix
bundle domain. In one embodiment, the three helix domain of this
parent polypeptide sequence forms part of protein G from
Streptococcus strain G148, in particular domain GA3.
[0047] In another embodiment, the amino acid sequence of the
albumin binding polypeptide is selected from any one of SEQ ID
NO:1-144 and SEQ ID NO:164-203, such as selected from any one of
SEQ ID NO:1-144. More specifically, the amino acid sequence is
selected from SEQ ID NO:4-5, SEQ ID NO:7-8, SEQ ID NO:10-11, SEQ ID
NO:13-14, SEQ ID NO:16-17, SEQ ID NO:19-20, SEQ ID NO:22-23, SEQ ID
NO:25-26, SEQ ID NO:28-29, SEQ ID NO:31-32, SEQ ID NO:34-35, SEQ ID
NO:37-38, SEQ ID NO:41-42, SEQ ID NO:49-50, SEQ ID NO:164-170 and
SEQ ID NO:192-203. Thus, the amino acid sequence may be selected
from SEQ ID NO:4-5, SEQ ID NO:7-8, SEQ ID NO:10-11, SEQ ID
NO:13-14, SEQ ID NO:16-17, SEQ ID NO:19-20, SEQ ID NO:22-23, SEQ ID
NO:25-26, SEQ ID NO:28-29, SEQ ID NO:31-32, SEQ ID NO:34-35, SEQ ID
NO:37-38, SEQ ID NO:41-42 and SEQ ID NO:49-50.
[0048] In one embodiment, the albumin binding polypeptide according
to this aspect further comprises one or more additional amino acid
residues positioned at the N- and/or the C-terminal of the sequence
defined in i). These additional amino acid residues may play a role
in enhancing the binding of albumin by the polypeptide, and
improving the conformational stability of the folded albumin
binding domain, but may equally well serve other purposes, related
for example to one or more of production, purification,
stabilization in vivo or in vitro, coupling, labeling or detection
of the polypeptide, as well as any combination thereof. Such
additional amino acid residues may comprise one or more amino acid
residue(s) added for purposes of chemical coupling, e.g. to a
chromatographic resin to obtain an affinity matrix or to a
chelating moiety for complexing with a radiometal.
[0049] The amino acids directly preceding or following the alpha
helix at the N- or C-terminus of the amino acid sequence i) may
thus in one embodiment affect the conformational stability. One
example of an amino acid residue which may contribute to improved
conformational stability is a serine residue positioned at the
N-terminal of the amino acid sequence i) as defined above. The
N-terminal serine residue may in some cases form a canonical
S-X-X-E capping box, by involving hydrogen bonding between the
gamma oxygen of the serine side chain and the polypeptide backbone
NH of the glutamic acid residue. This N-terminal capping may
contribute to stabilization of the first alpha helix of the three
helix domain constituting the albumin binding polypeptide according
to the first aspect of the disclosure.
[0050] Thus, in one embodiment, the additional amino acids comprise
at least one serine residue at the N-terminal of the polypeptide.
The amino acid sequence is in other words preceded by one or more
serine residue(s). In another embodiment of the albumin binding
polypeptide, the additional amino acids comprise a glycine residue
at the N-terminal of the polypeptide. It is understood that the
amino acid sequence i) may be preceded by one, two, three, four or
any suitable number of amino acid residues. Thus, the amino acid
sequence may be preceded by a single serine residue, a single
glycine residue or a combination of the two, such as a
glycine-serine (GS) combination or a glycine-serine-serine (GSS)
combination. Examples of albumin binding polypeptides comprising
additional amino residues at the N-terminal are set out in SEQ ID
NO:145-163, such as in SEQ ID NO:145-148 and SEQ ID NO:162-163. In
yet another embodiment, the additional amino acid residues comprise
a glutamic acid at the N-terminal of the polypeptide as defined by
the sequence i).
[0051] Similarly, C-terminal capping may be exploited to improve
stability of the third alpha helix of the three helix domain
constituting the albumin binding polypeptide. A proline residue,
when present at the C-terminal of the amino acid sequence defined
in i), may at least partly function as a capping residue. In such a
case, a lysine residue following the proline residue at the
C-terminal may contribute to further stabilization of the third
helix of the albumin binding polypeptide, by hydrogen bonding
between the epsilon amino group of the lysine residue and the
carbonyl groups of the amino acids located two and three residues
before the lysine in the polypeptide backbone, e.g., when both L45
and P46 are present, the carbonyl groups of the leucine and alanine
residues of the amino acid sequence defined in i). Thus, in one
embodiment, the additional amino acids comprise a lysine residue at
the C-terminal of the polypeptide.
[0052] As discussed above, the additional amino acids may be
related to the production of the albumin binding polypeptide. In
particular, when an albumin binding polypeptide according to an
embodiment in which P46 is present is produced by chemical peptide
synthesis, one or more optional amino acid residues following the
C-terminal proline may provide advantages. Such additional amino
acid residues may for example prevent formation of undesired
substances, such as diketopiperazine at the dipeptide stage of the
synthesis. One example of such an amino acid residue is glycine.
Thus, in one embodiment, the additional amino acids comprise a
glycine residue at the C-terminal of the polypeptide, directly
following the proline residue or following an additional lysine
and/or glycine residue as accounted for above. Alternatively,
polypeptide production may benefit from amidation of the C-terminal
proline residue of the amino acid sequence i), when present. In
this case, the C-terminal proline comprises an additional amine
group at the carboxyl carbon. In one embodiment of the polypeptides
described herein, particularly those ending at its C-terminus with
proline or other amino acid known to racemize during peptide
synthesis, the above-mentioned addition of a glycine to the
C-terminus or amidation of the proline, when present, can also
counter potential problems with racemization of the C-terminal
amino acid residue. If the polypeptide, amidated in this way, is
intended to be produced by recombinant means, rather than by
chemical synthesis, amidation of the C-terminal amino acid can be
performed by several methods known in the art, e.g. through the use
of amidating PAM enzyme.
[0053] Examples of albumin binding polypeptides comprising
additional amino acid residues at the C-terminal are set out in SEQ
ID NO:145-152, such as in SEQ ID NO:148-150. The skilled person is
aware of methods for accomplishing C-terminal modification, such as
by different types of pre-made matrices for peptide synthesis.
[0054] In another embodiment, the additional amino acid residues
comprise a cysteine residue at the N- and/or C-terminal of the
polypeptide. Such a cysteine residue may directly precede and/or
follow the amino acid sequence as defined in i) or may precede
and/or follow any other additional amino acid residues as described
above. Examples of albumin binding polypeptides comprising a
cysteine residue at the N- and/or C-terminal of the polypeptide
chain are set out in SEQ ID NO:149-150 (C-terminal) and SEQ ID
NO:151-152 (N-terminal). By the addition of a cysteine residue to
the polypeptide chain, a thiol group for site directed conjugation
of the albumin binding polypeptide may be obtained. Alternatively,
a selenocysteine residue may be introduced at the C-terminal of the
polypeptide chain, in a similar fashion as for the introduction of
a cysteine residue, to facilitate site-specific conjugation (Cheng
et al, Nat Prot 1:2, 2006).
[0055] In one embodiment, the albumin binding polypeptide comprises
no more than two cysteine residues. In another embodiment, the
albumin binding polypeptide comprises no more than one cysteine
residue.
[0056] In another embodiment, the additional amino acid residues of
the albumin binding polypeptide comprise a "tag" for purification
or detection of the polypeptide, such as a hexahistidyl (Hiss) tag,
or a "myc" ("c-Myc") tag or a "FLAG" tag for interaction with
antibodies specific to the tag and/or to be used in purification.
The skilled person is aware of other alternatives.
[0057] In yet another embodiment, the albumin binding polypeptide
according to this aspect binds to human serum albumin. In other
embodiments, the albumin binding polypeptide binds to albumin from
other species than the human species, such as albumin from mouse,
rat, dog and cynomolgus macaques.
[0058] The "additional amino acid residues" discussed above may
also constitute one or more polypeptide domain(s) with any desired
function, such as the same binding function as the first, albumin
binding domain, or another binding function, or a therapeutic
function, or an enzymatic function, or a fluorescent function, or
mixtures thereof.
[0059] There is consequently in another, related aspect, provided a
fusion protein or conjugate comprising
i) a first moiety consisting of an albumin binding polypeptide
according to the first aspect as described herein; and ii) a second
moiety consisting of a polypeptide having a desired biological
activity.
[0060] A fusion protein or conjugate comprising an albumin binding
polypeptide according to the first aspect of the disclosure and a
second moiety may increase the in vitro and/or the in vivo half
life of the second moiety, as compared to the in vivo half life of
the second moiety per se. As a consequence, when a fusion protein
or conjugate according to this aspect is administered to a subject,
such as a human subject, the in vivo exposure to the second moiety
may increase, which may lead to improved potency of the biological
activity of the second moiety, as compared to the potency of in
vivo exposure of the second moiety when administered by itself.
[0061] The desired biological activity may, for example, be a
therapeutic activity, a binding activity or an enzymatic activity.
When the desired biological activity is a therapeutic activity, the
second moiety showing this activity may be a therapeutically active
polypeptide. Non-limiting examples of therapeutically active
polypeptides are biomolecules, such as molecules selected from the
group consisting of human endogenous enzymes, hormones, growth
factors, chemokines, cytokines and lymphokines, and non-human
biologically active proteins, such as proteins selected from the
group consisting of bacterial toxins (e.g. pseudomonas exotoxin and
staphylococcal and streptococcal superantigens), enzymes (e.g.
RNase and beta-lactamase) and activating proteins (e.g.
streptokinase). Non-limiting examples of therapeutically active
biomolecules which may prove useful in a fusion or conjugate with
the albumin binding polypeptide are selected from the group
consisting of IL-2, GLP-1, BNP (Alb-beta-natriuretic peptide),
IL-1-RA (interleukin-1 receptor antagonist), KGF (keratinocyte
growth factor), STEMGEN, growth hormone (GH), G-CSF, CTLA-4,
myostatin, Factor VII, Factor VIII and Factor IX.
[0062] The leaky defective blood vessels of tumor tissue make its
vasculature (endothelial barrier) permeable for macromolecules,
whereas in blood vessels of healthy tissue only small molecules can
pass the endothelial barrier. Likewise, the permeability of the
blood-joint barrier for albumin in inflamed joints of rheumatoid
arthritis patients is markedly increased. Thus, fusion proteins or
conjugates according to this aspect are likely to permeate blood
vessels in tumor tissue and the blood-joint barrier in inflamed
joints.
[0063] When said desired biological activity of the second moiety
is a binding activity, said second moiety may be a binding
polypeptide capable of selective interaction with a target
molecule. Such a binding polypeptide may for example be selected
from the group consisting of antibodies and fragments and domains
thereof substantially retaining antibody binding activity;
microbodies, maxybodies, avimers and other small disulfide-bonded
proteins; and binding proteins derived from a scaffold selected
from the group consisting of staphylococcal protein A and domains
thereof, other three helix domains, lipocalins, ankyrin repeat
domains, cellulose binding domains, y crystallines, green
fluorescent protein, human cytotoxic T lymphocyte-associated
antigen 4, protease inhibitors such as Kunitz domains, PDZ domains,
SH3 domains, peptide aptamers, staphylococcal nuclease,
tendamistats, fibronectin type III domain, transferrin, zinc
fingers and conotoxins.
[0064] In some embodiments, the target molecule for binding of said
target binding polypeptide may be selected from the group
consisting of amyloid F (AF) peptide of Alzheimer's disease; other
disease-associated amyloid peptides; toxins, such as bacterial
toxins and snake venoms; blood clotting factors, such as von
Willebrand factor; interleukins, such as IL-13; myostatin;
pro-inflammatory factors, such as TNF-.alpha., TNF-.alpha.
receptor, IL-1, IL-8 and IL-23; complement factors, such as C3 and
C5, hypersensitivity mediators, such as histamine and IgE;
tumor-related antigens, such as CD19, CD20, CD22, CD30, CD33, CD40,
CD52, CD70, cMet, HER1, HER2, HER3, HER4, CAIX (carbonic anhydrase
IX), CEA, IL-2 receptor, MUC1, PSMA, TAG-72; and other biological
molecules such as G-CSF, GM-CSF, growth hormone (GH), insulin and
somatostatin.
[0065] As the skilled person understands, the albumin binding
polypeptide according to the first aspect may be useful in a fusion
protein or as a conjugate partner to any other moiety. Therefore,
the above lists of therapeutically active polypeptides, binding
polypeptides and target molecules should not be construed as
limiting in any way.
[0066] In one embodiment of a fusion protein or conjugate according
to the present disclosure, the second moiety is conjugated to the
albumin binding polypeptide via a lysine or cysteine residue added
to the N- or C-terminal of the albumin binding polypeptide or via a
lysine or cysteine residue at a position within the albumin binding
polypeptide, such as at a position selected from X.sub.3, X.sub.6
and X.sub.14. If the conjugation site is one within the amino acid
sequence i) of the albumin binding polypeptide, such as a cysteine
in position X.sub.14, no additional amino acids need to be added to
the albumin binding polypeptide for the purpose of enabling
conjugation to the second moiety. A conjugation site within the
polypeptide chain as defined by i) may moreover shield the
polypeptide against cross-reacting antibodies, in particular the
portion of the polypeptide close to the conjugation site. Without
wishing to be bound by theory, when the conjugate via the albumin
binding polypeptide is bound to serum albumin in vivo, i.e.
situated in the binding pocket of serum albumin, the second moiety,
conjugated at a position within for example helix one of the three
helix domain constituting the albumin binding polypeptide, is
likely to point away from the serum albumin to which the albumin
binding polypeptide is bound. In addition, a conjugation site
within the albumin binding polypeptide may impair the presentation
of the portion of the peptides otherwise derived from this portion
of the polypeptide to T-cells due to, for example, effects on
processing in the antigen presenting cell, impaired fit of
potential peptides in the peptide binding grove of the MCH class II
molecule, and remodeled peptide surface available to the T-cell
receptor (due to the conjugated portion sticking out). Thus, the
immunogenicity of the portion of the conjugate near the conjugation
site is expected to become further reduced after conjugation.
[0067] Due to the high affinity between the albumin binding
polypeptide of the present disclosure and serum albumin, a
conjugate or fusion protein comprising such an albumin binding
polypeptide might be regarded as an indirect complex with serum
albumin. A conjugate or a fusion protein according to the present
disclosure thus provides an alternative to the frequently used
method of exploiting direct conjugates or fusions with serum
albumin. Such direct conjugates with serum albumin are frequently
inhomogeneous, irrespective of what method is used for coupling.
When a specific molecule is coupled to serum albumin via an amino
group of a lysine residue, any one of a large number of lysines on
the surface of the serum albumin molecule may be targeted, which
gives a random conjugation site and a random product. Although
thiol coupling via the single unpaired cysteine in human serum
albumin (in position 34, Peters, 1985, supra) seems to offer an
alternative method for obtaining a direct conjugate, such a
methodology frequently does not lead to a homogeneous product. Only
20-60% of the molecules in commercially available (human) serum
albumin display a free thiol group, whereas the rest are blocked by
thiol compounds such as cysteine, homocysteine or glutathione. In
contrast, conjugation to the three helix domain of the albumin
binding polypeptide according to the present disclosure may be
performed site-specifically. This may be accomplished, as discussed
above, either by coupling to one or more cysteines, to a
selenocysteine, or to a designated lysine (orthogonally protected
during synthesis).
[0068] According to this aspect of the present disclosure, the
second moiety having the desired biological activity may either be
conjugated to the three helix domain of the albumin binding
polypeptide or produced as a fusion protein with the same. A
non-limiting example of a conjugate according to the present
disclosure is given below. Glucagon-like peptide 1 (GLP-1), or a
derivative thereof, is a small polypeptide which may suitably be
present as a second moiety in a conjugate with the albumin binding
polypeptide. Conjugation of GLP-1 to the albumin binding
polypeptide may be performed in any one of the positions of the
polypeptide sequence as described above. The conjugate may as such
be produced in a non-biological process and is expected to display
a significantly enhanced potency as compared to the potency of
GLP-1 per se. Conjugation may be employed with both small
polypeptides or proteins, such as GLP-1, or with larger
polypeptides or proteins. A conjugate according to the present
disclosure may typically comprise a non-amino acid spacer moiety,
such as polyethylene glycol (PEG).
[0069] Other polypeptides or proteins may be combined with the
amino acid sequence of the albumin binding polypeptide in the form
of a fusion protein. Such a fusion protein may furthermore comprise
one or more spacer amino acid residues between the first and second
moieties.
[0070] As described above, the albumin binding polypeptide
according to the first aspect binds serum albumin from several
species, including mouse, rat, dog and cynomolgus macaques. Thus, a
fusion protein or conjugate according to the present disclosure may
contribute to enhancing the biological effect of a second moiety,
not only in a human subject, but also in animal models. A number of
endogenous proteins have been produced as direct fusions with human
serum albumin, examples of such proteins include G-CSF, GH,
interferons, CD4, IL-2, insulin, glucagon, GLP-1, antibody Fab
fragments and protease inhibitors like Kunitz-domain derived
proteins. Such direct fusions may however not be fully evaluated in
animal models. This is due to the fact that human serum albumin
does not interact properly with the endogenous Fc neonatal receptor
(FcRn), e.g. in the commonly used animal models mouse and rat, and
that this interaction is an important factor contributing to the
long circulation time of serum albumin. As described above, a
conjugate or a fusion protein according to the present disclosure
may, in the presence of serum albumin, combine with albumin and
function as an indirect fusion with albumin. This makes a conjugate
or a fusion protein comprising an albumin binding polypeptide
according to the first aspect useful in preclinical model species,
provided that the second moiety is biologically active in the
selected species.
[0071] In one embodiment, there is provided a fusion protein or
conjugate comprising a further moiety consisting of a polypeptide
having a further, desired biological activity, which may be the
same as or different from that of the second moiety. One specific
example of such a fusion protein or conjugate comprises a
therapeutically active polypeptide as defined above as a second
moiety and a binding polypeptide as defined above as a further
moiety.
[0072] With regard to the description above of fusion proteins or
conjugates incorporating an albumin binding polypeptide according
to the first aspect, it is to be noted that the designation of
first, second and further moieties is made for clarity reasons to
distinguish between albumin binding polypeptide or polypeptides
according to the present disclosure on the one hand, and moieties
exhibiting other functions on the other hand. These designations
are not intended to refer to the actual order of the different
domains in the polypeptide chain of the fusion protein or
conjugate. Thus, for example, said first moiety may without
restriction appear at the N-terminal end, in the middle, or at the
C-terminal end of the fusion protein or conjugate.
[0073] In a related aspect, there is provided an albumin binding
polypeptide, fusion protein or conjugate as defined in the present
disclosure, further comprising an organic molecule, such as a
cytotoxic agent. Non-limiting examples of cytotoxic agents which
may be fused or conjugated to an albumin binding polypeptide
according to the first aspect, or combined with a fusion protein or
conjugate according to the second aspect, are selected from
calicheamycin, auristatin, doxorubicin, maytansinoid, taxol,
ecteinascidin, geldanamycin, methotrexate and their derivatives,
and combinations thereof. Previously, attempts have been made to
treat various disorders with direct albumin conjugates. Such direct
albumin conjugates have been exploited e.g. with doxorubicin in
cancer (Kratz et al, J Med Chem 45: 5523-33, 2002) and metotrexate
in rheumatoid arthritis (Wunder et al, J Immunol 170:4793-4801,
2003). It is to be understood that the albumin binding polypeptide,
either by itself or as a moiety in a fusion protein or conjugate,
by its high albumin binding ability provides indirect means of
construing albumin complexes, and thus may provide an alternative
treatment method compared to the attempts mentioned above.
[0074] The above aspects furthermore encompass polypeptides in
which the albumin binding polypeptide according to the first
aspect, or the albumin binding polypeptide as comprised in a fusion
protein or conjugate according to the second aspect, has been
provided with a label group, such as a label selected from the
group consisting of fluorescent dyes and metals, chromophoric dyes,
chemiluminescent compounds and bioluminescent proteins, enzymes,
radionuclides and particles, for example for purposes of detection
of the polypeptide. In particular, the disclosure encompasses a
radiolabeled polypeptide consisting of a radiochelate of an albumin
binding polypeptide, fusion protein or conjugate as described
herein and a radionuclide, such as a radioactive metal.
[0075] In embodiments where the labeled albumin binding polypeptide
comprises an albumin binding polypeptide according to the first
aspect of the disclosure and a label, the labeled polypeptide may
for example be used for labeling serum albumin indirectly. Due to
the strong association between the labeled polypeptide and serum
albumin, the labeled polypeptide may be used for example to study
vascular permeability and blood pool.
[0076] In other embodiments, the labeled albumin binding
polypeptide is present as a moiety in a fusion protein or conjugate
also comprising a second moiety having a desired biological
activity. The label may in some instances be coupled only to the
albumin binding polypeptide, and in some instances both to the
albumin binding polypeptide and to the second moiety of the
conjugate or fusion protein. When reference is made to a labeled
polypeptide, this should be understood as a reference to all
aspects of polypeptides as described herein, including fusion
proteins and conjugates comprising an albumin binding polypeptide
and a second and optionally further moieties. Thus, a labeled
polypeptide may contain only the albumin binding polypeptide and
e.g. a therapeutic radionuclide, which may be chelated or
covalently coupled to the albumin binding polypeptide, or contain
the albumin binding polypeptide, a therapeutic radionuclide and a
second moiety such as a small molecule having a desired biological
activity such as therapeutic efficacy. In embodiments where the
albumin binding polypeptide, fusion protein or conjugate is
radiolabeled, such a radiolabeled polypeptide may comprise a
radionuclide. A majority of radionuclides have a metallic nature
and metals are typically incapable of forming stable covalent bonds
with elements presented in proteins and peptides. For this reason,
labeling of proteins and peptides with radioactive metals is
performed with the use of chelators, i.e.
[0077] multidentate ligands, which form non-covalent compounds,
called chelates, with the metal ions. In an embodiment of the
albumin binding polypeptide, fusion protein or conjugate, the
incorporation of a radionuclide is enabled through the provision of
a chelating environment, through which the radionuclide may be
coordinated, chelated or complexed to the polypeptide.
[0078] One example of a chelator is the polyaminopolycarboxylate
type of chelator. Two classes of such polyaminopolycarboxylate
chelators can be distinguished: macrocyclic and acyclic chelators.
In one embodiment, the albumin binding polypeptide, fusion protein
or conjugate comprises a chelating environment provided by a
polyaminopolycarboxylate chelator conjugated to the albumin binding
polypeptide via a thiol group of a cysteine residue or an epsilon
amine group of a lysine residue.
[0079] The most commonly used macrocyclic chelators for
radioisotopes of indium, gallium, yttrium, bismuth, radioactinides
and radiolanthanides are different derivatives of DOTA
(1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid). In one
embodiment, the chelating environment of the albumin binding
polypeptide, fusion protein or conjugate is provided by DOTA or a
derivative thereof. More specifically, one group of chelating
polypeptides encompassed by the present disclosure is made by
reacting the DOTA derivative
1,4,7,10-tetraazacyclododecane-1,4,7-tris-acetic
acid-10-maleimidoethylacetamide (maleimidomonoamide-DOTA) with, for
example, a thiol group of the albumin binding polypeptide, for
example as described in Example 5.
[0080] The high kinetic inertness, i.e. the slow rate of
dissociation of metal from DOTA, favors stable attachment of a
radionuclide. However, elevated temperatures are required for
labeling due to a slow association rate. For this reason, DOTA
derivatives are widely used for labeling of short peptides, such as
the albumin binding polypeptides of the present disclosure, which
display binding functionality following incubation at temperatures
required for the labeling reaction.
[0081] The most commonly used acyclic polyaminopolycarboxylate
chelators are different derivatives of DTPA
(diethylenetriamine-pentaacetic acid).
[0082] Hence, polypeptides having a chelating environment provided
by diethylenetriaminepentaacetic acid or derivatives thereof are
also encompassed by the present disclosure.
[0083] It has been found that backbone-modified semi-rigid variants
of DTPA provide adequate stability for labeling with .sup.90Y of
e.g. ZEVALIN. Though acyclic chelators are less inert, and
consequently, less stable than macrocyclic ones, their labeling is
rapid enough even at ambient temperature. For this reason, they
might be used for labeling of fusion proteins or conjugates
according to the present disclosure. Detailed protocols for
coupling of polyaminopolycarboxylate chelators to targeting
proteins and peptides have been published by Cooper et al (Nat Prot
1: 314-7, 2006) and by Sosabowski and Mather (Nat Prot 1:972-6,
2006).
[0084] An albumin binding polypeptide, a fusion protein or
conjugate according to the aspects described herein coupled to a
polyaminopolycarboxylate chelator may be used to provide a
radiolabeled polypeptide consisting of a radiochelate of the
albumin binding polypeptide, fusion protein or conjugate coupled to
the chelator and a radionuclide suitable for medical imaging, the
radionuclide being selected from the group consisting of .sup.61Cu,
.sup.64Cu, .sup.65Ga, .sup.67Ga, .sup.68Ga, .sup.110mIn,
.sup.111In, .sup.44Sc and .sup.86Y, or with a radionuclide suitable
for therapy, the radionuclide being selected from the group
consisting of .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.67Cu,
.sup.166Ho, .sup.177Lu, .sup.212Pb, .sup.149Pm, .sup.153Sm,
.sup.227Th and .sup.90Y, wherein the radionuclide is complexed with
the albumin binding polypeptide via a chelator.
[0085] In embodiments thereof, the polypeptide may also be
radiolabeled with non-metal radioisotopes using so called indirect
labeling. Thus, for labeling with for example .sup.18F, .sup.76Br,
different iodine isotopes and .sup.211At, intermediate "linker
molecules" are used for labeling. Such a linker molecule should
contain two functional moieties, one providing rapid and efficient
radiolabeling, and another enabling rapid and efficient coupling to
the proteins, e.g. to amine groups, or preferably to the thiol
group of a unique cysteine, such as in position X.sub.14 of the
albumin binding polypeptide. For example a malemide group reacts
with thiol groups to form a stable thioether bond. The "linker
molecule" may first be reacted with the radiolabel and subsequently
with the thiol or the selenothiol group of the protein.
[0086] In another aspect, there is provided a polynucleotide
encoding an albumin binding polypeptide or a fusion protein as
described herein. Also encompassed is a method of producing an
albumin binding polypeptide or a fusion protein as described above,
comprising expressing the polynucleotide, an expression vector
comprising the polynucleotide and a host cell comprising the
expression vector.
[0087] The albumin binding polypeptide of the present disclosure
may alternatively be produced by non-biological peptide synthesis
using amino acids and/or amino acid derivatives having protected
reactive side-chains, the non-biological peptide synthesis
comprising
[0088] step-wise coupling of the amino acids and/or the amino acid
derivatives to form a polypeptide according to the first aspect
having protected reactive side-chains,
[0089] removal of the protecting groups from the reactive
side-chains of the polypeptide, and
[0090] folding of the polypeptide in aqueous solution.
[0091] Thus, normal amino acids (e.g. glycine, alanine,
phenylalanine, isoleucine, leucine and valine) and pre-protected
amino acid derivatives are used to sequentially build a polypeptide
sequence, in solution or on a solid support in an organic solvent.
One specific example of peptide synthesis on solid support is
described in Example 5. When a complete polypeptide sequence is
built, the protecting groups are removed and the polypeptide is
allowed to fold in an aqueous solution. Each polypeptide according
to the present disclosure reversibly folds into a three helix
bundle domain without added factors, and hence folds
spontaneously.
[0092] The conjugate according to the second aspect may be produced
by a method comprising producing an albumin binding polypeptide
according to any of the methods described above, such as by
non-biological peptide synthesis, and conjugating the produced
albumin binding polypeptide with a second and/or further moiety as
defined in connection with the second aspect.
[0093] In one embodiment of a fusion protein or conjugate, there is
moreover provided a fusion protein or conjugate as defined herein
for use in therapy, e.g. for use as a medicament. Such a fusion
protein or conjugate may exhibit a half-life in vivo which is
longer than the half-life in vivo of the polypeptide having a
desired biological activity per se. The fusion protein or conjugate
may moreover elicit no or a reduced immune response upon
administration to the mammal, such as a human, as compared to the
immune response elicited upon administration to the mammal of the
polypeptide having a desired biological activity per se.
Alternatively speaking, this provides a method for decreasing the
immunogenicity of a polypeptide having a desired biological
activity, through the fusion or conjugation of such a polypeptide
to an albumin binding polypeptide, fusion protein or conjugate
according to aspects disclosed herein. In addition, this may enable
enhancement of the biological activity of a second moiety.
[0094] In another embodiment, there is provided a fusion protein or
conjugate according to the present disclosure, for use in
diagnosis, e.g. for use as a diagnostic agent.
[0095] The present disclosure also concerns different aspects of
using the above-described albumin binding polypeptide, as well as
various methods for treatment, diagnosis and detection in which the
polypeptide is useful due to its binding and other characteristics.
When referring to the "albumin binding polypeptide" in the
following description of these uses and methods, this term is
intended to encompass the albumin binding polypeptide alone, but
also all those molecules based on this polypeptide described above
that e.g. incorporate the albumin binding polypeptide as a moiety
in a fusion protein or conjugate, and/or are conjugated to a label,
a chelator, a therapeutic and/or diagnostic agent and/or are
provided with additional amino acid residues as a tag or for other
purposes. As explained above, such fusion proteins, derivatives etc
form a part of the present disclosure.
[0096] Another set of aspects concern the provision of new means to
increase the solubility in aqueous solution of a poorly soluble
compound, through conjugation thereof to an albumin binding
polypeptide, fusion protein or conjugate. The ensuing complex of
poorly soluble compound and an albumin binding polypeptide, alone
or incorporated as a moiety in a fusion protein or conjugate, is
able to associate with albumin in vivo or in vitro, which
association increases the solubility in aqueous solution. Thus, in
an embodiment of this further aspect, there is provided a
composition, comprising
[0097] a compound which per se has a solubility in water of no more
than 100 .mu.g/ml, coupled to
[0098] an albumin binding polypeptide, a fusion protein or
conjugate as described herein, wherein the compound and the albumin
binding polypeptide, fusion protein or conjugate are covalently
coupled.
[0099] In one embodiment, the compound per se has a solubility of
no more than 10 .mu.g/ml. In yet another embodiment, said
solubility is no more than 1 .mu.g/ml.
[0100] In some embodiments, the compound may be a pharmaceutically
active compound, for example a cytotoxic agent. Non-limiting
examples of cytotoxic agents are those selected from calicheamycin,
auristatin, doxorubicin, maytansinoid, taxol, ecteinascidin,
geldanamycin and their derivatives, and combinations thereof.
Alternatively, the cytotoxic agent may be a synthetic chemotoxin
made by organic synthesis and not derived from a naturally
occurring compound.
[0101] In addition to the poorly soluble compound and albumin
binding polypeptide, fusion protein or conjugate, the composition
according to this aspect of the disclosure may, in some
embodiments, also comprise a binding polypeptide with an affinity
for a clinically relevant target. This binding polypeptide is
suitably different from the albumin binding polypeptide, and may be
non-covalently or covalently coupled to the other components of the
inventive composition. As non-limiting examples, the binding
polypeptide with an affinity for a clinically relevant target may
be selected from the group consisting of antibodies and fragments
and domains thereof substantially retaining antibody binding
activity; microbodies, maxybodies, avimers and other small
disulfide-bonded proteins; and binding proteins derived from a
scaffold selected from the group consisting of staphylococcal
protein A and domains thereof, other three helix domains,
lipocalins, ankyrin repeat domains, cellulose binding domains, y
crystallines, green fluorescent protein, human cytotoxic T
lymphocyte-associated antigen 4, protease inhibitors such as Kunitz
domains, PDZ domains, SH3 domains, peptide aptamers, staphylococcal
nuclease, tendamistats, fibronectin type III domain, transferrin,
zinc fingers and conotoxins.
[0102] The composition according to the above aspect of the present
disclosure has an ability to associate with albumin in vivo or in
vitro, through the provision in the composition of an albumin
binding polypeptide, by itself or as present in a fusion protein or
conjugate. In certain cases, it may be of benefit to form a complex
of the composition with albumin outside of a living organism, i.e.
to add exogenous albumin to the composition. Such a composition may
be lyophilized, providing a formulation that is suitable for
storage at ambient temperature. Thus, the present disclosure also
provides a composition as defined above which further comprises
albumin, such as human serum albumin.
[0103] The present disclosure also provides the composition
according to the above aspect for use as a medicament, i.e. for use
in therapy, in cases where the compound is a therapeutically active
compound. Suitably, the provision of an albumin binding
polypeptide, fusion protein or conjugate and optionally albumin
does not deleteriously affect the therapeutic efficacy of the
active compound, so the inventive composition will be useful in
those therapeutic or prophylactic settings where the compound per
se is indicated.
[0104] In another embodiment, there is provided the composition
according to the above aspect for use as a diagnostic agent, i.e.
for use in diagnosis.
[0105] A related aspect of the present disclosure provides a method
of preparation of a composition as described immediately above. The
method comprises
[0106] providing a compound which per se has a solubility in water
of no more than 100 .mu.g/ml, and
[0107] covalently coupling the compound to an albumin binding
polypeptide, fusion protein or conjugate according aspects as
described herein, thus forming a composition comprising a covalent
complex of compound and albumin binding polypeptide, fusion protein
or conjugate.
[0108] In embodiments of the present disclosure where albumin is
included into the composition, the method may comprise the
additional step of mixing said complex of compound and albumin
binding polypeptide, fusion protein or conjugate with albumin, thus
forming a composition comprising a non-covalent complex of i) the
covalent complex of compound and albumin binding polypeptide,
fusion protein or conjugate, and ii) albumin. The relative
proportions of the two components of this non-covalent complex may
for example be 1:1, so that one unit of the complex of poorly
soluble compound and albumin binding polypeptide, fusion protein or
conjugate is associated with one molecule of albumin. In one
embodiment, the method additionally comprises lyophilizing the
non-covalent complex to obtain a lyophilized composition.
[0109] In another closely related aspect, the present disclosure
provides a method of increasing the aqueous solubility of a
compound, comprising
[0110] providing a compound which per se has a solubility in water
of no more than 100 .mu.g/ml,
[0111] covalently coupling the compound to an albumin binding
polypeptide, fusion protein or conjugate according aspects as
described herein, thus forming a covalent complex of compound and
albumin binding polypeptide, fusion protein or conjugate; and
[0112] mixing said complex of compound and albumin binding
polypeptide, fusion protein or conjugate with albumin under
conditions that promote the non-covalent association of the albumin
binding polypeptide with albumin;
[0113] whereby the solubility in water of the compound in said
complex is greater than the solubility in water of the compound per
se.
[0114] In these method aspects concerning the solubility of a
poorly soluble compound, the optional features of the various
components are as described in connection with the immediately
preceding composition aspect.
[0115] While the invention has been described with reference to
various exemplary embodiments, it will be understood by those
skilled in the art that various changes may be made and equivalents
may be substituted for elements thereof without departing from the
scope of the invention. In addition, many modifications may be made
to adapt a particular situation or molecule to the teachings of the
invention without departing from the essential scope thereof.
Therefore, it is intended that the invention not be limited to any
particular embodiment contemplated for carrying out this invention,
but that the invention will include all embodiments falling within
the scope of the appended claims.
FIGURES
[0116] FIG. 1A-1F is a listing of the amino acid sequences of
examples of albumin binding polypeptides of the present disclosure
(SEQ ID NO:1-152, SEQ ID NO:155-203), the GA3 domain from protein G
of Streptococcus strain G148 extended by a N-terminal glycine
residue (SEQ ID NO:153) and an albumin binding polypeptide derived
from G148-GA3 as previously described by Jonsson et al (supra, SEQ
ID NO:154).
[0117] FIG. 2 shows the result of binding analysis performed in a
Biacore instrument for investigating the binding of the albumin
binding polypeptide PEP07912 (SEQ ID NO:157) to human serum
albumin. Three different concentrations of purified protein (40 nM,
fat gray line; 10 nM, black line; and 2.5 nM, gray line) were
injected over a surface with 955 RU of immobilized human serum
albumin.
[0118] FIGS. 3A-C show the result of binding analysis performed by
ELISA for investigating the binding of the albumin binding
polypeptides PEP07913 (SEQ ID NO:153), PEP06923 (SEQ ID NO:154),
PEP07271 (SEQ ID NO:155), PEP07912 (SEQ ID NO:157), PEP07554 (SEQ
ID NO:156), PEP07914 (SEQ ID NO:158), PEP07968 (DOTA-conjugated
PEP07911, SEQ ID NO:159) and PEP07844 (SEQ ID NO:161), to IgG
molecules present in 126 individual normal human sera, where A)
shows the average OD-value, B) shows the percentage of negative
sera (defined as OD<0.15), and C) shows the percentage of
positive sera (defined as OD>1.0).
[0119] FIGS. 4A-B are chromatograms showing analysis of purified,
chemically produced albumin binding polypeptide PEP07834 (SEQ ID
NO:160), where A) shows the absorbance signal at 220 nm, blank
subtracted, and B) shows the absorbance signal at 280 nm, blank
subtracted. Two peaks appeared at both wavelengths.
[0120] FIGS. 5A-B are spectrograms showing masspectrometric
analysis of the two peaks identified in FIGS. 4A) and B). A) is the
spectrogram of the first peak, i.e. the monomer of PEP07834 (SEQ ID
NO:160), and B) is the spectrogram of the dimer of PEP07834.
[0121] FIGS. 6A-C are diagrams showing an immunogenicity assessment
of albumin binding polypeptides PEP07913 (SEQ ID NO:153), PEP07912
(SEQ ID NO:157), PEP07914 (SEQ ID NO:158) and PEP07968
(DOTA-conjugated PEP07911, SEQ ID NO:159) in a CD3.sup.+ CD4.sup.+
T cell proliferation assay. A) shows the number of individuals
responding to the albumin binding polypeptides compared to
recombinant human albumin in a cohort of 52 Caucasian donors. B)
shows the average stimulation indices (SI) for PEP07913, PEP07912,
PEP07914 and PEP07968 compared to the negative control containing
recombinant human albumin. C) shows the number of responding
individuals against all proteins in the study as compared to the
buffer control.
[0122] FIGS. 7A-C shows the result of binding analysis performed in
a Biacore instrument for investigating the binding of the albumin
binding polypeptides A) PEP07986 (SEQ ID NO:163), B) PEP08296
(DOTA-conjugated PEP08185, SEQ ID NO:148) and C) PEP06923 (SEQ ID
NO:154) to albumin from different species. The sensorgrams shown
correspond to protein injected at a concentration of 40 nM over
surfaces immobilized with albumin from human (1130 RU), thin gray
line; cynomolgus monkey (1046 RU), thick gray line; rat (831 RU),
thick light gray line; dog (1053 RU), thin black line; and mouse
(858 RU), thick black line.
[0123] FIG. 8 shows the inhibitory effect of Z.sub.X-PP013 (open
circles), Z.sub.Y-PP013 (open squares) and Z.sub.neg-PP013 (closed
triangles) on cytokine induced TF-1 cell proliferation in the
presence of five times molar excess of HSA.
[0124] FIG. 9 shows the maximum binding responses obtained by
Biacore analysis of PEP07986 (SEQ ID NO:163) stored at 4, 25 or
40.degree. C. for one week, two weeks, one month and three months
as indicated, at a concentration of 2 mg/ml, injected over
immobilized HSA (704 RU) at a concentration of 10 nM. Non-treated
samples from time=0 are shown as references.
[0125] FIG. 10 shows the result of binding analysis performed in a
Biacore instrument for investigating the binding of the albumin
binding polypeptide PEP08296 (DOTA-conjugated PEP08185, SEQ ID
NO:148) to human serum albumin before and after heat treatment. Two
concentrations of PEP08296 (0.8 nM, grey lines; 4 nM, black lines)
were injected over a surface with 724 RU of immobilized human serum
albumin. Solid lines are before heat treatment and hatched lines
after heat treatment for 10 minutes at 90.degree. C.
[0126] FIGS. 11A-B show the overlay of two CD spectra of PEP08296
(DOTA-conjugated PEP08185, SEQ ID NO:148) before and after heat
treatment for 12 min at 90.degree. C. A) Sample incubated in PBS pH
7.2. B) Sample incubated in PBS pH 4.0.
[0127] FIG. 12 shows the maximum intensity projection (MIP) image
of the whole body distribution of .sup.68Ga-PEP08296 in a healthy
rat, summed during 1.5 h of data collection immediately following
intravenous injection (tail vein). Circulating radioactivity in the
major vessels (e.g. the jugular (long arrow) and femoral (short
arrow)), the heart (H), liver (L), spleen (S), kidney (K) and
bladder (B) are readily delineated.
[0128] FIG. 13 shows a gel filtration chromatogram of PEP07986 (SEQ
ID NO:163) injected at a concentration of 42 mg/ml, black solid
line. A chromatogram of ovalbumin (Mw 43 kDa) injected at a
concentration of 5 mg/ml, gray broken line, is included for
comparison, confirming that the peak for PEP07986 is not an
aggregate, which would have been expected in the void volume eluted
at an earlier time point than ovalbumin.
[0129] The invention will now be illustrated further through the
non-limiting description of experiments conducted in accordance
therewith. Unless otherwise specified, conventional chemistry and
molecular biology methods were used throughout.
EXAMPLES
Example 1
Cloning, Expression, Purification and Characterization of Albumin
Binding Polypeptides
[0130] In this example, ten different albumin binding polypeptides,
PEP07913 (SEQ ID NO:153), PEP07912 (SEQ ID NO: 157), PEP07914 (SEQ
ID NO:158), PEP07968 (DOTA-conjugated PEP07911, SEQ ID NO:159),
PEP06923 (SEQ ID NO:154), PEP07271 (SEQ ID NO:155), PEP07554 (SEQ
ID NO:156), PEP07844 (SEQ ID NO:161), PEP07986 (SEQ ID NO:163) and
PEP08296 (DOTA-conjugated PEP08185, SEQ ID NO:148), the amino acid
sequences of which are set out in FIG. 1 and in the appended
sequence listing, were cloned, purified and characterized.
Material and Methods
Cloning of Albumin Binding Polypeptide Variants
[0131] Mutations in G148-GA3 were generated using site directed
mutagenesis with the appropriate oligonucleotides to obtain the
desired albumin binding polypeptide variants. The gene fragments
were amplified by PCR with primers adding specific endonuclease
sites as well as an N-terminal MGSS sequence preceding the albumin
binding polypeptide variants. The fragments were cleaved with NdeI
and NotI, purified and ligated to a cloning vector, the plasmid
pAY02556 (containing an origin of replication from pBR322, a
kanamycin resistance gene and a T7 promoter for expression of the
gene of interest), restricted with the same enzymes. Ligations were
transformed to electrocompetent E. coli TOP10 cells. The
transformed cells were spread on TBAB plates (30 g/l tryptose blood
agar base) supplemented with 50 .mu.g/ml of kanamycin, followed by
incubation at 37.degree. C. overnight. The colonies were screened
using PCR and sequencing of amplified fragments was performed using
the biotinylated oligonucleotide and a BIGDYE Terminator v3.1 Cycle
Sequencing Kit (Applied Biosystems), used in accordance with the
manufacturer's protocol. The sequencing reactions were purified by
binding to magnetic streptavidin coated beads using a Magnatrix
8000 (NorDiag AB), and analyzed on ABI PRISM.RTM. 3100 Genetic
Analyzer (PE Applied Biosystems). All albumin binding polypeptide
variants were subcloned as monomers and the constructs encoded by
the expression vectors were MGSS-[PP###], where PP### corresponds
to the amino acid residues constituting the sequence of the albumin
binding polypeptide.
[0132] In addition, the gene fragments of G148-GA3, PP007 (SEQ ID
NO:7), PP013 (SEQ ID NO:13) and PP037 (SEQ ID NO:37) were amplified
by PCR with primers adding specific endonuclease sites as well as a
hexahistidin sequence, a TEV protease site and a glycine residue
before the amino acid residues constituting the sequence of the
albumin binding polypeptide. The polypeptides PEP07913 (SEQ ID
NO:153), PEP07912 (SEQ ID NO:157), PEP07914 (SEQ ID NO:158) and
PEP07968 (SEQ ID NO:159) correspond to the albumin binding
polypeptides G148-GA3, PP007 (SEQ ID NO:7), PP013 (SEQ ID NO:13)
and PP037 (SEQ ID NO:37) with glycine residues added. The fragments
were cleaved with Xbal and NotI, purified and ligated to a cloning
vector, the plasmid pAY02512 (containing an origin of replication
from pBR322, a kanamycin resistance gene and a T7 promoter for
expression of the gene of interest. The cloning site is preceded by
a sequence encoding a peptide containing a hexahistidine tag
followed by a cleavage site for the TEV protease), restricted with
the same enzymes. Ligation, transformation and sequence
verification were performed as described above. The four albumin
binding polypeptide variants G148-GA3, PP007, PP013 and PP037 were
subcloned as monomers and the constructs encoded by the expression
vectors were MGSSHHHHHHLQSSGVDLGTENLYFQG-[PP###].
[0133] The expression vector encoding
MGSSHHHHHHLQSSGVDLGTENLY-FQG-[PP013] (SEQ ID NO:206) was further
modified by site directed mutagenesis using oligonucleotides,
resulting in the insertion of a serine residue before the amino
acid residues constituting the sequence of the albumin binding
polypeptide, to obtain the construct
MGSSHHHHHHLQSSGVDLGTENLYFQGS-[PP013] (SEQ ID NO:207). This
construct was further modified by 1) site directed mutagenesis to
replace the serine residue at position 14 (within PP013) with a
cysteine residue, generating MGSSHHHHHHLQSSGVDLGTENLYFQGS-[PP049]
(SEQ ID NO:208), and 2) addition of a glycine residue C-terminally,
generating MGSSHHHHHHLQSSGVDLGTENLYFQGS-[PP049]-G (SEQ ID NO:209).
The addition of glycine C-terminally was accomplished by PCR
amplification with primers including nucleotides encoding the
glycine residue and specific endonuclease sites. The fragment was
cleaved with Xbal and NotI, purified and ligated to a cloning
vector, the plasmid pAY02641 (containing an origin of replication
from pBR322, a kanamycin resistance gene and a T7 promoter for
expression of the gene of interest), restricted with the same
enzymes. Ligation, transformation and sequence verification were
performed as described above.
Protein Expression
[0134] The albumin binding polypeptide variants were expressed in
E. coli BL21 (DE3) either with an N-terminal MGSS-extension or with
an N-terminal Hiss-tag followed by a TEV-protease recognition site
and a glycine residue. A colony of each albumin binding polypeptide
variant was used to inoculate 4 ml TSB+YE medium supplemented with
kanamycin to a concentration of 50 .mu.g/ml. The cultures were
grown at 37.degree. C. for approximately 5 hours. 3 ml from each of
the cultures was used to inoculate 800 ml TSB+YE supplemented with
kanamycin to a concentration of 50 .mu.g/ml in parallel bio
reactors (Greta system, Belach Bioteknik AB). The cultivations were
performed at 37.degree. C., with aeration at 800 ml/minute and an
agitation profile to keep dissolved oxygen levels above 30%, to an
OD600 of 2, which was followed by addition of IPTG to a final
concentration of 0.5 mM. Cultivation was continued for five hours
after which the cultivation was cooled to 10.degree. C., aeration
was stopped and agitation lowered to 300 rpm. Cell pellets were
harvested by centrifugation (15600.times.g, 4.degree. C., 20
minutes) and stored at -20.degree. C. until purification.
Purification of Albumin Binding Polypeptide Variants with a
Hiss-Tag and a TEV-Protease Site
[0135] Frozen cell pellets harboring soluble hexahistidine-tagged
polypeptides PEP07913 (SEQ ID NO:153), PEP07912 (SEQ ID NO:156),
PEP07914 (SEQ ID NO:158), PEP07968 (SEQ ID NO:159), PEP07986 (SEQ
ID NO:163) and PEP08185 (SEQ ID NO:148) were suspended in 35 ml
binding buffer (20 mM sodium phosphate, 0.5 M NaCl, 20 mM
imidazole, pH 7.4) with an addition of 1000 U BENZONAZE
(1.01654.001, Merck) and disrupted by ultrasonication. For each of
the polypeptides, the ultrasonicated suspension was clarified by
centrifugation (1 h, 37000.times.g, 4.degree. C.) and the
supernatant was loaded onto a His GRAVITRAP column (11-0033-99, GE
Healthcare). The column was washed with 10 ml washing buffer (20 mM
sodium phosphate, 0.5 M NaCl, 60 mM imidazole, pH 7.4), before
eluting the polypeptide with 3 ml elution buffer (20 mM sodium
phosphate, 0.5 M NaCl, 0.5 M imidazole, pH 7.4). The buffer was
exchanged to a cleavage buffer (50 mM Tris-HCl, 150 mM NaCl, pH 8)
using PD-10 desalting column (17-0851-01, GE Healthcare). The
amount of polypeptide product was determined by measuring the
absorbance at 280 nm before adding DTT to a final concentration of
5 mM. Hiss-tagged TEV protease was added to the cleavage buffer at
a 1:10 mass ratio relative to the polypeptide product. The cleavage
was performed over night under slow mixing at 4.degree. C.
Imidazole was added to the cleavage mix, to a concentration of 20
mM, before loading the mix onto a His GRAVITRAP column (11-0033-99,
GE Healthcare) for removing cleaved Hiss-tags, Hiss-tagged TEV
protease and Hiss-tagged uncleaved product.
[0136] For each variant, the flow-through, containing the albumin
binding polypeptide variant, was further purified by reversed phase
chromatography (RPC), as follows. The flow-through fraction was
loaded on 1 ml Resource 15 RPC column (GE Healthcare), previously
equilibrated with RPC A Buffer (0.1% TFA in water). After column
wash with 10 column volumes (CV) RPC A Buffer, bound polypeptides
were eluted with a linear gradient of 0-50% RPC B Buffer (0.1% TFA
in acetonitrile) during 10 CV. The flow rate was 2 ml/min and the
absorbance at 280 nm was monitored. Fractions containing albumin
binding polypeptide variant were identified by SDS-PAGE analysis
and pooled.
[0137] The RPC-purified albumin binding polypeptide variants were
further purified by gel filtration on 120 ml Superdex 75 (GE
Healthcare) packed in an XK16 column (GE Healthcare). The running
buffer was 1.times.PBS, and the flow rate 2 ml/min. Fractions
containing pure albumin binding polypeptide variant were pooled and
concentrated to approximately 1.3 mg/ml. Finally, the concentrate
was purified from trace amounts of remaining endotoxins by using 1
ml columns of AffinityPak Detoxi-Gel Endotoxin removing gel
(Pierce, prod#20344), according to the manufacture's
recommendations.
[0138] The albumin binding polypeptide variants PEP07911 and
PEP08185 were conjugated with Mal-DOTA before the RPC-purification
step, as follows. The buffer of the flow-through fraction from the
IMAC-FT purification step was exchanged to 0.2 M NaAc, pH 5.5,
using a disposable PD-10 desalting column (GE Healthcare).
Maleimido-mono-amide-DOTA (Macrocyclics, cat. no. B-272) was added
at 5-fold molar excess and incubated for 60 minutes at 30.degree.
C. under continuous shaking. The resulting polypeptide were denoted
PEP07968 and PEP08296, respectively.
Purification of Albumin Binding Polypeptide-Variants without
Hiss-Tag
[0139] Frozen cell pellets harboring soluble albumin binding
polypeptide variants PEP06923 (SEQ ID NO:154), PEP07271 (SEQ ID
NO:155), PEP07554 (SEQ ID NO:156) and PEP07844 (SEQ ID NO:161) were
suspended in 20 mM Tris-HCl, pH 8 and disrupted by ultrasonication.
For each of the polypeptide variants, the ultrasonicated suspension
was clarified by centrifugation (30 min, 32000.times.g, 4.degree.
C.) and the supernatant was loaded onto a HSA-Sepharose column (GE
Healthcare). After washing with TST-buffer (25 mM Tris-HCl, 1 mM
EDTA, 200 mM NaCl, 0.05% Tween 20, pH 8.0), followed by 5 mM
NH.sub.4Ac, pH 5.5, bound albumin binding polypeptide variant was
eluted with 0.5 M HAc, pH 3.2.
[0140] The albumin binding polypeptide variants were further
purified by reversed phase chromatography (RPC), as follows. For
each of the variants, the eluate from the HSA-affinity purification
step was loaded on 1 ml Resource 15 RPC column (GE Healthcare),
previously equilibrated with RPC A Buffer (0.1% TFA in water).
After column wash with 10 CV RPC A Buffer, bound polypeptides were
eluted with a linear gradient of 0-50% RPC B Buffer (0.1% TFA in
acetonitrile) during 10 CV. The flow rate was 2 ml/min and the
absorbance at 280 nm was monitored. Fractions containing pure
albumin binding polypeptide variants were identified by SDS-PAGE
analysis and pooled. Finally, the buffer was exchanged to
1.times.PBS (2.68 mM KCl, 137 mM NaCl, 1.47 mM KH.sub.2PO.sub.4,
8.1 mM Na.sub.2HPO.sub.4, pH 7.4) using a disposable PD-10
desalting column (GE Healthcare).
Characterization of Purified Albumin Binding
Polypeptide-Variants
[0141] The concentration was assessed by measuring the absorbance
at 280 nm using a NANODROP ND-1000 Spectrophotometer. The proteins
were further analyzed with SDS-PAGE and LC-MS.
[0142] For the SDS-PAGE analysis, approximately 10 .mu.g of each
albumin binding polypeptide variant was mixed with NuPAGE LDS
Sample Buffer (Invitrogen), incubated at 70.degree. C. for 15 min
and loaded onto NuPAGE 4-12% Bis-Tris Gels (Invitrogen). The gels
were run with NuPAGE MES SDS Running Buffer (Invitrogen) in an
XCell II SureLock Electrophoresis Cell (Novex) employing the Sharp
Prestained Standard (Invitrogen) as molecular weight marker and
using PhastGel BlueR (GE Healthcare) for staining.
[0143] To verify the identity of the albumin binding polypeptide
variants, LC/MS analyses were performed using an Agilent 1100
LC/MSD system, equipped with API-ESI and a single quadruple mass
analyzer. Approximately 10 .mu.g of each of the purified albumin
binding polypeptide variants was loaded on a Zorbax 300SB-C8
Narrow-Bore column (2.1.times.150 mm, 3.5 .mu.m, Agilent
Technologies) at a flow-rate of 0.5 ml/min. Polypeptides were
eluted using a linear gradient of 10-70% solution B for 15 min at
0.5 ml/min. The separation was performed at 30.degree. C. The ion
signal and the absorbance at 280 and 220 nm were monitored. The
molecular weights of the purified albumin binding polypeptide
variants were confirmed by MS.
Results
[0144] The expression levels of the albumin binding polypeptide
variants were 10-30 mg product/g cell pellet, as estimated from
SDS-PAGE analysis.
[0145] For all variants, the purity, as determined by SDS-PAGE
analysis, exceeded 95% and the LC/MS analysis verified the correct
molecular weights. After purification, between 1 and 8 mg of pure
polypeptide was obtained for each of the ten albumin binding
polypeptide variants.
Example 2
Affinity Determination for Albumin Binding Polypeptides
[0146] In this example, PEP06923 (SEQ ID NO:154), PEP07271 (SEQ ID
NO:155), PEP07844 (SEQ ID NO:161), PEP07912 (SEQ ID NO:157),
PEP07913 (SEQ ID NO:153), PEP07914 (SEQ ID NO:158) and PEP07968,
(DOTA-conjugated PEP07911, SEQ ID NO:159), synthesized or expressed
and purified in Example 1 were characterized for affinity to human
serum albumin (HSA) using a Biacore instrument. PEP07913
corresponds to the amino acid sequence of G148-GA3 with addition of
a N-terminal glycine residue, whereas PEP07271, PEP07844, PEP07912,
PEP07914 and PEP07968 correspond to the albumin binding
polypeptides of PP001 (SEQ ID NO:1), PP043 (SEQ ID NO:43), PP007
(SEQ ID NO:7), PP013 (SEQ ID NO:13) and PP037 (SEQ ID NO:37) with
different N-terminal amino acid additions.
Material and Methods
[0147] Biosensor analysis on a Biacore2000 instrument (GE
Healthcare) was performed with HSA (ALBUCULT, Novozymes),
immobilized by amine coupling onto the carboxylated dextran layer
of the surfaces of CM-5 chips (research grade; GE Healthcare)
according to the manufacturer's recommendations. Surface 1 of the
chip was activated and deactivated and used as a reference cell
(blank surface) during injections, whereas surface 2 comprised HSA
immobilized to 731 resonance units (RU) and surface 4 comprised HSA
immobilized to 955 RU. The purified albumin binding polypeptide
variants were diluted in running buffer HBS-EP (GE Healthcare) to
2.5 nM, 10 nM and 40 nM, and injected at a constant flow-rate of 50
.mu.l/min for 5 minutes, followed by injection of HBS-EP for 60
minutes. The surfaces were regenerated with one injection of 25
.mu.l HCl, 10 mM. The affinity measurements were performed in two
sets; in the first set HBS-EP, PEP06923, PEP07271, PEP07912,
PEP07913, PEP07914 and PEP07968 were injected (chip surface 2), and
in the second set HBS-EP, PEP06923, PEP07844, PEP07912 and PEP07914
were injected (chip surface 4). PEP06923 was injected twice in each
run as a control. The results were analyzed with a BiaEvaluation
software (GE Healthcare). Curves of the blank surface were
subtracted from the curves of the ligand surfaces.
Results
[0148] The Biacore 2000 instrument has a technical limitation,
hindering measurements of very high affinity. Hence, the purpose of
the Biacore study was not to determine the exact kinetic parameters
of the albumin binding polypeptide variants' affinity for HSA.
However, the results provide a quantitative estimation of the
relative affinities of these polypeptides for albumin. After
subtraction of reference surface and buffer injection, curves were
fitted to a 1:1 (Langmuir) binding model using BIAevaluation
software with correction for mass transfer and with RUmax set as a
local parameter. Curves are shown in FIG. 2. The relative K.sub.D,
k.sub.a (k.sub.on) and k.sub.d (k.sub.off) values were estimated
and are presented in the Tables below.
TABLE-US-00002 TABLE 1 Kinetic parameters (k.sub.a, k.sub.d and
K.sub.D) of albumin binding polypeptides to HSA, 1st set k.sub.a
(Ms.sup.-1) k.sub.d (s.sup.-1) K.sub.D (M) PEP07913 5.7 .times.
10.sup.5 9.3 .times. 10.sup.-4 1.6 .times. 10.sup.-9 PEP06923 (1)
2.9 .times. 10.sup.7 2.9 .times. 10.sup.-5 9.9 .times. 10.sup.-13
PEP06923 (2) 2.6 .times. 10.sup.7 2.8 .times. 10.sup.-5 1.1 .times.
10.sup.-12 PEP07271 3.9 .times. 10.sup.6 2.9 .times. 10.sup.-5 7.5
.times. 10.sup.-12 PEP07912 4.6 .times. 10.sup.6 2.8 .times.
10.sup.-5 6.2 .times. 10.sup.-12 PEP07914 3.5 .times. 10.sup.6 2.5
.times. 10.sup.-5 7.2 .times. 10.sup.-12 PEP07968 3.0 .times.
10.sup.6 2.7 .times. 10.sup.-5 9.0 .times. 10.sup.-12
TABLE-US-00003 TABLE 2 Kinetic parameters (k.sub.a, k.sub.d and
K.sub.D) of albumin binding polypeptides to HSA, 2nd set k.sub.a
(Ms.sup.-1) k.sub.d (s.sup.-1) K.sub.D (M) PEP06923 (1) 2.0 .times.
10.sup.7 2.6 .times. 10.sup.-5 1.3 .times. 10.sup.-12 PEP06923 (2)
2.1 .times. 10.sup.7 2.5 .times. 10.sup.-5 1.2 .times. 10.sup.-12
PEP07912 5.4 .times. 10.sup.6 2.8 .times. 10.sup.-5 5.2 .times.
10.sup.-12 PEP07914 3.8 .times. 10.sup.6 2.6 .times. 10.sup.-5 6.9
.times. 10.sup.-12 PEP07844 5.4 .times. 10.sup.6 2.3 .times.
10.sup.-5 4.4 .times. 10.sup.-12
[0149] As shown in Tables 1 and 2, PEP07271 (SEQ ID NO:155),
PEP07844 (SEQ ID NO:161), PEP07912 (SEQ ID NO:157), PEP07914 (SEQ
ID NO:158) and PEP07968 (DOTA-conjugated PEP07911, SEQ ID NO:159)
all seem to have approximately the same affinity for HSA, widely
exceeding the affinity of the parent G148-GA3 (PEP07913, SEQ ID
NO:153). The HSA affinity of these polypeptides is slightly lower
compared to PEP06923 (SEQ ID NO:154), despite similar off-rate.
Example 3
Determination of Melting Temperature (Tm) for Albumin Binding
Polypeptides
[0150] In this example, the albumin binding polypeptide variants
PEP07913 (SEQ ID NO:153), PEP06923 (SEQ ID NO:154), PEP07271 (SEQ
ID NO:155), PEP07554 (SEQ ID NO:156), PEP07912 (SEQ ID NO:157),
PEP07914 (SEQ ID NO:158), PEP07968 (DOTA-conjugated PEP07911, SEQ
ID NO:159), PEP07844 (SEQ ID NO:161) and PEP07986 (SEQ ID NO:163),
expressed and purified as described in Example 1, and the albumin
polypeptide variant PEP07975 (DOTA-conjugated PEP07834, SEQ ID
NO:160), produced as described in Example 5, were analyzed by CD
analysis. PEP07913 corresponds to the sequence of G148-GA3 having
an N-terminal glycine residue, PEP06923 is an engineered high
affinity derivative previously described by Jonsson et al, supra,
whereas PEP07271, PEP07554, PEP07912, PEP07914, PEP07968, PEP07844
and PEP07975 are examples of the albumin binding polypeptides of
PP001 (SEQ ID NO:1), PP007 (SEQ ID NO:7), PP013 (SEQ ID NO:13),
PP037 (SEQ ID NO:37) and PP043 (SEQ ID NO:43) having different
N-terminal amino acid additions according to the present
disclosure.
Material and Methods
[0151] Purified albumin binding polypeptide variants were diluted
in 1.times.PBS, to final concentrations between 0.4 and 0.5 mg/ml.
Circular dichroism (CD) analysis was performed on a Jasco J-810
spectropolarimeter in a cell with an optical path-length of 1 mm.
In the variable temperature measurements, the absorbance was
measured at 221 nm from 20.degree. C. to 90.degree. C., with a
temperature slope of 5.degree. C./min.
Results
[0152] The melting temperatures (Tm) of the different albumin
binding polypeptide variants were calculated by determining the
midpoint of the transition in the CD vs. temperature plot. The
results are summarized in Table 3 below.
TABLE-US-00004 TABLE 3 Determined Tm values of tested albumin
binding polypeptide variants N-terminal Tm Variant SEQ ID NO: #
sequence.sup.3 (.degree. C.) PEP07913 SEQ ID NO: 153 GL 61 PEP06923
SEQ ID NO: 154 GSSL 57 PEP07271 SEQ ID NO: 155 GSSL 65 PEP07554 SEQ
ID NO: 156 GSSL 58 PEP07912 SEQ ID NO: 157 GL 53 PEP07914 SEQ ID
NO: 158 GL 59 PEP07968 SEQ ID NO: 159.sup.1 GL 53 PEP07975 SEQ ID
NO: 160.sup.1, 2 AL 50 PEP07844 SEQ ID NO: 161 GSSL 65 PEP07986 SEQ
ID NO: 163 GSL 61 .sup.1The peptide is conjugated with
maleimide-DOTA at the cysteine .sup.2The peptide is amidated at the
C-terminus .sup.3Leucine (underlined) is the residue in position 1
of the amino acid sequence of the albumin binding polypeptide as
defined in the first aspect of the present disclosure
[0153] The polypeptide PEP07968 is identical to PEP07912, except
for the former having a cysteine residue in position 14 conjugated
with maleimide DOTA, and the latter a serine residue. Thus, the
DOTA modification should not affect the melting temperature. Also
PEP07975 is conjugated with DOTA using C14, and is identical to
PEP07968 except for the C-terminal amide (resulting from the
peptide synthesis in Example 5) and for having an N-terminal
alanine instead of a glycine. Furthermore, comparing PEP07912 and
PEP07554 reveals that an N-terminal serine gives a higher melting
temperature than a glycine in the same position (5.degree. C.
difference in Tm). Thus, all albumin binding polypeptide variants
according to the present disclosure show Tm above 55.degree. C.,
except PEP07912 and DOTA-conjugated variants. Taking into
consideration the importance of the N-terminal portion, all the
tested albumin binding polypeptides are superior to the prior art
derivative of Jonsson et al, i.e. PEP06923.
Example 4
Serum Response Analysis
[0154] The percentage of human serum containing IgG, capable of
binding to a set of albumin binding polypeptides as disclosed
herein was analyzed by ELISA. In total, 149 serum samples
corresponding to 127 individuals were screened.
Material and Methods
[0155] ELISA plates (96-well, half area plates (Costar, cat. No.
3690)) were coated with 50 .mu.l/well of ALBUCULT (Novozymes)
diluted to 8 .mu.g/ml in coating buffer (Sigma, cat. No. 3041). The
plates were coated over night for three days at 4.degree. C. On the
day of analysis, the plates were washed twice with tap water and
blocked for 2 hours with 100 .mu.l of phosphate buffered saline
(PBS) containing 0.05% casein (PBSC). The plates were emptied and
50 .mu.l/well of the albumin binding polypeptides PEP07913 (SEQ ID
NO:153), PEP06923 (SEQ ID NO:154), PEP07271 (SEQ ID NO:155),
PEP07912 (SEQ ID NO:157), PEP07554 (SEQ ID NO:156), PEP07914 (SEQ
ID NO:158), PEP07968 (DOTA-conjugated PEP07911, SEQ ID NO:159) and
PEP07844 (SEQ ID NO:161), diluted to 2 .mu.g/ml in PBSC were added
according to a pre-made plate layout. After incubation for two
hours at room temperature (RT), the plates were washed in PBSC four
times using an automated ELISA washer. The 149 serum samples from
129 individuals were diluted 50 times in PBSC by adding 24 .mu.l
serum to 1174 .mu.l PBSC. 50 .mu.l of the diluted sera was added
per well according to the pre-made plate layout. Each serum sample
was tested as a singlet. Positive and negative controls were
included on each plate and for each albumin binding polypeptide.
Albumin binding antibodies (50 .mu.l, 0.5 .mu.l/ml immunoglobulin
solution prepared in house from sera from primates immunized with
PEP06923) was added as a positive control and 50 .mu.l PBSC was
used as a negative control. The plates were incubated for one hour
at RT and subsequently washed four times in PBSC using an automated
ELISA washer. The bound IgG was detected with 50 .mu.l/well of
anti-human IgG (Southern Biotech, cat no 2040-05) diluted 10 000
times in PBSC. After washing four times in PBSC using an automated
ELISA washer, 50 .mu.l/well of substrate was added (Pierce cat. No.
34021). The reaction was stopped after 10-15 minutes by the
addition of 50 .mu.l H2504 to each well, prior to measuring the
absorbance using a multi-well plate reader (Victor3, Perkin
Elmer).
Results
[0156] Of the 149 sera screened for IgG binding to the albumin
binding polypeptides, 23 were negative for all eight polypeptides
(OD-value <0.1), i.e. showed no IgG bound to the polypeptides.
The analysis was performed with the 126 sera that were positive for
one or more albumin binding polypeptides. The average absorbance
was calculated (FIG. 3A) and the percentage of sera with OD-values
values either <0.15 (FIG. 3B) or >1.0 (FIG. 3C). The highest
average OD-value and the highest percentage of serum with IgG
binding were obtained with PEP07913 (SEQ ID NO:153), PEP06923 (SEQ
ID NO:154) and PEP07844 (SEQ ID NO:161), whereas least reactivity
was found against PEP07968 (DOTA-conjugated PEP07911, SEQ ID
NO:159), PEP07914 (SEQ ID NO:158) and PEP07554 (SEQ ID NO:156).
[0157] Thus, the most reactive albumin binding polypeptides were
the parental G148-GA3 (PEP07913, SEQ ID NO:153) and the previously
affinity improved derivative (PEP06923, SEQ ID NO:154), having
helix 1 retained from G148-GA3. The third of the more reactive
polypeptides (PEP07844, SEQ ID NO:161) contains the original lysine
in position 14 in helix 1. This residue is intended for
conjugation, and will therefore not be exposed in the final
context. The identical albumin binding polypeptide variant, except
for having an alanine in position 14 (PEP07554, SEQ ID NO:156), is
one of the least reactive.
Example 5
Chemical Synthesis of a DOTA-Conjugated Albumin Binding
Polypeptide
Material and Methods
[0158] The albumin binding polypeptide PEP07834 (SEQ ID NO:160) was
synthesized by solid phase peptide synthesis (SPPS, as described by
Quibell, M. & Johnson, T., in Fmoc Solid Phase Peptide
Synthesis-A Practical Approach, W. C. Chan, P. D. White Eds, Oxford
University Press 2000, 115-135) in a 433 A Peptide Synthesizer
reactor (Applied Biosystems, Foster City, Calif.) on a 0.1 mmol
scale, i.e. with a theoretical possible yield of 0.1 mmol peptide,
using standard Fmoc chemistry. An acid-labile Fmoc amide resin was
used as solid support throughout the synthesis (Rink Amide MBHA
Resin LL (100-200 mesh), loading 0.39 mmol amide/g resin
(Novabiochem)).
[0159] 47 amino acid residues according to the sequence below were
coupled to the amide resin by acylation reactions in the reactor
for 10 minutes at room temperature (RT) and mixing. The acylation
reactions were performed with a ten-fold molecular excess of Fmoc
protected amino acids in NMP (N-methylpyrrolidone, Merck),
activated with 1 eq of
2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethylaminium
hexafluorophosphate (HBTU, IRIS Biotech), 1 eq of
1-hydroxybenzotriazole (HOBt, IRIS Biotech) and 2 eq of
diisopropylethylamine (DIEA, Applied Biosystems). In addition, all
reactive amino acid side chains were protected with standard side
chain protection groups (tert-butyl (tBu) for Asp, Glu, Ser, Thr
and Tyr, tert-butyloxycarbonyl (Boc) for Lys,
2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl (Pbf) for Arg,
and trityl (Trt) for Asn and Cys) prior to activation and coupling.
In order to diminish the amount of incomplete couplings leading to
truncated peptides, a minor amount of selected amino acid residues
were subjected to coupling by acylation twice, without Fmoc
deprotection as described below between the first and second
coupling. The amino acid sequence of the synthesized albumin
binding polypeptide PEP07834 was
TABLE-US-00005 (SEQ ID NO: 160-NH.sub.2)
ALASAKEAANAELDCYGVSDFYKRLIDKAKTVEGVEALKDAILAALP- NH.sub.2.
The underlined amino acid residues were double coupled. Any
remaining unreacted amino groups on the resin bound peptides were
capped with acetic anhydride (0.5 M acetic anhydride (AlfaAesar),
0.125 M DIEA, 0.015 M HOBt in NMP) for 5 min. Following every
coupling, deprotection of the N-terminal Fmoc group on the resin
bound peptides were performed by treatment with 20% piperidine
(Sigma-Aldrich) in NMP for 10 min.
[0160] After completed synthesis, the peptides were cleaved from
the solid support and simultaneously the side chain protection
groups were cleaved off by treatment with TFA/EDT/H.sub.2O/TIS
(94:2.5:2.5:1) (TFA: trifluoroacetic acid (Apollo), EDT:
1,2-ethanedithiol (Aldrich), TIS: triisopropylsilane (Aldrich)) at
RT for 2 h with occasional mixing. After TFA treatment, the
peptides were extracted three times using 20% acetonitrile (Merck)
in water and tert-butyl methyl ether (Merck). The aqueous phases
were combined, filtered and lyophilized.
[0161] The crude peptides were analyzed and purified by
semi-preparative RP-HPLC (Reprosil GOLD C18 300, 250*10 mm, 5 .mu.m
particle size) and a gradient of 32-55% B (A: 0.1% TFA-H.sub.2O; B:
0.1% TFA-CH.sub.3CN) during 25 min at a flow rate of 2.5 ml
min.sup.-1, followed by lyophilization.
[0162] The synthetic yield was determined by calculation of the
integrated areas under the peaks from the 220 nm signal from the
crude analysis on RP-HPLC. The correct molecular weight was
verified using liquid chromatography electrospray ionization mass
spectrometry (LC-ESI-MS) on a 6520 Accurate Mass Q-TOF LC/MS
(Agilent Technologies). The purity of the product was verified
using RP-HPLC (Reprosil GOLD C18 300, 250*4.6 mm, 3 .mu.m particle
size) using a gradient of 35-55% B over 25 min at a flow rate of
1.0 ml
DOTA Conjugation
[0163] 3 mg of PEP07834-amide (SEQ ID NO:160-amide) was reduced
with 20 mM DTT at 40.degree. C. for 30 minutes. Excess DTT was
removed by buffer exchange on a PD-10 column (GE Healthcare) to 0.2
M ammonium acetate, pH 5.5. The coupling was performed with a
5-fold molar excess of chelator, maleimido-mono-amide-DOTA
(Macrocyclics, Cat. No. B-272) solution in water (1 mg/ml). The
mixture was incubated for 1 hour at 30.degree. C. under continuous
shaking. Purification from non-conjugated chelators was made on a
semi-preparative RPC column (Zorbax 300SB C18, 9.4.times.250 mm, 5
.mu.m). The coupling degree of the purified material was analyzed
by HPLC-MS on a Zorbax 300SB C8 150.times.2.1 mm, 3.5 .mu.m
analytical column. Only maleimide-DOTA-conjugated PEP07834, denoted
PEP07975, was detected by the method.
Results
[0164] Based on the elution profile of the crude material, the
synthetic yield of the albumin binding polypeptide PEP07834-amide
(SEQ ID NO:160-amide) was determined to be 8%. The found molecular
weight was 4952.9 Da, which is in good agreement with the
theoretical molecular weight calculated to 4952.6 Da. When
analyzing the purified product, approximately 10-15% of the protein
was found to be a disulfide linked homodimer (FIGS. 4 and 5). The
binding activity of the DOTA-conjugated peptide (PEP07975) was
confirmed as described in Example 2 (data not shown), and the
melting temperature determined as described in Example 3.
Example 6
Immunogenicity Testing of Albumin Binding Polypeptides
[0165] PEP07913 (SEQ ID NO:153), PEP07912 (SEQ ID NO:157), PEP07914
(SEQ ID NO:158), and PEP07968 (DOTA-conjugated PEP07911, SEQ ID
NO:159) were screened for their ability to induce T cell
proliferation in peripheral blood mononuclear cells (PBMC) from 52
human Caucasian individuals (obtained from CRI-Labo Medische
Analyse, Gent, Belgium). PEP07913 corresponds to the sequence of
G148-GA3 having an N-terminal glycine residue, whereas PEP07912,
PEP07914 and PEP07968 are examples of the albumin binding
polypeptides of PP007 (SEQ ID NO:7), PP013 (SEQ ID NO:13) and PP037
(SEQ ID NO:37) having different N-terminal amino acid additions
according to the present disclosure.
Materials and Methods
[0166] PBMCs, prepared according to standard cell biological
methods, were added to a tissue culture (TC) treated 96-well round
bottom plate (Falcon) in an amount of 300 000 PBMCs/well. The cells
were stimulated by addition of 100 .mu.l/well of albumin binding
polypeptides PEP07913, PEP07912, PEP07914 and PEP07968 in AIMV
medium (Invitrogen) additionally containing 900 .mu.g/ml (3-fold
molar excess) of recombinant human albumin (ALBUCULT, Novozymes).
This corresponded to a final concentration of albumin binding
polypeptide of 30 .mu.g/ml. The stimulation was done in
eight-plicates, i.e. the same albumin binding polypeptide were
added to eight wells in identical amounts and under the same
conditions. In positive control wells, the cells were stimulated
with either 30 .mu.g/ml Keyhole Limpet Hemocyanin (KLH, Calbiochem)
or 30 .mu.g/ml tetanus toxoid (TT, Statens Serum Institut). In
negative control wells, only AIMV medium with or without 900
.mu.g/ml of albumin were added.
[0167] Cell proliferation was assessed after seven days of
culturing using Alexa Fluor 488 Click-iT EdU flow cytometry assay
kit (Invitrogen). 1 .mu.M/well of EdU incorporation marker was
added on day six. On day seven, cells were washed, dissociated from
the plate, washed again and stained for 30 minutes with
anti-CD3-PerCP reagent (Becton Dickinson) and anti-CD4-Alexa647
reagent (Becton Dickinson). Following staining, the cells were
washed, fixed (BD cellfix, BD biosciences), permeabilized (using
saponin) and stained for EdU by addition of Click-iT reagent
according to the manufacturer's protocol (Invitrogen). After
completed staining, cells were washed again and analyzed using flow
cytometry (FACSCantoll, BD Biosciences). To assess the number of
proliferating cells, a fixed number of fluospheres (Invitrogen) was
added to each well before analysis. All staining procedures and
washes were performed directly in the 96-well plate.
[0168] The raw FACSCantoll data were gated hierarchically on
CD3.sup.+ CD4.sup.+ T cells and the number of gated cells as well
as their fluorescence intensity of EdU-Alexa Flour 488
incorporation marker were recorded. The mean values of the number
of proliferating cells/eight-plicate of protein treated wells were
compared to the positive and negative controls and the resulting
ratios, described as stimulation indices (SI), were calculated.
Based on the SI and the variation between replicates, threshold
SI-values were set to 2.0 and 0.5 for stimulation and inhibition,
respectively.
Results
[0169] The albumin binding polypeptides PEP07913, PEP07912,
PEP07914 and PEP07968 were assessed for their immunogenic potential
in the presence of 3-fold excess of recombinant human albumin in a
target human population using an in vitro PBMC proliferation assay.
Compared to the albumin control, PEP07913 induced
CD3.sup.+CD4.sup.+ T cells proliferation in 6 of 52 donors,
PEP07912 in 5 of 52 donors and PEP07914 and PEP07968 in 1 of 52
donors (FIG. 6A).
[0170] The mean stimulation index (SI) for all 52 donors was not
significantly different for PEP07914 and PEP07968 compared to the
negative control containing recombinant human albumin (p=0.79 and
0.48 respectively, FIG. 6B). The SI for PEP07913 was significantly
higher (p=0.002) whereas the SI for PEP07912 was higher but not
significant (p=0.03, FIG. 6B).
[0171] As compared to buffer only, the number of responding
individuals was 10 for PEP07912, 7 for PEP07912, 2 for PEP07914, 1
for PEP07968, 2 for recombinant human albumin, and 49 and 51 for
the two positive controls TT and KLH, respectively (FIG. 6C). The
albumin binding polypeptides were ranked according to their
immunogenicity in the following order:
PEP07913>PEP07912>PEP07914>PEP07968. Both PEP07914 and
PEP07968 were defined as non-immunogenic. The above results thus
demonstrate that the immunogenic potential of the albumin binding
polypeptides of the present disclosure is low, as compared to the
positive controls.
Example 7
Albumin Binding Polypeptides' Affinity to Albumin from Different
Species
[0172] In this example, PEP06923 (SEQ ID NO:154), PEP07986 (SEQ ID
NO:163) and PEP08296, (DOTA-conjugated PEP08185, SEQ ID NO:148),
expressed and purified as described in Example 1, were
characterized for affinity to albumin from human (HSA), cynomolgus
monkey (CSA), rat (RSA), mouse (MSA) and dog (DSA) using a Biacore
instrument.
Material and Methods
[0173] Biosensor analysis on a Biacore2000 instrument (GE
Healthcare) was performed with HSA (ALBUCULT, Novozymes), CSA
(purified in-house from cynomolgus serum), RSA (Sigma-Aldrich, Cat.
No. A6272), MSA (Sigma-Aldrich, Cat. No. A3559) and DSA (MP
Biomedicals, Cat. No. 55925), immobilized by amine coupling onto
the carboxylated dextran layer of the surfaces of CM-5 chips
(research grade; GE Healthcare) according to the manufacturer's
recommendations.
[0174] On chip 1, surface 1 was activated and deactivated and used
as a reference cell (blank surface) during injections, whereas
surface 2 comprised HSA immobilized to 1130 resonance units (RU),
surface 3 comprised CSA immobilized to 1046 RU, surface 4 comprised
RSA immobilized to 831 RU. On chip 2, surface 1 was used as blank
surface, whereas surface 3 comprised MSA immobilized to 858 RU. On
chip 3, surface 1 was used as blank surface, whereas surface 2
comprised DSA immobilized to 1053 RU.
[0175] For analysis of affinity for HSA, CSA, and RSA (chip 1), the
purified albumin binding polypeptide variants were diluted in
running buffer HBS-EP (GE Healthcare) to 40 nM, 10 nM and 2.5 nM;
for analysis of affinity for MSA (chip 2) the albumin binding
polypeptide variants were diluted to 1280 nM, 640 nM, 160 nM and 40
nM and for analysis of affinity for DSA (chip 3) albumin binding
polypeptide variants were diluted to 1280 nM, 640 nM, 160 nM, 40 nM
and 10 nM. The albumin binding polypeptides were injected at a
constant flow-rate of 50 .mu.l/min for 5 minutes, followed by
injection of HBS-EP for 60 minutes. The surfaces were regenerated
with one injection of 25 .mu.l HCl, 10 mM. All samples were run in
duplicates.
[0176] The results were analyzed with a BIAevaluation software (GE
Healthcare). Curves of the blank surface were subtracted from the
curves of the ligand surfaces.
Results
[0177] The Biacore 2000 instrument has a technical limitation,
hindering measurements of very high affinity. Hence, the purpose of
the Biacore study was not to determine the exact kinetic parameters
of the albumin binding polypeptide variants' affinity for HSA, CSA,
RSA, MSA and DSA respectively. However, the results provide a
quantitative estimation of the relative affinities of the enclosed
polypeptides for albumin from these different species. After
subtraction of reference surface and buffer injection, curves were
fitted to a 1:1 (Langmuir) binding model using BIAevaluation
software with correction for mass transfer and with RUmax set as a
local parameter. Representative binding curves are shown in FIG.
7.
[0178] PEP07986 and PEP08296 (DOTA-conjugated PEP08185) bind with
high affinity (K.sub.D in the range from below picomolar to below
nanomolar) to human serum albumin as well as to albumin from the
frequent preclinical model species rat, cynomolgus monkey, mouse
and dog. The relative affinities for the different species can be
ranked as RSA HSA/CSA>MSA/DSA, i.e. the K.sub.D values ranked as
K.sub.D-RSA.ltoreq.K.sub.D-HSA/K.sub.D-CSA<K.sub.D-MSA/K.sub.D-DSA.
The affinities in terms of K.sub.D values are the same or slightly
lower (but in the same order of magnitude) as the affinity obtained
for PEP06923 (non-inventive polypeptide).
Example 8
In Vitro Activity of Protein Z Variants Fused to an Albumin Binding
Polypeptide
[0179] In this example, polypeptides comprising cytokine-specific
protein Z (derivative of domain B of staphylococcal protein A)
variants genetically fused to the albumin binding polypeptide
variant PP013 (SEQ ID NO:13) were tested for their functionality,
this being to block cytokine-induced proliferation of TF-1 cells in
the presence of human serum albumin. Proliferation of TF-1 cells is
dependent of the presence of any of several different types of
cytokines and the proliferative response can be inhibited by
blocking reagents such as the corresponding cytokine-specific
protein Z variant. PP013 fused to a protein Z variant with
specificity for an irrelevant protein was used as negative
control.
Materials and Methods
Cloning of Z-PP013 Fusion Proteins
[0180] Gene fragments of protein Z variants with specificity for
cytokine X or Y respectively, or for an irrelevant protein
(negative control), were amplified by PCR using primers adding PstI
and AccI specific endonuclease sites. The fragments were cleaved
with PstI and AccI, purified and ligated into an expression vector,
the plasmid pAY02747, restricted with the same enzymes. pAY02747
contains an origin of replication from pBR322, a kanamycin
resistance gene and a T7 promoter for expression of the gene of
interest. The cloning site is preceded by a sequence encoding the
amino acids MGSSLQ and succeded by a sequence encoding VDSS-PP013,
where PP013 is the disclosed albumin binding polypeptide with SEQ
ID NO:13. Ligation, transformation and sequence verification were
performed as described above. The encoded proteins were: [0181] 1)
MGSSLQ-Z.sub.X-VDSS-PP013 (denoted Z.sub.X-PP013) (SEQ ID NO:210)
[0182] 2) MGSSLQ-Z.sub.Y-VDSS-PP013 (denoted Z.sub.Y-PP013) (SEQ ID
NO:211) [0183] 3) MGSSLQ-Z.sub.neg-VDSS-PP013 (denoted
Z.sub.neg-PP013) (SEQ ID NO:212)
Protein Expression
[0184] Z.sub.X-PP013, Z.sub.Y-PP013 and Z.sub.neg-PP013 were
expressed in E. coli BL21 (DE3) cells. Colonies from the
transformations of each fusion variant were used to inoculate
starter cultures of 50 ml TSB+YE medium supplemented with kanamycin
to a concentration of 50 .mu.g/ml. The cultures were grown at
37.degree. C. over night with agitation, 100 rpm. The starter
cultures were then used to inoculate 900 ml TSB+YE medium
supplemented with kanamycin to a concentration of 50 .mu.g/ml. The
cultures were grown for approximately 1.5 h to an OD600 of >1.1,
upon which IPTG was added to a final concentration of 0.2 mM.
Cultivation was continued for five hours. Cell pellets were
harvested by centrifugation (15600 g, 4.degree. C., 20 minutes) and
stored at -20.degree. C. until purification.
Protein Purification
[0185] Frozen cell pellets harboring soluble fusion protein
variants Z.sub.X-PP013, Z.sub.Y-PP013 and Z.sub.neg-PP013 were
resuspended in 50 mM Tris-HCl, 150 mM NaCl, pH 8 and 1000 U
BENZONASE (Merck Cat. No. 1.01654.0001) was added. The cells were
disrupted by ultrasonication and for each of the fusion protein
variants, the ultrasonicated suspension was clarified by
centrifugation (15 min, 37000 g, 4.degree. C.). 20.times.TST-buffer
(20.times.[25 mM Tris-HCl, 1 mM EDTA, 200 mM NaCl, 0.05% Tween 20,
pH 8.0]) was added at a volume resulting in 1.times.TST buffer in
the clarified suspension. Each sample of fusion protein variant was
loaded onto a HSA-Sepharose column (GE Healthcare). After washing
with TST-buffer, followed by 5 mM NH.sub.4Ac, pH 5.5, bound fusion
protein variant was eluted with 0.5 M HAc, pH 2.5.
[0186] The fusion protein variants were further purified by
reversed phase chromatography (RPC), as follows. For each of the
variants, the eluate from the HSA-affinity purification step was
loaded on a 1 ml Resource 15 RPC column (GE Healthcare) previously
equilibrated with RPC A Buffer (0.1% TFA in water). After column
wash with 10 CV RPC A Buffer and 5 CV of RPC B Buffer (0.1% TFA in
acetonitrile), bound fusion proteins were eluted with a linear
gradient of 10-50% RPC B Buffer over 20 CV. The flow rate was 2
ml/min and the absorbance at 280 nm was monitored. Fractions
containing pure fusion protein variants were identified by SDS-PAGE
analysis and pooled. Finally, the buffer was exchanged to
1.times.PBS (2.68 mM KCl, 137 mM NaCl, 1.47 mM KH.sub.2PO.sub.4,
8.1 mM Na.sub.2HPO.sub.4, pH 7.4) using a disposable PD-10
desalting column (GE Healthcare). To verify the identity of the
fusion protein variants, SDS-PAGE and LC/MS analyses were performed
as described in Example 1.
In Vitro Cell Assay of Z-PP013 Fusion Proteins
[0187] The cell line TF-1 (CLS Cat. No. 300434) was propagated as
recommended by the provider in RPMI 1640 medium+10% fetal calf
serum (Gibco) with the addition of 2 ng/ml of rhGM-CSF (Miltenyi).
At the day of experiment, the cells were washed in RPMI 1640
medium+10% fetal calf serum to remove GM-CSF.
[0188] The ability of Z.sub.X-PP013 and Z.sub.Y-PP013 to block
cytokine induced proliferation was analyzed by mixing the molecules
Z.sub.X-PP013, Z.sub.Y-PP013 and Z.sub.neg-PP013 with cytokines X
and Y respectively, and with a five times molar excess of HSA
(ALBUCULT, Novozymes). The molecules were titrated in a 2-fold
dilution series with a fixed concentration of cytokine (4.9 .mu.M)
and a five times molar excess of HSA. The titration was performed
in 96-well plates in a volume of 100 .mu.l. 25 000 cells were added
per well (100 .mu.l) and plates were incubated at 37.degree. C., 5%
CO2 for three days. To measure the proliferation, 19 .mu.l of CCK-8
cell proliferation reagent (Sigma) diluted two times in RPMI 1640
medium+10% fetal calf serum, was added per well. The color reaction
was monitored after 4 hours using 96-well plate reader (Victor3;
PerkinElmer).
Results
[0189] As shown in FIG. 8, both Z.sub.X-PP013 and Z.sub.Y-PP013
inhibited the respective cytokine induced proliferation in the
presence of HSA whereas Z.sub.neg-PP013, the negative control, did
not affect proliferation of TF-1. Thus, the experiment shows that
the function of the Z molecules was retained when incorporated into
a fusion protein containing the albumin binding polypeptide, and
also when the fusion proteins were bound to albumin.
Example 9
Long-Term Stability of an Albumin Binding Polypeptide
[0190] In this example, the stability of PEP07986 (SEQ ID NO:163),
expressed and purified as described in Example 1, was investigated
after storage at 4, 25, and 40.degree. C. for up to three months.
The status of the polypeptide after storage was investigated by
measuring its binding to HSA using a Biacore instrument.
Material and Methods
[0191] Lyophilized PEP07986 was dissolved in sterile NaPi buffer
(20 mM sodium phosphate, 150 mM sodium chloride, pH 7.2) at a
concentration of 2 mg/ml. A reference sample (time=0) was removed
and stored at -80.degree. C. Aliquots of 105 .mu.l were stored in
sterile screw-cap eppendorf tubes sealed with parafilm at 4, 25,
and 40.degree. C. After one week, two weeks, one month and three
months, a sample stored at each temperature was cooled to 4.degree.
C., centrifuged for 5 min at 13000 rpm and then stored at
-80.degree. C. awaiting Biosensor analysis.
[0192] Biosensor analysis was performed essentially as described in
Example 2 but with HSA (ALBUCULT, Novozymes), immobilized to 704
resonance units (RU) and the albumin binding polypeptide variant
was diluted to 10 nM and injected at a constant flow-rate of 20
.mu.l/min for 10 minutes, followed by injection of HBS-EP for 10
minutes.
Results
[0193] The binding to HSA of PEP07986 (SEQ ID NO:163) was retained
after storage at 4, 25, and 40.degree. C. for at least three
months. The maximum binding responses to HSA obtained for PEP07986
stored at the various conditions are shown in FIG. 9.
Example 10
Stability of an Albumin Binding Polypeptide Under Extreme
Conditions
[0194] In this example, biosensor and circular dichroism (CD)
analysis of the albumin binding polypeptide PEP08296
(DOTA-conjugated PEP08185, SEQ ID NO:148) after heat treatment
(90.degree. C.) in low pH (.about.4.0) buffer is described. Since
such extreme reaction conditions have to be used for example for
.sup.68Ga labeling of DOTA-modified proteins, the influence of high
heat and low pH treatment on the structural identity of the
polypeptide and its capacity to bind HSA was investigated by
measuring the melting temperature (Tm), refolding properties and
binding to HSA.
Material and Methods
Biosensor Analysis of Heat Stability
[0195] Biosensor analysis on a Biacore 2000 instrument (GE
Healthcare) was performed with HSA (ALBUCULT, Novozymes)
immobilized by amine coupling onto the carboxylated dextran layer
of the surfaces of CM-5 chip (research grade; GE Healthcare)
according to the manufacturer's recommendations. Surface 1 of the
chip was activated and deactivated and used as a reference cell
(blank surface) during injections, whereas surface 2 comprised HSA
immobilized to 724 resonance units (RU). PEP08296 (50 .mu.l, 100
.mu.g) in a 15 ml Falcon tube was diluted with 450 .mu.l 0.2 M
sodium acetate (NaAc) pH 5.5 to a final peptide concentration of
0.2 mg/mL. After addition of 1.5 ml 0.05 M HCl (resembling the
conditions and volume used for eluting a .sup.68Ge/.sup.68Ga
generator) the sample was incubated for 10 minutes at 90.degree. C.
or RT (control) and then transferred to RT. 6 ml 0.1 M sodium
citrate was added to neutralize the pH. The heat treated PEP08296
(0.8 and 4 nM) was injected at a constant flow-rate of 50 .mu.l/min
for 5 minutes, followed by dissociation in HBS-EP for 15 minutes.
The surfaces were regenerated with one injection of 25 .mu.l 10 mM
HCl. The results were analyzed with BIAevaluation software (GE
Healthcare). Curves of the blank surface were subtracted from the
curves of the ligand surfaces.
Determination of the Melting Temperature (Tm)
[0196] PEP08296 was dissolved in PBS to a final concentration of
0.5 mg/ml. PBS with a pH of approximately 4.0 was prepared by
adding 9.5 .mu.l 100 mM HCl to 100 .mu.l PBS. Circular dichroism
(CD) analysis was performed as described in Example 3.
CD Analysis of Heat Stability
[0197] To investigate structural reversibility of PEP08296 after
heat treatment, two CD spectra between 195 and 250 were recorded
per sample at 20.degree. C. After the first spectrum, a VTM cycle
with heating to 90.degree. C. was run as described above followed
by collection of the second CD spectrum between 195 and 250 nm at
20.degree. C. In addition, PEP08296 was incubated in PBS pH 4.0
buffer or PBS pH 7.2 buffer for 12 minutes at 90.degree. C. in a
thermomixer (500 rpm, interval mixing 10 s on, 30 s off). After
incubation, the samples were cooled on ice followed by
centrifugation at 13000 rpm for 1 minute, and a CD spectrum between
195 and 250 nm was recorded at 20.degree. C.
Results
[0198] Biosensor analysis was used to investigate if heat treatment
in combination with low pH, i.e. common conditions needed for
.sup.68Ga-labeling of polypeptide, would affect the capacity of
PEP08296 to bind to HSA. FIG. 10 shows the result of this binding
analysis performed with a Biacore 2000 instrument. Two different
concentrations of PEP08296, 0.8 nM and 4 nM, were injected over a
surface with 724 RU of immobilized human serum albumin. Heat
treatment for 10 min at 90.degree. C., pH 4.0, slightly reduced the
binding capacity of PEP08296 to HSA, indicating a potential
structural change of the molecule.
[0199] CD was used to further investigate the potential structural
change of the molecule. Similar CD spectra before and after heating
would prove a sample to be structurally reversible. In the first
experiment, the samples were heated with a temperature gradient
from 20.degree. C. to 90.degree. C. The CD spectra before and after
heat treatment were similar in the Tm determination experiment with
the typical minima at 207 and 221 nm indicating .alpha.-helicity,
i.e. short time heating to 90.degree. C. in either pH 4 or pH 7.2
buffer had no effect on the structure of PEP08296.
[0200] However, pretreatment of PEP08296 for 12 minutes at
90.degree. C. showed a slightly reduced alpha helix content of
PEP08296 if incubated at pH 4.0, but no change in alpha helix
content if incubated at pH 7.2. Typical overlays of two CD spectra
before and after heating are shown in FIG. 11.
[0201] The results from the melting temperature (Tm) determination
are summarized in Table 4.
TABLE-US-00006 TABLE 4 Tm of PEP08296 Designation Tm (.degree. C.)
PEP08296 at pH 7.2 59 PEP08296 at pH 4.0 62
Example 11
Blood Pool Imaging Using a .sup.68Ga-Labeled Albumin Binding
Polypeptide
[0202] In the experiments making up this example, whole body
distribution of .sup.68Ga-labeled PEP08296 (DOTA-conjugated
PEP08185, SEQ ID NO:148) in rats was followed by dynamic imaging
over 1.5 hours. Due to the strong association between the labeled
polypeptide and serum albumin, the labeled polypeptide can be used
for example to study blood pool and tissue permeability.
Material and Methods
.sup.68Ga-Labeling of PEP08296
[0203] .sup.68Ga was eluted as .sup.68GaCl.sub.3 from the
.sup.68Ge/.sup.68Ga generator (Obninsk, Russia) with 0.1 M HCl,
converted to .sup.68GaCl.sub.4-- with concentrated HCl, trapped on
an anionic exchange column (Chromafix-HCO.sub.3) and subsequently
eluted with 18 MO water, as previously described (Velikyan et al
(2008), Nucl Med Biol 35:529-536).
[0204] The labeling was performed essentially as described in
Tolmachev et al. (EJNMMI 37:1356-1367, 2010). The concentrated
.sup.68Ga-eluate (150-200 .mu.l) was added to PEP08296 (100 .mu.g
in 0.2 M sodium acetate buffer pH 5.5) and the pH was adjusted to
3.5-4 using sodium acetate (1.25 M) or HCl (0.1 M). The labeling
mixture was incubated at 90.degree. C. for 15 min before cooling,
and the labeled protein was isolated by size exclusion purification
on a NAP-5 column eluted with physiologically buffered saline.
[0205] The radiochemical purity and identity of the
.sup.68Ga-labeled protein was assessed by radio-HPLC using UV (210
nm) and radioactivity detectors in series and a Superdex Peptide
10/300 GL column (GE Healthcare) eluted with physiologically
buffered saline.
Small Animal PET
[0206] A rat (277 g) was anesthetized with isoflurane (initially
5%, then 2% blended with 7:3 air/O.sub.2), controlled by an E-Z
vaporizer using Microflex non-rebreather masks from Euthanex
Corporation, and was kept on a heating pad (37.degree. C.) while
lying within a microPET Focus120 system (Siemens, CTI Concorde
Microsystems). .sup.68Ga-PEP08296, 33 MBq, was dispensed in a
syringe, diluted with saline to 0.5 ml and injected via the tail
vein. Data were acquired from the whole body by moving the bed in a
constant bed motion protocol for 1.5 h. Data were processed with
MicroPET Manager and corrected for randoms, dead time and decay.
Images were reconstructed by standard 2D filtered back projection
using a ramp filter and evaluated using Inveon Research Workplace
(Siemens Medical Solutions) software.
Results
[0207] Basic distribution patterns (FIG. 12) for PEP08296 were very
similar to that of albumin labeled with radioisotopes such as
.sup.68Ga-DOTA, .sup.64Cu-DOTA and .sup.11C (see e.g. Hoffend et al
(2005), Nucl Med Biol 32:287-292 and Lu et al (2008),
"[1-.sup.11C]Butanol and [Methyl-.sup.11C]Albumin for Blood Flow
and Blood Pool Imaging", poster at the Xlth Turku PET Symposium,
24-27 May 2008). In brief, high radioactivity concentrations were
observed in major blood vessels throughout the scan. Organs with
large blood volumes (liver, spleen and kidney) were also clearly
delineated, as was the cardiac blood pool radioactivity.
Radioactivity in the urinary bladder increased during the
observation period, this observation of renal elimination being
consistent with previous observations with labeled albumin-based
tracers and with that of the metabolism of albumin itself.
[0208] The general distribution pattern of radioactivity and very
slow plasma clearance after intravenous injection of
.sup.68Ga-PEP08296 is consistent with its expected very rapid and
strong binding to albumin. These results therefore support further
applications of the radiotracer as an in vivo blood pool imaging
agent for use with positron emission tomography studies of tissue
permeability, both during the development of disease and during
therapeutic intervention.
Example 12
Solubility of an Albumin Binding Polypeptide
[0209] The solubility of PEP07986 (SEQ ID NO:163) in physiological
buffer was investigated by consecutive concentrations of the sample
using ultrafiltration, followed by concentration measurement and
investigation of aggregation status. Concentrations determined by
direct absorbance readings at 280 nm were consistent with
concentrations determined by gel filtration, showing a solubility
of more than 42 mg/ml with no aggregates detected.
Material and Methods
[0210] Lyophilized PEP07986 was dissolved in NaPi buffer (20 mM
sodium phosphate, 150 mM sodium chloride, pH 7.2) at a
concentration of 3 mg/ml. Amicon Ultra centrifugal filter units,
cut off of 3 kDa, (Millipore, Cat. No. UFC800324) were prerinsed
with 2 ml NaPi buffer by centrifugation at 4000 g for 20 min in a
swinging bucket rotor centrifuge (Multifuge, Heraeus). 1620 .mu.l
of 3 mg/ml PEP07986 was applied to a first centrifugal filter unit
and centrifugation was performed at 4000 g, 20.degree. C., for 7
min. A 25 .mu.l sample was removed (UF sample 1) for further
analysis and the rest of the sample was transferred to a second
centrifugal filter unit. The centrifugation and sample removal were
repeated three times with spinning times of 8, 9 and 20 min
respectively (UF sample 2, 3 and 4 respectively). Absorbance
readings were performed using a NANODROP ND-1000 Spectrophotometer
and by diluting UF samples 1-4 in NaPi buffer 2, 4, 6 and 12 times
respectively. The concentrations were calculated using the
extinction coefficient 1 Abs 280=1.955 mg/ml. Gel filtration was
performed on a 1100 HPLC system (Agilent Technologies) using a
Superdex75 10/300 GL column (GE Healthcare) which had been
equilibrated in NaPi buffer. 10 .mu.l of each UF sample were
applied to the column; NaPi buffer was used as running buffer and
the flow rate was 0.5 ml/min. A chromatogram of the molecular
weight standard ovalbumin (GE Healthcare), injected at a
concentration of 5 mg/ml was collected as well. Concentrations were
determined by integrating the area under the curve.
Results
[0211] Concentrations determined by direct absorbance readings at
280 nm and concentrations determined by gel filtration are shown in
Table 5. The solubility of PEP07986 (SEQ ID NO:163) is at least 42
mg/ml in physiological buffer (20 mM sodium phosphate, 150 mM
sodium chloride, pH 7.2). No aggregates were detected by gel
filtration, as shown by FIG. 13.
TABLE-US-00007 TABLE 5 Concentrations determined after consecutive
concentration of PEP07986 (SEQ ID NO: 163). Concentrations (mg/ml)
determined by Sample Spectrophotometer Gel filtration UF2 12.1 12.4
UF3 22.2 22.1 UF4 42.7 42.6
Sequence CWU 1
1
212146PRTArtificialEngineered albumin-binding polypeptide 1Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45246PRTArtificialEngineered albumin-binding polypeptide 2Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45346PRTArtificialEngineered albumin-binding polypeptide 3Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45446PRTArtificialEngineered albumin-binding polypeptide 4Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45546PRTArtificialEngineered albumin-binding polypeptide 5Leu Ala
Ser Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45646PRTArtificialEngineered albumin-binding polypeptide 6Leu Ala
Ser Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45746PRTArtificialEngineered albumin-binding polypeptide 7Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45846PRTArtificialEngineered albumin-binding polypeptide 8Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45946PRTArtificialEngineered albumin-binding polypeptide 9Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451046PRTArtificialEngineered albumin-binding polypeptide 10Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451146PRTArtificialEngineered albumin-binding polypeptide 11Leu Ala
Ser Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451246PRTArtificialEngineered albumin-binding polypeptide 12Leu Ala
Ser Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451346PRTArtificialEngineered albumin-binding polypeptide 13Leu Ala
Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451446PRTArtificialEngineered albumin-binding polypeptide 14Leu Ala
Glu Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451546PRTArtificialEngineered albumin-binding polypeptide 15Leu Ala
Glu Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451646PRTArtificialEngineered albumin-binding polypeptide 16Leu Ala
Glu Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451746PRTArtificialEngineered albumin-binding polypeptide 17Leu Ala
Glu Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451846PRTArtificialEngineered albumin-binding polypeptide 18Leu Ala
Glu Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
451946PRTArtificialEngineered albumin-binding polypeptide 19Leu Ala
Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452046PRTArtificialEngineered albumin-binding polypeptide 20Leu Ala
Glu Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452146PRTArtificialEngineered albumin-binding polypeptide 21Leu Ala
Glu Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452246PRTArtificialEngineered albumin-binding polypeptide 22Leu Ala
Glu Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452346PRTArtificialEngineered albumin-binding polypeptide 23Leu Ala
Glu Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452446PRTArtificialEngineered albumin-binding polypeptide 24Leu Ala
Glu Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452546PRTArtificialEngineered albumin-binding polypeptide 25Leu Ala
Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452646PRTArtificialEngineered albumin-binding polypeptide 26Leu Ala
Gln Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452746PRTArtificialEngineered albumin-binding polypeptide 27Leu Ala
Gln Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452846PRTArtificialEngineered albumin-binding polypeptide 28Leu Ala
Gln Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
452946PRTArtificialEngineered albumin-binding polypeptide 29Leu Ala
Gln Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453046PRTArtificialEngineered albumin-binding polypeptide 30Leu Ala
Gln Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453146PRTArtificialEngineered albumin-binding polypeptide 31Leu Ala
Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453246PRTArtificialEngineered albumin-binding polypeptide 32Leu Ala
Gln Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453346PRTArtificialEngineered albumin-binding polypeptide 33Leu Ala
Gln Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453446PRTArtificialEngineered albumin-binding polypeptide 34Leu Ala
Gln Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453546PRTArtificialEngineered albumin-binding polypeptide 35Leu Ala
Gln Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453646PRTArtificialEngineered albumin-binding polypeptide 36Leu Ala
Gln Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453746PRTArtificialEngineered albumin-binding polypeptide 37Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453846PRTArtificialEngineered albumin-binding polypeptide 38Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
453946PRTArtificialEngineered albumin-binding polypeptide 39Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454046PRTArtificialEngineered albumin-binding polypeptide 40Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454146PRTArtificialEngineered albumin-binding polypeptide 41Leu Ala
Ser Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454246PRTArtificialEngineered albumin-binding polypeptide 42Leu Ala
Ser Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454346PRTArtificialEngineered albumin-binding polypeptide 43Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454446PRTArtificialEngineered albumin-binding polypeptide 44Leu Ala
Ser Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454546PRTArtificialEngineered albumin-binding polypeptide 45Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu 20 25
30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
454646PRTArtificialEngineered albumin-binding polypeptide 46Leu Ala
Ser Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10 15Val
Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 454746PRTArtificialEngineered albumin-binding polypeptide 47Leu
Ala Ser Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 454846PRTArtificialEngineered albumin-binding polypeptide 48Leu
Ala Ser Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 454946PRTArtificialEngineered albumin-binding polypeptide 49Leu
Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455046PRTArtificialEngineered albumin-binding polypeptide 50Leu
Ala Glu Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455146PRTArtificialEngineered albumin-binding polypeptide 51Leu
Ala Glu Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455246PRTArtificialEngineered albumin-binding polypeptide 52Leu
Ala Glu Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455346PRTArtificialEngineered albumin-binding polypeptide 53Leu
Ala Glu Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455446PRTArtificialEngineered albumin-binding polypeptide 54Leu
Ala Glu Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455546PRTArtificialEngineered albumin-binding polypeptide 55Leu
Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455646PRTArtificialEngineered albumin-binding polypeptide 56Leu
Ala Glu Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455746PRTArtificialEngineered albumin-binding polypeptide 57Leu
Ala Glu Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455846PRTArtificialEngineered albumin-binding polypeptide 58Leu
Ala Glu Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 455946PRTArtificialEngineered albumin-binding polypeptide 59Leu
Ala Glu Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456046PRTArtificialEngineered albumin-binding polypeptide 60Leu
Ala Glu Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456146PRTArtificialEngineered albumin-binding polypeptide 61Leu
Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456246PRTArtificialEngineered albumin-binding polypeptide 62Leu
Ala Gln Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456346PRTArtificialEngineered albumin-binding polypeptide 63Leu
Ala Gln Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456446PRTArtificialEngineered albumin-binding polypeptide 64Leu
Ala Gln Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456546PRTArtificialEngineered albumin-binding polypeptide 65Leu
Ala Gln Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456646PRTArtificialEngineered albumin-binding polypeptide 66Leu
Ala Gln Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456746PRTArtificialEngineered albumin-binding polypeptide 67Leu
Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456846PRTArtificialEngineered albumin-binding polypeptide 68Leu
Ala Gln Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 456946PRTArtificialEngineered albumin-binding polypeptide 69Leu
Ala Gln Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457046PRTArtificialEngineered albumin-binding polypeptide 70Leu
Ala Gln Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457146PRTArtificialEngineered albumin-binding polypeptide 71Leu
Ala Gln Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457246PRTArtificialEngineered albumin-binding polypeptide 72Leu
Ala Gln Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457346PRTArtificialEngineered albumin-binding polypeptide 73Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457446PRTArtificialEngineered albumin-binding polypeptide 74Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457546PRTArtificialEngineered albumin-binding polypeptide 75Leu
Ala Cys Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457646PRTArtificialEngineered albumin-binding polypeptide 76Leu
Ala Cys Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457746PRTArtificialEngineered albumin-binding polypeptide 77Leu
Ala Cys Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457846PRTArtificialEngineered albumin-binding polypeptide 78Leu
Ala Cys Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 457946PRTArtificialEngineered albumin-binding polypeptide 79Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458046PRTArtificialEngineered albumin-binding polypeptide 80Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458146PRTArtificialEngineered albumin-binding polypeptide 81Leu
Ala Cys Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458246PRTArtificialEngineered albumin-binding polypeptide 82Leu
Ala Cys Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458346PRTArtificialEngineered albumin-binding polypeptide 83Leu
Ala Cys Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458446PRTArtificialEngineered albumin-binding polypeptide 84Leu
Ala Cys Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458546PRTArtificialEngineered albumin-binding polypeptide 85Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458646PRTArtificialEngineered albumin-binding polypeptide 86Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458746PRTArtificialEngineered albumin-binding polypeptide 87Leu
Ala Cys Ala Lys Glu Ser Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458846PRTArtificialEngineered albumin-binding polypeptide 88Leu
Ala Cys Ala Lys Glu Ser Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 458946PRTArtificialEngineered albumin-binding polypeptide 89Leu
Ala Cys Ala Lys Ser Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 459046PRTArtificialEngineered albumin-binding polypeptide 90Leu
Ala Cys Ala Lys Ser Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 459146PRTArtificialEngineered albumin-binding polypeptide 91Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 459246PRTArtificialEngineered albumin-binding polypeptide 92Leu
Ala Cys Ala Lys Glu Ala Ala Asn Ser Glu
Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp
Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile
Leu Ala Ala Leu Pro 35 40 459346PRTArtificialEngineered
albumin-binding polypeptide 93Leu Ala Cys Ala Lys Glu Ser Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 459446PRTArtificialEngineered
albumin-binding polypeptide 94Leu Ala Cys Ala Lys Glu Ser Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 459546PRTArtificialEngineered
albumin-binding polypeptide 95Leu Ala Cys Ala Lys Ser Ala Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 459646PRTArtificialEngineered
albumin-binding polypeptide 96Leu Ala Cys Ala Lys Ser Ala Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 459746PRTArtificialEngineered
albumin-binding polypeptide 97Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 459846PRTArtificialEngineered
albumin-binding polypeptide 98Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 459946PRTArtificialEngineered
albumin-binding polypeptide 99Leu Ala Gln Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510046PRTArtificialEngineered
albumin-binding polypeptide 100Leu Ala Gln Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510146PRTArtificialEngineered
albumin-binding polypeptide 101Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Cys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510246PRTArtificialEngineered
albumin-binding polypeptide 102Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Cys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510346PRTArtificialEngineered
albumin-binding polypeptide 103Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510446PRTArtificialEngineered
albumin-binding polypeptide 104Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510546PRTArtificialEngineered
albumin-binding polypeptide 105Leu Ala Gln Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510646PRTArtificialEngineered
albumin-binding polypeptide 106Leu Ala Gln Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510746PRTArtificialEngineered
albumin-binding polypeptide 107Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Lys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510846PRTArtificialEngineered
albumin-binding polypeptide 108Leu Ala Gln Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Lys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4510946PRTArtificialEngineered
albumin-binding polypeptide 109Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511046PRTArtificialEngineered
albumin-binding polypeptide 110Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511146PRTArtificialEngineered
albumin-binding polypeptide 111Leu Ala Ser Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511246PRTArtificialEngineered
albumin-binding polypeptide 112Leu Ala Ser Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511346PRTArtificialEngineered
albumin-binding polypeptide 113Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Cys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511446PRTArtificialEngineered
albumin-binding polypeptide 114Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Cys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511546PRTArtificialEngineered
albumin-binding polypeptide 115Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511646PRTArtificialEngineered
albumin-binding polypeptide 116Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511746PRTArtificialEngineered
albumin-binding polypeptide 117Leu Ala Ser Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511846PRTArtificialEngineered
albumin-binding polypeptide 118Leu Ala Ser Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4511946PRTArtificialEngineered
albumin-binding polypeptide 119Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Lys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512046PRTArtificialEngineered
albumin-binding polypeptide 120Leu Ala Ser Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Lys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512146PRTArtificialEngineered
albumin-binding polypeptide 121Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512246PRTArtificialEngineered
albumin-binding polypeptide 122Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512346PRTArtificialEngineered
albumin-binding polypeptide 123Leu Ala Glu Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512446PRTArtificialEngineered
albumin-binding polypeptide 124Leu Ala Glu Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512546PRTArtificialEngineered
albumin-binding polypeptide 125Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Cys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512646PRTArtificialEngineered
albumin-binding polypeptide 126Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Cys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512746PRTArtificialEngineered
albumin-binding polypeptide 127Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512846PRTArtificialEngineered
albumin-binding polypeptide 128Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4512946PRTArtificialEngineered
albumin-binding polypeptide 129Leu Ala Glu Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513046PRTArtificialEngineered
albumin-binding polypeptide 130Leu Ala Glu Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ser Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513146PRTArtificialEngineered
albumin-binding polypeptide 131Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Lys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513246PRTArtificialEngineered
albumin-binding polypeptide 132Leu Ala Glu Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Lys Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513346PRTArtificialEngineered
albumin-binding polypeptide 133Leu Ala Cys Ala Lys Cys Ala Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513446PRTArtificialEngineered
albumin-binding polypeptide 134Leu Ala Cys Ala Lys Cys Ala Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513546PRTArtificialEngineered
albumin-binding polypeptide 135Leu Ala Cys Ala Lys Cys Ser Ala Asn
Ser Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys Asp
Ala Ile Leu Ala Ala Leu Pro 35 40 4513646PRTArtificialEngineered
albumin-binding polypeptide 136Leu Ala Cys Ala Lys Cys Ser Ala Asn
Ala Glu Leu Asp Ala Tyr Gly1 5 10 15Val Ser Asp Phe Tyr Lys Arg Leu
Ile Asp Lys Ala Lys Thr Val Glu 20 25 30Gly Val Glu Ala Leu Lys
Asp Ala Ile Leu Ala Ala Leu Pro 35 40
4513746PRTArtificialEngineered albumin-binding polypeptide 137Leu
Ala Cys Ala Lys Cys Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 4513846PRTArtificialEngineered albumin-binding polypeptide
138Leu Ala Cys Ala Lys Cys Ala Ala Asn Ser Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4513946PRTArtificialEngineered albumin-binding polypeptide
139Leu Ala Cys Ala Lys Cys Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4514046PRTArtificialEngineered albumin-binding polypeptide
140Leu Ala Cys Ala Lys Cys Ala Ala Asn Ser Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4514146PRTArtificialEngineered albumin-binding polypeptide
141Leu Ala Cys Ala Lys Cys Ser Ala Asn Ser Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4514246PRTArtificialEngineered albumin-binding polypeptide
142Leu Ala Cys Ala Lys Cys Ser Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4514346PRTArtificialEngineered albumin-binding polypeptide
143Leu Ala Cys Ala Lys Cys Ala Ala Asn Ala Glu Leu Asp Lys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4514446PRTArtificialEngineered albumin-binding polypeptide
144Leu Ala Cys Ala Lys Cys Ala Ala Asn Ser Glu Leu Asp Lys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4514549PRTArtificialEngineered albumin-binding polypeptide
145Gly Ser Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser1
5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys
Thr 20 25 30Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala
Leu Pro 35 40 45Gly14649PRTArtificialEngineered albumin-binding
polypeptide 146Gly Ser Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu
Leu Asp Ser1 5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp
Lys Ala Lys Thr 20 25 30Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile
Leu Ala Ala Leu Pro 35 40 45Gly14749PRTArtificialEngineered
albumin-binding polypeptide 147Gly Ser Leu Ala Ser Ala Lys Glu Ala
Ala Asn Ala Glu Leu Asp Cys1 5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys
Arg Leu Ile Asp Lys Ala Lys Thr 20 25 30Val Glu Gly Val Glu Ala Leu
Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
45Gly14849PRTArtificialEngineered albumin-binding polypeptide
148Gly Ser Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys1
5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys
Thr 20 25 30Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala
Leu Pro 35 40 45Gly14950PRTArtificialEngineered albumin-binding
polypeptide 149Gly Ser Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu
Leu Asp Ser1 5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp
Lys Ala Lys Thr 20 25 30Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile
Leu Ala Ala Leu Pro 35 40 45Cys Gly 5015050PRTArtificialEngineered
albumin-binding polypeptide 150Gly Ser Leu Ala Glu Ala Lys Glu Ala
Ala Asn Ala Glu Leu Asp Ser1 5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys
Arg Leu Ile Asp Lys Ala Lys Thr 20 25 30Val Glu Gly Val Glu Ala Leu
Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40 45Cys Gly
5015150PRTArtificialEngineered albumin-binding polypeptide 151Gly
Cys Ser Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp1 5 10
15Lys Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys
20 25 30Thr Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala
Leu 35 40 45Pro Gly 5015250PRTArtificialEngineered albumin-binding
polypeptide 152Gly Cys Ser Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala
Glu Leu Asp1 5 10 15Lys Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile
Asp Lys Ala Lys 20 25 30Thr Val Glu Gly Val Glu Ala Leu Lys Asp Ala
Ile Leu Ala Ala Leu 35 40 45Pro Gly 5015347PRTArtificialEngineered
albumin-binding polypeptide 153Gly Leu Ala Glu Ala Lys Val Leu Ala
Asn Arg Glu Leu Asp Lys Tyr1 5 10 15Gly Val Ser Asp Tyr Tyr Lys Asn
Leu Ile Asn Asn Ala Lys Thr Val 20 25 30Glu Gly Val Lys Ala Leu Ile
Asp Glu Ile Leu Ala Ala Leu Pro 35 40
4515449PRTArtificialEngineered albumin-binding polypeptide 154Gly
Ser Ser Leu Ala Glu Ala Lys Val Leu Ala Asn Arg Glu Leu Asp1 5 10
15Lys Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asn Lys Ala Lys
20 25 30Thr Val Glu Gly Val Glu Ala Leu Lys Leu His Ile Leu Ala Ala
Leu 35 40 45Pro15549PRTArtificialEngineered albumin-binding
polypeptide 155Gly Ser Ser Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala
Glu Leu Asp1 5 10 15Ala Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile
Asp Lys Ala Lys 20 25 30Thr Val Glu Gly Val Glu Ala Leu Lys Asp Ala
Ile Leu Ala Ala Leu 35 40 45Pro15649PRTArtificialEngineered
albumin-binding polypeptide 156Gly Ser Ser Leu Ala Ser Ala Lys Glu
Ala Ala Asn Ala Glu Leu Asp1 5 10 15Ser Tyr Gly Val Ser Asp Phe Tyr
Lys Arg Leu Ile Asp Lys Ala Lys 20 25 30Thr Val Glu Gly Val Glu Ala
Leu Lys Asp Ala Ile Leu Ala Ala Leu 35 40
45Pro15747PRTArtificialEngineered albumin-binding polypeptide
157Gly Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr1
5 10 15Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr
Val 20 25 30Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu
Pro 35 40 4515847PRTArtificialEngineered albumin-binding
polypeptide 158Gly Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu
Asp Ser Tyr1 5 10 15Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys
Ala Lys Thr Val 20 25 30Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu
Ala Ala Leu Pro 35 40 4515947PRTArtificialEngineered
albumin-binding polypeptide 159Gly Leu Ala Ser Ala Lys Glu Ala Ala
Asn Ala Glu Leu Asp Cys Tyr1 5 10 15Gly Val Ser Asp Phe Tyr Lys Arg
Leu Ile Asp Lys Ala Lys Thr Val 20 25 30Glu Gly Val Glu Ala Leu Lys
Asp Ala Ile Leu Ala Ala Leu Pro 35 40
4516047PRTArtificialEngineered albumin-binding polypeptide 160Ala
Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr1 5 10
15Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
20 25 30Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4516149PRTArtificialEngineered albumin-binding polypeptide
161Gly Ser Ser Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp1
5 10 15Lys Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala
Lys 20 25 30Thr Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala
Ala Leu 35 40 45Pro16248PRTArtificialEngineered albumin-binding
polypeptide 162Gly Ser Leu Ala Ser Ala Lys Glu Ala Ala Asn Ala Glu
Leu Asp Ser1 5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp
Lys Ala Lys Thr 20 25 30Val Glu Gly Val Glu Ala Leu Lys Asp Ala Ile
Leu Ala Ala Leu Pro 35 40 4516348PRTArtificialEngineered
albumin-binding polypeptide 163Gly Ser Leu Ala Glu Ala Lys Glu Ala
Ala Asn Ala Glu Leu Asp Ser1 5 10 15Tyr Gly Val Ser Asp Phe Tyr Lys
Arg Leu Ile Asp Lys Ala Lys Thr 20 25 30Val Glu Gly Val Glu Ala Leu
Lys Asp Ala Ile Leu Ala Ala Leu Pro 35 40
4516446PRTArtificialEngineered albumin-binding polypeptide 164Leu
Ala Glu Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ser Tyr Gly1 5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro 35
40 4516546PRTArtificialEngineered albumin-binding polypeptide
165Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4516646PRTArtificialEngineered albumin-binding polypeptide
166Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4516746PRTArtificialEngineered albumin-binding polypeptide
167Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4516846PRTArtificialEngineered albumin-binding polypeptide
168Leu Ala Glu Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4516946PRTArtificialEngineered albumin-binding polypeptide
169Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Lys Ala Leu Pro
35 40 4517046PRTArtificialEngineered albumin-binding polypeptide
170Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ser Leu Pro
35 40 4517146PRTArtificialEngineered albumin-binding polypeptide
171Leu Ala Glu Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4517246PRTArtificialEngineered albumin-binding polypeptide
172Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4517346PRTArtificialEngineered albumin-binding polypeptide
173Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4517446PRTArtificialEngineered albumin-binding polypeptide
174Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4517546PRTArtificialEngineered albumin-binding polypeptide
175Leu Ala Glu Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4517646PRTArtificialEngineered albumin-binding polypeptide
176Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Lys Ala Leu Pro
35 40 4517746PRTArtificialEngineered albumin-binding polypeptide
177Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ser Leu Pro
35 40 4517846PRTArtificialEngineered albumin-binding polypeptide
178Leu Ala Gln Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4517946PRTArtificialEngineered albumin-binding polypeptide
179Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4518046PRTArtificialEngineered albumin-binding polypeptide
180Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10
15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val Glu
20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro 35
40 4518146PRTArtificialEngineered albumin-binding polypeptide
181Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4518246PRTArtificialEngineered albumin-binding polypeptide
182Leu Ala Gln Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4518346PRTArtificialEngineered albumin-binding polypeptide
183Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Lys Ala Leu Pro
35 40 4518446PRTArtificialEngineered albumin-binding polypeptide
184Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ser Leu Pro
35 40 4518546PRTArtificialEngineered albumin-binding polypeptide
185Leu Ala Gln Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4518646PRTArtificialEngineered albumin-binding polypeptide
186Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4518746PRTArtificialEngineered albumin-binding polypeptide
187Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4518846PRTArtificialEngineered albumin-binding polypeptide
188Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4518946PRTArtificialEngineered albumin-binding polypeptide
189Leu Ala Gln Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4519046PRTArtificialEngineered albumin-binding polypeptide
190Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Lys Ala Leu Pro
35 40 4519146PRTArtificialEngineered albumin-binding polypeptide
191Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ser Leu Pro
35 40 4519246PRTArtificialEngineered albumin-binding polypeptide
192Leu Ala Glu Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4519346PRTArtificialEngineered albumin-binding polypeptide
193Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu Pro
35 40 4519446PRTArtificialEngineered albumin-binding polypeptide
194Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4519546PRTArtificialEngineered albumin-binding polypeptide
195Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4519646PRTArtificialEngineered albumin-binding polypeptide
196Leu Ala Glu Ala Lys Glu Ala Ala Asn Arg Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Glu Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Glu Ala Ile Leu Ala Ala Leu Pro
35 40 4519746PRTArtificialEngineered albumin-binding polypeptide
197Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Lys Ala Leu Pro
35 40 4519846PRTArtificialEngineered albumin-binding polypeptide
198Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ser Leu Pro
35 40 4519945PRTArtificialEngineered albumin binding polypeptide
199Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu 35
40 4520045PRTArtificialEngineered albumin binding polypeptide
200Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu 35
40 4520145PRTArtificialEngineered albumin binding polypeptide
201Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ala Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu 35
40 4520245PRTArtificialEngineered albumin binding polypeptide
202Leu Ala Gln Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Ser Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu 35
40 4520345PRTArtificialEngineered albumin binding polypeptide
203Leu Ala Glu Ala Lys Glu Ala Ala Asn Ala Glu Leu Asp Cys Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Asp Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Asp Ala Ile Leu Ala Ala Leu 35
40 4520446PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(3)..(3)X is selected from E, S, Q and
CMISC_FEATURE(6)..(6)X is selected from E, S and
CMISC_FEATURE(7)..(7)X is selected from A and
SMISC_FEATURE(10)..(10)X is selected from A, S and
RMISC_FEATURE(14)..(14)X is selected from A, S, C and
KMISC_FEATURE(26)..(26)X is selected from D and
EMISC_FEATURE(39)..(39)X is selected from D and
EMISC_FEATURE(40)..(40)X is selected from A and
EMISC_FEATURE(43)..(43)X is selected from A and
KMISC_FEATURE(44)..(44)X is selected from A, S and
EMISC_FEATURE(45)..(45)L in position 45 is present or
absentMISC_FEATURE(46)..(46)P in position 46 is present or absent
204Leu Ala Xaa Ala Lys Xaa Xaa Ala Asn Xaa Glu Leu Asp Xaa Tyr Gly1
5 10 15Val Ser Asp Phe Tyr Lys Arg Leu Ile Xaa Lys Ala Lys Thr Val
Glu 20 25 30Gly Val Glu Ala Leu Lys Xaa Xaa Ile Leu Xaa Xaa Leu Pro
35 40 4520527PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(27)..(27)PP### albumin binding polypeptide
205Met Gly Ser Ser His His His His His His Leu Gln Ser Ser Gly Val1
5 10 15Asp Leu Gly Thr Glu Asn Leu Tyr Phe Gln Gly 20
2520627PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(27)..(27)PP013 albumin binding polypeptide
206Met Gly Ser Ser His His His His His His Leu Gln Ser Ser Gly Val1
5 10 15Asp Leu Gly Thr Glu Asn Leu Tyr Phe Gln Gly 20
2520728PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(28)..(28)PP013 albumin binding polypeptide
207Met Gly Ser Ser His His His His His His Leu Gln Ser Ser Gly Val1
5 10 15Asp Leu Gly Thr Glu Asn Leu Tyr Phe Gln Gly Ser 20
2520828PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(28)..(28)PP049 albumin binding polypeptide
208Met Gly Ser Ser His His His His His His Leu Gln Ser Ser Gly Val1
5 10 15Asp Leu Gly Thr Glu Asn Leu Tyr Phe Gln Gly Ser 20
2520929PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(28)..(29)PP049 albumin binding polypeptide
209Met Gly Ser Ser His His His His His His Leu Gln Ser Ser Gly Val1
5 10 15Asp Leu Gly Thr Glu Asn Leu Tyr Phe Gln Gly Ser Gly 20
2521010PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(6)..(7)Z variant with specificity for
Cytokine XMISC_FEATURE(10)..(10)PP013 albumin binding polypeptide
210Met Gly Ser Ser Leu Gln Val Asp Ser Ser1 5 1021110PRTArtificial
SequenceEngineered PolypeptideMISC_FEATURE(6)..(7)Z variant with
specificity for Cytokine YMISC_FEATURE(10)..(10)PP013 albumin
binding polypeptide 211Met Gly Ser Ser Leu Gln Val Asp Ser Ser1 5
1021210PRTArtificial SequenceEngineered
PolypeptideMISC_FEATURE(6)..(7)Zneg is an irrelevant
proteinMISC_FEATURE(10)..(10)PP013 albumin binding polypeptide
212Met Gly Ser Ser Leu Gln Val Asp Ser Ser1 5 10
* * * * *