U.S. patent application number 16/449109 was filed with the patent office on 2019-12-05 for compositions and methods for treating or ameliorating fibrosis, systemic sclerosis, scleroderma and graft versus host disease.
The applicant listed for this patent is LEADIANT BIOSCIENCES LTD.. Invention is credited to Gianfranco Fornasini, Santosh Kumar Ramamurthy, Brian Dean Schreiber, Nadejda Soukhareva.
Application Number | 20190365874 16/449109 |
Document ID | / |
Family ID | 63041995 |
Filed Date | 2019-12-05 |
![](/patent/app/20190365874/US20190365874A1-20191205-C00001.png)
![](/patent/app/20190365874/US20190365874A1-20191205-C00002.png)
![](/patent/app/20190365874/US20190365874A1-20191205-D00000.png)
![](/patent/app/20190365874/US20190365874A1-20191205-D00001.png)
![](/patent/app/20190365874/US20190365874A1-20191205-D00002.png)
![](/patent/app/20190365874/US20190365874A1-20191205-D00003.png)
United States Patent
Application |
20190365874 |
Kind Code |
A1 |
Schreiber; Brian Dean ; et
al. |
December 5, 2019 |
COMPOSITIONS AND METHODS FOR TREATING OR AMELIORATING FIBROSIS,
SYSTEMIC SCLEROSIS, SCLERODERMA AND GRAFT VERSUS HOST DISEASE
Abstract
Provided are Adenosine Deaminase (ADA), or a polypeptides or
peptides having an ADA activity, or an ADA conjugate,
pharmaceutical compositions and formulations, products of
manufacture and kits, and methods containing them for the
prevention and treatment of a scleroderma-associated vasculopathy,
in particular proliferative obliterative vasculopathy, progressive
obliterative vasculopathy or an idiopathic obliterative
vasculopathy and/or preventing or decreasing the progression of
scleroderma, wherein optionally the scleroderma comprises a local
scleroderma or a diffuse, or a systemic scleroderma.
Inventors: |
Schreiber; Brian Dean;
(Oshkosh, WI) ; Fornasini; Gianfranco; (Bethesda,
MD) ; Soukhareva; Nadejda; (Derwood, MD) ;
Ramamurthy; Santosh Kumar; (Columbia, MD) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
LEADIANT BIOSCIENCES LTD. |
London |
|
GB |
|
|
Family ID: |
63041995 |
Appl. No.: |
16/449109 |
Filed: |
June 21, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16037795 |
Jul 17, 2018 |
10391154 |
|
|
16449109 |
|
|
|
|
62534468 |
Jul 19, 2017 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 45/06 20130101;
A61P 9/10 20180101; C12Y 305/04004 20130101; A61K 38/50 20130101;
A61K 47/60 20170801; C07K 14/47 20130101 |
International
Class: |
A61K 38/50 20060101
A61K038/50; A61K 47/60 20060101 A61K047/60; C07K 14/47 20060101
C07K014/47; A61P 9/10 20060101 A61P009/10 |
Claims
1-20. (canceled)
21. A therapeutic combination comprising: (a) an agent, a compound
or a composition having an Adenosine Deaminase (ADA) enzyme
activity, or is capable of increasing or sustaining levels of
Adenosine Deaminase enzyme activity; and (b) one or more of a
therapeutic agent or agents selected from the group consisting of:
(i) a calcium channel blocker for Raynaud's syndrome; (ii) an
antihistamine for pruritus; (iii) an H2 blocker or proton pump
inhibitor for an esophageal symptom; (iv) and anti-diarrheal agent
or an anti-spasmotic for a lower GI symptom; (v) an ADEI/ARB
medication for hypertension or other renal manifestations of
systemic sclerosis; (vi) an immunosuppressive agents combining such
agents as methotrexate, cyclophosphamide, mycophenolate mofetil, or
rituximab; (vii) an antibiotic; (viii) a cytokine; (ix) an
immunoregulatory agent; (x) an anti-inflammatory agents; (xi) a
complement activating agent; (xii) a carbohydrate-binding domain;
and (xiii) any combination of (i) to (xii).
22. The therapeutic combination claim 21, wherein the agent,
compound or composition comprises or is: (i) an Adenosine Deaminase
enzyme; (ii) a polypeptide or a peptide having an Adenosine
Deaminase activity; or, (iii) a conjugate of (i) or (ii).
23. The therapeutic combination claim 21, wherein the agent,
compound or composition comprises: a recombinant, an isolated, a
synthetic, extracted or a peptidomimetic version of the agent,
compound or composition having an Adenosine Deaminase enzyme
activity or is capable of increasing or sustaining levels of
adenosine deaminase enzyme activity; or, a polypeptide or peptide
having Adenosine Deaminase activity.
24. The therapeutic combination claim 23, wherein the Adenosine
Deaminase enzyme, or the polypeptide or peptide having Adenosine
Deaminase activity, is or is derived from an animal source, wherein
optionally the animal source is a mammal, wherein optionally the
mammal is a human, a bovine or a mixture thereof.
25. The therapeutic combination claim 21, wherein the agent,
compound or composition is: (a) manufactured as or is formulated in
a polyethylene glycol conjugate form, or is administered in a
polyethylene glycol conjugate form, wherein optionally the
polyethylene glycol conjugate form is a PEGylated bovine adenosine
deaminase enzyme, which optionally comprises pegademase, or
elapegademase, or a poly(oxy-1,2-ethanediyl),
.alpha.-carboxy-.omega.-methoxy-amide with an Adenosine Deaminase
enzyme activity or polypeptide having Adenosine Deaminase enzyme
activity, or (b) conjugated to, linked to or covalently linked to a
non-antigenic polymer, wherein optionally the non-antigenic polymer
comprises a polyalkylene oxide, dextran, polyvinyl pyrrolidones,
polysaccharides, starches, polyvinyl alcohols, polyacryl amides; or
(c) conjugated to, linked to or covalently linked to a
substantially hydrolysis-resistant urethane bond between the
epsilon amino groups of enzymes and a functionalized terminal
group, wherein optionally an Adenosine Deaminase enzyme, or a
polypeptide or a peptide having an Adenosine Deaminase enzyme
activity, is conjugated through epsilon amino group modifications
of lysines, or modifications of carboxylic acid groups.
26. The therapeutic combination claim 25, wherein the Adenosine
Deaminase (ADA) enzyme, or a conjugate of the polypeptide or
peptide having an Adenosine Deaminase (ADA) enzyme activity,
comprises from between about 1 to about 25 polymeric strands
attached to each molecule of the ADA, or the polypeptide or peptide
having an ADA activity.
27. The therapeutic combination claim 25, wherein the Adenosine
Deaminase enzyme, or the polypeptide or peptide having Adenosine
Deaminase enzyme activity, is conjugated to a polyalkylene oxide,
wherein optionally the polyalkylene oxide is a polyethylene glycol
(PEG), wherein optionally the polyalkylene oxide is a straight,
branched or multi-arm polymer, and optionally the polyalkylene
oxide or PEG has a molecular weight (MW) ranging from between about
2,000 to about 45,000 daltons.
28. The therapeutic combination claim 25, wherein the Adenosine
Deaminase enzyme, or the polypeptide or peptide having Adenosine
Deaminase enzyme activity, is conjugated with either of:
##STR00002## wherein n is a positive integer between 1 and about
5,000.
29. The therapeutic combination claim 25, wherein the Adenosine
Deaminase enzyme, or the polypeptide or peptide having an Adenosine
Deaminase enzyme activity, is a conjugate of formula:
[R--NH].sub.z-(ADA) where z is a positive integer from about 1 to
about 80; and R comprises a substantially non-antigenic polymer,
and optionally the substantially non-antigenic polymer is in a
releasable or non-releasable form, and optionally the substantially
non-antigenic polymer is a linear, branched or a multi-armed
polyalkylene oxide, wherein optionally the polyalkylene oxide is a
polyethylene glycol (PEG), having average MW from between about
1000 to about 100,000 Da.
30. The therapeutic combination claim 29, wherein the polyalkylene
oxide is functionalized as:
--C(.dbd.Y.sub.74)--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.n--,
--C(.dbd.Y.sub.74)--Y--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.n--,
--C(.dbd.Y.sub.74)--NR.sub.11--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.-
n--,
--CR.sub.75R.sub.76--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.n--,
where R.sub.11, R.sub.75 and R.sub.76 are independently selected
from among H, C.sub.1-6alkyls, aryls, substituted aryls, aralkyls,
heteroalkyls, substituted heteroalkyls and substituted C.sub.1-6
alkyls; m is zero or is a positive integer; Y.sub.74 is O or S; and
n represents the degree of polymerization.
31. The therapeutic combination claim 21, wherein the agent,
compound or composition, or the one or more of a therapeutic agent
or agents, is formulated as a pharmaceutical composition.
32. The therapeutic combination claim 21, wherein the agent,
compound or composition, or the one or more of a therapeutic agent
or agents, is formulated for enteral or parenteral administration;
or, is formulated for administration by oral, nasal, rectal,
intravaginal, topical, subcutaneous, intradermal, intramuscular
(IM), intravenous (IV) or intrathecal (IT) intracerebral, epidural,
intracranial or rectal route; or, is formulated for administration
by inhalation or spray.
33. The therapeutic combination claim 21, wherein the agent,
compound or composition, or the one or more of a therapeutic agent
or agents, is formulated for: oral, rectal, intravaginal, topical,
subcutaneous, intradermal, intramuscular (IM), intravenous (IV) or
intrathecal (IT) intracerebral, epidural, intracranial or rectal,
nasal, or by inhalation or spray, administration.
34. The therapeutic combination claim 21, wherein the agent,
compound or composition, or the one or more of a therapeutic agent
or agents, is contained in, or is carried in, or is in the form of:
(a) a nanoparticle, a particle, a micelle, a liposome, a lipoplex,
a polymersome, a polyplex, a dendrimer, a nanolipoparticle, a
vesicle or a liposomal membrane, wherein optionally the
nanoparticle, particle, micelle, liposome, lipoplex, polymersome,
polyplex, dendrimer, nanolipoparticle, vesicle or liposomal
membrane is designed to target a specific molecule, wherein
optionally the specific molecule is a biologic molecule, and
optionally the nanoparticle, particle, micelle, liposome, lipoplex,
polymersome, polyplex, dendrimer, nanolipoparticle, vesicle or
liposomal membrane comprises a cell surface targeting compound for
targeting a particular cell, wherein optionally the particular cell
is a vascular cell, a fibroblast, a myocyte or heart cell or an
endothelial cell, and optionally the targeting compound is a
targeting polypeptide capable of specifically binding to the cell;
or (b) a tablet, a pill, a capsule, a gel, a geltab, a liquid, a
powder, an emulsion, a lotion, an aerosol, a spray, a lozenge, an
aqueous or a sterile or an injectable solution, or an implant.
Description
TECHNICAL FIELD
[0001] This invention generally relates to the prevention and
treatment of a scleroderma-associated vasculopathy. In alternative
embodiments, provided are pharmaceutical compositions and
formulations, products of manufacture and kits, and methods for
using them, for: the prevention and treatment of
scleroderma-associated vasculopathies and vascular changes, in
particular a proliferative obliterative vasculopathy such as
idiopathic obliterative vasculopathy and progressive obliterative
vasculopathy, causing structural and functional abnormalities such
as Raynaud's syndrome (also called "Raynaud's phenomenon (RP)"),
edematous puffy hands, telangiectasias, digital ulcers, pulmonary
arterial hypertension (PAH), myocardial dysfunction, and
scleroderma renal crisis. In alternative embodiments, provided are
an Adenosine Deaminase (ADA), or the polypeptide or peptide having
ADA activity, including ADA conjugates, for use in treating,
ameliorating or preventing: scleroderma-associated vasculopathies
and vascular changes, in particular a proliferative obliterative
vasculopathy such as idiopathic obliterative vasculopathy and
progressive obliterative vasculopathy, causing structural and
functional abnormalities such as Raynaud's syndrome, edematous
puffy hands, telangiectasias, digital ulcers, pulmonary arterial
hypertension (PAH), myocardial dysfunction, and scleroderma renal
crisis. In alternative embodiments, provided are an Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
including ADA conjugates, for use in preventing or decreasing the
progression of scleroderma, wherein optionally the scleroderma
comprises a local scleroderma or a diffuse, or a systemic
scleroderma.
BACKGROUND
[0002] Systemic sclerosis (SSc) is a multisystem connective tissue
disorder featured by vascular injury as well as fibrosis of the
skin and various internal organs with an autoimmune background.
Although the pathogenesis of SSc still remains elusive, it is
generally accepted that initial vascular injury due to autoimmunity
and environmental factors causes structural and functional
abnormalities of the vasculature which eventually result in the
constitutive activation of fibroblasts and their evolution to
myofibroblasts in various organs.
[0003] SSc is characterized by structural alteration of the
vasculature, which includes destructive vasculopathy, or loss of
small vessels and progressive obliterative vasculopathy, thickening
of vessel walls and occlusion of arterioles and small arteries. SSc
also is characterized by impaired vasculogenesis and
angiogenesis.
[0004] Impaired function of SSC vasculature includes the altered
expression of cell adhesion molecules, endothelial dysfunction,
activated endothelial to mesenchymal transition leading to
abnormalities of the vasculature and impaired
coagulation/thrombosis.
[0005] Structural abnormalities of the vasculature in SSc patients
are classified into two categories, these being destructive
vasculopathy and proliferative obliterative vasculopathy.
Destructive vasculopathy is characterized by a progressive loss of
small blood vessels, whereas proliferative obliterative
vasculopathy is due to excessive proliferation of vascular
endothelial and smooth muscle cells leading to the occlusion of
arterioles and small arteries. The vascular abnormalities are
caused by impaired or abnormal compensatory vasculogenesis, along
with angiogenesis, and vascular remodeling, which leads to tissue
hypoxia and dermal fibroblast activation, and other features of
scleroderma such as digital ulcers, PAH, and scleroderma renal
crisis.
SUMMARY
[0006] In alternative embodiments, provided are an Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
including ADA conjugates, for use in arresting, treating,
ameliorating or preventing or decreasing the progression of:
[0007] (i) a scleroderma-associated vasculopathy and vascular
changes, in particular, a proliferative obliterative vasculopathy,
such as idiopathic obliterative vasculopathy and progressive
obliterative vasculopathy, Raynaud's syndrome, edematous puffy
hands, telangiectasias, digital ulcers, pulmonary arterial
hypertension (PAH), myocardial dysfunction, and scleroderma renal
crisis;
[0008] (ii) vascular wall thickening in a scleroderma patient,
wherein optionally the scleroderma comprises a local scleroderma or
a diffuse, or a systemic scleroderma, and optionally systemic
sclerosis, a scleroderma-associated vasculopathy or a
scleroderma-associated obliterative vasculopathy, wherein
optionally the proliferative obliterative vasculopathy is an
idiopathic obliterative vasculopathy or a progressive obliterative
vasculopathy;
[0009] (iii) vascular occlusion in a scleroderma patient, wherein
optionally the scleroderma comprises a local scleroderma or a
diffuse, or a systemic scleroderma, or in an individual with a
scleroderma-associated vasculopathy or a proliferative obliterative
vasculopathy, optionally an idiopathic obliterative vasculopathy or
a progressive obliterative vasculopathy, associated with systemic
sclerosis (iv) Raynaud's syndrome associated with scleroderma,
nonpitting edema of the hands, distal finger ulcers and/or facial
or peri-oral skin tightening with decreased oral aperture, wherein
the Raynaud's syndrome, nonpitting edema of the hands, distal
finger ulcers and/or facial or peri-oral skin tightening are early
pathological expressions of scleroderma.
[0010] Also disclosed are methods for arresting, treating,
ameliorating or preventing or decreasing the progression of the
above-mentioned diseases or conditions comprising:
[0011] (a) administering to the individual in need thereof an
effective amount of an agent, a compound or a composition having an
Adenosine Deaminase enzyme (also known as adenosine aminohydrolase,
or ADA) activity, or is capable of increasing or sustaining levels
of ADA activity in the individual, or
[0012] (b) (1) providing an effective amount of an agent, a
compound or a composition having an Adenosine Deaminase enzyme
(also known as adenosine aminohydrolase, or ADA) activity, or is
capable of increasing or sustaining levels of ADA activity in the
individual, and
[0013] (2) administering the agent, compound or composition to the
individual in need thereof,
[0014] thereby
[0015] (i) arresting, treating, ameliorating or preventing or
decreasing the progression of: a scleroderma-associated
vasculopathy, optionally a scleroderma-associated proliferative
obliterative vasculopathy, optionally an idiopathic obliterative
vasculopathy or a progressive obliterative vasculopathy, in an
individual in need thereof;
[0016] (ii) arresting, treating, ameliorating or preventing or
decreasing the progression of vascular wall thickening in a
scleroderma patient,
[0017] wherein optionally the scleroderma comprises a local
scleroderma or a diffuse, or a systemic scleroderma,
[0018] and optionally the arresting, treating, ameliorating or
preventing or decreasing the progression of systemic sclerosis, a
scleroderma-associated vasculopathy or a proliferative obliterative
vasculopathy, wherein optionally the proliferative obliterative
vasculopathy is an idiopathic obliterative vasculopathy or a
progressive obliterative vasculopathy
[0019] (iii) arresting, treating, ameliorating or preventing or
decreasing the progression of vascular vessel occlusion in a
scleroderma patient, wherein optionally the scleroderma comprises a
local scleroderma or a diffuse, or a systemic scleroderma, or in an
individual with a scleroderma-associated vasculopathy or a
proliferative obliterative vasculopathy, optionally an idiopathic
obliterative vasculopathy or a progressive obliterative
vasculopathy associated with systemic sclerosis;
[0020] (iv) arresting, treating, ameliorating or preventing or
decreasing the progression of Raynaud's syndrome associated with
scleroderma, nonpitting edema of the hands, distal finger ulcers
and/or facial and/or peri-oral skin tightening with decreased oral
aperture, wherein the Raynaud's syndrome, nonpitting edema of the
hands, distal finger ulcers and/or facial or peri-oral skin
tightening are early pathological expressions of scleroderma;
[0021] (v) preventing or decreasing the progression of scleroderma,
wherein optionally the scleroderma comprises a local scleroderma or
a diffuse, or a systemic scleroderma.
[0022] In alternative embodiments, provided are methods wherein the
agent, compound or composition comprises or is an Adenosine
Deaminase enzyme (also known as adenosine aminohydrolase, or ADA)
or a polypeptide or peptide having Adenosine Deaminase
activity.
[0023] In alternative embodiments, provided are an agent, compound
or composition comprising or being an Adenosine Deaminase enzyme
(also known as adenosine aminohydrolase, or ADA) or a polypeptide
or peptide having Adenosine Deaminase activity for use in
arresting, treating, ameliorating or preventing any of the above
listed diseases, more in particular:
[0024] (i) a scleroderma-associated vasculopathy, optionally a
scleroderma-associated proliferative obliterative vasculopathy,
optionally an idiopathic obliterative vasculopathy or a progressive
obliterative vasculopathy;
[0025] (ii) vascular wall thickening in a scleroderma patient,
wherein optionally the scleroderma comprises a local scleroderma or
a diffuse, or a systemic scleroderma, and optionally the arresting,
treating, ameliorating or preventing in an individual with focal or
localized or systemic sclerosis, a scleroderma-associated
vasculopathy or a proliferative obliterative vasculopathy, wherein
optionally the proliferative obliterative vasculopathy is an
idiopathic obliterative vasculopathy or a progressive obliterative
vasculopathy:
[0026] (iii) vascular vessel occlusion in a scleroderma patient,
wherein optionally the scleroderma comprises a local scleroderma or
a diffuse, or a systemic scleroderma, a scleroderma-associated
vasculopathy or a proliferative obliterative vasculopathy,
optionally an idiopathic obliterative vasculopathy or a progressive
obliterative vasculopathy associated with systemic sclerosis;
[0027] (iv) Raynaud's syndrome associated with scleroderma,
nonpitting edema of the hands, distal finger ulcers and/or facial
or peri-oral skin tightening with decreased oral aperture, wherein
the Raynaud's syndrome, nonpitting edema of the hands, distal
finger ulcers and/or facial or peri-oral skin tightening are early
pathological expressions of scleroderma;
[0028] (v) preventing or decreasing the progression of scleroderma,
wherein optionally the scleroderma comprises a local scleroderma or
a diffuse, or a systemic scleroderma; and/or
[0029] (vi) wherein the agent, compound or composition is used as a
supplementary treatment to any of the above listed diseases or
conditions, or the agent, compound or composition is administered
to patients who have failed other scleroderma treatments.
[0030] In alternative embodiments, provided are methods wherein the
agent, compound or composition is or comprises: a recombinant, an
isolated, an extracted, a synthetic or a peptidomimetic version of
the agent, compound or composition having an Adenosine Deaminase
enzyme (also known as adenosine aminohydrolase, or ADA) activity,
or is capable of increasing or sustaining levels of ADA activity in
the individual, or the polypeptide or peptide having Adenosine
Deaminase activity.
[0031] In alternative embodiments, the individual is a mammal, or a
human.
[0032] In alternative embodiments, the Adenosine Deaminase (ADA),
or the polypeptide or peptide having Adenosine Deaminase activity,
is or is derived from a human or other mammalian source, optionally
a bovine source or a source as described in U.S. Pat. No.
8,071,741, or a mixture thereof.
[0033] In alternative embodiments, provided are the Adenosine
Deaminase (ADA), or the polypeptide or peptide having Adenosine
Deaminase (ADA) activity is: (a) manufactured as or is formulated
in a polyethylene glycol conjugate form, or is administered in a
polyethylene glycol conjugate form, wherein optionally the
polyethylene glycol conjugate form is a PEGylated bovine adenosine
deaminase enzyme, which optionally comprises a
(monomethoxypolyethylene glycol succinimidyl) 11-17-adenosine
deaminase (CAS 130167-68-9), also named pegademase bovine, also
known as ADAGEN.RTM. (Leadiant Biosciences Ltd., Windsor, UK); or
in alternative embodiment is a poly(oxy-1,2-ethanediyl),
.alpha.-carboxy-.omega.-methoxy-, amide with an ADA (also named
elapegademase--CAS 1709806-75-6-or EZN2279) or in alternative
embodiment a polypeptide having ADA activity, or
[0034] (b) conjugated to, linked to or covalently linked to a
non-antigenic polymer, gelatin, or nanoparticles or other release
system known by practitioners of the art, wherein optionally the
non-antigenic polymer comprises a polyalkylene oxide.
[0035] In alternative embodiments, the agent, compound or
composition is formulated as a pharmaceutical composition, or is
formulated for administration in vivo; or formulated for enteral or
parenteral administration, or for oral, topical, subcutaneous,
intramuscular (IM), intravenous (IV) or intrathecal (IT)
administration, or by inhalation or spray,
[0036] wherein optionally the compound or formulation is
administered orally, parenterally, by inhalation spray, nasally,
topically, intrathecally, intracerebrally, epidurally,
intracranially or rectally;
[0037] wherein optionally the formulation or pharmaceutical
composition is contained in or carried in a nanoparticle, a
particle, a micelle or a liposome or lipoplex, a polymersome, a
polyplex or a dendrimer; or
[0038] wherein optionally the compound or composition, or the
formulation or pharmaceutical composition, is formulated as, or
contained in, a nanoparticle, a liposome, a tablet, a pill, a
capsule, a gel, a geltab, a liquid, a powder, an emulsion, a
lotion, an aerosol, a spray, a lozenge, an aqueous or a sterile or
an injectable solution, or an implant.
[0039] In alternative embodiments, an effective amount of Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
administered to an individual in need thereof is:
[0040] (a) from about 0.01 to about 100 mg/kg, for example from
about 1 to about 100 mg/kg, or from about 5 to about 50 mg/kg, or
from about 10 to about 30 mg/kg subdivided into multiple
administrations from a minimum of once a day to once a year;
[0041] (b) from about 5 U/kg to about 50 U/kg, for example from
about 10 U/kg to about 30 U/kg, or from about 20 U/kg to about 60
U/kg, or from about 0.5 U/kg to about 5 U/kg (e.g., about 1 U/kg),
supraphysiological doses can also be provided, for example up to
100 U/kg;
[0042] (c) about 250 units/ml administered weekly, optionally
administered subcutaneously or IM; or
[0043] (d) any of (a) to (c), wherein the dosage is individualized
based on monitoring of plasma ADA activity, adenosine levels and/or
other specific biomarkers after initial administrations.
[0044] In alternative embodiments, an effective amount of Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
administered to an individual in need thereof comprises use of
various dosing schedules, optionally using: [0045] a dosing
schedule of about 10 U/kg, or between about 5 to 15 U/kg, Adagen
(or about 0.067 mg/kg, or between about 0.001 to 0.12 mg/kg, for
example 0.03 to 0.12 mg/kg, EZN2279) for the first dose; [0046]
about 15 U/kg, or between about 5 to 15 U/kg, Adagen (or about 0.1
mg/kg or between about 0.05 to 0.5 mg/kg, EZN2279) for the second
dose, and/or [0047] about 30 U/kg Adagen, for example 20 U/kg or
between about 15 to 25 or 30 U/kg, (or about 0.134 mg/kg, or
between about 0.05 to 0.30, for example 0.25 mg/kg, EZN2279) for
the third dose; if necessary or desired, supraphysiological doses
may also be foreseen, for example up to 100 U/kg.
[0048] In alternative embodiments, provided are kits comprising a
compound or composition or a formulation or a pharmaceutical
composition as provided herein, and optionally comprising
instructions on practicing a method as provided herein.
[0049] In alternative embodiments, provided are uses of a compound
or composition or a formulation as provided herein, in the
manufacture of a medicament.
[0050] Use of a compound or composition, or a formulation or a
pharmaceutical composition as provided herein in the manufacture of
a medicament for:
[0051] (i) arresting, treating, ameliorating or preventing:
scleroderma-associated vasculopathies, optionally a
scleroderma-associated proliferative obliterative vasculopathy,
optionally an idiopathic obliterative vasculopathy or a progressive
obliterative vasculopathy, in an individual in need thereof;
[0052] (ii) arresting, treating, ameliorating or preventing
vascular wall thickening in a scleroderma patient,
[0053] wherein optionally the scleroderma comprises a local or
focal scleroderma or a diffuse, or a systemic scleroderma,
[0054] and optionally the arresting, treating, ameliorating or
preventing in an individual with a local or focal, or systemic,
sclerosis, a scleroderma-associated vasculopathy or a proliferative
obliterative vasculopathy, wherein optionally the proliferative
obliterative vasculopathy is an idiopathic obliterative
vasculopathy or a progressive obliterative vasculopathy
[0055] (iii) arresting, treating, ameliorating or preventing
vascular vessel occlusion in a scleroderma patient, wherein
optionally the scleroderma comprises a local or focal scleroderma
or a diffuse, or a systemic scleroderma, or in an individual with a
scleroderma-associated vasculopathy or a proliferative obliterative
vasculopathy, optionally an idiopathic obliterative vasculopathy or
a progressive obliterative vasculopathy associated with systemic
sclerosis;
[0056] (iv) arresting, treating, ameliorating or preventing
Raynaud's syndrome associated with scleroderma, nonpitting edema of
the hands, distal finger ulcers and/or facial or peri-oral skin
tightening with decreased oral aperture, wherein the Raynaud's
syndrome, nonpitting edema of the hands, distal finger ulcers
and/or facial or peri-oral skin tightening are early pathological
expressions of scleroderma;
[0057] (v) preventing or decreasing the progression of scleroderma,
wherein optionally the scleroderma comprises a local or focal
scleroderma or a diffuse, or a systemic scleroderma.
[0058] In alternative embodiments, provided are compounds or
compositions or formulations as provided herein, for use in:
[0059] (i) arresting, treating, ameliorating or preventing:
scleroderma-associated vasculopathies, optionally a
scleroderma-associated proliferative obliterative vasculopathy,
optionally an idiopathic obliterative vasculopathy or a progressive
obliterative vasculopathy, in an individual in need thereof;
[0060] (ii) arresting, treating, ameliorating or preventing
vascular wall thickening in a scleroderma patient,
[0061] wherein optionally the scleroderma comprises a local or
focal scleroderma or a diffuse, or a systemic scleroderma,
[0062] and optionally the arresting, treating, ameliorating or
preventing in an individual with or a systemic sclerosis, a
scleroderma-associated vasculopathy or a proliferative obliterative
vasculopathy, wherein optionally the obliterative vasculopathy is
an idiopathic obliterative vasculopathy or a progressive
obliterative vasculopathy
[0063] (iii) arresting, treating, ameliorating or preventing
vascular vessel occlusion in a scleroderma patient, wherein
optionally the scleroderma comprises a local or focal scleroderma
or a diffuse, or a systemic scleroderma, or in an individual with a
scleroderma-associated vasculopathy or an obliterative
vasculopathy, optionally an idiopathic obliterative vasculopathy or
a progressive proliferative obliterative vasculopathy associated
with systemic sclerosis;
[0064] (iv) arresting, treating, ameliorating or preventing
Raynaud's syndrome associated with scleroderma, nonpitting edema of
the hands, distal finger ulcers, and/or facial or peri-oral skin
tightening with decreased oral aperture, wherein the Raynaud's
syndrome, nonpitting edema of the hands, distal finger ulcers
and/or facial or peri-oral skin tightening are early pathological
expressions of scleroderma;
[0065] (v) preventing or decreasing the progression of scleroderma,
wherein optionally the scleroderma comprises a local or focal
scleroderma or a diffuse, or a systemic scleroderma;
[0066] wherein optionally the use comprises a method for
administering to an individual in need thereof,
[0067] wherein the individual in need thereof has or is developing
or is predisposed to: [0068] (i) a scleroderma-associated
vasculopathy, optionally a proliferative obliterative vasculopathy,
optionally an idiopathic obliterative vasculopathy or a progressive
obliterative vasculopathy; [0069] (ii) a vascular wall thickening
caused by a scleroderma,
[0070] wherein optionally the scleroderma comprises a local or
focal scleroderma or a diffuse, or a systemic scleroderma; [0071]
(iii) a vascular vessel occlusion caused by a scleroderma, wherein
optionally the scleroderma comprises a local or focal scleroderma
or a diffuse, or a systemic scleroderma, or a
scleroderma-associated vasculopathy or a scleroderma-associated
proliferative obliterative vasculopathy, optionally an idiopathic
obliterative vasculopathy or a progressive obliterative
vasculopathy, or a systemic sclerosis or [0072] (iv) the individual
in need thereof has or is developing or is predisposed to a
systemic sclerosis, or Raynaud's syndrome associated with
scleroderma, nonpitting edema of the hands, distal finger ulcers
and/or facial or peri-oral skin tightening with decreased oral
aperture; and/or [0073] (v) the individual in need thereof has or
is developing or is predisposed to is developing a scleroderma,
wherein optionally the scleroderma comprises a local or focal
scleroderma or a diffuse, or a systemic scleroderma;
[0074] The details of one or more exemplary embodiments of the
invention are set forth in the accompanying drawings and the
description below. Other features, objects, and advantages of the
invention will be apparent from the description and drawings, and
from the claims.
[0075] All publications, patents, patent applications cited herein
are hereby expressly incorporated by reference for all
purposes.
DESCRIPTION OF DRAWINGS
[0076] The drawings set forth herein are illustrative of exemplary
embodiments provided herein and are not meant to limit the scope of
the invention as encompassed by the claims.
[0077] Figures are described in detail herein.
[0078] FIG. 1 illustrates images of data, and graphically
illustrates data, from experiments where ADAGEN.RTM. pegylated
adenosine deaminase (Leadiant Biosciences Ltd., Windsor, UK)
significantly reduced the number of occluded pulmonary vessels in
Fra2 transgenic (tg) mice with decreases from 69.2+/-20.5% in
vehicle treated Fra2 tg mice to 40.6+/-15.7% and 25+/-20.4% in Fra2
tg mice treated with ADAGEN.RTM. in doses of 0.5 and 5 U
respectively. The differences between both dosage levels of
ADAGEN.RTM. and vehicle in regard to vessel occlusion were both
significant with P<0.05.
[0079] FIG. 2 illustrates images of data, and graphically
illustrates data, from experiments showing that the mean vessel
wall thickness of the pulmonary arteries in Fra2 tg mice was
increased by 1.81+/-0.31 fold compared to non-transgenic control
mice (P<0.01). Treatment with ADAGEN.RTM. pegylated adenosine
deaminase (Leadiant Biosciences Ltd., Windsor, UK) significantly
decreased thickening of the vessel walls of the pulmonary arteries
and reduced the increase in relative vessel wall thickness in Fra2
tg mice to 1.21+/-0 0.19 at 0.5 U (P<0.01 vs NaCl) and to
1.09+/-0.04 fold at ADAGEN.RTM. 5 U (P<0.01 vs NaCl
control).
[0080] FIG. 3 graphically depicts the effect of ADAGEN.RTM.
pegylated adenosine deaminase (Leadiant Biosciences Ltd., Windsor,
UK) on the clinical outcomes on body weight (FIG. 3A) and clinical
composite score (FIG. 3B) in murine sclerodermatous cGvHD.
[0081] Like reference symbols in the various drawings indicate like
elements.
DETAILED DESCRIPTION
[0082] In alternative embodiments, provided are pharmaceutical
compositions and formulations, products of manufacture and kits,
and methods for using them, for treating, ameliorating, reversing,
or abating or diminishing the symptoms of, or preventing
scleroderma-associated vasculopathies, optionally a vasculopathy
associated with scleroderma; a scleroderma-associated proliferative
obliterative vasculopathy such as idiopathic obliterative
vasculopathy or progressive obliterative vasculopathy.
[0083] In alternative embodiments, provided are an Adenosine
Deaminase (ADA), or a polypeptide or a peptide having ADA activity,
including ADA conjugates for use in treating, ameliorating or
preventing scleroderma-associated vasculopathies and vascular
changes, in particular a progressive obliterative vasculopathy such
as idiopathic obliterative vasculopathy and progressive
obliterative vasculopathy, Raynaud's syndrome, edematous puffy
hands, telangiectasias, digital ulcers, pulmonary arterial
hypertension (PAH), myocardial dysfunction, and scleroderma renal
crisis.
[0084] In alternative embodiments, provided are methods for
administering an effective amount of an Adenosine Deaminase (ADA),
or a polypeptide or a peptide having ADA activity, including ADA
conjugates to an individual in need thereof to treat, ameliorate or
prevent scleroderma-associated vasculopathies; in particular
scleroderma-associated vasculopathies and vascular changes, in
particular a proliferative obliterative vasculopathy such as
idiopathic obliterative vasculopathy and progressive obliterative
vasculopathy, Raynaud's syndrome, edematous puffy hands,
telangiectasias, digital ulcers, pulmonary arterial hypertension
(PAH), myocardial dysfunction, and scleroderma renal crisis.
[0085] In alternative embodiments, provided are methods for
administering an effective amount of an Adenosine Deaminase (ADA),
or a polypeptide or a peptide having ADA activity, including ADA
conjugates to an individual in need thereof to prevent or decrease
the progression of scleroderma.
[0086] Described herein is an in vivo study using an art-accepted
SSc animal model, the Fra2 mouse model of SSc (see e.g., Maurer et
al, Vascul Pharmacol. (2013) March; 58(3):194-201; Beyer et al.,
Arthritis & Rheumatology, October 2010, 62(10):2831-2844). The
Fra2 (Fos-related antigen-2) transgenic mouse is a model of
scleroderma that incorporates both the vascular and fibrotic
features of scleroderma, vascular changes being first detectable by
the age of nine weeks and precede the onset of fibrosis thereby
imitating the pathology of systemic sclerosis. The Fra2 mouse
eventually develops pulmonary disease and dies of respiratory
failure anywhere in the range of 18-22 weeks. In these experiments,
treatment of the Fra2 mice began at eight weeks and the mice were
sacrificed and tissue samples studied at 16 weeks of age. Four
groups of mice were studied in this experiment.
[0087] Group 1) Wild type control mice treated with the vehicle for
ADA
[0088] Group 2) Fra2 transgenic mice treated only with the vehicle
for ADA
[0089] Group 3) (treatment group 1) Fra2 TG mice treated with low
dose ADA (0.5 U/week (wk) i.p.)
[0090] Group 4) Group 4 (treatment group 2) Fra2 TG mice treated
with high dose ADA (5 U 1.times./week i.p.)
[0091] Outcome Measures:
[0092] Histological evaluation of vascular remodeling in pulmonary
arteries; vessel wall thickness of the pulmonary arteries was
assessed by measuring the thickness of SM22-positive vessel walls
with an average vessel wall diameter greater than (>) 10% of
normal considered to represent pathology. Three measurements were
taken to determine the thickness of each wall. In addition, the
degree of luminal occlusion of pulmonary arteries was determined by
a manual count of arteries with occluded luminae;
[0093] The data clearly illustrate that ADA administration to this
SSc model profoundly affected vascular wall thickness. In the
control, non-treated Fra2 mouse, the mean thickness of the vessel
wall of pulmonary arteries was increased by 1.81+/-0.31 fold
compared to non-Fra2 transgenic control mice. Treatment with ADA
was associated with significantly decreased thickening of the
vessel walls of the pulmonary arteries, reducing the relative
vessel wall thickness to 1.21+/-0.19 in Fra2 mice given 0.5 units
of ADA and to 1.09+/-0.04 fold when given 5 units of ADA. This
improvement in vascular thickening demonstrates the in vivo
efficacy of ADA administration for the prevention or decrease of
the progression of SSc and related disorders, particularly the
vascular component of the pathology of SSc, which has not been
addressed by previous anti-inflammatory or anti-thrombotic
therapies or other therapies for scleroderma.
[0094] Another prominent aspect of the vasculopathy that is an
important aspect of local or focal or systemic scleroderma is
occlusion of arteries due to the combined pathophysiology of SSc
vessels described above. In experiments treating the transgenic
(tg) Fra2 mice, it was demonstrated that ADA significantly reduced
the number of occluded pulmonary vessels in Fra2 tg mice with
decreases from 69.2+/-20.5% in vehicle treated Fra2 mice to
40.6+/-15.7% and 25.0+/-20.4% in Fra2 tg mice treated with
ADAGEN.RTM. (Leadiant Biosciences Ltd., Windsor, UK) in doses of
0.5 and 5 units respectively. The photomicrographs illustrated in
FIG. 1, where the data is summarized in graphic form, visually
illustrate this point. FIG. 1 photomicrographs demonstrate the
effects of ADAGEN.RTM. on the occlusion of pulmonary vessels in
Fra2 tg mice. Representative images stained with hematoxylin/eosin
are shown in 200-fold magnification for each group.
[0095] The photomicrographs illustrated in FIG. 2, where the data
is summarized in graphic form, demonstrate the effects of
ADAGEN.RTM. on vascular lesions in Fra2 tg mice as analyzed by
relative vessel wall thickness of the pulmonary arteries.
Representative images stained with hematoxylin/eosin are shown in
100-fold magnification for each group.
[0096] Another widely used mouse model of systemic sclerosis was
also employed in the study, the B10.D2.fwdarw.BALB/c (H-2(d) minor
histocompatibility antigen mismatched model, is a model of systemic
sclerosis (also known as the sclerodermatous chronic graft versus
host disease mouse model or SSc-cGVHD) characterized by similar
dermatological and pulmonary pathology. The B10.2D2 (H-2D) mice
purchased from Jackson laboratory (Bar Harbor Me.) were maintained
in specific pathogen free conditions with sterile pellet food and
water on a normal day/night cycle. Unfractionated tibial and
femoral derived bone marrow cells were obtained and filtered by
usual methods until the time of transplantation Recipient mice
(BALB/c (H-2d) 8 weeks old received total body radiation with 700
cGy. Six hours following radiation, all BALB/c (H-2D recipients
received bone marrow from either syngeneic BALB/c (H-2D) mice or
from allogeneic B10.D2 (H-2D) mice. Via infusion of 5.times.10(6)
splenocytes and 1.times.10(6) bone marrow cells resuspended in 0.2
ml of PBS injected via tail veins. Four groups of transplanted mice
were begun on treatment starting 10 days post BMT and the mice were
sacrificed and samples obtained for analyses 45 days post BMT.
[0097] Four groups comprised of eight mice each were studied. The
groups were as follows:
[0098] Group 1) Syngeneically transplanted control group with
application of the solvent of ADA
[0099] Group 2) Vehicle-treated fibrosis group: Mice who had
undergone allogeneic bone marrow and splenocyte transplantation
(B10.D2(H-2d.fwdarw.BALB/c(H-2d)
[0100] Treatment Group 1) Mice who had undergone allogeneic bone
marrow and splenocyte transplantation (B10.D2(H-2d).fwdarw.BALB/c
(H-2d) treated with ADA low dose (0.5 U 1.times./week i.p.)
[0101] Treatment Group 2) Allogeneic bone marrow and splenocyte
transplantation (B10.D2 (H-2d) treated with high dose ADA (5 U
1.times./week i.p.)
[0102] Outcome Measures:
[0103] Clinical score of SSc-cGVHD (an art accepted animal model of
systemic sclerosis); Mice with chronic GVHD develop wasting,
hunched posture, and alopecia.
[0104] A scoring system was used for classification of the degree
of SSc-GVHD as follows based on surface area of observed alopecia
[0105] Healthy appearance=0 [0106] Alopecia <1 cm.sup.2=1 [0107]
Alopecia 1-2 cm.sup.2=2 [0108] Alopecia >2 cm.sup.2=3
[0109] Additional clinical parameters monitored included mobility,
diarrhea, and weight loss. The incidence of clinical cGVHD was
expressed as the percentage of mice that showed clinical
manifestations.
[0110] Allogeneic BMT induced weight loss with a significantly
lower mean body weight in allogenically transplanted,
vehicle-treated mice compared to syngeneic controls 45 days after
BMT (99.+-.5% baseline vs. 122.+-.4% baseline, **). Treatment with
ADAGEN at doses of 0.5 U and 5 U partially rescued the weight loss
induced by allogeneic BMT and increased the mean body weights to
111.+-.8% and 106.+-.4% baseline, respectively (* for both). See
FIG. 3A.
[0111] The first clinical signs of disease became evident at 24
days after allogeneic BMT. The composite score of cGvHD
progressively increased to 2.75.+-.1.50 in vehicle-treated,
allogeneically transplanted mice at 45 days after BMT. In contrast,
syngeneically transplanted control mice did not develop any
clinical manifestation of disease throughout the observation period
(mean score of 0.+-.0). ADAGEN ameliorated clinical signs of cGvHD
and reduced the mean composite scores to 1.38.+-.0.52 for mice
treated with doses of 0.5 U and to 1.13.+-.0.64 for mice treated
with ADAGEN in doses of 5 U (* for both). See FIG. 3B.
[0112] ADAGEN.RTM. was initially used in animal models of
scleroderma to test its pharmacological activity, and the same or
substantially the same pharmacological effects are expected to be
obtained following the administration of any Adenosine Deaminase
(ADA) native protein of human or animal origin, including bovine;
and also including: ADA obtained by extraction and purification
from tissues; by recombinant or any synthetic or semi-synthetic
process; as well as by any peptide or polypeptide with ADA
activity, including ADA conjugates.
[0113] ADA activity is important to lower the levels of adenosine
in blood, plasma, serum, tissues and to trigger a cascade of
biochemical events which could result in the amelioration of the
clinical manifestations of scleroderma-associated
vasculopathies.
[0114] ADA, or any peptide or polypeptide with ADA activity,
including ADA conjugates, which can lower levels of adenosine in
blood, plasma, serum, tissues, are effective in the prevention or
decrease of progression of scleroderma and associated vascular
conditions; and is effective in arresting, treating, ameliorating
or preventing scleroderma-associated vasculopathies and vascular
changes, in particular a proliferative obliterative vasculopathy
such as idiopathic obliterative vasculopathy and progressive
obliterative vasculopathy, Raynaud's syndrome, edematous puffy
hands, telangiectasias, digital ulcers, pulmonary arterial
hypertension (PAH), myocardial dysfunction, and scleroderma renal
crisis.
[0115] In summary, these data demonstrate the value of ADA
(including ADA conjugates) in affecting (decreasing) the vascular
wall thickness (or preventing the occurrence of, or decreasing the
severity of, scleroderma-related vascular wall thickening) of
sclerodermatous arteries, as well as decreasing or preventing the
vascular thromboses that are an important feature of this serious
and often fatal disease.
[0116] In summary, these data demonstrate the value of ADA
treatment (including ADA conjugates) in improving the underlying
vasculopathy that is a significant component of the disease in a
well-accepted model of scleroderma (Fra2 mouse). ADA dramatically
affected the proliferative vasculopathy and vascular intimal
thickening which are not only responsible for many of the
morbidities seen in scleroderma and are thought by many experts to
be a critical component of the pathophysiology of the disease.
Preventive treatment with ADA also slowed the progression of
disease in the SSc-cGVHD model and improved clinical features when
given at very early stages of the disease.
Adenosine Deaminase (ADA) Enzymes
[0117] In alternative embodiments, provided are compositions and
methods using Adenosine Deaminase (ADA) enzymes, or polypeptides or
peptides having ADA activity, including ADA conjugates, which can
be from human or non-human, e.g., animal such as bovine, sources or
recombinant or synthetic ADA. In alternative embodiments, enzymes
used include ADA polypeptides or active fragments thereof,
including analogs, mutations, derivatives or chemical modifications
thereof, including for example, conjugates, capped forms or
multiple or mono-pegylations as described below, or as described in
U.S. Pat. No. 8,071,741. For example, in one embodiment, if the ADA
is purified from a bovine source, the Cys 74 residue of the
naturally occurring bovine ADA is capped or protected by a cysteine
and the six C-terminal residues predicted from the gene encoding
the ADA of SEQ ID NO:1 are not present.
[0118] In alternative embodiments, ADA or polypeptides or peptides
having ADA activity, are recombinant forms. In alternative
embodiments, ADA can be a recombinant bovine ADA (SEQ ID NO:1) or a
recombinant human ADA ("rhADA", SEQ ID NO:3) translated from a DNA
molecule according to SEQ ID NO:2 or SEQ ID NO:4. In alternative
embodiments, the recombinant ADA can lack the six C-terminal
residues of the bovine ADA, e.g., as described in U.S. Pat. No.
8,071,741.
[0119] In alternative embodiments, ADA or polypeptides or peptides
or agonists having ADA activity, are mutations, analogs,
derivative, chemical modifications, variants or conjugates as
described e.g., U.S. Patent Application Publication no. 20080159964
A1 and U.S. Pat. No. 8,071,741. For example, alternative
embodiments, ADA can be stabilized by capping a solvent-exposed
oxidizable Cys residue; an oxidizable amino acid such as cysteine
residue of the recombinant ADA can be capped by the capping agent
such as oxidized glutathione, iodoacetamide, iodoacetic acid,
cystine, other dithiols and mixtures thereof without substantially
inactivating the ADA protein. The capping of the recombinant ADA
stabilizes and protects the ADA from degradation. In alternative
embodiments, in ADA or polypeptides or peptides having ADA
activity, an oxidizable Cys residue that is solvent-exposed is
replaced with a suitable non-oxidizable amino acid residue, e.g.,
alanine, serine, asparagine, glutamine, glycine, isoleucine,
leucine, phenylalanine, threonine, tyrosine, and valine.
Adenosine Deaminase (ADA) Conjugates
[0120] In alternative embodiments, provided are Adenosine Deaminase
(ADA) enzymes, or polypeptides or peptides having ADA activity,
conjugated to another molecule, e.g., a polyethylene glycol or
other polymer, including any non-antigenic (e.g., non-antigenic to
a human) polymer, gelatin, or nanoparticles.
[0121] In alternative embodiments, ADA-polyethylene glycol
conjugates used to practice methods as provided herein are prepared
using the techniques described in U.S. Pat. Nos. 4,179,337;
5,122,614; 5,324,844; 5,349,001; and, 5,728,650, which describe how
to form a substantially hydrolysis-resistant urethane bond between
the epsilon amino groups of enzymes and a functionalized terminal
group. The linkage by which the ADA enzyme or polypeptide or
peptide having ADA activity is joined to the polymer strand(s) can
be any moiety known in the art which sufficiently unites the enzyme
or polypeptide and polymer so that the conjugate may be
administered in a pharmaceutically acceptable manner. In
alternative embodiments, amide linkages are used. An example of
amide-linked polymer enzymes that can be used is found in U.S. Pat.
No. 5,349,001, which describes use of cyclic imide-activated
polyalkylene oxides and conjugation thereof with therapeutic
proteins and enzymes including ADA.
[0122] In alternative embodiments, non-antigenic polymeric
substances include materials such as dextran, polyvinyl
pyrrolidones, polysaccharides, starches, polyvinyl alcohols,
polyacryl amides or other similar non-immunogenic polymers.
[0123] In alternative embodiments, to prepare an ADA, or a
polypeptide or peptide having ADA activity, for conjugation,
epsilon amino group modifications of lysines, or modifications of
carboxylic acid groups, and/or other reactive amino acid groups are
prepared as well-known in the art.
[0124] In alternative embodiments, conjugates are from between
about 1 to about 25 polymeric strands attached to each molecule of
the ADA, or a polypeptide or peptide having ADA activity. By
controlling the molar excess of the polymer reacted with the
enzyme, the number of polymeric strands attached can be varied. For
example, in alternative embodiments, conjugates comprise from
between about 5 to about 20 polymeric strands, or from about 10 to
18 polymeric strands as well-known in the art.
[0125] In alternative embodiments, ADA, or a polypeptide or peptide
having ADA activity, is conjugated to a polyalkylene oxide, such as
polyethylene glycol, which can be straight, branched or multi-arm
polymers; optionally polyalkylene oxides and polyethylene glycols
(PEGs) have molecular weights (MWs) ranging from between about
2,000 to about 45,000 daltons, see for example U.S. Pat. No.
8,071,841; e.g., the ADA when conjugated to a polyethylene glycol
is ADAGEN.RTM. (Leadiant Biosciences, Windsor, UK).
[0126] In alternative embodiments, the polypeptide having ADA
activity is a poly(oxy-1,2-ethanediyl),
.alpha.-carboxy-.omega.-methoxy-, amide with adenosine deaminase,
e.g., a synthetic ADA (one form of which has been given the name
elapegademase or EZN2279), where the ADA can have the sequence (SEQ
ID NO:1):
TABLE-US-00001 AQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQN
IIGMDKPLSLPEFLAKFDYYMPAIAGSREAVKRIAYEFVEMKAKDGV
VYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGER
DFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIE
GSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERL
GHGYHTLEDTTLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRF
KNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAA
KSSFLPEDEKKELLDLLYKAYGMPSPA.
[0127] The above mentioned ADA is codified by a DNA, where the DNA
can have the sequence (SEQ ID No. 2):
TABLE-US-00002 atggctcaga ccccggcttt caacaaaccg aaggtagaac
tgcacgtaca cctggatggt gctatcaaac cggagactat cctgtactat ggtcgtaagc
gtggcatcgc tctgccggct gacactccgg aagaactgca gaacatcatc ggcatggaca
aaccgctgtc tctgccggaa ttcctggcta aattcgacta ctacatgccg gctatcgctg
gttctcgtga agcagtcaaa cgtatcgctt acgaattcgt agaaatgaaa gctaaagatg
gtgtagtata cgttgaagtt cgttactctc cgcacctgct ggcaaactct aaagttgaac
cgatcccgtg gaaccaggca gaaggcgatc tgactccgga tgaagtagtt tctctggtta
accagggtct gcaggagggt gaacgcgatt tcggcgtaaa agttcgttct atcctgtgct
gcatgcgcca ccagccgtct tggtcttctg aagttgttga actgtgcaag aaataccgtg
agcagaccgt agttgctatc gatctggcag gtgatgaaac catcgaaggt tcttctctgt
ttccgggtca cgtaaaggct tatgctgaag ctgttaaatc tggcgtacac cgtactgtac
acgcaggtga agttggttct gctaacgttg ttaaagaagc tgttgacacc ctgaaaactg
aacgcctggg tcacggctac cacaccctgg aagacaccac cctgtacaac cgtctgcgtc
aggaaaacat gcacttcgaa gtttgtccgt ggtcctctta cctgactggt gcttggaaac
cggacaccga acacccggtt gttcgtttca aaaacgacca ggtaaactac tctctgaaca
ctgacgatcc gctgatcttc aaatctaccc tggacaccga ctaccagatg accaaaaacg
aaatgggttt cactgaagaa gaattcaaac gtctgaacat caacgctgct aagtcctctt
ttctgccgga agatgagaaa aaagaactgc tggacctgct gtacaaggca tacggtatgc
cgtctccggc ttaa.
[0128] In alternative embodiments, the polypeptide having ADA
activity is a recombinant human protein, which can have the
sequence (SEQ ID NO. 3):
TABLE-US-00003 AQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLN
VIGMDKPLTLPDFLAKFDYYMPAIAGSREAIKRIAYEFVEMKAKEGV
VYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGER
DFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIP
GSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERL
GHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRL
KNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAA
KSSFLPEDEKRELLDLLYKAYGMPPSASAGQNL
[0129] The above mentioned ADA of SEQ ID NO. 3 is codified by a
DNA, where the DNA can have the sequence (SEQ ID No. 4):
TABLE-US-00004 atggctcaga cacccgcatt tgataaaccg aaagtggaac
tgcatgtcca cctggatggt agcatcaaac cggaaactat cttatattac ggtcggcgtc
gtggtattgc gttgccggca aacacggctg aaggtttgct gaacgtgatc ggcatggaca
aaccgctgac cttgccggat tttttggcga aatttgatta ttatatgccg gcgattgctg
gttcccgcga ggcaatcaaa cgcatcgcgt atgagtttgt tgaaatgaaa gcgaaagaag
gcgttgtgta tgttgaggtc cgttacagtc cgcatctgct ggctaacagc aaggtagaac
ctatcccctg gaaccaagct gaaggcgatc tgacgccgga tgaagtggtt gctctggtgg
gtcagggttt acaggagggg gagcgcgatt ttggcgttaa agctcgctct attttatgtt
gcatgcgcca tcagcccaat tggtccccga aagtggttga actttgtaaa aagtaccaac
aacagaccgt tgtcgcgatt gatttggcag gcgatgaaac aattccaggc agctccctgt
tgccagggca cgtgcaagcg taccaagaag cagtgaaaag cggcatccac cggactgtcc
acgccggcga ggtcggtagc gccgaggttg tgaaagaagc cgtggacatc ctgaaaaccg
agcggctggg ccatgggtac cacacactgg aggatcaggc attatataac cgcttacgcc
aggaaaatat gcatttcgaa atttgtccgt ggagtagtta cttaactggc gcgtggaaac
cggataccga acatgcggtt atccgcttaa agaatgatca agcaaattac agtctgaata
cagatgatcc cctgattttc aagtctaccc tggacacaga ttatcagatg acgaagcggg
atatgggatt tacggaagaa gaatttaagc gtctcaatat caatgcggcg aaatcttcat
ttctgccgga agatgagaaa cgtgagttgc tggatcttct gtacaaggcc tacggtatgc
cgccgagcgc atcggccggg cagaacctg
[0130] In alternative embodiments, the polypeptide having ADA
activity is conjugated with either of:
##STR00001##
[0131] wherein n is a positive integer between 1 and 5,000,
preferably between 1 and 4,000, more preferably between 1 and
2,500, in particular between 18 and 2,269.
[0132] In alternative embodiments, the polypeptide having ADA
activity is described in U.S. Pat. No. 8,071,741.
[0133] In alternative embodiments, ADA or polypeptides or peptides
having ADA activity, are conjugates having the general formula:
[R--NH].sub.z-(ADA)
[0134] where z is a positive integer, e.g., from about 1 to about
80; and R comprises a polymer, e.g., a substantially non-antigenic
polymer, which can be in a releasable or non-releasable form. In
alternative embodiments, the polymer is a polyethylene glycol
(PEG), where the PEG can be a linear, branched or a multi-armed
PEG. In alternative embodiments, average MW of the polymers ranges
from an average 1000 to 100,000 Da, or from about 5,000 Da to about
45,000 Da, or 5,000 Da to about 20,000 Da, or about 5,000 Daltons,
as is found in ADAGEN.RTM..
[0135] In alternative embodiments, the PEG can be functionalized
as:
--C(.dbd.Y.sub.74)--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.n--,
--C(.dbd.Y.sub.74)--Y--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.n--,
--C(.dbd.Y.sub.74)--NR.sub.11--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub-
.n--,
--CR.sub.75R.sub.76--(CH.sub.2).sub.m--(CH.sub.2CH.sub.2O).sub.n--,
[0136] where R.sub.11, R.sub.75 and R.sub.76 are independently
selected from among H, C.sub.1-6 alkyls, aryls, substituted aryls,
aralkyls, heteroalkyls, substituted heteroalkyls and substituted
C.sub.1-6 alkyls; m is zero or is a positive integer, e.g., 1 or 2;
Y.sub.74 is O or S; and n represents the degree of
polymerization.
[0137] In alternative embodiments, releasable polymer systems can
be based on benzyl elimination or trimethyl lock lactonization.
Activated polymer linkers of releasable polymer systems can be
prepared e.g., as described in U.S. Pat. Nos. 6,180,095; 6,720,306;
5,965,119; 6,624,142; and 6,303,569. In alternative embodiments, an
ADA polymer conjugate is made using certain bicine
(2-(Bis(2-hydroxyethyl) amino) acetic acid) polymer residues such
as those described in U.S. Pat. Nos. 7,122,189 and 7,087,229. In
alternative embodiments, activated PEGs as described in U.S. Pat.
Nos. 5,122,614; 5,324,844; 5,612,460; and 5,808,096, are used. In
alternative embodiments, a polyalkylene oxide is conjugated to an
ADA via linker chemistry including, e.g., succinimidyl carbonate,
thiazolidine thione, urethane, and amide based linkers. In
alternative embodiments, polyalkylene oxide is covalently attached
to an epsilon amino group of a Lys on the ADA purified from bovine
or the cysteine-stabilized recombinant human ADA. In alternative
embodiments, capped ADA polymer conjugates comprise at least 5
polyethylene glycol strands attached to epsilon amino groups of Lys
on the enzyme, have between about 11 to 18 PEG strands attached to
epsilon amino groups of Lys on the enzyme.
Pharmaceutical Compositions and Formulations
[0138] In alternative embodiments, provided are pharmaceutical
compositions and formulations for practicing the uses and methods
as provided herein, e.g., methods for treating, ameliorating,
reversing, slowing the progression of, or abating or diminishing
the symptoms of, or preventing: scleroderma-associated
vasculopathies and vascular changes, in particular a proliferative
obliterative vasculopathy such as idiopathic obliterative
vasculopathy and progressive obliterative vasculopathy, Raynaud's
syndrome, edematous puffy hands, telangiectasias, digital ulcers,
pulmonary arterial hypertension (PAH), myocardial dysfunction, and
scleroderma renal crisis; in an individual in need thereof; or,
arresting, treating, ameliorating, slowing the progression of or
preventing Raynaud's syndrome, nonpitting edema of the hands,
distal finger ulcers and/or facial or peri-oral skin tightening
with decreased oral aperture, wherein the Raynaud's syndrome,
nonpitting edema of the hands, distal finger ulcers and/or facial
or peri-oral skin tightening are early pathological expressions of
scleroderma.
[0139] In alternative embodiments, pharmaceutical compositions and
formulations comprise an Adenosine Deaminase (ADA), or a
polypeptide or peptide having Adenosine Deaminase activity, for
example, an ADA manufactured as or is formulated in an ADA
conjugate form, e.g., as a polyethylene glycol conjugate form,
e.g., as a PEGylated bovine adenosine deaminase enzyme, or a
(monomethoxypolyethylene glycol succinimidyl) 11-17-adenosine
deaminase, or ADAGEN.RTM. (Leadiant Biosciences Ltd., Windsor,
UK).
[0140] In alternative embodiments, compositions used to practice
the uses and methods as provided herein, are formulated with a
pharmaceutically acceptable carrier. In alternative embodiments,
the pharmaceutical compositions used to practice the uses and
methods as provided herein can be administered parenterally,
topically, subcutaneously, intramuscularly, orally or by local
administration, such as by aerosol or transdermally. The
pharmaceutical compositions can be formulated in any way and can be
administered in a variety of unit dosage forms depending upon the
condition or disease and the degree of illness, the general medical
condition of each patient, the resulting preferred method of
administration and the like. Details on techniques for formulation
and administration are well described in the scientific and patent
literature, see, e.g., the latest edition of Remington's
Pharmaceutical Sciences, Mack Publishing Co, Easton Pa.
("Remington's").
[0141] Therapeutic agents used to practice the uses and methods as
provided herein can be administered alone or as a component of a
pharmaceutical formulation (composition). The compounds may be
formulated for administration in any convenient way for use in
human or veterinary medicine. Wetting agents, emulsifiers and
lubricants, such as sodium lauryl sulfate and magnesium stearate,
as well as coloring agents, release agents, coating agents,
sweetening, flavoring and perfuming agents, buffers, preservatives
and antioxidants can also be present in the compositions.
[0142] Formulations of the compositions used to practice the uses
and methods as provided herein include those suitable for
oral/nasal, topical, parenteral, preferably intramuscular,
injection; rectal, and/or intravaginal administration. The
formulations may conveniently be presented in unit dosage form and
may be prepared by any methods well known in the art of pharmacy.
The amount of active ingredient which can be combined with a
carrier material to produce a single dosage form will vary
depending upon the host being treated, the particular mode of
administration. The amount of active ingredient which can be
combined with a carrier material to produce a single dosage form
will generally be that amount of the compound which produces a
therapeutic effect.
[0143] Pharmaceutical formulations used to practice the uses and
methods as provided herein can be prepared according to any method
known to the art for the manufacture of pharmaceuticals. Such drugs
can contain sweetening agents, flavoring agents, coloring agents
and preserving agents. A formulation can be admixtured with
nontoxic pharmaceutically acceptable excipients which are suitable
for manufacture. Formulations may comprise one or more diluents,
emulsifiers, preservatives, buffers, excipients, etc. and may be
provided in such forms as liquids, powders, emulsions, lyophilized
powders, sprays, creams, lotions, controlled release formulations,
tablets, pills, gels, on patches, in implants, etc.
[0144] Pharmaceutical formulations for oral administration can be
formulated using pharmaceutically acceptable carriers well known in
the art in appropriate and suitable dosages. Such carriers enable
the pharmaceuticals to be formulated in unit dosage forms as
tablets, geltabs, pills, powder, dragees, capsules, liquids,
lozenges, gels, syrups, slurries, suspensions, etc., suitable for
ingestion by the patient. Pharmaceutical preparations for oral use
can be formulated as a solid excipient, optionally grinding a
resulting mixture, and processing the mixture of granules, after
adding suitable additional compounds, if desired, to obtain tablets
or dragee cores. Suitable solid excipients are carbohydrate or
protein fillers include, e.g., sugars, including lactose, sucrose,
mannitol, or sorbitol; starch from corn, wheat, rice, potato, or
other plants; cellulose such as methyl cellulose,
hydroxypropylmethyl-cellulose, or sodium carboxy-methylcellulose;
and gums including arabic and tragacanth; and proteins, e.g.,
gelatin and collagen. Disintegrating or solubilizing agents may be
added, such as the cross-linked polyvinyl pyrrolidone, agar,
alginic acid, or a salt thereof, such as sodium alginate.
[0145] Dragee cores are provided with suitable coatings such as
concentrated sugar solutions, which may also contain gum arabic,
talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol,
and/or titanium dioxide, lacquer solutions, and suitable organic
solvents or solvent mixtures. Dyestuffs or pigments may be added to
the tablets or dragee coatings for product identification or to
characterize the quantity of active compound (i.e., dosage).
Pharmaceutical preparations used to practice the uses and methods
as provided herein can also be used orally using, e.g., push-fit
capsules made of gelatin, as well as soft, sealed capsules made of
gelatin and a coating such as glycerol or sorbitol. Push-fit
capsules can contain active agents mixed with a filler or binders
such as lactose or starches, lubricants such as talc or magnesium
stearate, and, optionally, stabilizers. In soft capsules, the
active agents can be dissolved or suspended in suitable liquids,
such as fatty oils, liquid paraffin, or liquid polyethylene glycol
with or without stabilizers.
[0146] Aqueous suspensions can contain an active agent (e.g., a
composition used to practice the uses and methods as provided
herein) in admixture with excipients suitable for the manufacture
of aqueous suspensions. Such excipients include a suspending agent,
such as sodium carboxymethylcellulose, methylcellulose,
hydroxypropyl-methylcellulose, sodium alginate,
polyvinylpyrrolidone, gum tragacanth and gum acacia, and dispersing
or wetting agents such as a naturally occurring phosphatide (e.g.,
lecithin), a condensation product of an alkylene oxide with a fatty
acid (e.g., polyoxyethylene stearate), a condensation product of
ethylene oxide with a long chain aliphatic alcohol (e.g.,
heptadecaethylene oxycetanol), a condensation product of ethylene
oxide with a partial ester derived from a fatty acid and a hexitol
(e.g., polyoxyethylene sorbitol mono-oleate), or a condensation
product of ethylene oxide with a partial ester derived from fatty
acid and a hexitol anhydride (e.g., polyoxyethylene sorbitan
mono-oleate). The aqueous suspension can also contain one or more
preservatives such as ethyl or n-propyl p-hydroxybenzoate, one or
more coloring agents, one or more flavoring agents and one or more
sweetening agents, such as sucrose, aspartame or saccharin, or
erythritol or rebaudioside A. Formulations can be adjusted for
osmolarity.
[0147] Oil-based pharmaceuticals are particularly useful for
administration hydrophobic active agents used to practice the uses
and methods as provided herein. Oil-based suspensions can be
formulated by suspending an active agent in a vegetable oil, such
as arachis oil, olive oil, sesame oil or coconut oil, or in a
mineral oil such as liquid paraffin; or a mixture of these. See
e.g., U.S. Pat. No. 5,716,928 describing using essential oils or
essential oil components for increasing bioavailability and
reducing inter- and intra-individual variability of orally
administered hydrophobic pharmaceutical compounds (see also U.S.
Pat. No. 5,858,401). The oil suspensions can contain a thickening
agent, such as beeswax, hard paraffin or cetyl alcohol. Sweetening
agents can be added to provide a palatable oral preparation, such
as glycerol, sorbitol or sucrose, or erythritol or rebaudioside A.
These formulations can be preserved by the addition of an
antioxidant such as ascorbic acid. As an example of an injectable
oil vehicle, see Minto (1997) J. Pharmacol. Exp. Ther. 281:93-102.
The pharmaceutical formulations as provided herein can also be in
the form of oil-in-water emulsions. The oily phase can be a
vegetable oil or a mineral oil, described above, or a mixture of
these. Suitable emulsifying agents include naturally-occurring
gums, such as gum acacia and gum tragacanth, naturally occurring
phosphatides, such as soybean lecithin, esters or partial esters
derived from fatty acids and hexitol anhydrides, such as sorbitan
mono-oleate, and condensation products of these partial esters with
ethylene oxide, such as polyoxyethylene sorbitan mono-oleate. The
emulsion can also contain sweetening agents and flavoring agents,
as in the formulation of syrups and elixirs. Such formulations can
also contain a demulcent, a preservative, or a coloring agent.
[0148] In practicing uses and methods provided herein, the
pharmaceutical compounds can also be administered by in intranasal,
intraocular and intravaginal routes including suppositories,
insufflation, powders and aerosol formulations (for examples of
steroid inhalants, see Rohatagi (1995) J. Clin. Pharmacol.
35:1187-1193; Tjwa (1995) Ann. Allergy Asthma Immunol. 75:107-111).
Suppositories formulations can be prepared by mixing the drug with
a suitable non-irritating excipient which is solid at ordinary
temperatures but liquid at body temperatures and will therefore
melt in the body to release the drug. Such materials are cocoa
butter and polyethylene glycols.
[0149] In practicing uses and methods provided herein, the
pharmaceutical compounds can be delivered by transdermally, by a
topical route, formulated as applicator sticks, solutions,
suspensions, emulsions, gels, creams, ointments, pastes, jellies,
paints, powders, and aerosols.
[0150] In practicing methods provided herein, the pharmaceutical
compounds can be delivered by inhalation; for example, in
alternative embodiments ADA or ADA conjugates, e.g., PEG-conjugates
for inhalation are prepared for dry dispersal, for example, by
spray drying a solution containing ADA or ADA PEG-conjugate, e.g.,
using methods as described in U.S. Pat. Nos. 6,509,006; 6,592,904;
7,097,827; and 6,358,530. Exemplary dry powder excipients include a
low molecular weight carbohydrates or polypeptides to be mixed with
the ADA or ADA PEG-conjugate to aid in dispersal. In alternative
embodiments, types of pharmaceutical excipients that are useful as
carriers for dry powder dispersal include stabilizers such as human
serum albumin (HSA), that is also a useful dispersing agent,
bulking agents such as carbohydrates, amino acids and polypeptides;
pH adjusters or buffers; salts such as sodium chloride; and the
like. These carriers may be in a crystalline or amorphous form or
may be a mixture of the two. Devices that can be used to deliver
powder or aerosol formulations include those as described e.g., in
U.S. Pat. Nos. 5,605,674; 7,097,827, for example, the devices can
be nebulizers.
[0151] In practicing methods provided herein, the pharmaceutical
compounds can also be delivered as nanoparticles or microspheres
for slow release in the body. For example, nanoparticles or
microspheres can be administered via intradermal or subcutaneous
injection of drug which slowly release subcutaneously; see Rao
(1995) J. Biomater Sci. Polym. Ed. 7:623-645; as biodegradable and
injectable gel formulations, see, e.g., Gao (1995) Pharm. Res.
12:857-863 (1995); or, as microspheres for oral administration,
see, e.g., Eyles (1997) J. Pharm. Pharmacol. 49:669-674.
[0152] In practicing methods provided herein, the pharmaceutical
compounds can be parenterally administered, such as by
intramuscular (IM), intrathecal, or intravenous (IV) administration
or administration into a body cavity or lumen of an organ. These
formulations can comprise a solution of active agent dissolved in a
pharmaceutically acceptable carrier. Acceptable vehicles and
solvents that can be employed are water, dextrose in water, and
Ringer's solution, an isotonic sodium chloride. In addition,
sterile fixed oils can be employed as a solvent or suspending
medium. For this purpose any bland fixed oil can be employed
including synthetic mono- or diglycerides. In addition, fatty acids
such as oleic acid can likewise be used in the preparation of
injectables. These solutions are sterile and generally free of
undesirable matter. These formulations may be sterilized by
conventional, well known sterilization techniques. The formulations
may contain pharmaceutically acceptable auxiliary substances as
required to approximate physiological conditions such as pH
adjusting and buffering agents, toxicity adjusting agents, e.g.,
sodium acetate, sodium chloride, potassium chloride, calcium
chloride, sodium lactate and the like. The concentration of active
agent in these formulations can vary widely, and will be selected
primarily based on fluid volumes, viscosities, body weight, and the
like, in accordance with the particular mode of administration
selected and the patient's needs. For IV administration, the
formulation can be a sterile injectable preparation, such as a
sterile injectable aqueous or oleaginous suspension. This
suspension can be formulated using those suitable dispersing or
wetting agents and suspending agents. The sterile injectable
preparation can also be a suspension in a nontoxic
parenterally-acceptable diluent or solvent, such as a solution of
1,3-butanediol. The administration can be by bolus or continuous
infusion (e.g., substantially uninterrupted introduction into a
blood vessel for a specified period of time).
[0153] The pharmaceutical compounds and formulations used to
practice the uses and methods as provided herein can be
lyophilized. Provided are a stable lyophilized formulation
comprising a composition as provided herein, which can be made by
lyophilizing a solution comprising a pharmaceutical as provided
herein and a bulking agent, e.g., mannitol, trehalose, raffinose,
and sucrose or mixtures thereof. There are many other conventional
lyophilizing agents. Among the sugars, lactose is the most common.
Also used are citric acid, sodium carbonate, EDTA, Benzyl alcohol,
glycine, sodium chloride, etc. (see for example Journal of
Excipients and Food Chemistry Vol. 1, Issue 1 (2010) pp 41-54). A
process for preparing a stable lyophilized formulation can include
lyophilizing a solution about 2.5 mg/mL protein, about 15 mg/mL
sucrose, about 19 mg/mL NaCl, and a sodium citrate buffer having a
pH greater than 5.5 but less than 6.5. See, e.g., U.S. patent app.
no. 20040028670.
[0154] The formulations used to practice the uses and methods as
provided herein can be administered for prophylactic and/or
therapeutic treatments. In therapeutic applications, compositions
are administered to a subject already suffering from a condition,
or disease in an amount sufficient to cure, alleviate or partially
arrest the clinical manifestations of the condition, or disease and
its complications (a "therapeutically effective amount"). For
example, in alternative embodiments, pharmaceutical compositions as
provided herein are administered in an amount sufficient to for
e.g., the prevention and treatment of scleroderma-associated
vasculopathies and vascular changes, in particular a proliferative
obliterative vasculopathy such as idiopathic obliterative
vasculopathy and progressive obliterative vasculopathy, causing
structural and functional abnormalities such as Raynaud's syndrome,
edematous puffy hands, telangiectasias, digital ulcers, pulmonary
arterial hypertension (PAH), myocardial dysfunction, and
scleroderma renal crisis in an individual in need thereof. The
amount of pharmaceutical composition adequate to accomplish this is
defined as a "therapeutically effective dose." The dosage schedule
and amounts effective for this use, i.e., the "dosing regimen,"
will depend upon a variety of factors, including the stage of the
disease or condition, the severity of the disease or condition, the
general state of the patient's health, the patient's physical
status, age and the like. The dosage schedule can be adjusted also
by monitoring the relevant biomarkers. In calculating the dosage
regimen for a patient, the mode of administration also is taken
into consideration.
[0155] The dosage regimen also takes into consideration
pharmacokinetics parameters well known in the art, i.e., the active
agents' rate of absorption, bioavailability, metabolism, clearance,
and the like (see, e.g., Hidalgo-Aragones (1996) J. Steroid
Biochem. Mol. Biol. 58:611-617; Groning (1996) Pharmazie
51:337-341; Fotherby (1996) Contraception 54:59-69; Johnson (1995)
J. Pharm. Sci. 84:1144-1146; Rohatagi (1995) Pharmazie 50:610-613;
Brophy (1983) Eur. J. Clin. Pharmacol. 24:103-108; the latest
Remington's, supra). The state of the art allows the clinician to
determine the dosage regimen for each individual patient, active
agent and disease or condition treated. Guidelines provided for
similar compositions used as pharmaceuticals can be used as
guidance to determine the dosage regiment, i.e., dose schedule and
dosage levels, administered practicing the methods as provided
herein are correct and appropriate.
[0156] Single or multiple administrations of formulations can be
given depending on the dosage and frequency as required and
tolerated by the patient. The formulations should provide a
sufficient quantity of active agent to effectively treat, prevent
or ameliorate a conditions, diseases or symptoms as described
herein. For example, an exemplary pharmaceutical formulation for
oral administration of compositions used to practice the methods as
provided herein can be in a daily amount of between about 0.1 to
0.5 to about 20, 50, 100 or 1000 or more .mu.g per kilogram of body
weight per day. In an alternative embodiment, dosages are from
about 1 mg to about 4 mg per kg of body weight per patient per day
are used. In alternative embodiments, an effective amount of
Adenosine Deaminase (ADA), or the polypeptide or peptide having ADA
activity, administered to an individual in need thereof is: from
about 0.01 to about 100 mg/kg, or about 1 to about 100 mg/kg, or
from about 5 to about 50 mg/kg, or from about 10 to about 30 mg/kg;
from about 5 U/kg to about 50 U/kg, or from about 10 U/kg to about
30 U/kg; or from about 0.5 U/kg to about 5 U/kg (e.g., about 1
U/kg), or, about 250 units/ml administered at various intervals
(daily, weekly, biweekly, triweekly, monthly), optionally
administered IV, IM or subcutaneously. Supraphysiological doses can
also be provided, for example up to about 100 U/kg or more.
[0157] In alternative embodiments, an effective amount of Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
administered to an individual in need thereof comprises use of
various dosaging schedules, e.g.: [0158] dosing schedule is about
10 U/kg, or between about 5 to 15 U/kg, ADAGEN.RTM. (or about 0.067
mg/kg, or between about 0.001 to 0.12 mg/kg or between about 0.03
to 0.12 mg/kg, EZN2279) for the first dose; [0159] about 15 U/kg,
or between about 5 to 15 U/kg, ADAGEN.RTM. (or about 0.1 mg/kg or
between about 0.05 to 0.5 mg/kg, EZN2279) for the second dose,
[0160] about 30 U/kg ADAGEN.RTM., or about 20 U/kg ADAGEN.RTM., or
between about 15 to 30 U/kg, between about 15 to 25 U/kg (or about
0.134 mg/kg, or between about 0.05 to 0.30 mg/kg, or between about
0.05 to 0.25 mg/kg EZN2279) for the third dose. Supraphysiological
doses can also be provided, for example up to 100 U/kg, or
more.
[0161] In alternative embodiments, a maintenance dose is
administered, e.g., about 20 U/kg per week, or between about 15 to
25 U/kg per week, for ADAGEN.RTM. (or about 0.134, or between about
0.05 to 0.25 mg/kg, mg/kg EZN2279), with further increases of about
5, or between about 1 and 10, U/kg/week if necessary, but for some
patients a maximum single dose of about 30 U/kg ADAGEN.RTM. (or
about 0.2 mg/kg EZN2279) should not be exceeded. However, if needed
or wished, supraphysiological doses may also be provided, for
example up to 100 U/kg, or higher, as the "dosing regimen," will
depend upon a variety of factors, including the stage of the
disease or condition, the severity of the disease or condition, the
general state of the patient's health, the patient's physical
status, age and the like.
[0162] In alternative embodiments, an effective amount of Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
administered to an individual in need thereof is individualized
based on monitoring of plasma ADA activity after initial
administrations.
[0163] In alternative embodiments, an effective amount of Adenosine
Deaminase (ADA), or the polypeptide or peptide having ADA activity,
administered to an individual in need thereof is an amount
sufficient to maintain plasma ADA activity (trough levels) in the
range of from between about 250 U/L to about 580 U/L (assayed at
37.degree. C.), or in the range of from between about 10 U/L to
about 50 U/L or in the range of between about 10 U/L to about 600
U/L.
[0164] In alternative embodiments, an effective amount is
demonstrated by a decline in adenosine in the form of plasma
adenosine. In alternative embodiments, an effective amount of
Adenosine Deaminase (ADA), or the polypeptide or peptide having ADA
activity, or ADA conjugates, administered to an individual in need
thereof is an amount sufficient to reduce vascular tissue adenosine
levels (where adenosine is present in the form of AMP, ADP, ATP) to
less than about 10 nmoles per mg protein, or to less than about 5
nmoles per mg protein.
[0165] In alternative embodiments, lower dosages of ADA, or the
polypeptide or peptide having ADA activity, including ADA
conjugates, are used when administered in the blood stream or IV or
IM (in contrast to administration e.g., orally, by inhalation or
subcutaneously) e.g., as an IV or an IM administration, or into a
body cavity or into a lumen of an organ. Substantially higher
dosages can be used in topical, spray, inhalation or oral
administration or administering by powders, spray or inhalation.
Actual methods for preparing parenterally or non-parenterally
administrable formulations will be known or apparent to those
skilled in the art and are described in more detail in such
publications as Remington's, supra.
[0166] In alternative embodiments, ADA, or the polypeptide or
peptide having ADA activity, including ADA conjugates, are given
chronically, e.g., from day of diagnosis and until the last day of
a patient's life or until the disease has abated. In alternative
embodiments, dose adjustments are required moving from a treatment
phase to a maintenance period through the periodic monitoring of
specific, conventionally known biomarkers of the disease.
[0167] In alternative embodiments, in evaluating the efficacy of a
treatment, a treatment regimen or a particular dosage, or to
determine if a treatment versus a maintenance dosage should be
given, individuals, e.g., scleroderma patients, are subject to
regular periodic screening for presence and extent of organ and
tissue involvement, e.g., including the Rodnan skin score for
cutaneous complication, radiography and/or high resolution CT
scanning to monitor interstitial fibrosis, echocardiography with
Doppler examination to monitor pulmonary hypertension and, blood
and urine tests to monitor renal parameters and, if cardiac disease
is suspected, serum troponin, creatine kinase MB fraction, and
N-terminal pro-brain natruietic peptide, lung function, e.g. FVC. A
thorough physical examination should be done at a time interval
chosen by those experts in the treatment of systemic sclerosis
which would concentrate on cutaneous findings such as digital
ulcers, non-pitting edema, telangiectasias, calcinosis cutis and
presence and severity of Raynaud's syndrome. Blood pressure is
carefully monitored due to the high incidence of renal involvement
and the history and physical examination would also concentrate on
pulmonary, rheumatic, and gastrointestinal signs and symptoms.
[0168] If, in the course of careful clinical and laboratory
observation, progression of cutaneous or visceral symptoms of
scleroderma are found, one might consider restarting the ADA, or
the polypeptide or peptide having ADA activity, or ADA conjugate,
at full dose for at least one year before attempting a taper. In
some patients, it is likely that the administration of ADA, or the
polypeptide or peptide having ADA activity, will need to be chronic
and would be justified by the high morbidity and mortality
associated with systemic sclerosis.
[0169] If residual symptoms remain once the patient is on ADA
therapy, a physician skilled in the treatment of scleroderma could
use concomitant organ based therapy. For example, in alternative
embodiments ADA is administered with topical nitrates or calcium
channel blockers for Raynaud's syndrome, antihistamines for
pruritus, H2 blockers or proton pump inhibitors for esophageal
symptoms, anti-diarrheal agents or anti-spasmotics for lower GI
symptoms and ACEI/ARB medications for hypertension or other renal
manifestations of systemic sclerosis. If, despite ADA and
symptomatic treatment there has not been an adequate response, in
alternative embodiments immunosuppressive agents combining such
agents as methotrexate, cyclophosphamide, mycophenolate mofetil, or
rituximab are also used (with a use and method as provided herein)
for a rapidly progressing skin disease or pulmonary fibrosis, since
they have been shown to have some effectiveness in various clinical
studies.
[0170] The uses and methods as provided herein can further comprise
co-administration with other drugs or pharmaceuticals, e.g.,
compositions for treating an autoimmune disease or condition, a
cancer, septic shock, an infection, fever, pain and related
symptoms or conditions. For example, the methods and/or
compositions and formulations as provided herein can be
co-formulated with and/or co-administered with antibiotics (e.g.,
antibacterial or bacteriostatic peptides or proteins), particularly
those effective against gram negative bacteria or other species
causing intestinal bacterial overgrowth, fluids, cytokines,
immunoregulatory agents, anti-inflammatory agents, complement
activating agents, such as peptides or proteins comprising
collagen-like domains or fibrinogen-like domains (e.g., a ficolin),
carbohydrate-binding domains, and the like and combinations
thereof.
Nanoparticles, Nanolipoparticles and Liposomes
[0171] Also provided are nanoparticles, nanolipoparticles, vesicles
and liposomal membranes comprising compounds used to practice the
uses and methods as provided herein, e.g., to deliver compositions
as provided herein (which can comprise an Adenosine Deaminase
(ADA), or a polypeptide or peptide having ADA activity or ADA
conjugate,) to mammalian cells in vivo, in vitro or ex vivo. In
alternative embodiments, these compositions are designed to target
specific molecules, including biologic molecules, such as
polypeptides, including cell surface polypeptides, e.g., for
targeting a desired cell type, e.g., a vascular cell (e.g., a
vascular endothelial, epithelial or smooth muscle cell), a
fibroblast, a myocyte or heart cell, an endothelial cell, and the
like.
[0172] Provided are multilayered liposomes comprising compounds
used to practice methods as provided herein, e.g., as described in
Park, et al., U.S. Pat. Pub. No. 20070082042. The multilayered
liposomes can be prepared using a mixture of oil-phase components
comprising squalane, sterols, ceramides, neutral lipids or oils,
fatty acids and lecithins, to about 200 to 5000 nm in particle
size, to entrap a composition used to practice uses and methods as
provided herein.
[0173] Liposomes can be made using any method, e.g., as described
in U.S. Pat. No. 4,534,899; or Park, et al., U.S. Pat. Pub. No.
20070042031, including method of producing a liposome by
encapsulating an active agent (e.g., an Adenosine Deaminase (ADA),
or a polypeptide or peptide having ADA activity or ADA conjugate),
the method comprising providing an aqueous solution in a first
reservoir; providing an organic lipid solution in a second
reservoir, and then mixing the aqueous solution with the organic
lipid solution in a first mixing region to produce a liposome
solution, where the organic lipid solution mixes with the aqueous
solution to substantially instantaneously produce a liposome
encapsulating the active agent; and immediately then mixing the
liposome solution with a buffer solution to produce a diluted
liposome solution.
[0174] In one embodiment, liposome compositions used to practice
uses and methods as provided herein comprise a substituted ammonium
and/or polyanions, e.g., for targeting delivery of a compound
(e.g., an Adenosine Deaminase (ADA), or a polypeptide or peptide
having ADA activity or ADA conjugate,) used to practice methods as
provided herein to a desired cell type (e.g., an endothelial cell,
a cancer cell, or any tissue in need thereof), as described e.g.,
in U.S. Pat. Pub. No. 20070110798.
[0175] Provided are nanoparticles comprising compounds (e.g., an
Adenosine Deaminase (ADA), or a polypeptide or peptide having ADA
activity or ADA conjugate,) used to practice uses and methods as
provided herein in the form of active agent-containing
nanoparticles (e.g., a secondary nanoparticle), as described, e.g.,
in U.S. Pat. Pub. No. 20070077286. In one embodiment, provided are
nanoparticles comprising a fat-soluble active agent used to
practice a use and method as provided herein or a fat-solubilized
water-soluble active agent to act with a bivalent or trivalent
metal salt.
[0176] In one embodiment, solid lipid suspensions can be used to
formulate and to deliver compositions used to practice uses and
methods as provided herein to mammalian cells in vivo, in vitro or
ex vivo, as described, e.g., in U.S. Pat. Pub. No. 20050136121.
[0177] The compositions and formulations used to practice the uses
and methods as provided herein can be delivered by the use of
liposomes or nanoliposomes. By using liposomes, particularly where
the liposome surface carries ligands specific for target cells, or
are otherwise preferentially directed to a specific organ, one can
focus the delivery of the active agent into target cells in vivo.
See, e.g., U.S. Pat. Nos. 6,063,400; 6,007,839; Al-Muhammed (1996)
J. Microencapsul. 13:293-306; Chonn (1995) Curr. Opin. Biotechnol.
6:698-708; Ostro (1989) Am. J. Hosp. Pharm. 46:1576-1587.
Delivery Vehicles
[0178] In alternative embodiments, any delivery vehicle can be used
to practice the uses and methods as provided herein, e.g., to
deliver compositions methods as provided herein (e.g., an Adenosine
Deaminase (ADA), or a polypeptide or peptide having ADA activity or
ADA conjugate,) to mammalian cells in vivo, in vitro or ex vivo.
For example, delivery vehicles comprising polycations, cationic
polymers and/or cationic peptides, such as polyethyleneimine
derivatives, can be used e.g. as described, e.g., in U.S. Pat. Pub.
No. 20060083737.
[0179] In one embodiment, a dried polypeptide-surfactant complex is
used to formulate a composition used to practice a use and method
as provided herein, e.g. as described, e.g., in U.S. Pat. Pub. No.
20040151766.
[0180] In one embodiment, a composition used to practice uses and
methods as provided herein can be applied to cells using vehicles
with cell membrane-permeant peptide conjugates, e.g., as described
in U.S. Pat. Nos. 7,306,783; 6,589,503. In one aspect, the
composition to be delivered is conjugated to a cell
membrane-permeant peptide. In one embodiment, the composition to be
delivered and/or the delivery vehicle are conjugated to a
transport-mediating peptide, e.g., as described in U.S. Pat. No.
5,846,743, describing transport-mediating peptides that are highly
basic and bind to poly-phosphoinositides.
[0181] In one embodiment, electro-permeabilization is used as a
primary or adjunctive means to deliver the composition to a cell,
e.g., using any electroporation system as described e.g. in U.S.
Pat. Nos. 7,109,034; 6,261,815; 5,874,268.
Products of Manufacture and Kits
[0182] In alternative embodiments, provided are products of
manufacture and kits comprising an Adenosine Deaminase (ADA), or a
polypeptide or peptide having ADA activity, or ADA conjugate, for
practicing uses and methods as provided herein, e.g., to treat,
ameliorate or prevent scleroderma-associated vasculopathies and
vascular changes, in particular an proliferative obliterative
vasculopathy such as idiopathic obliterative vasculopathy and
progressive obliterative vasculopathy, Raynaud's syndrome,
edematous puffy hands, telangiectasias, digital ulcers, pulmonary
arterial hypertension (PAH), myocardial dysfunction, and
scleroderma renal crisis. In alternative embodiments, provided are
products of manufacture and kits comprising an Adenosine Deaminase
(ADA), or the polypeptide or peptide having ADA activity, including
ADA conjugates, for use in treating, ameliorating or preventing:
scleroderma-associated vasculopathies and vascular changes, in
particular a proliferative obliterative vasculopathy such as
idiopathic obliterative vasculopathy and progressive obliterative
vasculopathy, Raynaud's syndrome, the edematous puffy hands,
telangiectasias, digital ulcers, pulmonary arterial hypertension
(PAH), myocardial dysfunction, and scleroderma renal crisis. In
alternative embodiments, provided are products of manufacture and
kits comprising an Adenosine Deaminase (ADA), or the polypeptide or
peptide having ADA activity, including ADA conjugates, for use in
preventing or decreasing the progression of scleroderma, wherein
optionally the scleroderma comprises a local or focal scleroderma
or a diffuse, or a systemic scleroderma.
[0183] In alternative embodiments, products of manufacture and kits
as provided herein comprise instructions for practicing a method as
provided herein.
[0184] The invention will be further described with reference to
the examples described herein; however, it is to be understood that
the invention is not limited to such examples.
EXAMPLES
[0185] Unless stated otherwise in the Examples, all recombinant DNA
techniques are carried out according to standard protocols, for
example, as described in Sambrook et al. (1989) Molecular Cloning:
A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory
Press, NY and in Volumes 1 and 2 of Ausubel et al. (1994) Current
Protocols in Molecular Biology, Current Protocols, USA. Other
references for standard molecular biology techniques include
Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual,
Third Edition, Cold Spring Harbor Laboratory Press, NY, Volumes I
and II of Brown (1998) Molecular Biology LabFax, Second Edition,
Academic Press (UK). Standard materials and methods for polymerase
chain reactions can be found in Dieffenbach and Dveksler (1995) PCR
Primer: A Laboratory Manual, Cold Spring Harbor Laboratory Press,
and in McPherson at al. (2000) PCR--Basics: From Background to
Bench, First Edition, Springer Verlag, Germany.
Example 1: Treating or Ameliorating Scleroderma-Associated
Vasculopathy and/or Preventing or Decreasing the Progression of
Systemic Sclerosis (SSc)
[0186] This example describes a protocol for using a pharmaceutical
composition or formulation, product of manufacture or kit as
provided herein for treating, preventing or decreasing progression
of Systemic Sclerosis (SSc) in a patient suffering from
scleroderma-related vasculopathy. Preclinical data in animal models
of systemic sclerosis have shown efficacy of adenosine deaminase
when given very early after the insult; i.e., passage of time for
the Fra2 mouse of eight weeks (an art accepted animal model of
systemic sclerosis).
[0187] Therefore, the preclinical data demonstrates several
scenarios under which patients qualify for treatment using methods
as provided herein. These would include patients diagnosed with
systemic sclerosis with high risk features for progression
including diffuse skin involvement though some patients with
limited skin involvement develop pulmonary hypertension. Thus, in
alternative embodiments, patients with any signs or symptoms of
pulmonary hypertension, myocarditis, inflammatory myopathy and/or
arthritis, or other internal organ treatment poorly responsive to
conventional symptomatic therapy qualify for treatment using
methods as provided herein.
[0188] However, since the SSc-cGVHD model (an art-accepted mouse
model for cGVDH) demonstrates that ADA can impact the earliest
pathological expression of scleroderma, i.e., vascular changes, in
alternative embodiments ADA is administered early in the earliest
course of the disease, e.g., where manifestations may include
Raynaud's syndrome, nonpitting edema of the hands, painful distal
finger ulcers and/or facial or peri-oral skin tightening with
decreased oral aperture and the particularly useful finding of
abnormal capillaroscopy consistent with a sclerodermatous
pattern.
[0189] In alternative embodiments, for treating patients with
established scleroderma disease, including scleroderma patients
with diffuse skin involvement (progressive cutaneous skin
tightening, involvement of internal organs such as esophagus,
lungs, heart, kidney including poorly controllable hypertension,
diarrhea with malabsorption or intestinal pseudo-obstruction,
dyspnea on exertion joint involvement, or scleroderma patients
whose cutaneous or systemic symptoms are rapidly progressing, can
be included as a group of individuals qualifying for treatment with
a method as provided herein.
[0190] In alternative embodiments, another group of individuals
(with early symptoms) qualifying for treatment with a method as
provided herein includes those with skin involvement or abnormal
capillaroscopy, puffy or swollen digits, or Raynaud's syndrome in
the presence of positive tests for anti-topoisomerase 1
(anti-Scl-70) antibody, anticentromere antibody, and/or anti-RNA
polymerase III antibody or a positive ANA with a nucleolar
pattern.
[0191] In alternative embodiments, another group of individuals
qualifying for treatment with a method as provided herein includes
those having clinical signs and symptoms in the presence of skin
thickening of the fingers of both hands especially with proximal
involvement that strongly suggest systemic sclerosis, including
ischemic fingertip ulcerations, calcinosis cutis,
hyperpigmentation, mucocutaneous telangiectasia, heartburn or
dysphagia of new onset, dyspnea on exertion with evidence of
interstitial pulmonary changes on radiography or high resolution CT
scanning or pulmonary hypertension on Doppler echocardiography.
[0192] A number of embodiments of the invention have been
described. Nevertheless, it can be understood that various
modifications may be made without departing from the spirit and
scope of the invention. Accordingly, other embodiments are within
the scope of the following claims.
Sequence CWU 1
1
41356PRTBos taurusMUTAGEN(74)..(74)Cys to Ser mutein 1Ala Gln Thr
Pro Ala Phe Asn Lys Pro Lys Val Glu Leu His Val His1 5 10 15Leu Asp
Gly Ala Ile Lys Pro Glu Thr Ile Leu Tyr Tyr Gly Arg Lys 20 25 30Arg
Gly Ile Ala Leu Pro Ala Asp Thr Pro Glu Glu Leu Gln Asn Ile 35 40
45Ile Gly Met Asp Lys Pro Leu Ser Leu Pro Glu Phe Leu Ala Lys Phe
50 55 60Asp Tyr Tyr Met Pro Ala Ile Ala Gly Ser Arg Glu Ala Val Lys
Arg65 70 75 80Ile Ala Tyr Glu Phe Val Glu Met Lys Ala Lys Asp Gly
Val Val Tyr 85 90 95Val Glu Val Arg Tyr Ser Pro His Leu Leu Ala Asn
Ser Lys Val Glu 100 105 110Pro Ile Pro Trp Asn Gln Ala Glu Gly Asp
Leu Thr Pro Asp Glu Val 115 120 125Val Ser Leu Val Asn Gln Gly Leu
Gln Glu Gly Glu Arg Asp Phe Gly 130 135 140Val Lys Val Arg Ser Ile
Leu Cys Cys Met Arg His Gln Pro Ser Trp145 150 155 160Ser Ser Glu
Val Val Glu Leu Cys Lys Lys Tyr Arg Glu Gln Thr Val 165 170 175Val
Ala Ile Asp Leu Ala Gly Asp Glu Thr Ile Glu Gly Ser Ser Leu 180 185
190Phe Pro Gly His Val Lys Ala Tyr Ala Glu Ala Val Lys Ser Gly Val
195 200 205His Arg Thr Val His Ala Gly Glu Val Gly Ser Ala Asn Val
Val Lys 210 215 220Glu Ala Val Asp Thr Leu Lys Thr Glu Arg Leu Gly
His Gly Tyr His225 230 235 240Thr Leu Glu Asp Thr Thr Leu Tyr Asn
Arg Leu Arg Gln Glu Asn Met 245 250 255His Phe Glu Val Cys Pro Trp
Ser Ser Tyr Leu Thr Gly Ala Trp Lys 260 265 270Pro Asp Thr Glu His
Pro Val Val Arg Phe Lys Asn Asp Gln Val Asn 275 280 285Tyr Ser Leu
Asn Thr Asp Asp Pro Leu Ile Phe Lys Ser Thr Leu Asp 290 295 300Thr
Asp Tyr Gln Met Thr Lys Asn Glu Met Gly Phe Thr Glu Glu Glu305 310
315 320Phe Lys Arg Leu Asn Ile Asn Ala Ala Lys Ser Ser Phe Leu Pro
Glu 325 330 335Asp Glu Lys Lys Glu Leu Leu Asp Leu Leu Tyr Lys Ala
Tyr Gly Met 340 345 350Pro Ser Pro Ala 35521074DNABos taurus
2atggctcaga ccccggcttt caacaaaccg aaggtagaac tgcacgtaca cctggatggt
60gctatcaaac cggagactat cctgtactat ggtcgtaagc gtggcatcgc tctgccggct
120gacactccgg aagaactgca gaacatcatc ggcatggaca aaccgctgtc
tctgccggaa 180ttcctggcta aattcgacta ctacatgccg gctatcgctg
gttctcgtga agcagtcaaa 240cgtatcgctt acgaattcgt agaaatgaaa
gctaaagatg gtgtagtata cgttgaagtt 300cgttactctc cgcacctgct
ggcaaactct aaagttgaac cgatcccgtg gaaccaggca 360gaaggcgatc
tgactccgga tgaagtagtt tctctggtta accagggtct gcaggagggt
420gaacgcgatt tcggcgtaaa agttcgttct atcctgtgct gcatgcgcca
ccagccgtct 480tggtcttctg aagttgttga actgtgcaag aaataccgtg
agcagaccgt agttgctatc 540gatctggcag gtgatgaaac catcgaaggt
tcttctctgt ttccgggtca cgtaaaggct 600tatgctgaag ctgttaaatc
tggcgtacac cgtactgtac acgcaggtga agttggttct 660gctaacgttg
ttaaagaagc tgttgacacc ctgaaaactg aacgcctggg tcacggctac
720cacaccctgg aagacaccac cctgtacaac cgtctgcgtc aggaaaacat
gcacttcgaa 780gtttgtccgt ggtcctctta cctgactggt gcttggaaac
cggacaccga acacccggtt 840gttcgtttca aaaacgacca ggtaaactac
tctctgaaca ctgacgatcc gctgatcttc 900aaatctaccc tggacaccga
ctaccagatg accaaaaacg aaatgggttt cactgaagaa 960gaattcaaac
gtctgaacat caacgctgct aagtcctctt ttctgccgga agatgagaaa
1020aaagaactgc tggacctgct gtacaaggca tacggtatgc cgtctccggc ttaa
10743362PRTHomo sapiensMUTAGEN(74)..(74)Cys to Ser mutein 3Ala Gln
Thr Pro Ala Phe Asp Lys Pro Lys Val Glu Leu His Val His1 5 10 15Leu
Asp Gly Ser Ile Lys Pro Glu Thr Ile Leu Tyr Tyr Gly Arg Arg 20 25
30Arg Gly Ile Ala Leu Pro Ala Asn Thr Ala Glu Gly Leu Leu Asn Val
35 40 45Ile Gly Met Asp Lys Pro Leu Thr Leu Pro Asp Phe Leu Ala Lys
Phe 50 55 60Asp Tyr Tyr Met Pro Ala Ile Ala Gly Ser Arg Glu Ala Ile
Lys Arg65 70 75 80Ile Ala Tyr Glu Phe Val Glu Met Lys Ala Lys Glu
Gly Val Val Tyr 85 90 95Val Glu Val Arg Tyr Ser Pro His Leu Leu Ala
Asn Ser Lys Val Glu 100 105 110Pro Ile Pro Trp Asn Gln Ala Glu Gly
Asp Leu Thr Pro Asp Glu Val 115 120 125Val Ala Leu Val Gly Gln Gly
Leu Gln Glu Gly Glu Arg Asp Phe Gly 130 135 140Val Lys Ala Arg Ser
Ile Leu Cys Cys Met Arg His Gln Pro Asn Trp145 150 155 160Ser Pro
Lys Val Val Glu Leu Cys Lys Lys Tyr Gln Gln Gln Thr Val 165 170
175Val Ala Ile Asp Leu Ala Gly Asp Glu Thr Ile Pro Gly Ser Ser Leu
180 185 190Leu Pro Gly His Val Gln Ala Tyr Gln Glu Ala Val Lys Ser
Gly Ile 195 200 205His Arg Thr Val His Ala Gly Glu Val Gly Ser Ala
Glu Val Val Lys 210 215 220Glu Ala Val Asp Ile Leu Lys Thr Glu Arg
Leu Gly His Gly Tyr His225 230 235 240Thr Leu Glu Asp Gln Ala Leu
Tyr Asn Arg Leu Arg Gln Glu Asn Met 245 250 255His Phe Glu Ile Cys
Pro Trp Ser Ser Tyr Leu Thr Gly Ala Trp Lys 260 265 270Pro Asp Thr
Glu His Ala Val Ile Arg Leu Lys Asn Asp Gln Ala Asn 275 280 285Tyr
Ser Leu Asn Thr Asp Asp Pro Leu Ile Phe Lys Ser Thr Leu Asp 290 295
300Thr Asp Tyr Gln Met Thr Lys Arg Asp Met Gly Phe Thr Glu Glu
Glu305 310 315 320Phe Lys Arg Leu Asn Ile Asn Ala Ala Lys Ser Ser
Phe Leu Pro Glu 325 330 335Asp Glu Lys Arg Glu Leu Leu Asp Leu Leu
Tyr Lys Ala Tyr Gly Met 340 345 350Pro Pro Ser Ala Ser Ala Gly Gln
Asn Leu 355 36041089DNAHomo sapiens 4atggctcaga cacccgcatt
tgataaaccg aaagtggaac tgcatgtcca cctggatggt 60agcatcaaac cggaaactat
cttatattac ggtcggcgtc gtggtattgc gttgccggca 120aacacggctg
aaggtttgct gaacgtgatc ggcatggaca aaccgctgac cttgccggat
180tttttggcga aatttgatta ttatatgccg gcgattgctg gttcccgcga
ggcaatcaaa 240cgcatcgcgt atgagtttgt tgaaatgaaa gcgaaagaag
gcgttgtgta tgttgaggtc 300cgttacagtc cgcatctgct ggctaacagc
aaggtagaac ctatcccctg gaaccaagct 360gaaggcgatc tgacgccgga
tgaagtggtt gctctggtgg gtcagggttt acaggagggg 420gagcgcgatt
ttggcgttaa agctcgctct attttatgtt gcatgcgcca tcagcccaat
480tggtccccga aagtggttga actttgtaaa aagtaccaac aacagaccgt
tgtcgcgatt 540gatttggcag gcgatgaaac aattccaggc agctccctgt
tgccagggca cgtgcaagcg 600taccaagaag cagtgaaaag cggcatccac
cggactgtcc acgccggcga ggtcggtagc 660gccgaggttg tgaaagaagc
cgtggacatc ctgaaaaccg agcggctggg ccatgggtac 720cacacactgg
aggatcaggc attatataac cgcttacgcc aggaaaatat gcatttcgaa
780atttgtccgt ggagtagtta cttaactggc gcgtggaaac cggataccga
acatgcggtt 840atccgcttaa agaatgatca agcaaattac agtctgaata
cagatgatcc cctgattttc 900aagtctaccc tggacacaga ttatcagatg
acgaagcggg atatgggatt tacggaagaa 960gaatttaagc gtctcaatat
caatgcggcg aaatcttcat ttctgccgga agatgagaaa 1020cgtgagttgc
tggatcttct gtacaaggcc tacggtatgc cgccgagcgc atcggccggg
1080cagaacctg 1089
* * * * *