U.S. patent application number 16/453482 was filed with the patent office on 2019-10-24 for human il-23 antigen binding proteins.
The applicant listed for this patent is AMGEN INC.. Invention is credited to Heather Cerne, Janet D. Cheng, Randal R. Ketchem, Jason C. O'Neill, Derek E. Piper, Yu Sun, Jennifer E. Towne, Yu Zhang.
Application Number | 20190322737 16/453482 |
Document ID | / |
Family ID | 43413789 |
Filed Date | 2019-10-24 |
![](/patent/app/20190322737/US20190322737A1-20191024-D00001.png)
![](/patent/app/20190322737/US20190322737A1-20191024-D00002.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00001.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00002.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00003.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00004.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00005.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00006.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00007.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00008.png)
![](/patent/app/20190322737/US20190322737A1-20191024-P00009.png)
View All Diagrams
United States Patent
Application |
20190322737 |
Kind Code |
A1 |
Towne; Jennifer E. ; et
al. |
October 24, 2019 |
HUMAN IL-23 ANTIGEN BINDING PROTEINS
Abstract
Antigen binding proteins that bind to human IL-23 protein are
provided. Nucleic acids encoding the antigen binding protein,
vectors, and cells encoding the same as well as use of IL-23
antigen binding proteins for diagnostic and therapeutic purposes
are also provided.
Inventors: |
Towne; Jennifer E.;
(Seattle, WA) ; Cheng; Janet D.; (Seattle, WA)
; O'Neill; Jason C.; (Brier, WA) ; Zhang; Yu;
(Shoreline, WA) ; Sun; Yu; (Seattle, WA) ;
Cerne; Heather; (Seattle, WA) ; Piper; Derek E.;
(Santa Clara, CA) ; Ketchem; Randal R.;
(Snohomish, WA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AMGEN INC. |
Thousand Oaks |
CA |
US |
|
|
Family ID: |
43413789 |
Appl. No.: |
16/453482 |
Filed: |
June 26, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16194896 |
Nov 19, 2018 |
|
|
|
16453482 |
|
|
|
|
15922675 |
Mar 15, 2018 |
|
|
|
16194896 |
|
|
|
|
15271315 |
Sep 21, 2016 |
9951129 |
|
|
15922675 |
|
|
|
|
14228556 |
Mar 28, 2014 |
9487580 |
|
|
15271315 |
|
|
|
|
13504449 |
Aug 31, 2012 |
8722033 |
|
|
PCT/US10/54148 |
Oct 26, 2010 |
|
|
|
14228556 |
|
|
|
|
61381287 |
Sep 9, 2010 |
|
|
|
61254982 |
Oct 26, 2009 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/24 20130101;
C07K 2317/626 20130101; C07K 2317/76 20130101; C07K 2317/565
20130101; A61K 47/6845 20170801; C07K 2317/31 20130101; A61K
2039/505 20130101; C07K 16/24 20130101; C07K 2317/55 20130101; C07K
2317/21 20130101; A61K 39/395 20130101; A61P 37/00 20180101; C07K
16/244 20130101; C07K 2317/54 20130101; C07K 2317/622 20130101;
C07K 2317/92 20130101 |
International
Class: |
C07K 16/24 20060101
C07K016/24; A61K 39/395 20060101 A61K039/395; A61K 47/68 20060101
A61K047/68 |
Claims
1. An isolated antigen binding protein that binds IL-23, comprising
at least one heavy chain variable region comprising a CDRH1, a
CDRH2 and a CDRH3 selected from the group consisting of: a) a CDRH1
that differs by no more than one amino acid substitution, insertion
or deletion from a CDRH1 as shown in TABLE 3; b) a CDRH2 that
differs by no more than three amino acid substitutions, insertions
and/or deletions from a CDRH2 as shown in TABLE 3; c) a CDRH3 that
differs by no more than three amino acid substitutions, insertions
and/or deletions from a CDRH3 as shown in TABLE 3; and comprising
at least one light chain variable region comprising a CDRL1, a
CDRL2 and a CDRL3 selected from the group consisting of: d) a CDRL1
that differs by no more than three amino acid substitutions,
insertions and/or deletions from a CDRL1 as shown in TABLE 3; e) a
CDRL2 that differs by no more than one amino acid substitution,
insertion or deletion from a CDRL2 as shown in TABLE 3; f) a CDRL3
that differs by no more than one amino acid substitution, insertion
or deletion from a CDRL3 as shown in TABLE 3.
2. An isolated antigen binding protein of claim 1, comprising at
least one heavy chain variable region comprising a CDRH1, a CDRH2
and a CDRH3 selected from the group consisting of: a) a CDRH1 that
differs by no more than one amino acid substitution, insertion or
deletion from a CDRH1 as shown in TABLE 3; b) a CDRH2 that differs
by no more than two amino acid substitutions, insertions and/or
deletions from a CDRH2 as shown in TABLE 3; c) a CDRH3 that differs
by no more than two amino acid substitutions, insertions and/or
deletions from a CDRH3 as shown in TABLE 3; and also comprising at
least one light chain variable region comprising a CDRL1, a CDRL2
and a CDRL3 selected from the group consisting of: d) a CDRL1 that
differs by no more than two amino acid substitutions, insertions
and/or deletions from a CDRL1 as shown in TABLE 3; e) a CDRL2 that
differs by no more than one amino acid substitution, insertions or
deletion from a CDRL2 as shown in TABLE 3; f) a CDRL3 that differs
by no more than one amino acid substitution, insertions or deletion
from a CDRL3 as shown in TABLE 3.
3. An isolated antigen binding protein of claim 1, comprising at
least one heavy chain variable region comprising a CDRH1, CDRH2 and
a CDRH3 selected from the group consisting of: a) a CDRH1 that
differs by no more than one amino acid substitution, insertion or
deletion from a CDRH1 as shown in TABLE 3; b) a CDRH2 that differs
by no more than one amino acid substitution, insertion or deletion
from a CDRH2 as shown in TABLE 3; c) a CDRH3 that differs by no
more than one amino acid substitution, insertion or deletion from a
CDRH3 as shown in TABLE 3; and also comprising at least one light
chain variable region comprising a CDRL1, a CDRL2 and a CDRL3
selected from the group consisting of: d) a CDRL1 that differs by
no more than one amino acid substitution, insertion or deletion
from a CDRL1 as shown in TABLE 3; e) a CDRL2 that differs by no
more than one amino acid substitution, insertion or deletion from a
CDRL2 as shown in TABLE 3; f) a CDRL3 that differs by no more than
one amino acid substitution, insertion or deletion from a CDRL3 as
shown in TABLE 3.
4. An isolated antigen binding protein that binds IL-23 selected
from the group consisting of a) an antigen binding protein having
CDRH1 of SEQ ID NO:129, CDRH2 of SEQ ID NO:132, CDRH3 of SEQ ID
NO:136, and CDRL1 of SEQ ID NO:123, CDRL2 of SEQ ID NO:81, and
CDRL3 of SEQ ID NO: 76; b) an antigen binding protein having CDRH1
of SEQ ID NO:131, CDRH2 of SEQ ID NO: 134, CDRH3 of SEQ ID NO:137
and CDRL1 of SEQ ID NO:124, CDRL2 of SEQ ID N0126 and CDRL3 of SEQ
ID NO:128; c) a) an antigen binding protein having CDRH1 of SEQ ID
NO:130, CDRH2 of SEQ ID NO:133, CDRH3 of SEQ ID NO:99 and CDRL1 of
SEQ ID NO:68, CDRL2 of SEQ ID NO:69, and CDRL3 of SEQ ID NO:67; and
d) an antigen binding protein having CDRH1 SEQ ID NO:91, CDRH2 SEQ
ID NO: 135, CDRH3 SEQ ID NO:138 and CDRL1 SEQ ID NO:125, CDRL2 SEQ
ID NO:127, and CDRL3 SEQ ID NO:64.
5. An isolated antigen binding protein of claim 1 comprising: a
CDRH1 selected from the group consisting of SEQ ID NO: 91, 94, 97,
100, and 103; a CDRH2 selected from the group consisting of SEQ ID
NO:92, 95, 98, 101, 104, 107, and 110; a CDRH3 selected from the
group consisting of SEQ ID NO: 93, 96, 99, 102, and 105; a CDRL1
selected from the group consisting of SEQ ID NO: 62, 65, 68, 71,
and 74; a CDRL2 selected from the group consisting of SEQ ID NO:63,
66, 69, 72, 75, and 78; and a CDRL3 selected from the group
consisting of SEQ ID NO:64, 67, 70 and 73.
6. An isolated antigen binding protein of claim 1, comprising: a
CDRH1 selected from the group consisting of SEQ ID NO: 91, 106,
109, 112, and 115; a CDRH2 selected from the group consisting of
SEQ ID NO: 113, 116, 118, 120, 121, and 122; a CDRH3 selected from
the group consisting of SEQ ID NO: 108, 111, 114, 117, and 119; a
CDRL1 selected from the group consisting of SEQ ID NO: 77, 80, 83,
85, 86, 87, 88, 89 and 90; a CDRL2 is SEQ ID NO: 81; and a CDRL3
selected from the group consisting of SEQ ID NO: 76, 79, 82 and
84.
7. An isolated antigen binding protein that binds IL-23 comprising
at least one heavy chain variable region and at least one light
chain variable region, selected from the group consisting of: a) a
heavy chain variable region comprising amino acid residues 31-35,
50-65 and 99-113 of SEQ ID NO:31; and a light chain variable region
comprising amino acid residues 23-36, 52-58 and 91-101 of SEQ ID
NO:1; b) a heavy chain variable region comprising amino acid
residues 31-35, 50-65 and 99-110 of SEQ ID NO:34 and heavy chain
variable region comprising amino acid residues 31-35, 50-66 and
99-110 of SEQ ID NO:36; and a light chain variable region
comprising amino acid residues 23-36, 52-62 and 97-105 of SEQ ID
NO:4; c) a heavy chain variable region comprising amino acid
residues 31-35, 50-66 and 99-114 of SEQ ID NO:38; and a light chain
variable region comprising amino acid residues 23-34, 50-61 and
94-106 of SEQ ID NO:7; d) a heavy chain variable region comprising
amino acid residues 31-35, 50-66 and 99-114 of SEQ ID NO:40; and a
light chain variable region comprising amino acid residues 24-34,
50-56 and 94-106 of SEQ ID NO:9; e) a heavy chain variable region
comprising amino acid residues 31-35, 50-66 and 99-114 of SEQ ID
NO:42; and a light chain variable region comprising amino acid
residues 23-34, 50-61 and 94-106 of SEQ ID NO:11; f) a heavy chain
variable region comprising amino acid residues 31-35, 50-65 and
98-107 of SEQ ID NO:44; and a light chain variable region
comprising amino acid residues 24-34, 50-56 and 89-97 of SEQ ID
NO:13; g) a heavy chain variable region comprising amino acid
residues 31-37, 52-67 and 100-109 of SEQ ID NO:46 or 153; and a
light chain variable region comprising amino acid residues 24-34,
50-56 and 89-97 of SEQ ID NO15; h) a heavy chain variable region
comprising amino acid residues 31-37, 52-67 and 100-109 of SEQ ID
NO:48; and a light chain variable region comprising amino acid
residues 24-34, 50-56 and 89-97 of SEQ ID NO:17; i) a heavy chain
variable region comprising amino acid residues 31-37, 52-67 and
101-109 of SEQ ID NO:50; and a light chain variable region
comprising amino acid residues 24-34, 50-56 and 89-97 of SEQ ID
NO:19; j) a heavy chain variable region comprising amino acid
residues 31-35, 50-65 and 98-107 of SEQ ID NO: 52; and a light
chain variable region comprising amino acid residues 24-34, 50-56
and 98-107 of SEQ ID NO:21; k) a heavy chain variable region
comprising amino acid residues 31-37, 52-67 and 100-109 of SEQ ID
NO:54; and a light chain variable region comprising amino acid
residues 24-34, 50-56 and 89-97 of SEQ ID NO:23; l) a heavy chain
variable region comprising amino acid residues 31-37, 52-67 and
100-109 of SEQ ID NO:56; and a light chain variable region
comprising amino acid residues 24-34, 50-56 and 89-97 of SEQ ID
NO:25; and m) a heavy chain variable region comprising amino acid
residues 31-37, 52-57 and 100-109 of SEQ ID NO:58; and a light
chain variable region comprising amino acid residues 24-34, 500-56
and 89-97 of SEQ ID NO:27.
8. An isolated antigen-binding protein of claim 1 that comprises at
least one heavy chain variable region and at least one light chain
variable region.
9. An isolated antigen-binding protein of claim 1 that comprises at
least two heavy chain variable regions and at least two light chain
variable regions.
10. An isolated antigen binding protein that binds IL-23 comprising
a heavy chain variable region and a light chain variable region,
wherein the heavy chain variable region sequence differs by no more
than 13 amino acid substitutions, additions and/or deletions from a
heavy chain variable region sequence as shown in TABLE 2; and
wherein the light chain variable region sequence differs by no more
than 13 amino acid substitutions, additions and/or deletions from a
light chain variable region sequence as shown in TABLE 1.
11. An isolated antigen binding protein of claim 10, wherein the
heavy chain variable region sequence differs by no more than 11
amino acid substitutions, insertions and/or deletions from a heavy
chain variable region sequence as shown in TABLE 2.
12. An isolated antigen binding protein of claim 10, wherein the
heavy chain variable region sequence differs by no more than 5
amino acid substitutions, insertions and/or deletions from a heavy
chain variable region sequence as shown in TABLE 2.
13. An isolated antigen binding protein of claim 10, wherein the
heavy chain variable region sequence differs by no more than 2
amino acid substitutions, insertions and/or deletions from a heavy
chain variable region sequence as shown in TABLE 2.
14. An isolated antigen binding protein of claim 10, wherein the
heavy chain variable region sequence differs by no more than 1
amino acid substitution, insertion or deletion from a heavy chain
variable region sequence as shown in TABLE 2.
15. An isolated antigen binding protein of claim 10, wherein the
light chain variable region sequence differs by no more than 7
amino acid substitutions, insertions and/or deletions from a light
chain variable region sequence as shown in TABLE 1.
16. An isolated antigen binding protein of claim 10, wherein the
light chain variable region sequence differs by no more than 4
amino acid substitutions, insertions and/or deletions from a light
chain variable region sequence as shown in TABLE 1.
17. An isolated antigen binding protein of claim 10, wherein the
light chain variable region sequence differs by no more than 2
amino acid substitutions, insertions and/or deletions from a light
chain variable region sequence as shown in TABLE 1.
18. An isolated antigen binding protein of claim 10, wherein the
light chain variable region sequence differs by no more than 1
amino acid substitutions, insertions and/or deletions from a light
chain variable region sequence as shown in TABLE 1.
19. An isolated antigen binding protein that binds IL-23 selected
from the group consisting of a) a heavy chain variable region of
SEQ ID NO:140 and a light chain variable region of SEQ ID NO: 30;
b) a heavy chain variable region of SEQ ID NO:141 and a light chain
variable region of SEQ ID NO:61; c) a heavy chain variable region
of SEQ ID NO:142 and a light chain variable region of SEQ ID NO:4;
and d) a heavy chain variable region of SEQ ID NO:143 and a light
chain variable region of SEQ ID NO:139.
20. An isolated antigen binding protein that binds IL-23 comprising
a heavy chain variable region comprising of an amino acid sequence
having at least 90% sequence identity to SEQ ID NO:31, 34, 36, 38,
40, 42, 44, 46, 48, 50, 52, 54, 56 and 58; and a light chain
variable region comprising an amino acid sequence having at least
90% sequence identity to SEQ ID NO: 1, 4, 7, 9, 11, 13, 15, 17, 19,
21, 23, 25 and 27.
21. An isolated antigen binding protein of claim 20, a heavy chain
variable region comprising of an amino acid sequence having at
least 95% sequence identity to SEQ ID NO:31, 34, 36, 38, 40, 42,
44, 46, 48, 50, 52, 54, 56 and 58; and a light chain variable
region comprising an amino acid sequence having at least 95%
sequence identity to SEQ ID NO: 1, 4, 7, 9, 11, 13, 15, 17, 19, 21,
23, 25 and 27.
22. An isolated antigen binding protein of claim 20, comprising a
heavy chain variable region comprising of an amino acid sequence
having at least 97% sequence identity to SEQ ID NO:31, 34, 36, 38,
40, 42, 44, 46, 48, 50, 52, 54, 56 and 58; and a light chain
variable region comprising an amino acid sequence having at least
97% sequence identity to SEQ ID NO: 1, 4, 7, 9, 11, 13, 15, 17, 19,
21, 23, 25 and 27.
23. An isolated antigen binding protein of claim 20, comprising a
heavy chain variable region comprising of an amino acid sequence
having at least 98% sequence identity to SEQ ID NO:31, 34, 36, 38,
40, 42, 44, 46, 48, 50, 52, 54, 56 and 58; and a light chain
variable region comprising an amino acid sequence having at least
98% sequence identity to SEQ ID NO: 1, 4, 7, 9, 11, 13, 15, 17, 19,
21, 23, 25 and 27.
24. An isolated antigen binding protein of claim 20, comprising a
heavy chain variable region selected from the group consisting of
SEQ ID NO: 44, 46, 48, 50, 52, 54, 56, 58 and 153, and a light
chain variable region selected from the group consisting of SEQ ID
NO:13, 15, 17, 19, 21, 23, 25, and 27.
25. An isolated antigen binding protein of claim 20, comprising a
heavy chain variable region selected from the group consisting of
SEQ ID NO: 31, 34, 36, 38, 40 and 42, and a light chain variable
region selected from the group consisting of SEQ ID NO: 1, 4, 7, 9
and 11.
26. An isolated antigen binding protein that binds IL-23 comprising
a heavy chain variable region and a light chain variable region
selected from the group consisting of: a) a heavy chain variable
region of SEQ ID NO:31 and a light chain variable region of SEQ ID
NO:1; b) a heavy chain variable region of SEQ ID NO:34 or 36 and a
light chain variable region of SEQ ID NO:4; c) a heavy chain
variable region of SEQ ID NO:38 and a light chain variable region
of SEQ ID NO: 7; d) a heavy chain variable region of SEQ ID NO:40
and a light chain variable region of SEQ ID NO:9; e) a heavy chain
variable region of SEQ ID NO:42 and a light chain variable region
of SEQ ID NO: 11; f) a heavy chain variable region of SEQ ID NO:44
and a light chain variable region of SEQ ID NO:13; g) a heavy chain
variable region of SEQ ID NO:46 or 153 and a light chain variable
region of SEQ ID NO:15; h) a heavy chain variable region of SEQ ID
NO:48 and a light chain variable region of SEQ ID NO:17; i) a heavy
chain variable region of SEQ ID NO:50 and a light chain variable
region of SEQ ID NO: 19; j) a heavy chain variable region of SEQ ID
NO:52 and a light chain variable region of SEQ ID NO:21; k) a heavy
chain variable region of SEQ ID NO:54 and a light chain variable
region of SEQ ID NO:23; l) a heavy chain variable region of SEQ ID
NO:56 and a light chain variable region of SEQ ID NO:25; and m) a
heavy chain variable region of SEQ ID NO:58 and a light chain
variable region of SEQ ID NO:27.
27. An isolated antigen binding protein that binds human IL-23,
wherein the covered patch formed when said antigen binding protein
is bound to human IL-23 comprises residue contacts 30, 31, 32, 49,
50, 52, 53, 56, 92 and 94 of SEQ ID NO:15, wherein said residue
contacts have a difference value of greater than or equal to 10
.ANG..sup.2 as determined by solvent exposed surface area.
28. An isolated antigen binding protein that binds human IL-23,
wherein the covered patch formed when said antigen binding protein
is bound to human IL-23 comprises residue contacts 31-35, 54,
58-60, 66, and 101-105 of SEQ ID NO:46, wherein said residue
contacts have a difference value of greater than or equal to 10
.ANG..sup.2 as determined by solvent exposed surface area.
29. An isolated antigen binding protein that binds human IL-23,
wherein the covered patch formed when said antigen binding protein
is bound to human IL-23 comprises residue contacts 31-34, 51, 52,
55, 68, 93 and 98 of SEQ ID NO:1, wherein said residue contacts
have a difference value of greater than or equal to 10 .ANG..sup.2
as determined by solvent exposed surface area.
30. An isolated antigen binding protein that binds human IL-23,
wherein the covered patch formed when said antigen binding protein
is bound to human IL-23 comprises residue contacts 1, 26, 28, 31,
32, 52, 53, 59, 76, 101, 102 and 104-108 of SEQ ID NO:31, wherein
said residue contacts have a difference value of greater than or
equal to 10 .ANG..sup.2 as determined by solvent exposed surface
area.
31. An isolated antigen binding protein that binds human IL-23,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues
32-35, 54, 58-60, 66 and 101-105 of SEQ ID NO:46, as determined by
X-ray crystallography.
32. An isolated antigen binding protein according to claim 31,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues
31-35, 54, 56, 58-60, 66 and 101-105 of SEQ ID NO:46.
33. An isolated antigen binding protein that binds human IL-23,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues
30-32, 49, 52, 53, 91-94 and 96 of SEQ ID NO:1 5, as determined by
X-ray crystallography.
34. An isolated antigen binding protein according to claim 33,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues
30-32, 49, 50, 52, 53, 56, 91-94 and 96 of SEQ ID NO:15.
35. An isolated antigen binding protein that binds human IL-23,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues
26-28, 31, 53, 59, 102 and 104-108 of SEQ ID NO:31, as determined
by X-ray crystallography.
36. An isolated antigen binding protein according to claim 35,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues 1,
26-28, 30-32, 52, 53, 59, 100, and 102-108 of SEQ ID NO:31.
37. An isolated antigen binding protein that binds human IL-23,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues
31-34, 51, 52, 55, 68 and 93 of SEQ ID NO:1 as determined by X-ray
crystallography.
38. An isolated antigen binding protein according to claim 37,
wherein when said antigen binding protein is bound to human IL-23,
said antigen binding protein is 5 .ANG. or less from residues 29,
31-34, 51, 52, 55, 68, 93 and 100 of SEQ ID NO:1.
39. An isolated antigen binding protein of claim 1, 4, 7, 10, 19,
20, 26-31, 33, 35 or 37, wherein said antigen binding protein is an
antibody.
40. An isolated antigen binding protein of claim 39, wherein said
antibody is a monoclonal antibody, a recombinant antibody, a human
antibody, a humanized antibody, a chimeric antibody, a
multispecific antibody, or an antibody fragment thereof.
41. An isolated antigen binding protein of claim 40, wherein said
antibody fragment is a Fab fragment, a Fab' fragment, a
F(ab').sub.2 fragment, a Fv fragment, a diabody, or a single chain
antibody molecule.
42. An isolated antigen binding protein of claim 40, wherein said
antigen binding protein is a human antibody.
43. An isolated antigen binding protein of claim 40, wherein said
antigen binding protein is a monoclonal antibody.
44. An isolated antigen binding protein of claim 39, wherein said
antigen binding protein is of the IgG1-, IgG2- IgG3- or
IgG4-type.
45. An isolated antigen binding protein of claim 44, wherein said
antigen binding protein is of the IgG1- or IgG2-type.
46. An isolated nucleic acid molecule encoding an antigen binding
protein of claim 1, 4, 7, 10, 19, 20 or 26.
47. An isolated nucleic acid molecule of claim 46, wherein at least
one heavy chain variable region is encoded by an isolated nucleic
acid molecule selected from the group consisting of SEQ ID NOs:32,
35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59 and 152 and at
least one light chain variable region is encoded by an isolated
nucleic acid molecule selected from the group consisting of SEQ ID
NOs:2, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, and 28.
48. A nucleic acid molecule according to claim 47, wherein said
nucleic acid molecule is operably linked to a control sequence.
49. A vector comprising a nucleic acid molecule according to claim
46.
50. A host cell comprising the nucleic acid molecule according to
claim 46.
51. A host cell comprising the vector according to claim 49.
52. An isolated polynucleotide sufficient for use as a
hybridization probe, PCR primer or sequencing primer that is a
fragment of the nucleic acid molecule of claim 47 or its
complement.
53. A method of making the antigen binding protein of claim 1, 4,
7, 10, 19, 20 or 26 comprising the step of preparing said antigen
binding protein from a host cell that secretes said antigen binding
protein.
54. An isolated antigen binding protein that binds human IL-23,
wherein the covered patch formed when said antigen binding protein
is bound to human IL-23 comprises a residue contact within residues
46-58, a residue contact within residues 112-120, and a residue
contact within residues 155-163 of the human IL-23p19 subunit as
described in SEQ ID NO:145, wherein said residue contact has a
difference value greater than or equal to 10 .ANG..sup.2 as
determined by solvent exposed surface area.
55. An isolated antigen binding protein according to claim 54,
wherein the covered patch formed when said antigen binding protein
binds to human IL-23 further comprises a residue contact within
residues 121-125 of the human IL-23p40 subunit as described in SEQ
ID NO:147, wherein said residue contact has a difference value
greater than or equal to 10 .ANG..sup.2 as determined by solvent
exposed surface area.
56. An isolated antigen binding protein that binds human IL-23,
wherein when said antigen binding protein is bound to human IL-23
said antigen binding protein is 5 .ANG. or less from a residue
within residues 46-58, from a residue within residues 112-123, and
from a residue within residues 155-163 of the human IL-23p19
subunit as described in SEQ ID NO:145, as determined by X-ray
crystallography.
57. An isolated antigen binding protein according to claim 56,
wherein when said antigen binding protein is bound to human IL-23
said antigen binding protein is 5 .ANG. or less from a residue
within residues 121-125, of the human IL-23p40 subunit as described
in SEQ ID NO:147, as determined by X-ray crystallography.
58. An isolated antigen binding protein of claim 1, 4, 7, 10, 19,
20, 26-31, 33, 35, 37, 54 or 56 wherein said antigen binding
protein has at least one property selected from the group
consisting of: a) reducing human IL-23 activity; b) reducing
production of a proinflammatory cytokine; c) binding to human IL-23
with a K.sub.D of .ltoreq.5.times.10.sup.-8 M; d) having a
K.sub.off rate of .ltoreq.5.times.10.sup.-6 1/s; and e) having an
IC.sub.50 of .ltoreq.400 pM.
59. A pharmaceutical composition comprising at least one antigen
binding protein of claim 1, 4, 7, 10, 19, 20 or 26 and
pharmaceutically acceptable excipient.
60. A pharmaceutical composition of claim 59, further comprises a
labeling group or an effector group.
61. A pharmaceutical composition of claim 60, wherein said labeling
group is selected from the group consisting of isotopic labels,
magnetic labels, redox active moieties, optical dyes, biotinylated
groups and predetermined polypeptide epitopes recognized by a
secondary reporter.
62. A pharmaceutical composition of claim 60, wherein said effector
group is selected from the group consisting of a radioisotope,
radionuclide, a toxin, a therapeutic group and a chemotherapeutic
group.
63. An isolated antigen binding protein of claim 60, wherein said
antigen binding protein is coupled to a labeling group.
64. A method for treating or preventing a condition associated with
IL-23 in a patient, comprising administering to a patient in need
thereof an effective amount of at least one isolated antigen
binding protein of claim 1, 4, 7, 10, 19, 20 or 26.
65. A method of claim 64, wherein the condition is selected from
the group consisting of an inflammatory disorder, a rheumatic
disorder, an autoimmune disorder, an oncological disorder and a
gastrointestinal disorder.
66. A method of claim 65, wherein the condition is selected from
the group consisting of multiple sclerosis, rheumatoid arthritis,
cancer, psoriasis, inflammatory bowel disease, Crohn's disease,
ulcerative colitis, systemic lupus erythematosus, psoriatic
arthritis, autoimmune myocarditis; type 1 diabetes and ankylosing
spondylitis.
67. A method of claim 64, wherein the isolated antigen-binding
protein is administered alone or as a combination therapy.
68. A method of reducing IL-23 activity in a patient comprising
administering an effective amount of at least one antigen binding
protein of claim 1, 4, 7, 10, 19, 20 or 26.
69. A method of reducing IL-23 activity of claim 68, wherein said
IL-23 activity is inducing production of a proinflammatory
cytokine.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U.S.C. 119(e)
of U.S. patent application No. 61/254,982, filed Oct. 26, 2009 and
U.S. patent application No. 61/381,287, filed Sep. 9, 2010, which
are incorporated herein by reference.
BACKGROUND
[0002] Interleukin 23 (IL-23), a heterodimeric cytokine, is a
potent inducer of pro-inflammatory cytokines. IL-23 is related to
the heterodimeric cytokine Interleukin 12 (IL-12) both sharing a
common p40 subunit. In IL-23, a unique p19 subunit is covalently
bound to the p40 subunit. In IL-12, the unique subunit is p35
(Oppmann et al., Immunity, 2000, 13: 713-715). The IL-23
heterodimeric protein is secreted. Like IL-12, IL-23 is expressed
by antigen presenting cells (such as dendritic cells and
macrophages) in response to activation stimuli such as CD40
ligation, Toll-like receptor agonists and pathogens. IL-23 binds a
heterodimeric receptor comprising an IL-12R.beta.1 subunit (which
is shared with the IL-12 receptor) and a unique receptor subunit,
IL-23R. The IL-12 receptor consists of IL-12R.beta.1 and
IL-12R.beta.2. IL-23 binds its heterodimeric receptor and signals
through JAK2 and Tyk2 to activate STAT1, 3, 4 and 5 (Parham et al.,
J. Immunol. 2002, 168:5699-708). The subunits of the receptor are
predominantly co-expressed on activated or memory T cells and
natural killer cells and also at lower levels on dendritic cells,
monocytes, macrophages, microglia, keratinocytes and synovial
fibroblasts. IL-23 and IL-12 act on different T cell subsets and
play substantially different roles in vivo.
[0003] IL-23 acts on activated and memory T cells and promotes
survival and expansion of the T cell subset, Th17. Th17 cells
produce proinflammatory cytokines including IL-6, IL-17,
TNF.alpha., IL-22 and GM-CSF. IL-23 also acts on natural killer
cells, dendritic cells and macrophages to induce pro-inflammatory
cytokine expression. Unlike IL-23, IL-12 induces the
differentiation of naive CD4+ T cells into mature Th1
IFN.gamma.-producing effector cells, and induces NK and cytotoxic T
cell function by stimulating IFN.gamma. production. Th1 cells
driven by IL-12 were previously thought to be the pathogenic T cell
subset in many autoimmune diseases, however, more recent animal
studies in models of inflammatory bowel disease, psoriasis,
inflammatory arthritis and multiple sclerosis, in which the
individual contributions of IL-12 versus IL-23 were evaluated have
firmly established that IL-23, not IL-12, is the key driver in
autoimmune/inflammatory disease (Ahern et al., Immun. Rev. 2008
226:147-159; Cua et al., Nature 2003 421:744-748; Yago et al.,
Arthritis Res and Ther. 2007 9(5): R96). It is believed that IL-12
plays a critical role in the development of protective innate and
adaptive immune responses to many intracellular pathogens and
viruses and in tumor immune surveillance. See Kastelein, et al.,
Annual Review of Immunology, 2007, 25: 221-42; Liu, et al.,
Rheumatology, 2007, 46(8): 1266-73; Bowman et al., Current Opinion
in Infectious Diseases, 2006 19:245-52; Fieschi and Casanova, Eur.
J. Immunol. 2003 33:1461-4; Meeran et al., Mol. Cancer Ther. 2006
5: 825-32; Langowski et al., Nature 2006 442: 461-5. As such, IL-23
specific inhibition (sparing IL-12 or the shared p40 subunit)
should have a potentially superior safety profile compared to dual
inhibition of IL-12 and IL-23.
[0004] Therefore, use of IL-23 specific antagonists that inhibit
human IL-23 (such as antibodies that bind at least the unique p19
subunit or bind both the p19 and p40 subunits of IL-23) that spare
IL-12 should provide efficacy equal to or greater than IL-12
antagonists or p40 antagonists without the potential risks
associated with inhibition of IL-12. Murine, humanized and phage
display antibodies selected for inhibition of recombinant IL-23
have been described; see for example U.S. Pat. No. 7,491,391, WIPO
Publications WO1999/05280, WO2007/0244846, WO2007/027714, WO
2007/076524, WO2007/147019, WO2008/103473, WO 2008/103432,
WO2009/043933 and WO2009/082624. However, there is a need for fully
human therapeutic agents that are able to inhibit native human
IL-23. Such therapeutics are highly specific for the target,
particularly in vivo. Complete inhibition of the in vivo target can
result in lower dose formulations, less frequent and/or more
effective dosing which in turn results in reduced cost and
increased efficiency. The present invention provides such IL-23
antagonists.
SUMMARY
[0005] Antigen binding proteins that bind IL-23, particularly
native human IL-23, are provided. The human IL-23 antigen binding
proteins can reduce, inhibit, interfere with, and/or modulate at
least one of the biological responses related to IL-23, and as
such, are useful for ameliorating the effects of IL-23 related
diseases or disorders. IL-23 antigen binding proteins can be used,
for example, to reduce, inhibit, interfere with and/or modulate
IL-23 signaling, IL-23 activation of Th17 cells, IL-23 activation
of NK cells, or inducing production of proinflammatory
cytokines.
[0006] Also provided are expression systems, including cell lines,
for the production of IL-23 antigen binding proteins and methods of
diagnosing and treating diseases related to human IL-23.
[0007] Some of the antigen binding proteins that bind IL-23 that
are provided comprise at least one heavy chain variable region
comprising a CDRH1, a CDRH2 and a CDRH3 selected from the group
consisting of: a CDRH1 that differs by no more than one amino acid
substitution, insertion or deletion from a CDRH1 as shown in TABLE
3; a CDRH2 that differs by no more than three, two or one amino
acid substitutions, insertions and/or deletions from a CDRH2 as
shown in TABLE 3; a CDRH3 that differs by no more than three, two
or one amino acid substitutions, insertions and/or deletions from a
CDRH3 as shown in TABLE 3; and comprising at least one light chain
variable region comprising a CDRL1, a CDRL2 and a CDRL3 selected
from the group consisting of: a CDRL1 that differs by no more than
three, two or one amino acid substitutions, insertions and/or
deletions from a CDRL1 as shown in TABLE 3; a CDRL2 that differs by
no more than one amino acid substitution, insertion or deletion
from a CDRL2 as shown in TABLE 3; a CDRL3 that differs by no more
than one amino acid substitution, insertion or deletion from a
CDRL3 as shown in TABLE 3. In one embodiment is provided isolated
antigen binding proteins comprising: a CDRH1 selected from the
group consisting of SEQ ID NO: 91, 94, 97, 100, and 103; a CDRH2
selected from the group consisting of SEQ ID NO:92, 95, 98, 101,
104, 107, and 110; a CDRH3 selected from the group consisting of
SEQ ID NO: 93, 96, 99, 102, and 105; a CDRL1 selected from the
group consisting of SEQ ID NO: 62, 65, 68, 71, and 74; a CDRL2
selected from the group consisting of SEQ ID NO:63, 66, 69, 72, 75,
and 78; and a CDRL3 selected from the group consisting of SEQ ID
NO:64, 67, 70 and 73. In another embodiment is provided isolated
antigen bindings protein of comprising: a CDRH1 selected from the
group consisting of SEQ ID NO: 91, 106, 109, 112, and 115; a CDRH2
selected from the group consisting of SEQ ID NO: 113, 116, 118,
120, 121, and 122; a CDRH3 selected from the group consisting of
SEQ ID NO: 108, 111, 114, 117, and 119; a CDRL1 selected from the
group consisting of SEQ ID NO: 77, 80, 83, 85, 86, 87, 88, 89 and
90; a CDRL2 is SEQ ID NO: 81; and a CDRL3 selected from the group
consisting of SEQ ID NO: 76, 79, 82 and 84. In another embodiment
is provided an isolated antigen-binding protein of that comprises
at least one heavy chain variable region and at least one light
chain variable region. In yet another embodiment is provided an
isolated antigen-binding protein as described above that comprise
at least two heavy chain variable regions and at least two light
chain variable regions. In yet another embodiment is provided an
isolated antigen binding protein wherein the antigen binding
protein is coupled to a labeling group.
[0008] Also provided are isolated antigen binding proteins that
bind IL-23 selected from the group consisting of a) an antigen
binding protein having CDRH1 of SEQ ID NO:129, CDRH2 of SEQ ID
NO:132, CDRH3 of SEQ ID NO:136, and CDRL1 of SEQ ID NO:123, CDRL2
of SEQ ID NO:81, and CDRL3 of SEQ ID NO: 76; b) an antigen binding
protein having CDRH1 of SEQ ID NO:131, CDRH2 of SEQ ID NO: 134,
CDRH3 of SEQ ID NO:137 and CDRL1 of SEQ ID NO:124, CDRL2 of SEQ ID
NO126 and CDRL3 of SEQ ID NO:128; c) a) an antigen binding protein
having CDRH1 of SEQ ID NO:130, CDRH2 of SEQ ID NO:133, CDRH3 of SEQ
ID NO:99 and CDRL1 of SEQ ID NO:68, CDRL2 of SEQ ID NO:69, and
CDRL3 of SEQ ID NO:67; and d) an antigen binding protein having
CDRH1 SEQ ID NO:91, CDRH2 SEQ ID NO: 135, CDRH3 SEQ ID NO:138 and
CDRL1 SEQ ID NO:125, CDRL2 SEQ ID NO:127, and CDRL3 SEQ ID
NO:64.
[0009] Also provided are isolated antigen binding proteins that
bind IL-23 comprising at least one heavy chain variable region and
at least one light chain variable region, selected from the group
consisting of: a heavy chain variable region comprising amino acid
residues 31-35, 50-65 and 99-113 of SEQ ID NO:31; and a light chain
variable region comprising amino acid residues 23-36, 52-58 and
91-101 of SEQ ID NO:1; a heavy chain variable region comprising
amino acid residues 31-35, 50-65 and 99-110 of SEQ ID NO:34 and
heavy chain variable region comprising amino acid residues 31-35,
50-66 and 99-110 of SEQ ID NO:36; and a light chain variable region
comprising amino acid residues 23-36, 52-62 and 97-105 of SEQ ID
NO:4; a heavy chain variable region comprising amino acid residues
31-35, 50-66 and 99-114 of SEQ ID NO:38; and a light chain variable
region comprising amino acid residues 23-34, 50-61 and 94-106 of
SEQ ID NO:7; a heavy chain variable region comprising amino acid
residues 31-35, 50-66 and 99-114 of SEQ ID NO:40; and a light chain
variable region comprising amino acid residues 24-34, 50-56 and
94-106 of SEQ ID NO:9; a heavy chain variable region comprising
amino acid residues 31-35, 50-66 and 99-114 of SEQ ID NO:42; and a
light chain variable region comprising amino acid residues 23-34,
50-61 and 94-106 of SEQ ID NO:11; a heavy chain variable region
comprising amino acid residues 31-35, 50-65 and 98-107 of SEQ ID
NO:44; and a light chain variable region comprising amino acid
residues 24-34, 50-56 and 89-97 of SEQ ID NO:13; a heavy chain
variable region comprising amino acid residues 31-37, 52-67 and
100-109 of SEQ ID NO:46 or SEQ ID NO:153; and a light chain
variable region comprising amino acid residues 24-34, 50-56 and
89-97 of SEQ ID NO15; a heavy chain variable region comprising
amino acid residues 31-37, 52-67 and 100-109 of SEQ ID NO:48; and a
light chain variable region comprising amino acid residues 24-34,
50-56 and 89-97 of SEQ ID NO:17; a heavy chain variable region
comprising amino acid residues 31-37, 52-67 and 101-109 of SEQ ID
NO:50; and a light chain variable region comprising amino acid
residues 24-34, 50-56 and 89-97 of SEQ ID NO:19; a heavy chain
variable region comprising amino acid residues 31-35, 50-65 and
98-107 of SEQ ID NO: 52; and a light chain variable region
comprising amino acid residues 24-34, 50-56 and 98-107 of SEQ ID
NO:21; a heavy chain variable region comprising amino acid residues
31-37, 52-67 and 100-109 of SEQ ID NO:54; and a light chain
variable region comprising amino acid residues 24-34, 50-56 and
89-97 of SEQ ID NO:23; a heavy chain variable region comprising
amino acid residues 31-37, 52-67 and 100-109 of SEQ ID NO:56; and a
light chain variable region comprising amino acid residues 24-34,
50-56 and 89-97 of SEQ ID NO:25; and a heavy chain variable region
comprising amino acid residues 31-37, 52-57 and 100-109 of SEQ ID
NO:58; and a light chain variable region comprising amino acid
residues 24-34, 500-56 and 89-97 of SEQ ID NO:27.
[0010] Provided herein is an isolated antigen binding protein that
binds IL-23 comprising a heavy chain variable region and a light
chain variable region, wherein the heavy chain variable region
sequence differs by no more than 13, 12, 11, 10, 9, 8, 7, 6, 5, 4,
3, 2 or 1 amino acid substitutions, additions and/or deletions from
a heavy chain variable region sequence as shown in TABLE 2; and
wherein the light chain variable region sequence differs by no more
than 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid
substitutions, additions and/or deletions from a light chain
variable region sequence as shown in TABLE 1.
[0011] Also provided is an isolated antigen binding protein that
binds IL-23 selected from the group consisting of a) a heavy chain
variable region of SEQ ID NO:140 and a light chain variable region
of SEQ ID NO: 30; b) a heavy chain variable region of SEQ ID NO:141
and a light chain variable region of SEQ ID NO:61; c) a heavy chain
variable region of SEQ ID NO:142 and a light chain variable region
of SEQ ID NO:4; and d) a heavy chain variable region of SEQ ID
NO:143 and a light chain variable region of SEQ ID NO:139.
[0012] Also provided is an isolated antigen binding protein
comprising a heavy chain variable region comprising of an amino
acid sequence having at least 90%, 95%, 96%, 97%, 98% or 99%
sequence identity to SEQ ID NO:31, 34, 36, 38, 40, 42, 44, 46, 48,
50, 52, 54, 56 and 58; and a light chain variable region comprising
an amino acid sequence having at least 90% sequence identity to SEQ
ID NO: 1, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25 and 27. In
another embodiment is an isolated antigen binding protein
comprising a heavy chain variable region selected from the group
consisting of SEQ ID NO: 44, 46, 48, 50, 52, 54, 56, 58 and 153,
and a light chain variable region selected from the group
consisting of SEQ ID NO:13, 15, 17, 19, 21, 23, 25, and 27. In yet
another embodiment is an isolated antigen binding protein
comprising a heavy chain variable region selected from the group
consisting of SEQ ID NO: 31, 34, 36, 38, 40 and 42, and a light
chain variable region selected from the group consisting of SEQ ID
NO: 1, 4, 7, 9 and 11.
[0013] Also provided is an isolated antigen binding protein that
binds IL-23 comprising a heavy chain variable region and a light
chain variable region selected from the group consisting of: a) a
heavy chain variable region of SEQ ID NO:31 and a light chain
variable region of SEQ ID NO:1; b) a heavy chain variable region of
SEQ ID NO:34 or 36 and a light chain variable region of SEQ ID
NO:4; c) a heavy chain variable region of SEQ ID NO:38 and a light
chain variable region of SEQ ID NO: 7; d) a heavy chain variable
region of SEQ ID NO:40 and a light chain variable region of SEQ ID
NO:9; e) a heavy chain variable region of SEQ ID NO:42 and a light
chain variable region of SEQ ID NO: 11; f) a heavy chain variable
region of SEQ ID NO:44 and a light chain variable region of SEQ ID
NO:13; g) a heavy chain variable region of SEQ ID NO:46 or SEQ ID
NO:153 and a light chain variable region of SEQ ID NO:15; h) a
heavy chain variable region of SEQ ID NO:48 and a light chain
variable region of SEQ ID NO:17; i) a heavy chain variable region
of SEQ ID NO:50 and a light chain variable region of SEQ ID NO: 19;
j) a heavy chain variable region of SEQ ID NO:52 and a light chain
variable region of SEQ ID NO:21; k) a heavy chain variable region
of SEQ ID NO:54 and a light chain variable region of SEQ ID NO:23;
I) a heavy chain variable region of SEQ ID NO:56 and a light chain
variable region of SEQ ID NO:25; and m) a heavy chain variable
region of SEQ ID NO:58 and a light chain variable region of SEQ ID
NO:27.
[0014] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein the covered patch formed when the
antigen binding protein is bound to human IL-23 comprises residue
contacts 30, 31, 32, 49, 50, 52, 53, 56, 92 and 94 of SEQ ID NO:15,
wherein the residue contacts have a difference value of greater
than or equal to 10 .ANG..sup.2 as determined by solvent exposed
surface area. Within one embodiment the residue contacts comprise
residues 31-35, 54, 58-60, 66, and 101-105 of SEQ ID NO:46.
[0015] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein the covered patch formed when the
antigen binding protein is bound to human IL-23 comprises residue
contacts 31-34, 51, 52, 55, 68, 93 and 98 of SEQ ID NO:1, wherein
the residue contacts have a difference value of greater than or
equal to 10 .ANG..sup.2 as determined by solvent exposed surface
area. Within one embodiment the residue contacts comprise residues
1, 26, 28, 31, 32, 52, 53, 59, 76, 101, 102 and 104-108 of SEQ ID
NO:31.
[0016] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein when the antigen binding protein is
bound to human IL-23, the antigen binding protein is 5 .ANG. or
less from residues 32-35, 54, 58-60, 66 and 101-105 of SEQ ID
NO:46, as determined by X-ray crystallography. In one embodiment
the antigen binding protein is 5 .ANG. or less from residues 31-35,
54, 56, 58-60, 66 and 101-105 of SEQ ID NO:46.
[0017] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein when the antigen binding protein is
bound to human IL-23, the antigen binding protein is 5 .ANG. or
less from residues 30-32, 49, 52, 53, 91-94 and 96 of SEQ ID NO:15,
as determined by X-ray crystallography. In one embodiment the
antigen binding protein is 5 .ANG. or less from residues 30-32, 49,
50, 52, 53, 56, 91-94 and 96 of SEQ ID NO:15.
[0018] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein when the antigen binding protein is
bound to human IL-23, the antigen binding protein is 5 .ANG. or
less from residues 26-28, 31, 53, 59, 102 and 104-108 of SEQ ID
NO:31, as determined by X-ray crystallography. In one embodiment
the antigen binding protein is 5 .ANG. or less from residues 1,
26-28, 30-32, 52, 53, 59, 100, and 102-108 of SEQ ID NO:31.
[0019] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein when said antigen binding protein is
bound to human IL-23, said antigen binding protein is 5 .ANG. or
less from residues 31-34, 51, 52, 55, 68 and 93 of SEQ ID NO:1 as
determined by X-ray crystallography. In one embodiment the antigen
binding protein is 5 .ANG. or less from residues 29, 31-34, 51, 52,
55, 68, 93 and 100 of SEQ ID NO:1.
[0020] Also provided is an isolated antigen binding protein as
described above, wherein the antigen binding protein is an
antibody. In one embodiment is provided an isolated antigen binding
protein wherein the antibody is a monoclonal antibody, a
recombinant antibody, a human antibody, a humanized antibody, a
chimeric antibody, a multispecific antibody, or an antibody
fragment thereof. In another embodiment is provided an isolated
antigen binding protein wherein the antibody fragment is a Fab
fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a
diabody, or a single chain antibody molecule. In yet another
embodiment is provided an isolated antigen binding protein wherein
the antigen binding protein is a human antibody. In still another
embodiment is provided an isolated antigen binding protein wherein
the antigen binding protein is a monoclonal antibody. In another
embodiment is provided an isolated antigen binding protein wherein
the antigen binding protein is of the IgG1-, IgG2- IgG3- or
IgG4-type. In yet another embodiment is provided an isolated
antigen binding protein wherein the antigen binding protein is of
the IgG1- or IgG2-type.
[0021] An isolated nucleic acid molecule encoding an antigen
binding protein as described above, is also provided. In one
embodiment is provided an isolated nucleic acid molecule wherein at
least one heavy chain variable region is encoded by an isolated
nucleic acid molecule selected from the group consisting of SEQ ID
NOs:32, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59 and 152
and at least one light chain variable region is encoded by an
isolated nucleic acid molecule selected from the group consisting
of SEQ ID NOs:2, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, and
28. In another embodiment is provided a nucleic acid molecule
wherein the nucleic acid molecule is operably linked to a control
sequence. In another embodiment is provided a vector comprising a
nucleic acid molecule as described above. In yet another embodiment
is provided a host cell comprising the nucleic acid molecule as
described above. In another embodiment is provided a host cell
comprising the vector described above. In yet another embodiment is
provided an isolated polynucleotide sufficient for use as a
hybridization probe, PCR primer or sequencing primer that is a
fragment of the nucleic acid molecule as described above or its
complement.
[0022] Also provided is a method of making the antigen binding
protein as described above, comprising the step of preparing said
antigen binding protein from a host cell that secretes said antigen
binding protein.
[0023] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein the covered patch formed when the
antigen binding protein is bound to human IL-23 comprises a residue
contact within residues 46-58, a residue contact within residues
112-120, and a residue contact within residues 155-163 of the human
IL-23p19 subunit as described in SEQ ID NO:145, wherein the residue
contact has a difference value greater than or equal to 10
.ANG..sup.2 as determined by solvent exposed surface area. In one
embodiment is provided wherein the covered patch formed when the
antigen binding protein is bound to human IL-23 comprises one, two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve or
thirteen residue contacts within residues 46-58, one, two, three,
four, five, six, seven, eight, nine or ten residue contacts within
residues 112-120, and one, two, three, four, five, six, seven,
eight or nine residue contacts within residues 155-163 of the human
IL-23p19 subunit as described in SEQ ID NO:145. In another
embodiment is provided wherein the covered patch formed when the
antigen binding protein binds to human IL-23 comprises a residue
contact within residues 121-125 of the human IL-23p40 subunit as
described in SEQ ID NO:147. In a related embodiment is wherein the
covered patch formed when the antigen binding protein is bound to
human IL-23 comprises one, two, three, four or five residue
contacts within residues 121-125 of the human IL-23p40 subunit as
described in SEQ ID NO:147. Within another embodiment is provided
wherein the covered patch formed when the antigen binding protein
is bound to human IL-23 comprises residue contacts 46, 47, 49, 50,
53, 112-116, 118, 120, 155, 156, 159, 160, and 163 of SEQ ID
NO:145. In another embodiment is provided wherein the covered patch
formed when the antigen binding protein is bound to human IL-23
comprises residue contacts 46, 47, 49, 50, 53, 112-118, 120, 155,
156, 159, 160, and 163 of SEQ ID NO:145. Within another embodiment
is provided wherein the covered patch formed when the antigen
binding protein is bound to human IL-23 comprises residues 46, 47,
49, 50, 53-55, 57, 58, 112-116, 118-120, 155, 156, 159, 160, 162
and 163 of SEQ ID NO:145. In a related embodiment is provided
wherein the covered patch formed when the antigen binding protein
is bound to human IL-23 comprises residue contact 122 of the human
IL-23p40 subunit as described in SEQ ID NO:147. In another related
embodiment is provided wherein the covered patch formed when the
antigen binding protein is bound to human IL-23 comprises residue
contacts 122 and 124 of the human IL-23p40 subunit as described in
SEQ ID NO:147. In yet another related embodiment is provided
wherein the covered patch formed when the antigen binding protein
is bound to human IL-23 comprises residue contact 121-123 and 125
of the human IL-23p40 subunit as described in SEQ ID NO:147. In a
further related embodiment is provided wherein the covered patch
formed when the antigen binding protein is bound to human IL-23
comprises residue contact 121-123, 125 and 283 of the human
IL-23p40 subunit as described in SEQ ID NO:147.
[0024] Also provided is an isolated antigen binding protein that
binds human IL-23, wherein when said antigen binding protein is
bound to human IL-23 said antigen binding protein is 5 .ANG. or
less from a residue within residues 46-58, from a residue within
residues 112-123, and from a residue within residues 155-163 of the
human IL-23p19 subunit as described in SEQ ID NO:145, as determined
by X-ray crystallography. In one embodiment, when the antigen
binding protein is bound to human IL-23, the antigen binding
protein is 5 .ANG. or less from one, two, three, four, five, six,
seven, eight, nine, ten, eleven, twelve or thirteen residues within
residues 46-58, from one, two, three, four, five, six, seven,
eight, nine or ten, residues within residues 112-123, and from one,
two, three, four, five, six, seven, eight or nine residues within
residues 155-163 of the human IL-23p19 subunit as described in SEQ
ID NO:145. Within another embodiment when the antigen binding
protein is bound to human IL-23 the antigen binding protein is 5
.ANG. or less from residues 46-50, 113-116, 120, 156, 159, 160 and
163 of SEQ ID NO:145. Within another embodiment when the antigen
binding protein is bound to human IL-23, the antigen binding
protein is 5 .ANG. or less from residues 46-50, 112-120, 156, 159,
160 and 163 of SEQ ID NO:145. Within a related embodiment when the
antigen binding protein is bound to human IL-23, the antigen
binding protein is 5 .ANG. or less from residues 46-50, 53,
112-120, 156, 159, 160 and 163 of SEQ ID NO:145. Within another
embodiment when the antigen binding protein is bound to human
IL-23, the antigen binding protein is 5 .ANG. or less from residues
46-50, 53-55, 58, 113-116, 120, 121, 156, 159, 160, 162 and 163 of
SEQ ID NO:145. Within a related embodiment when the antigen binding
protein is bound to human IL-23, the antigen binding protein is 5
.ANG. or less from residues 46-51, 53-55, 57, 58, 112-116, 118-121,
123, 155, 156, 159, 160, 162 and 163 of SEQ ID NO:145. Within a
further embodiment when the antigen binding protein is bound to
human IL-23 the antigen binding protein is 5 .ANG. or less from a
residue within residues 121-125, of the human IL-23p40 subunit as
described in SEQ ID NO:147, as determined by X-ray crystallography.
With a related embodiment when the antigen binding protein is bound
to human IL-23, said antigen binding protein is 5 .ANG. or less
from residues 122 and 124 of SEQ ID NO:147. Within another
embodiment when the antigen binding protein is bound to human
IL-23, the antigen binding protein is 5 .ANG. or less from residues
121-123 and 125 of SEQ ID NO:147.
[0025] Also provided is an isolated antigen binding protein as
described above, wherein the antigen binding protein has at least
one property selected from the group consisting of: a) reducing
human IL-23 activity; b) reducing production of a proinflammatory
cytokine; c) binding to human IL-23 with a KD of
.ltoreq.5.times.10-8 M; d) having a Koff rate of
.ltoreq.5.times.10-6 l/s; and d) having an IC50 of .ltoreq.400
pM.
[0026] A pharmaceutical composition comprising at least one antigen
binding protein as described above and pharmaceutically acceptable
excipient is provided. In one embodiment is provided a
pharmaceutical composition further comprises a labeling group or an
effector group. In yet another embodiment is provided a
pharmaceutical composition wherein the labeling group is selected
from the group consisting of isotopic labels, magnetic labels,
redox active moieties, optical dyes, biotinylated groups and
predetermined polypeptide epitopes recognized by a secondary
reporter. In yet another embodiment is provided a pharmaceutical
composition wherein the effector group is selected from the group
consisting of a radioisotope, radionuclide, a toxin, a therapeutic
group and a chemotherapeutic group.
[0027] Also provided is a method for treating or preventing a
condition associated with IL-23 in a patient, comprising
administering to a patient in need thereof an effective amount of
at least one isolated antigen binding protein as described above.
In one embodiment is provided a method of wherein the condition is
selected from the group consisting of an inflammatory disorder, a
rheumatic disorder, an autoimmune disorder, an oncological disorder
and a gastrointestinal disorder. In yet another embodiment is
provided a method wherein the condition is selected from the group
consisting of multiple sclerosis, rheumatoid arthritis, cancer,
psoriasis, inflammatory bowel disease, Crohn's disease, ulcerative
colitis, systemic lupus erythematosus, psoriatic arthritis,
autoimmune myocarditis; type 1 diabetes and ankylosing spondylitis.
In still another embodiment is provided a method wherein the
isolated antigen-binding protein is administered alone or as a
combination therapy.
[0028] Also provided is a method of reducing IL-23 activity in a
patient comprising administering an effective amount of at least
one antigen binding protein as described above. In one embodiment
is provided a method of reducing IL-23 activity, wherein said IL-23
activity is inducing production of a proinflammatory cytokine.
BRIEF DESCRIPTION OF THE DRAWINGS
[0029] FIG. 1A: Results of STAT-luciferase reporter assay using
recombinant human IL-23. All antibodies completely inhibited
recombinant human IL-23
[0030] FIG. 1B: Results from STAT-luciferase reporter assay using
native human IL-23. Only half of those antibodies that completely
inhibited recombinant human IL-23 were able to completely inhibit
native human IL-23
DETAILED DESCRIPTION
[0031] The present invention provides compositions, kits, and
methods relating to IL-23 antigen binding proteins, including
molecules that antagonize IL-23, such as anti-IL-23 antibodies,
antibody fragments, and antibody derivatives, e.g., antagonistic
anti-IL-23 antibodies, antibody fragments, or antibody derivatives.
Also provided are polynucleotides, and derivatives and fragments
thereof, comprising a sequence of nucleic acids that encodes all or
a portion of a polypeptide that binds to IL-23, e.g., a
polynucleotide encoding all or part of an anti-IL-23 antibody,
antibody fragment, or antibody derivative, plasmids and vectors
comprising such nucleic acids, and cells or cell lines comprising
such polynucleotides and/or vectors and plasmids. The provided
methods include, for example, methods of making, identifying, or
isolating IL-23 antigen binding proteins, such as anti-IL-23
antibodies, methods of determining whether a molecule binds to
IL-23, methods of determining whether a molecule antagonizes IL-23,
methods of making compositions, such as pharmaceutical
compositions, comprising an IL-23 antigen binding protein, and
methods for administering an IL-23 antigen binding protein to a
subject, for example, methods for treating a condition mediated by
IL-23, and for antagonizing a biological activity of IL-23, in vivo
or in vitro.
[0032] Unless otherwise defined herein, scientific and technical
terms used in connection with the present invention shall have the
meanings that are commonly understood by those of ordinary skill in
the art. Further, unless otherwise required by context, singular
terms shall include pluralities and plural terms shall include the
singular. Generally, nomenclatures used in connection with, and
techniques of, cell and tissue culture, molecular biology,
immunology, microbiology, genetics and protein and nucleic acid
chemistry and hybridization described herein are those well known
and commonly used in the art. The methods and techniques of the
present invention are generally performed according to conventional
methods well known in the art and as described in various general
and more specific references that are cited and discussed
throughout the present specification unless otherwise indicated.
See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual,
3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor,
N.Y. (2001) and Ausubel et al., Current Protocols in Molecular
Biology, Greene Publishing Associates (1992), and Harlow and Lane
Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, N.Y. (1990). Enzymatic reactions and
purification techniques are performed according to manufacturer's
specifications, as commonly accomplished in the art or as described
herein. The terminology used in connection with, and the laboratory
procedures and techniques of, analytical chemistry, synthetic
organic chemistry, and medicinal and pharmaceutical chemistry
described herein are those well known and commonly used in the art.
Standard techniques can be used for chemical syntheses, chemical
analyses, pharmaceutical preparation, formulation, and delivery,
and treatment of patients.
[0033] All patents and other publications identified are expressly
incorporated herein by reference in their entirety for the purpose
of describing and disclosing, for example, the methodologies
described in such publications that might be used in connection
with information described herein.
[0034] The polynucleotide and protein sequences of the p19 subunit
of human IL-23 (SEQ ID NOs: 144 and 145), the shared p40 subunit
(SEQ ID NOs:146 and 147), the human IL-23 receptor hererodimeric
subunits IL-12R.beta.1 (SEQ ID NOs: 150 and 151) and IL-23R (SEQ ID
NOs: 148 and 149), are known in the art, see for example, GenBank
Accession Nos. AB030000; M65272, NM 005535, NM_144701, as are those
from other mammalian species. Recombinant IL-23 and IL-23 receptor
proteins including single chain and Fc proteins as well as cells
expressing the IL-23 receptor have been described or are available
from commercial sources. (see for example, Oppmann et al.,
Immunity, 2000, 13: 713-715; R&D Systems, Minneapolis. Minn.;
United States Biological, Swampscott, Mass.; WIPO Publication No.
WO 2007/076524). Native human IL-23 can be obtained from human
cells such as dendritic cells using methods known in the art
including those described herein.
[0035] IL-23 is a heterodimeric cytokine comprised of a unique p19
subunit that is covalently bound to a shared p40 subunit. The p19
subunit comprises four .alpha.-helices, "A", "B", "C" and "D" in an
up-up-down-down motif joined by three intra-helix loops between the
A and B helices, between the B and C helices and between the C and
D helices, see Oppmann et al., Immunity, 2000, 13: 713-715 and
Beyer, et al., J Mol Biol, 2008. 382(4): 942-55. The A and D
helices of 4 helical bundle cytokines are belived to be involved
with receptor binding. The p40 subunit comprises three beta-sheet
sandwich domains, D1, D2 and D3 (Lupardus and Garcia, J. Mol.
Biol., 2008, 382:931-941.
[0036] The term "polynucleotide" includes both single-stranded and
double-stranded nucleic acids and includes genomic DNA, RNA, mRNA,
cDNA, or synthetic origin or some combination thereof which is not
associated with sequences normally found in nature. Isolated
polynucleotides comprising specified sequences may include, in
addition to the specified sequences, coding sequences for up to ten
or even up to twenty other proteins or portions thereof, or may
include operably linked regulatory sequences that control
expression of the coding region of the recited nucleic acid
sequences, and/or may include vector sequences. The nucleotides
comprising the polynucleotide can be ribonucleotides or
deoxyribonucleotides or a modified form of either type of
nucleotide. The modifications include base modifications such as
bromouridine and inosine derivatives, ribose modifications such as
2',3'-dideoxyribose, and internucleotide linkage modifications such
as phosphorothioate, phosphorodithioate, phosphoroselenoate,
phosphorodiselenoate, phosphoroaniloth ioate, phoshoraniladate and
phosphoroamidate.
[0037] The term "oligonucleotide" means a polynucleotide comprising
100 or fewer nucleotides. In some embodiments, oligonucleotides are
10 to 60 bases in length. In other embodiments, oligonucleotides
are 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides in
length. Oligonucleotides may be single stranded or double stranded,
e.g., for use in the construction of a mutant gene.
Oligonucleotides may be sense or antisense oligonucleotides. An
oligonucleotide can include a detectable label, such as a
radiolabel, a fluorescent label, a hapten or an antigenic label,
for detection assays. Oligonucleotides may be used, for example, as
PCR primers, cloning primers or hybridization probes.
[0038] The terms "polypeptide" or "protein" means a macromolecule
having the amino acid sequence of a native protein, that is, a
protein produced by a naturally-occurring and non-recombinant cell;
or it is produced by a genetically-engineered or recombinant cell,
and comprise molecules having the amino acid sequence of the native
protein, or molecules having one or more deletions from, insertions
to, and/or substitutions of the amino acid residues of the native
sequence. The term also includes amino acid polymers in which one
or more amino acids are chemical analogs of a corresponding
naturally-occurring amino acid and polymers. The terms
"polypeptide" and "protein" encompass IL-23 antigen binding
proteins (such as antibodies) and sequences that have one or more
deletions from, additions to, and/or substitutions of the amino
acid residues of the antigen binding protein sequence. The term
"polypeptide fragment" refers to a polypeptide that has an
amino-terminal deletion, a carboxyl-terminal deletion, and/or an
internal deletion as compared with the full-length native protein.
Such fragments may also contain modified amino acids as compared
with the native protein. In certain embodiments, fragments are
about five to 500 amino acids long. For example, fragments may be
at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
50, 70, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids
long. Useful polypeptide fragments include immunologically
functional fragments of antibodies, including binding domains. In
the case of an IL-23 antigen binding protein, such as an antibody,
useful fragments include but are not limited to one or more CDR
regions, a variable domain of a heavy or light chain, a portion of
an antibody chain, a portion of a variable region including less
than three CDRs, and the like.
[0039] "Amino acid" includes its normal meaning in the art. The
twenty naturally-occurring amino acids and their abbreviations
follow conventional usage. See, Immunology-A Synthesis, 2nd
Edition, (E. S. Golub and D. R. Gren, eds.), Sinauer Associates:
Sunderland, Mass. (1991). Stereoisomers (e.g., D-amino acids) of
the twenty conventional amino acids, unnatural amino acids such as
[alpha]-, [alpha]-disubstituted amino acids, N-alkyl amino acids,
and other unconventional amino acids may also be suitable
components for polypeptides. Examples of unconventional amino acids
include: 4-hydroxyproline, [gamma]-carboxyglutamate,
[epsilon]-N,N,N-trimethyllysine, [epsilon]-N-acetyllysine,
O-phosphoserine, N-acetylserine, N-formylmethionine,
3-methylhistidine, 5-hydroxylysine, [sigma]-N-methylarginine, and
other similar amino acids and imino acids (e.g., 4-hydroxyproline).
In the polypeptide notation used herein, the left-hand direction is
the amino terminal direction and the right-hand direction is the
carboxyl-terminal direction, in accordance with standard usage and
convention.
[0040] The term "isolated protein" refers to a protein, such as an
antigen binding protein (an example of which could be an antibody),
that is purified from proteins or polypeptides or other
contaminants that would interfere with its therapeutic, diagnostic,
prophylactic, research or other use. As used herein, "substantially
pure" means that the described species of molecule is the
predominant species present, that is, on a molar basis it is more
abundant than any other individual species in the same mixture. In
certain embodiments, a substantially pure molecule is a composition
wherein the object species comprises at least 50% (on a molar
basis) of all macromolecular species present. In other embodiments,
a substantially pure composition will comprise at least 80%, 85%,
90%, 95%, or 99% of all macromolecular species present in the
composition. In certain embodiments, an essentially homogeneous
substance has been purified to such a degree that contaminating
species cannot be detected in the composition by conventional
detection methods and thus the composition consists of a single
detectable macromolecular species.
[0041] A "variant" of a polypeptide (e.g., an antigen binding
protein such as an antibody) comprises an amino acid sequence
wherein one or more amino acid residues are inserted into, deleted
from and/or substituted into the amino acid sequence relative to
another polypeptide sequence. Variants include fusion proteins. A
"derivative" of a polypeptide is a polypeptide that has been
chemically modified in some manner distinct from insertion,
deletion, or substitution variants, e.g., via conjugation to
another chemical moiety.
[0042] The terms "naturally occurring" or "native" as used
throughout the specification in connection with biological
materials such as polypeptides, nucleic acids, host cells, and the
like, refers to materials which are found in nature, such as native
human IL-23. In certain aspects, recombinant antigen binding
proteins that bind native IL-23 are provided. In this context, a
"recombinant protein" is a protein made using recombinant
techniques, i.e., through the expression of a recombinant nucleic
acid as described herein. Methods and techniques for the production
of recombinant proteins are well known in the art.
[0043] The term "antibody" refers to an intact immunoglobulin of
any isotype, or a fragment thereof that can compete with the intact
antibody for specific binding to the target antigen, and includes,
for instance, chimeric, humanized, fully human, and bispecific
antibodies. An antibody as such is a species of an antigen binding
protein. Unless otherwise indicated, the term "antibody" includes,
in addition to antibodies comprising two full-length heavy chains
and two full-length light chains, derivatives, variants, fragments,
and muteins thereof, examples of which are described below. An
intact antibody generally will comprise at least two full-length
heavy chains and two full-length light chains, but in some
instances may include fewer chains such as antibodies naturally
occurring in camelids which may comprise only heavy chains.
Antibodies may be derived solely from a single source, or may be
"chimeric," that is, different portions of the antibody may be
derived from two different antibodies as described further below.
The antigen binding proteins, antibodies, or binding fragments may
be produced in hybridomas, by recombinant DNA techniques, or by
enzymatic or chemical cleavage of intact antibodies.
[0044] The term "functional fragment" (or simply "fragment") of an
antibody or immunoglobulin chain (heavy or light chain), as used
herein, is an antigen binding protein comprising a portion
(regardless of how that portion is obtained or synthesized) of an
antibody that lacks at least some of the amino acids present in a
full-length chain but which is capable of specifically binding to
an antigen. Such fragments are biologically active in that they
bind specifically to the target antigen and can compete with other
antigen binding proteins, including intact antibodies, for specific
binding to a given epitope. In one aspect, such a fragment will
retain at least one CDR present in the full-length light or heavy
chain, and in some embodiments will comprise a single heavy chain
and/or light chain or portion thereof. These biologically active
fragments may be produced by recombinant DNA techniques, or may be
produced by enzymatic or chemical cleavage of antigen binding
proteins, including intact antibodies. Fragments include, but are
not limited to, immunologically functional fragments such as Fab,
Fab', F(ab')2, Fv, domain antibodies and single-chain antibodies,
and may be derived from any mammalian source, including but not
limited to human, mouse, rat, camelid or rabbit. It is contemplated
further that a functional portion of the antigen binding proteins
disclosed herein, for example, one or more CDRs, could be
covalently bound to a second protein or to a small molecule to
create a therapeutic agent directed to a particular target in the
body, possessing bifunctional therapeutic properties, or having a
prolonged serum half-life.
[0045] The term "compete" when used in the context of antigen
binding proteins (e.g., neutralizing antigen binding proteins or
neutralizing antibodies) means competition between antigen binding
proteins as determined by an assay in which the antigen binding
protein (e.g., antibody or immunologically functional fragment
thereof) under test prevents or inhibits specific binding of a
reference antigen binding protein (e.g., a ligand, or a reference
antibody) to a common antigen (e.g., an IL-23 protein or a fragment
thereof). Numerous types of competitive binding assays can be used,
for example: solid phase direct or indirect radioimmunoassay (RIA),
solid phase direct or indirect enzyme immunoassay (EIA), sandwich
competition assay (see, e.g., Stahli et al., 1983, Methods in
Enzymology 92:242-253); solid phase direct biotin-avidin EIA (see,
e.g., Kirkland et al., 1986, J. Immunol. 137:3614-3619) solid phase
direct labeled assay, solid phase direct labeled sandwich assay
(see, e.g., Harlow and Lane, 1988, Antibodies, A Laboratory Manual,
Cold Spring Harbor Press); solid phase direct label RIA using 1-125
label (see, e.g., Morel et al., 1988, Molec. Immunol. 25:7-15);
solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al.,
1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer et
al., 1990, Scand. J. Immunol. 32:77-82). Typically, such an assay
involves the use of purified antigen bound to a solid surface or
cells bearing either of these, an unlabelled test antigen binding
protein and a labeled reference antigen binding protein.
[0046] Competitive inhibition is measured by determining the amount
of label bound to the solid surface or cells in the presence of the
test antigen binding protein. Usually the test antigen binding
protein is present in excess. Antigen binding proteins identified
by competition assay (competing antigen binding proteins) include
antigen binding proteins binding to the same epitope as the
reference antigen binding proteins and antigen binding proteins
binding to an adjacent epitope sufficiently proximal to the epitope
bound by the reference antigen binding protein for steric hindrance
to occur. Usually, when a competing antigen binding protein is
present in excess, it will inhibit specific binding of a reference
antigen binding protein to a common antigen by at least 40%, 45%,
50%, 55%, 60%, 65%, 70% or 75%. In some instance, binding is
inhibited by at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97% 98%, 99% or more.
[0047] The term "epitope" or "antigenic determinant" refers to a
site on an antigen to which an antigen binding protein binds.
Epitopes can be formed both from contiguous amino acids or
noncontiguous amino acids juxtaposed by tertiary folding of a
protein. Epitopes formed from contiguous amino acids are typically
retained on exposure to denaturing solvents, whereas epitopes
formed by tertiary folding are typically lost on treatment with
denaturing solvents. Epitope determinants may include chemically
active surface groupings of molecules such as amino acids, sugar
side chains, phosphoryl or sulfonyl groups, and may have specific
three dimensional structural characteristics, and/or specific
charge characteristics. An epitope typically includes at least 3,
4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25,
30, 35 amino acids in a unique spatial conformation. Epitopes can
be determined using methods known in the art.
IL-23 Antigen Binding Proteins
[0048] An "antigen binding protein" as used herein means a protein
that specifically binds a specified target antigen; the antigen as
provided herein is IL-23, particularly human IL-23, including
native human IL-23. Antigen binding proteins as provided herein
interact with at least a portion of the unique p19 subunit of
IL-23, detectably binding IL-23; but do not bind with any
significance to IL-12 (e.g., the p40 and/or the p35 subunits of
IL-12), thus "sparing IL-12". As a consequence, the antigen binding
proteins provided herein are capable of impacting IL-23 activity
without the potential risks that inhibition of IL-12 or the shared
p40 subunit might incur. The antigen binding proteins may impact
the ability of IL-23 to interact with its receptor, for example by
impacting binding to the receptor, such as by interfering with
receptor association. In particular, such antigen binding proteins
totally or partially reduce, inhibit, interfere with or modulate
one or more biological activities of IL-23. Such inhibition or
neutralization disrupts a biological response in the presence of
the antigen binding protein compared to the response in the absence
of the antigen binding protein and can be determined using assays
known in the art and described herein. Antigen binding proteins
provided herein inhibit IL-23-induced proinflammatory cytokine
production, for example IL-23-induced IL-22 production in whole
blood cells and IL-23-induced IFN.gamma. expression in NK and whole
blood cells. Reduction of biological activity can be about 20%,
30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97% 98%, 99% or more.
[0049] An antigen binding protein may comprise a portion that binds
to an antigen and, optionally, a scaffold or framework portion that
allows the antigen binding portion to adopt a conformation that
promotes binding of the antigen binding protein to the antigen.
Examples of antigen binding proteins include antibodies, antibody
fragments (e.g., an antigen binding portion of an antibody),
antibody derivatives, and antibody analogs. The antigen binding
protein can comprise an alternative protein scaffold or artificial
scaffold with grafted CDRs or CDR derivatives. Such scaffolds
include, but are not limited to, antibody-derived scaffolds
comprising mutations introduced to, for example, stabilize the
three-dimensional structure of the antigen binding protein as well
as wholly synthetic scaffolds comprising, for example, a
biocompatible polymer. See, for example, Korndorfer et al.,
Proteins: Structure, Function, and Bioinformatics, (2003) Volume
53, Issue 1:121-129; Roque et al., Biotechnol. Prog., 2004,
20:639-654. In addition, peptide antibody mimetics ("PAMs") can be
used, as well as scaffolds based on antibody mimetics utilizing
fibronection components as a scaffold.
[0050] Certain antigen binding proteins described herein are
antibodies or are derived from antibodies. Such antigen binding
proteins include, but are not limited to, monoclonal antibodies,
bispecific antibodies, minibodies, domain antibodies, synthetic
antibodies, antibody mimetics, chimeric antibodies, humanized
antibodies, human antibodies, antibody fusions, antibody
conjugates, single chain antibodies, and fragments thereof,
respectively. In some instances, the antigen binding protein is an
immunological fragment of an antibody (e.g., a Fab, a Fab', a
F(ab')2, or a scFv). The various structures are further described
and defined herein.
[0051] Certain antigen binding proteins that are provided may
comprise one or more CDRs as described herein (e.g., 1, 2, 3, 4, 5,
6 or more CDRs). In some instances, the antigen binding protein
comprises (a) a polypeptide structure and (b) one or more CDRs that
are inserted into and/or joined to the polypeptide structure. The
polypeptide structure can take a variety of different forms. For
example, it can be, or comprise, the framework of a naturally
occurring antibody, or fragment or variant thereof, or may be
completely synthetic in nature. Examples of various polypeptide
structures are further described below.
[0052] An antigen binding protein of the invention is said to
"specifically bind" its target antigen when the dissociation
equilibrium constant (KD) is .ltoreq.10-8 M. The antigen binding
protein specifically binds antigen with "high affinity" when the KD
is .ltoreq.5.times.10-9 M, and with "very high affinity" when the
the KD is .ltoreq.5.times.10-10 M. In one embodiment the antigen
binding protein will bind to human IL-23 with a KD of
.ltoreq.5.times.10-12 M, and in yet another embodiment it will bind
with a KD.ltoreq.5.times.10-13 M. In another embodiment of the
invention, the antigen binding protein has a KD of
.ltoreq.5.times.10-12 M and an Koff of about .ltoreq.5.times.10-6
1/s. In another embodiment, the Koff is
.ltoreq.5.times.10-71/s.
[0053] Another aspect provides an antigen binding protein having a
half-life of at least one day in vitro or in vivo (e.g., when
administered to a human subject). In one embodiment, the antigen
binding protein has a half-life of at least three days. In another
embodiment, the antibody or portion thereof has a half-life of four
days or longer. In another embodiment, the antibody or portion
thereof has a half-life of eight days or longer. In another
embodiment, the antibody or antigen binding portion thereof is
derivatized or modified such that it has a longer half-life as
compared to the underivatized or unmodified antibody. In another
embodiment, the antigen binding protein contains point mutations to
increase serum half life, such as described in WIPO Publication No.
WO 00/09560.
[0054] In embodiments where the antigen binding protein is used for
therapeutic applications, an antigen binding protein can reduce,
inhibit, interfere with or modulate one or more biological
activities of IL-23, such inducing production of proinflammatory
cytokines. IL-23 has many distinct biological effects, which can be
measured in many different assays in different cell types; examples
of such assays and known and are provided herein.
[0055] Some of the antigen binding proteins that are provided have
the structure typically associated with naturally occurring
antibodies. The structural units of these antibodies typically
comprise one or more tetramers, each composed of two identical
couplets of polypeptide chains, though some species of mammals also
produce antibodies having only a single heavy chain. In a typical
antibody, each pair or couplet includes one full-length "light"
chain (in certain embodiments, about 25 kDa) and one full-length
"heavy" chain (in certain embodiments, about 50-70 kDa). Each
individual immunoglobulin chain is composed of several
"immunoglobulin domains", each consisting of roughly 90 to 110
amino acids and expressing a characteristic folding pattern. These
domains are the basic units of which antibody polypeptides are
composed. The amino-terminal portion of each chain typically
includes a variable region that is responsible for antigen
recognition. The carboxy-terminal portion is more conserved
evolutionarily than the other end of the chain and is referred to
as the "constant region" or "C region". Human light chains
generally are classified as kappa and lambda light chains, and each
of these contains one variable region and one constant domain
(CL1).z Heavy chains are typically classified as mu, delta, gamma,
alpha, or epsilon chains, and these define the antibody's isotype
as IgM, IgD, IgG, IgA, and IgE, respectively. IgG has several
subtypes, including, but not limited to, IgG1, IgG2, IgG3, and
IgG4. IgM subtypes include IgM, and IgM2. IgA subtypes include IgA1
and IgA2. In humans, the IgA and IgD isotypes contain four heavy
chains and four light chains; the IgG and IgE isotypes contain two
heavy chains and two light chains; and the IgM isotype contains
five heavy chains and five light chains. The heavy chain constant
region (CH) typically comprises one or more domains that may be
responsible for effector function. The number of heavy chain
constant region domains will depend on the isotype. IgG heavy
chains, for example, each contains three CH region domains known as
CH1, CH2 and CH3. The antibodies that are provided can have any of
these isotypes and subtypes, for example, the IL-23 antigen binding
protein is of the IgG1, IgG2, or IgG4 subtype. If an IgG4 is
desired, it may also be desired to introduce a point mutation
(CPSCP->CPPCP) in the hinge region as described in Bloom et al.,
1997, Protein Science 6:407) to alleviate a tendency to form
intra-H chain disulfide bonds that can lead to heterogeneity in the
IgG4 antibodies. Antibodies provided herein that are of one type
can be changed to a different type using subclass switching
methods. See, e.g., Lantto et al., 2002, Methods Mol. Biol.
178:303-316.
[0056] In full-length light and heavy chains, the variable and
constant regions are joined by a "J" region of about twelve or more
amino acids, with the heavy chain also including a "D" region of
about ten more amino acids. See, e.g., Fundamental Immunology, 2nd
ed., Ch. 7 (Paul, W., ed.) 1989, New York: Raven Press. The
variable regions of each light/heavy chain pair typically form the
antigen binding site.
[0057] Variable Regions
[0058] Various heavy chain and light chain variable regions (or
domains) provided herein are depicted in TABLES 1 and 2. Each of
these variable regions may be attached, for example, to heavy and
light chain constant regions described above. Further, each of the
so generated heavy and light chain sequences may be combined to
form a complete antigen binding protein structure.
[0059] Provided are antigen binding proteins that contain at least
one heavy chain variable region (VH) selected from the group
consisting of VH1, VH2, VH3, VH4, VH5, VH6, VH7, VH8, VH9, VH10,
VH11, VH12, VH13, VH14, VH15 and VH16 and/or at least one light
chain variable region (VL) selected from the group consisting of
VL1, VL2, VL3, VL4, VL5, VL6, VL7, VL8, VL9, VL10, VL11, VL12,
VL13, VL14, VL15, and VL16 as shown in TABLES 1 and 2 below.
[0060] Each of the heavy chain variable regions listed in TABLE 2
may be combined with any of the light chain variable regions shown
in TABLE 1 to form an antigen binding protein. In some instances,
the antigen binding protein includes at least one heavy chain
variable region and/or one light chain variable region from those
listed in TABLES 1 and 2. In some instances, the antigen binding
protein includes at least two different heavy chain variable
regions and/or light chain variable regions from those listed in
TABLES 1 and 2. The various combinations of heavy chain variable
regions may be combined with any of the various combinations of
light chain variable regions.
[0061] In other instances, the antigen binding protein contains two
identical light chain variable regions and/or two identical heavy
chain variable regions. As an example, the antigen binding protein
may be an antibody or immunologically functional fragment that
comprises two light chain variable regions and two heavy chain
variable regions in combinations of pairs of light chain variable
regions and pairs of heavy chain variable regions as listed in
TABLES 1 and 2. Examples of such antigen binding proteins
comprising two identical heavy chain and light chain variable
regions include: Antibody A VH14/VL14; Antibody B VH9/VL9; Antibody
C VH10/VL10; Antibody D VH15/VL15; Antibody E VH1/VL1, Antibody F
VH11/VL11; Antibody G VH12/VL12; Antibody H VH13/VL13; Antibody I
VH8/VL8; Antibody J VH3/VL3; Antibody K VH7/VL7; Antibody L
VH4/VL4; Antibody M VH5/VL5 and Antibody N VH6/VL6.
[0062] Some antigen binding proteins that are provided comprise a
heavy chain variable region and/or a light chain variable region
comprising a sequence of amino acids that differs from the sequence
of a heavy chain variable region and/or a light chain variable
region selected from TABLES 1 and 2 at only 1, 2, 3, 4, 5, 6, 7, 8,
9, 10, 11, 12, 13, 14 or 15 amino acid residues, wherein each such
sequence difference is independently either a deletion, insertion
or substitution of one amino acid. The light and heavy chain
variable regions, in some antigen binding proteins, comprise
sequences of amino acids that have at least 70%, 75%, 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence
identity to the amino acid sequences provided in TABLES 1 and 2.
Still other antigen binding proteins, e.g., antibodies or
immunologically functional fragments, also include variant heavy
chain region forms and/or variant light chain region forms as
described herein.
[0063] The term "identity" refers to a relationship between the
sequences of two or more polypeptide molecules or two or more
polynucleotides, as determined by aligning and comparing the
sequences. "Percent identity" means the percent of identical
residues between the amino acids or nucleotides in the compared
molecules and is calculated based on the size of the smallest of
the molecules being compared.
TABLE-US-00001 TABLE 1 Exemplary VariantLight Chain Region
Sequences FR1 CDRL1 FR2 CDRL2 FR3 CDRL3 FR4 VL.sub.1
QSVLTQPPSVSGAPGQRVTISC WYQQVPGTAPKLLIY
GVPDRFSGSKSGTSASLAITGLQAEDEADYYC FGGGTRLTVL SEQ ID NO: 1 VL.sub.2
QSVLTQPPSVSGAPGQRVTISC WYQQLPGTAPKLLIY
GVPDRFSGSKSGTSASLAITGLQAEDEADYYC FGGGTKLTVL SEQ ID NO: 3 VL.sub.3
QAVLTQPSSLSASPGASASLTC VVYQQKPGSPPQYLLR
GVPSRFSGSKDASANAGILLISGLQSEDEADYYC FGGGTKLTVL SEQ ID NO: 4 VL.sub.4
QAVLTQPSSLSASPGASASLTC VVYQQKPGSPPQYLLR
GVPSRFSGSKDASANAGILLISGLQSEDEADYYC FGGGTKLTVL SEQ ID NO: 4 VL.sub.5
QPVLTQPPSASASLGASVTLTC VVYQQRPGKGPRFVMR
GIPDRFSVLGSGLNRYLTIKNIQEEDESDYHC FGTGTKVTVL SEQ ID NO7 VL.sub.6
QPVLTQPPSASASLGASVTLTC VVYQQRPGKGPRFVMR
GIPDRFSVLGSGLNRYLTIKNIQEEDESDYHC FGTGTKVTVL SEQ ID NO: 9 VL.sub.7
QPELTQPPSASASLGASVTLTC VVYQLRPGKGPRFVMR
GIPDRFSVLGSGLNRSLTIKNIQEEDESDYHC FGTGTKVTVL SEQ ID NO: 11 VL.sub.8
DIQLTPSPSSVSASVGDRVTITCRASQGIAGWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGS-
GSGTDFTLTISSLQPEDFATYYCQQADSFPPTFGGGTKVEIK SEQ ID NO: 13 VL.sub.9
DIQMTQSPSSVSASVGDRVTITCRASQVISSWLAWYQQKPGKAPSLLIYAASSLQSGVPSRFSGS-
VSGTDFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVOFK SEQ ID NO: 15 VL.sub.10
DIQMTQSPSSVSASVGDRVTITCRASQGSSSWFAWYQQKPGKAPKLLIYAASSLQSGVPSRFSG-
SGSGTDFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVDIK SEQ ID NO: 17 VL.sub.11
DSQMTQSPSSVSASVGDRVTITCRASQGISSWFAWYQQKPGQAPNLLIYAASSLQSGVPSRFSG-
SGSGTEFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVDIK SEQ ID NO: 19 VL.sub.12
DIQMTQSPSSVSASVGDRVTITCRAGQVISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSG-
SGSGTDFTLTISSLQPDDFATYYCQQATSFPLTFGGGTKVEIK SEQ ID NO: 21 VL.sub.13
DIQMTQSPSSVSASVGDRVTITCRASQGFSGWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSG-
SGSGTDFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVDIK SEQ ID NO: 23 VL.sub.14
DIQLTQSPSSVSASVGDRVTITCRASQWSSWFAWYQQKPGKAPNLLIYAASSLQSGVPSRFSGS-
GSGTDFTLTISSLQPADFATYFCQQANSFPFTFGPGTKVDVK SEQ ID NO: 25 VL.sub.15
DIQMTQSPSSVSASVGDRVTITCRASQGSSSWFAWYQQKPGKAPKLLIYAASSLQSGVPSRFSG-
SGSGTDFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVDIK SEQ ID NO: 27 VL.sub.16
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSRFSG-
SGSGTEFTLTISSLQPEDFATYYCLQHNSYPPTFGQGTKVEIE SEQ ID NO: 29
TABLE-US-00002 TABLE 2 Exemplary Variant Heavy Chain Region
Sequences FR1 CDRH1 FR2 CDRH2 FR3 CDRH3 FR4 VH.sub.1
QVQLVESGGGVVQPGRSLRLSCAASGFTFS WVRQAPGKGLEWVA
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR WGQGTMVTVSS SEQ ID NO: 31 VH.sub.2
QVQLVESGGGVVQPGRSLRLSCAASGFTFS WVRQAPGKGLEWVA
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR WGQGTMVTVSS SEQ ID NO: 33 VH.sub.3
QVQLVESGGGVVQPGRSLRLSCAASGFTFS WVRQAPGKGLEWVA
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR WGQGTLVTVSS SEQ ID NO: 34 VH.sub.4
QVQLVESGGGVVQPGRSLRLSCAASGFTFS WVRQAPGKGLEWLS
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR WGQGTLVTVSS SEQ ID NO: 36 VH.sub.5
EVQLVESGGGLVQPGGSLRLSCAASGFTFS WVRQAPGKGLEWVS
RFTISRDNAKNSLYLQMNSLRDEDTAVYYCAR WGQGTIVTVSS SEQ ID NO: 38 VH.sub.6
EVQLVESGGGLVQPGGSLRLSCAASGFTFS WVRQAPGKGLEWVS
RFTISRDNAKNSLYLQMNSLRDEDTAVYYCAR WGQGTTVTVSS SEQ ID NO: 40 VH.sub.7
EVQLVESGGGLVQPGGSLRLSCVVSGFTFS WVRQAPGKGLEWVS
RFTISRDNAKNSLYLQMNSLRDEDTAVYYCAR WGQGTTVTVSS SEQ ID NO: 42 VH.sub.8
QVQLQESGPGLVKPSETLSLTCTVSGGSIS WIRQPAGKGLEWIG
RVTMSLDTSKNQFSLRLTSVTAADTAVYYCAR WGQGTTVTVSS SEQ ID NO: 44 VH.sub.9
QVQLQESGPGLVKPSQTLSLTCTVSGGSIS WIRQHPGKGLEWIG
RVTISVDTSKNQFSLKLSSVTAADTAVYYCAK WGQGTTVIVSS SEQ ID NO: 46
VH.sub.10 QVQLQESGPGLVKPSQTLSLTCTVSGGSIN WIRQHP0KGLEWIG
RVTISVDTSQNQFSLKLSSVTAADTAVYYCAR WGQGTTVTVSS SEQ ID NO: 48
VH.sub.11 QVQLQESGPGLVKPSQTLSLTCTVSGGSIS WIRQHPGKGLEWIG
RVTISVDTSKNQFSLKLSSVTAADTAVYYCAR WGQGTTVIVSS SEQ ID NO: 50
VH.sub.12 QVQLQESGPRLVKPSETLSLTCTVSGDSIS WIRQPPGKGLEWLG
RVTISIDTSKNQFSLKLSSVTAADTAVYYCTR WGQGTLVTVSS SEQ ID NO: 52
VH.sub.13 QVQLQESGPGLVKPSQTLSLICTVSGGSIS WIRQHPGKGLEWIG
RITISVDTSKNQFSLSLSSVTAADTAVYYCAR WGQGTTVIVSS SEQ ID NO: 54
VH.sub.14 QVQLQESGPGLVKPSQTLSLTCTVSGGSIS WIRQHPGKGLEWIG
RVIMSVDTSKNQFSLKLSSVTAADTAVYYCAK WGQGTTVTVSS SEQ ID NO: 56
VH.sub.15 QVQLQESGPGLVKPSQTLSLTCTVSGGSIN WIRQHPGKGLEWIG
RVTISVDTSKNQFSLKLSSVTAADTAVYYCAR WGQGTTVTVSS SEQ ID NO: 58
VH.sub.16 QVQLVESGGGVVQPGRSLRLSCAASGFTFS WVRQAPGKGLEWVA
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR WGQGTTVTVSS SEQ ID NO: 60
For these calculations, gaps in alignments (if any) must be
addressed by a particular mathematical model or computer program
(i.e., an "algorithm"). Methods that can be used to calculate the
identity of the aligned nucleic acids or polypeptides include those
described in Computational Molecular Biology, (Lesk, A. M., ed.),
1988, New York: Oxford University Press; Biocomputing Informatics
and Genome Projects, (Smith, D. W., ed.), 1993, New York: Academic
Press; Computer Analysis of Sequence Data, Part I, (Griffin, A. M.,
and Griffin, H. G., eds.), 1994, New Jersey: Humana Press; von
Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York:
Academic Press; Sequence Analysis Primer, (Gribskov, M. and
Devereux, J., eds.), 1991, New York: M. Stockton Press; and Carillo
et al., 1988, SIAM J. Applied Math. 48:1073.
[0064] In calculating percent identity, the sequences being
compared are aligned in a way that gives the largest match between
the sequences. The computer program used to determine percent
identity is the GCG program package, which includes GAP (Devereux
et al., 1984, Nucl. Acid Res. 12:387; Genetics Computer Group,
University of Wisconsin, Madison, Wis.). The computer algorithm GAP
is used to align the two polypeptides or polynucleotides for which
the percent sequence identity is to be determined. The sequences
are aligned for optimal matching of their respective amino acid or
nucleotide (the "matched span", as determined by the algorithm). A
gap opening penalty (which is calculated as 3.times. the average
diagonal, wherein the "average diagonal" is the average of the
diagonal of the comparison matrix being used; the "diagonal" is the
score or number assigned to each perfect amino acid match by the
particular comparison matrix) and a gap extension penalty (which is
usually 1/10 times the gap opening penalty), as well as a
comparison matrix such as PAM 250 or BLOSUM 62 are used in
conjunction with the algorithm. In certain embodiments, a standard
comparison matrix (see, Dayhoff et al., 1978, Atlas of Protein
Sequence and Structure 5:345-352 for the PAM 250 comparison matrix;
Henikoff et al., 1992, Proc. Natl. Acad. Sci. U.S.A. 89:10915-10919
for the BLOSUM 62 comparison matrix) is also used by the
algorithm.
[0065] Recommended parameters for determining percent identity for
polypeptides or nucleotide sequences using the GAP program are the
following: Algorithm: Needleman et al., 1970, J. Mol. Biol.
48:443-453; Comparison matrix: BLOSUM 62 from Henikoff et al.,
1992, supra; Gap Penalty: 12 (but with no penalty for end gaps),
Gap Length Penalty: 4, Threshold of Similarity: 0. Certain
alignment schemes for aligning two amino acid sequences may result
in matching of only a short region of the two sequences and this
small aligned region may have very high sequence identity even
though there is no significant relationship between the two
full-length sequences. Accordingly, the selected alignment method
(GAP program) can be adjusted if so desired to result in an
alignment that spans at least 50 contiguous amino acids of the
target polypeptide.
[0066] The heavy and light chain variable regions disclosed herein
include consensus sequences derived from groups of related antigen
binding proteins. The amino acid sequences of the heavy and light
chain variable regions were analyzed for similarities. Four groups
emerged, one group having kappa light chain variable regions,
(V.sub.H9/V.sub.L9, V.sub.H10/V.sub.L10, V.sub.H11/V.sub.L11,
V.sub.H13/V.sub.L13, V.sub.H14/V.sub.L14 and V.sub.H15/V.sub.L15)
and three groups having lambda light chain variable regions: lambda
group 1 (V.sub.H5/V.sub.L5, V.sub.H6/V.sub.L6 and
V.sub.H7/V.sub.L7), lambda group 2 (V.sub.H3/V.sub.L3 and
V.sub.H4/V.sub.L4), and lambda group 3 (V.sub.H1/V.sub.L1 and
V.sub.H2/V.sub.L2). Light chain germlines represented include
VK1/A30 and VK1/L19. Light chain lambda germlines represented
include VL1/1e, VL3/3p, VL5/5c and VL9/9a. Heavy chain germlines
represented include VH3/3-30, VH3/3-30.3, VH3/3-33, VH3/3-48,
VH4/4-31 and VH4/4-59. As used herein, a "consensus sequence"
refers to amino acid sequences having conserved amino acids common
among a number of sequences and variable amino acids that vary
within given amino acid sequences. Consensus sequences may be
determined using standard phylogenic analyses of the light and
heavy chain variable regions corresponding to the IL-23 antigen
binding proteins disclosed herein.
[0067] The light chain variable region consensus sequence for the
kappa group is
DX.sub.1QX.sub.2TQSPSSVSASVGDRVTITCRASQGX.sub.3X.sub.4SX.sub.5WX-
.sub.6AWYQQKPGX.sub.7APX.sub.8LLIYAASSLQSGVPSR FS
GSX.sub.9SGTX.sub.10FTLTISSLQPX.sub.11DFATYX.sub.12CQQANSFPFTFGPGTKVDX.su-
b.13K (SEQ ID NO:30) where X.sub.1 is selected from I or S; X.sub.2
is selected from M or L; X.sub.3 is selected from G or V and
X.sub.4 is selected from S, F or I; X.sub.5 is selected from S or
G; X.sub.6 is selected from F or L; X.sub.7 is selected from K or
Q; X.sub.8 is selected from K, N or S; X.sub.9 is selected from G
or V; X.sub.10 is selected from D or E, X.sub.11 is selected from E
or A; X.sub.12 is selected from Y or F; and X.sub.13 is selected
from I, V or F.
[0068] The light chain variable region consensus sequence for
lambda group 1 is
QPX.sub.1LTQPPSASASLGASVTLTCTLX.sub.2SGYSDYKVDWYQX.sub.3RPGKGPRFVMRV-
GTGGX.sub.4VGSKGX.sub.5GI
PDRFSVLGSGLNRX.sub.6LTIKNIQEEDESDYHCGADHGSGX.sub.7NFVYVFGTGTKVTVL
(SEQ ID NO:61) where X.sub.1 is selected from V or E; X.sub.2 is
selected from N or S; X.sub.3 is selected from Q or L and X.sub.4
is selected from I or T; X.sub.5 is selected from D or E; X.sub.6
is selected from Y or S; and X.sub.7 is selected from S or N.
[0069] The light chain variable region consensus sequence for
lambda group 3 is
QSVLTQPPSVSGAPGQRVTISCTGSSSNX.sub.1GAGYDVHWYQQX.sub.2PGTAPKLLIYGSX.s-
ub.3NRPSGVPDRF SG
SKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTX.sub.4RLTVL (SEQ ID
NO:139) where X.sub.1 is selected from T or I; X.sub.2 is selected
from V or L; X.sub.3 is selected from G or N and X.sub.4 is
selected from R or K.
[0070] The heavy chain variable region consensus sequence for the
kappa group is
QVQLQESGPGLVKPSQTLSLTCTVSGGSIX.sub.1SGGYYWX.sub.2WIRQHPGKGLEWIGX-
.sub.3IX.sub.4YSGX.sub.5X.sub.6YYNP SLK
SRX.sub.7TX.sub.8SVDTSX.sub.9NQFSLX.sub.10LSSVTAADTAVYYCAX.sub.11X.sub.12-
RGX.sub.13YYGMDVWGQGTTVTVSS (SEQ ID NO:140) where X.sub.1 is
selected from N or S; X.sub.2 is selected from S or T; X.sub.3 is
selected from Y or H and X.sub.4 is selected from Y or H; X.sub.5
is selected from S or N; X.sub.6 is selected from S or T; X.sub.7
is selected from V or I; X.sub.8 is selected from I or M; X.sub.9
is selected from K or Q; X.sub.10 is selected from K or S, X.sub.11
is selected from R or K; X.sub.12 is selected from D or N; and
X.sub.13 is selected from H, F or Y.
[0071] The heavy chain variable region consensus sequence for
lambda group 1 is
EVQLVESGGGLVQPGGSLRLSCX.sub.1X.sub.2SGFTFSX.sub.3X.sub.4SMNWVRQAPGKG-
LEWVSYISSX.sub.5SSTX.sub.6YX.sub.7AD SV
KGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCARRIAAAGX.sub.8X.sub.9X.sub.10YYYAX.sub.1-
1DVWGQGTTVTVSS (SEQ ID NO:141) where X.sub.1 is selected from A or
V; X.sub.2 is selected from A or V; X.sub.3 is selected from T or S
and X.sub.4 is selected from Y or F; X.sub.5 is selected from S or
R; X.sub.6 is selected from R or I; X.sub.7 is selected from H, Y
or I; X.sub.8 is selected from P or G; X.sub.9 is selected from W
or F; X.sub.10 is selected from G or H and X.sub.11 is selected
from M or L.
[0072] The heavy chain variable region consensus sequence for
lambda group 2 is
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYX.sub.1MHWVRQAPGKGLEWX.sub.2X.sub.3V-
ISX.sub.4DGSX.sub.5KYYAD SV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARERTTLSGSYFDYWGQGTLVTVSS (SEQ ID
NO:142) where X.sub.1 is selected from G or A; X.sub.2 is selected
from V or L; X.sub.3 is selected from A or S and X.sub.4 is
selected from F or H and X.sub.5 is selected from L or I.
[0073] The heavy chain variable region consensus sequence for
lambda group 3 is
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNX.sub.1YYAD-
SV KG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRGYX.sub.2SSWYPDAFDIWGQGTMVTVSS
(SEQ ID NO: 143) where X, is selected from E or K and X.sub.2 is
selected from T or S.
[0074] Complementarity Determining Regions
[0075] Complementarity determining regions or "CDRs" are embedded
within a framework in the heavy and light chain variable regions
where they constitute the regions responsible for antigen binding
and recognition. Variable domains of immunoglobulin chains of the
same species, for example, generally exhibit a similar overall
structure; comprising relatively conserved framework regions (FR)
joined by hypervariable CDR regions. An antigen binding protein can
have 1, 2, 3, 4, 5, 6 or more CDRs. The variable regions discussed
above, for example, typically comprise three CDRs. The CDRs from
heavy chain variable regions and light chain variable regions are
typically aligned by the framework regions to form a structure that
binds specifically on a target antigen (e.g., IL-23). From
N-terminal to C-terminal, naturally-occurring light and heavy chain
variable regions both typically conform to the following order of
these elements: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The CDR
and FR regions of exemplary light chain variable domains and heavy
chain variable domains are highlighted in TABLES 1 and 2. It is
recognized that the boundaries of the CDR and FR regions can vary
from those highlighted. Numbering systems have been devised for
assigning numbers to amino acids that occupy positions in each of
these domains. Complementarity determining regions and framework
regions of a given antigen binding protein may be identified using
these systems. Numbering systems are defined in Kabat et al.,
Sequences of Proteins of Immunological Interest, 5.sup.th Ed., US
Dept. of Health and Human Services, PHS, NIH, NIH Publication No.
91-3242, 1991, or Chothia & Lesk, 1987, J. Mol. Biol.
196:901-917; Chothia et al., 1989, Nature 342:878-883. Other
numbering systems for the amino acids in immunoglobulin chains
include IMGT.RTM. (the international ImMunoGeneTics information
system; Lefranc et al, Dev. Comp. Immunol. 2005, 29:185-203); and
AHo (Honegger and Pluckthun, J. Mol. Biol. 2001, 309(3):657-670).
The CDRs provided herein may not only be used to define the antigen
binding domain of a traditional antibody structure, but may be
embedded in a variety of other polypeptide structures, as described
herein.
[0076] The antigen binding proteins disclosed herein are
polypeptides into which one or more CDRs may be grafted, inserted,
embedded and/or joined. An antigen binding protein can have, for
example, one heavy chain CDR1 ("CDRH1"), and/or one heavy chain
CDR2 ("CDRH2"), and/or one heavy chain CDR3 ("CDRH3"), and/or one
light chain CDR1 ("CDRL1"), and/or one light chain CDR2 ("CDRL2"),
and/or one light chain CDR3 ("CDRL3"). Some antigen binding
proteins include both a CDRH3 and a CDRL3. Specific embodiments
generally utilize combinations of CDRs that are non-repetitive,
e.g., antigen binding proteins are generally not made with two
CDRH2 regions in one variable heavy chain region, etc. Antigen
binding proteins may comprise one or more amino acid sequences that
are identical to or that differ from to the amino acid sequences of
one or more of the CDRs presented in TABLE 3 at only 1, 2, 3, 4, 5,
6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acid residues, wherein
each such sequence difference is independently either a deletion,
insertion or substitution of one amino acid. The CDRs in some
antigen binding proteins comprise sequences of amino acids that
have at least 80%, 85%, 90%, 91%, 92, 93%, 94%, 95%, 96%, 97%, 98%,
or 99% sequence identity to CDRs sequence listed in TABLE 3. In
some antigen binding proteins, the CDRs are embedded into a
"framework" region, which orients the CDR(s) such that the proper
antigen binding properties of the CDR(s) is achieved.
TABLE-US-00003 TABLE 3 Exemplary CDRH and CDRL Sequences CDRL1
CDRL2 CDRL3 Exemplary CDRL Sequences TGSSSNTGAGYDVH GSGN RPS
QSYDSSLSGWV SEQ ID NO: 62 SEQ ID NO: 63 SEQ ID NO: 64 TGSSSN
IGAGYDVH GSNNRPS MIWHSSASV SEQ ID NO: 65 SEQ ID NO: 66 SEQ ID NO:
67 TLRSGINVGTYRIY YKSDSDKQQGS GADHGSGSNFVYV SEQ ID NO: 68 SEQ ID
NO: 69 SEQ ID NO: 70 TLNSGYSDYKV VGTGGIVGSKGD GADHGSGNNFVYV SEQ ID
NO: 71 SEQ ID NO: 72 SEQ ID NO: 73 TLSSGYSDYKV VGTGGIVGSKGE
QQANSFPFT SEQ ID NO: 74 SEQ ID NO: 75 SEQ ID NO: 76 RASQGFSGWLA
VGTGGTVGSKGE QQATSFPLT SEQ ID NO: 77 SEQ ID NO: 78 SEQ ID NO: 79
RASQVISSWLA AASSLQS QQADSFPPT SEQ ID NO: 80 SEQ ID NO: 81 SEQ ID
NO: 82 RASQVISSWFA LQHNSYPPT SEQ ID NO: 83 SEQ ID NO: 84
RASQGSSSWFA SEQ ID NO: 85 RASQGISSWFA SEQ ID NO: 86 RAGQVISSWLA SEQ
ID NO: 87 RASQGIAGWLA SEQ ID NO: 88 RASQGIRNDLG SEQ ID NO: 89
Exemplary CDRH Sequences SYGMH VIWYDGSNEYYADSVKG DRGYTSSWYPDAFDI
SEQ ID NO: 91 SEQ ID NO: 92 SEQ ID NO: 93 SYAMH VIWYDGSNKYYADSVKG
DRGYSSSWYPDAFDI SEQ ID NO: 94 SEQ ID NO: 95 SEQ ID NO: 96 TYSMN
VISFDGSLKYYADSVKG ERTTLSGSYFDY SEQ ID NO: 97 SEQ ID NO: 98 SEQ ID
NO: 99 SYSMN VISHDGSIKYYADSVKG RIAAAGGFHYYYALDV SEQ ID NO: 100 SEQ
ID NO: 101 SEQ ID NO: 102 SFSMN YISSRSSTIYIADSVKG RIAAAGPWGYYYAMDV
SEQ ID NO: 103 SEQ ID NO: 104 SEQ ID NO: 105 SGGYYWT
YISSSSSTRYHADSVKG NRGYYYGMDV SEQ ID NO: 106 SEQ ID NO: 107 SEQ ID
NO: 108 SGGYYWS YISSRSSTIYYADSVKG NRGFYYGMDV SEQ ID NO: 109 SEQ ID
NO: 110 SEQ ID NO: 111 SYFWS YIYYSGNTYYNPSLKS DRGHYYGMDV SEQ ID NO:
112 SEQ ID NO: 113 SEQ ID NO: 114 TYYWSH IHYSGNTYYNPSLKS DRGSYYGSDY
SEQ ID NO: 115 SEQ ID NO: 116 SEQ ID NO: 117 YIYYSGSTYYNPSLKS
DRGYYYGVDV SEQ ID NO: 118 SEQ ID NO: 119 YIYYSGSSYYNPSLKS
ENTVTIYYNYGMDV SEQ ID NO: 120 SEQ ID NO: 6 YIYYSGSTNYNPSLKS SEQ ID
NO: 121 LIYTSGSTNYNPSLKS SEQ ID NO: 122 LIWYDGSNKYYADSVKG SEQ ID
NO: 90
[0077] Provided herein are CDR1 regions comprising amino acid
residues 23-34 of SEQ ID NOs: 7 and 11; amino acid residues 24-34
of SEQ ID NOs: 9, 13, 15, 17, 19 21, 23, 25, 27 and 29; amino acid
residues 23-36 of SEQ ID NOs: 1, 3 and 4; amino acid residues 31-35
of SEQ ID NOs:31, 33, 34, 38, 40, 44, 52 and 60 and amino acid
residues 31-37 or SEQ ID NOs: 46, 48, 50, 54, 56 and 58.
[0078] CDR2 regions are provided comprising amino acid residues
50-56 of SEQ ID NOs: 9, 13, 15, 17, 19, 21, 23, 25, 27 and 29;
amino acid residues 50-61 of SEQ ID NOs: 7 and 11; amino acid
residues 52-62 of SEQ ID NO:4; amino acid residues 50-65 of SEQ ID
NOs: 31, 33, 44 and 52; amino acid residues 50-66 of SEQ ID NOs:
36, 38, 40, 42 and 60; amino acid residues 52-58 of SEQ ID NOs: 1
and 3 and amino acid residues 52-67 of SEQ ID NOs: 46, 48, 50, 54,
56 and 58.
[0079] CDR3 regions comprising amino acid residues 89-97 of SEQ ID
NOs: 13, 15, 17, 19, 21, 23, 25, 27 and 29; amino acid residues
91-101 of SEQ ID NOs: 1 and 3; amino acid residues 94-106 of SEQ ID
NOs: 7, 9 and 11; amino acid residues 98-107 of SEQ ID NOs: 44 and
52; amino acid residues 97-105 of SEQ ID NO: 4; amino acid residues
99-110 of SEQ ID NOs: 34 and 36; amino acid residues 99-112 of SEQ
ID NO: 112; amino acid residues 99-113 of SEQ ID NOs: 31 and 33;
amino acid residues 99-114 of SEQ ID NOs: 38, 40 and 42; amino acid
residues 100-109 of SEQ ID NOs: 46, 48, 54, 56 and 58; and amino
acid residues 101-019 of SEQ ID NO; 50; are also provided.
[0080] The CDRs disclosed herein include consensus sequences
derived from groups of related sequences. As described previously,
four groups of variable region sequences were identified, a kappa
group and three lambda groups. The CDRL1 consensus sequence from
the kappa group consists of RASQX.sub.1X.sub.2SX.sub.3WX.sub.4A
(SEQ ID NO:123) where X.sub.1 is selected from G or V; X.sub.2 is
selected from I, F or S; X.sub.3 is selected from S or G and
X.sub.4 is selected from F or L. The CDRL1 consensus sequence from
lambda group 1 consists of TLX.sub.1SGYSDYKVD (SEQ ID NO:124)
wherein X.sub.1 is selected from N or S. The CDRL1 consensus
sequences from lambda group 3 consists of TGSSSNX.sub.1GAGYDVH (SEQ
ID NO:125) wherein X.sub.1 is selected from I or T.
[0081] The CDRL2 consensus sequence from lambda group 1 consists of
VGTGGX.sub.1VGSKGX.sub.2 (SEQ ID NO: 126) wherein X.sub.1 is
selected from I or T and X.sub.2 is selected from D or E. The CDRL2
consensus sequence from lambda group 3 consists of GSX.sub.1NRPS
(SEQ ID NO:127) wherein X.sub.1 is selected from N or G.
[0082] The CDRL3 consensus sequences include GADHGSGX.sub.1NFVYV
(SEQ IDN NO:128) wherein X.sub.1 is S or N.
[0083] The CDRH1 consensus sequence from the kappa group consists
of SGGYYWX, (SEQ ID NO:129) wherein X.sub.1 is selected from S or
T. The CDRH1 consensus sequence from lambda group 1 consists of
X.sub.1X.sub.2SMN (SEQ ID NO:131) wherein X.sub.1 is selected from
S or T and X.sub.2 is selected from Y or F. The CDRH1 consensus
sequence from lambda group 2 consists of SYX.sub.1MH (SEQ ID
NO:130), wherein X.sub.1 is selected from G or A.
[0084] The CDRH2 consensus sequence from the kappa group consists
of X.sub.1IX.sub.2YSGX.sub.3X.sub.4YYNPSLKS (SEQ ID NO:132) wherein
X.sub.1 is selected from Y or H; X.sub.2 is selected from Y or H;
X.sub.3 is selected from S or N and X.sub.4 is selected from T or
S. The consensus sequence from lambda group 1 consists of
YISSX.sub.1SSTX.sub.2YX.sub.3ADSVKG (SEQ ID NO:134) wherein X.sub.1
is selected from R or S, X.sub.2 is selected from I or R, X.sub.3
is selected from I, H or Y. The consensus sequence from lambda
group 2 consists of VISX.sub.1DGSX.sub.2KYYADSVKG (SEQ ID NO:133)
wherein X, is F or H and X.sub.2 is L or T. The CDRH2 consensus
sequence from lambda group 3 consists of VIWYDGSNX.sub.1YYADSVKG
(SEQ ID NO:135) wherein X.sub.1 is selected from K or E.
[0085] The CDRH3 consensus sequence from the kappa group consists
of X.sub.1RGX.sub.2YYGMDV (SEQ ID NO:136) wherein X, is selected
from N or D and X.sub.2 is selected from H, Y or F. The CDRH3
consensus sequence from lambda group 1 consists of
RIAAAGX.sub.1X.sub.2X.sub.3YYYAX.sub.4DV (SEQ ID NO:137) wherein
X.sub.1 is selected from G or P; X.sub.2 is selected from F or W;
X.sub.3 is selected from H or G and X.sub.4 is selected from L and
M. The CDRH3 consensus sequence from lambda group 3 consists of
DRGYX.sub.1SSWYPDAFDI (SEQ ID NO:138) wherein X.sub.1 is selected
from S or T.
[0086] Monoclonal Antibodies
[0087] The antigen binding proteins that are provided include
monoclonal antibodies that bind to IL-23. Monoclonal antibodies may
be produced using any technique known in the art, e.g., by
immortalizing spleen cells harvested from the transgenic animal
after completion of the immunization schedule. The spleen cells can
be immortalized using any technique known in the art, e.g., by
fusing them with myeloma cells to produce hybridomas. Myeloma cells
for use in hybridoma-producing fusion procedures preferably are
non-antibody-producing, have high fusion efficiency, and enzyme
deficiencies that render them incapable of growing in certain
selective media which support the growth of only the desired fused
cells (hybridomas). Examples of suitable cell lines for use in
mouse fusions include Sp-20, P3-X63/Ag8, P3-X63-Ag8.653, NS1/1.Ag 4
1, Sp210-Ag14, FO, NSO/U, MPC-11, MPC11-X45-GTG 1.7 and S194/5XXO
Bul; examples of cell lines used in rat fusions include R210.RCY3,
Y3-Ag 1.2.3, IR983F and 4B210. Other cell lines useful for cell
fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
[0088] In some instances, a hybridoma cell line is produced by
immunizing an animal (e.g., a transgenic animal having human
immunoglobulin sequences) with an IL-23 immunogen; harvesting
spleen cells from the immunized animal; fusing the harvested spleen
cells to a myeloma cell line, thereby generating hybridoma cells;
establishing hybridoma cell lines from the hybridoma cells, and
identifying a hybridoma cell line that produces an antibody that
binds an IL-23 polypeptide while sparing IL-12. Such hybridoma cell
lines, and anti-IL-23 monoclonal antibodies produced by them, are
aspects of the present application.
[0089] Monoclonal antibodies secreted by a hybridoma cell line can
be purified using any technique known in the art. Hybridomas or
mAbs may be further screened to identify mAbs with particular
properties, such as the ability to inhibit IL-23-induced
activity.
[0090] Chimeric and Humanized Antibodies
[0091] Chimeric and humanized antibodies based upon the foregoing
sequences are also provided. Monoclonal antibodies for use as
therapeutic agents may be modified in various ways prior to use.
One example is a chimeric antibody, which is an antibody composed
of protein segments from different antibodies that are covalently
joined to produce functional immunoglobulin light or heavy chains
or immunologically functional portions thereof. Generally, a
portion of the heavy chain and/or light chain is identical with or
homologous to a corresponding sequence in antibodies derived from a
particular species or belonging to a particular antibody class or
subclass, while the remainder of the chain(s) is/are identical with
or homologous to a corresponding sequence in antibodies derived
from another species or belonging to another antibody class or
subclass. For methods relating to chimeric antibodies, see, for
example, U.S. Pat. No. 4,816,567; and Morrison et al., 1985, Proc.
Natl. Acad. Sci. USA 81:6851-6855. CDR grafting is described, for
example, in U.S. Pat. Nos. 6,180,370, 5,693,762, 5,693,761,
5,585,089, and 5,530,101.
[0092] One useful type of chimeric antibody is a "humanized"
antibody. Generally, a humanized antibody is produced from a
monoclonal antibody raised initially in a non-human animal. Certain
amino acid residues in this monoclonal antibody, typically from
non-antigen recognizing portions of the antibody, are modified to
be homologous to corresponding residues in a human antibody of
corresponding isotype. Humanization can be performed, for example,
using various methods by substituting at least a portion of a
rodent variable region for the corresponding regions of a human
antibody (see, e.g., U.S. Pat. Nos. 5,585,089, and 5,693,762; Jones
et al., 1986, Nature 321:522-525; Riechmann et al., 1988, Nature
332:323-27; Verhoeyen et al., 1988, Science 239:1534-1536),
[0093] In certain embodiments, constant regions from species other
than human can be used along with the human variable region(s) to
produce hybrid antibodies.
[0094] Fully Human Antibodies
[0095] Fully human antibodies are also provided. Methods are
available for making fully human antibodies specific for a given
antigen without exposing human beings to the antigen ("fully human
antibodies"). One specific means provided for implementing the
production of fully human antibodies is the "humanization" of the
mouse humoral immune system. Introduction of human immunoglobulin
(Ig) loci into mice in which the endogenous Ig genes have been
inactivated is one means of producing fully human monoclonal
antibodies (mAbs) in mouse, an animal that can be immunized with
any desirable antigen. Using fully human antibodies can minimize
the immunogenic and allergic responses that can sometimes be caused
by administering mouse or mouse-derivatized mAbs to humans as
therapeutic agents.
[0096] Fully human antibodies can be produced by immunizing
transgenic animals (usually mice) that are capable of producing a
repertoire of human antibodies in the absence of endogenous
immunoglobulin production. Antigens for this purpose typically have
six or more contiguous amino acids, and optionally are conjugated
to a carrier, such as a hapten. See, e.g., Jakobovits et al., 1993,
Proc. Natl. Acad. Sci. USA 90:2551-2555; Jakobovits et al., 1993,
Nature 362:255-258; and Bruggermann et al., 1993, Year in Immunol.
7:33. In one example of such a method, transgenic animals are
produced by incapacitating the endogenous mouse immunoglobulin loci
encoding the mouse heavy and light immunoglobulin chains therein,
and inserting into the mouse genome large fragments of human genome
DNA containing loci that encode human heavy and light chain
proteins. Partially modified animals, which have less than the full
complement of human immunoglobulin loci, are then cross-bred to
obtain an animal having all of the desired immune system
modifications. When administered an immunogen, these transgenic
animals produce antibodies that are immunospecific for the
immunogen but have human rather than murine amino acid sequences,
including the variable regions. For further details of such
methods, see, for example, WIPO patent publications WO96/33735 and
WO94/02602. Additional methods relating to transgenic mice for
making human antibodies are described in U.S. Pat. Nos. 5,545,807;
6,713,610; 6,673,986; 6,162,963; 5,545,807; 6,300,129; 6,255,458;
5,877,397; 5,874,299 and 5,545,806; in WIPO patent publications
WO91/10741, WO90/04036, and in EP 546073B1 and EP 546073A1.
[0097] The transgenic mice described above contain a human
immunoglobulin gene minilocus that encodes unrearranged human heavy
([mu] and [gamma]) and [kappa] light chain immunoglobulin
sequences, together with targeted mutations that inactivate the
endogenous [mu] and [kappa] chain loci (Lonberg et al., 1994,
Nature 368:856-859). Accordingly, the mice exhibit reduced
expression of mouse IgM or [kappa] and in response to immunization,
and the introduced human heavy and light chain transgenes undergo
class switching and somatic mutation to generate high affinity
human IgG [kappa] monoclonal antibodies (Lonberg et al., supra.;
Lonberg and Huszar, 1995, Intern. Rev. Immunol. 13: 65-93; Harding
and Lonberg, 1995, Ann. N.Y Acad. Sci. 764:536-546). The
preparation of such mice is described in detail in Taylor et al.,
1992, Nucleic Acids Research 20:6287-6295; Chen et al., 1993,
International Immunology 5:647-656; Tuaillon et al., 1994, J.
Immunol. 152:2912-2920; Lonberg et al., 1994, Nature 368:856-859;
Lonberg, 1994, Handbook of Exp. Pharmacology 113:49-101; Taylor et
al., 1994, International Immunology 6:579-591; Lonberg and Huszar,
1995, Intern. Rev. Immunol. 13:65-93; Harding and Lonberg, 1995,
Ann. N.Y Acad. Sci. 764:536-546; Fishwild et al., 1996, Nature
Biotechnology 14:845-85. See, further U.S. Pat. Nos. 5,545,806;
5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,877,397; 5,661,016;
5,814,318; 5,874,299; and 5,770,429; as well as U.S. Pat. No.
5,545,807; WIPO Publication Nos. WO 93/1227; WO 92/22646; and WO
92/03918. Technologies utilized for producing human antibodies in
these transgenic mice are disclosed also in WIPO Publication No. WO
98/24893, and Mendez et al., 1997, Nature Genetics 15:146-156. For
example, the HCo7 and HCo12 transgenic mice strains can be used to
generate anti-IL-23 antibodies.
[0098] Using hybridoma technology, antigen-specific human mAbs with
the desired specificity can be produced and selected from the
transgenic mice such as those described above. Such antibodies may
be cloned and expressed using a suitable vector and host cell, or
the antibodies can be harvested from cultured hybridoma cells.
[0099] Fully human antibodies can also be derived from
phage-display libraries (such as disclosed in Hoogenboom et al.,
1991, J. Mol. Biol. 227:381; Marks et al., 1991, J. Mol. Biol.
222:581; WIPO Publication No. WO 99/10494). Phage display
techniques mimic immune selection through the display of antibody
repertoires on the surface of filamentous bacteriophage, and
subsequent selection of phage by their binding to an antigen of
choice.
[0100] Bispecific or Bifunctional Antigen Binding Proteins
[0101] A "bispecific," "dual-specific" or "bifunctional" antigen
binding protein or antibody is a hybrid antigen binding protein or
antibody, respectively, having two different antigen binding sites,
such as one or more CDRs or one or more variable regions as
described above. In some instances they are an artificial hybrid
antibody having two different heavy/light chain pairs and two
different binding sites. Multispecific antigen binding protein or
"multispecific antibody" is one that targets more than one antigen
or epitope. Bispecific antigen binding proteins and antibodies are
a species of multispecific antigen binding protein antibody and may
be produced by a variety of methods including, but not limited to,
fusion of hybridomas or linking of Fab' fragments. See, e.g.,
Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321;
Kostelny et al., 1992, J. Immunol. 148:1547-1553.
[0102] Immunological Fragments
[0103] Antigen binding proteins also include immunological
fragments of an antibody (e.g., a Fab, a Fab', a F(ab').sub.2, or a
scFv). A "Fab fragment" is comprised one light chain (the light
chain variable region (V.sub.L) and its corresponding constant
domain (C.sub.L)) and one heavy chain (the heavy chain variable
region (V.sub.H) and first constant domain (C.sub.H1)). The heavy
chain of a Fab molecule cannot form a disulfide bond with another
heavy chain molecule. A "Fab' fragment" contains one light chain
and a portion of one heavy chain that also contains the region
between the C.sub.H1 and C.sub.H2 domains, such that an interchain
disulfide bond can be formed between the two heavy chains of two
Fab' fragments to form an F(ab').sub.2 molecule. A "F(ab').sub.2
fragment" thus is composed of two Fab' fragments that are held
together by a disulfide bond between the two heavy chains. A "Fv
fragment" consists of the variable light chain region and variable
heavy chain region of a single arm of an antibody. Single-chain
antibodies "scFv" are Fv molecules in which the heavy and light
chain variable regions have been connected by a flexible linker to
form a single polypeptide chain, which forms an antigen binding
region. Single chain antibodies are discussed in detail in WIPO
Publication No. WO 88/01649, U.S. Pat. Nos. 4,946,778 and
5,260,203; Bird, 1988, Science 242:423; Huston et al., 1988, Proc.
Natl. Acad. Sci. U.S.A. 85:5879; Ward et al., 1989, Nature 334:544,
de Graaf et al., 2002, Methods Mol Biol. 178:379-387; Kortt et al.,
1997, Prot. Eng. 10:423; Kortt et al., 2001, Biomol. Eng. 18:95-108
and Kriangkum et al., 2001, Biomol. Eng. 18:31-40. A "Fc" region
contains two heavy chain fragments comprising the C.sub.H1 and
C.sub.H2 domains of an antibody. The two heavy chain fragments are
held together by two or more disulfide bonds and by hydrophobic
interactions of the C.sub.H3 domains.
[0104] Also included are domain antibodies, immunologically
functional immunoglobulin fragments containing only the variable
region of a heavy chain or the variable region of a light chain. In
some instances, two or more V.sub.H regions are covalently joined
with a peptide linker to create a bivalent domain antibody. The two
V.sub.H regions of a bivalent domain antibody may target the same
or different antigens. Diabodies are bivalent antibodies comprising
two polypeptide chains, wherein each polypeptide chain comprises
V.sub.H and V.sub.L domains joined by a linker that is too short to
allow for pairing between two domains on the same chain, thus
allowing each domain to pair with a complementary domain on another
polypeptide chain (see, e.g., Holliger et al., Proc. Natl. Acad.
Sci. USA 90:6444-48, 1993 and Poljak et al., Structure 2:1121-23,
1994). Similarly, tribodies and tetrabodies are antibodies
comprising three and four polypeptide chains, respectively, and
forming three and four antigen binding sites, respectively, which
can be the same or different. Maxibodies comprise bivalent scFvs
covalently attached to the Fc region of IgG.sub.1, (see, e.g.,
Fredericks et al, 2004, Protein Engineering, Design &
Selection, 17:95-106; Powers et al., 2001, Journal of Immunological
Methods, 251:123-135; Shu et al., 1993, Proc. Natl. Acad. Sci. USA
90:7995-7999; Hayden et al., 1994, Therapeutic Immunology
1:3-15).
[0105] Various Other Forms
[0106] Also provided are variant forms of the antigen binding
proteins disclosed above, some of the antigen binding proteins
having, for example, one or more conservative amino acid
substitutions in one or more of the heavy or light chains, variable
regions or CDRs listed in TABLES 1 and 2.
[0107] Naturally-occurring amino acids may be divided into classes
based on common side chain properties: hydrophobic (norleucine,
Met, Ala, Val, Leu, lie); neutral hydrophilic (Cys, Ser, Thr, Asn,
Gin); acidic (Asp, Glu); basic (His, Lys, Arg); residues that
influence chain orientation (Gly, Pro); and aromatic (Trp, Tyr,
Phe).
[0108] Conservative amino acid substitutions may involve exchange
of a member of one of these classes with another member of the same
class. Conservative amino acid substitutions may encompass
non-naturally occurring amino acid residues, which are typically
incorporated by chemical peptide synthesis rather than by synthesis
in biological systems. These include peptidomimetics and other
reversed or inverted forms of amino acid moieties. Such substantial
modifications in the functional and/or biochemical characteristics
of the antigen binding proteins described herein may be achieved by
creating substitutions in the amino acid sequence of the heavy and
light chains that differ significantly in their effect on
maintaining (a) the structure of the molecular backbone in the area
of the substitution, for example, as a sheet or helical
conformation, (b) the charge or hydrophobicity of the molecule at
the target site, or (c) the bulkiness of the side chain.
[0109] Non-conservative substitutions may involve the exchange of a
member of one of the above classes for a member from another class.
Such substituted residues may be introduced into regions of the
antibody that are homologous with human antibodies, or into the
non-homologous regions of the molecule.
[0110] In making such changes, according to certain embodiments,
the hydropathic index of amino acids may be considered. The
hydropathic profile of a protein is calculated by assigning each
amino acid a numerical value ("hydropathy index") and then
repetitively averaging these values along the peptide chain. Each
amino acid has been assigned a hydropathic index on the basis of
its hydrophobicity and charge characteristics. They are: isoleucine
(+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8);
cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine
(-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9);
tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate
(-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5);
lysine (-3.9); and arginine (-4.5).
[0111] The importance of the hydropathic profile in conferring
interactive biological function on a protein is understood in the
art (see, e.g., Kyte et al., 1982, J. Mol. Biol. 157:105-131). It
is known that certain amino acids may be substituted for other
amino acids having a similar hydropathic index or score and still
retain a similar biological activity. In making changes based upon
the hydropathic index, in certain embodiments, the substitution of
amino acids whose hydropathic indices are within .+-.2 is included.
In some aspects, those which are within .+-.1 are included, and in
other aspects, those within .+-.0.5 are included.
[0112] It is also understood in the art that the substitution of
like amino acids can be made effectively on the basis of
hydrophilicity, particularly where the biologically functional
protein or peptide thereby created is intended for use in
immunological embodiments, as in the present case. In certain
embodiments, the greatest local average hydrophilicity of a
protein, as governed by the hydrophilicity of its adjacent amino
acids, correlates with its immunogenicity and antigen binding or
immunogenicity, that is, with a biological property of the
protein.
[0113] The following hydrophilicity values have been assigned to
these amino acid residues: arginine (+3.0); lysine (+3.0);
aspartate (+3.01); glutamate (+3.0.+-.1); serine (+0.3); asparagine
(+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline
(-0.5.+-.1); alanine (-0.5); histidine (-0.5); cysteine (-1.0);
methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine
(-1.8); tyrosine (-2.3); phenylalanine (-2.5) and tryptophan
(-3.4). In making changes based upon similar hydrophilicity values,
in certain embodiments, the substitution of amino acids whose
hydrophilicity values are within .+-.2 is included, in other
embodiments, those which are within .+-.1 are included, and in
still other embodiments, those within .+-.0.5 are included. In some
instances, one may also identify epitopes from primary amino acid
sequences on the basis of hydrophilicity. These regions are also
referred to as "epitopic core regions."
[0114] Exemplary conservative amino acid substitutions are set
forth in TABLE 4.
TABLE-US-00004 TABLE 4 Conservative Amino Acid Substitutions
Residue Sub Ala Ser Arg Lys Asn Gln, His Asp Glu Cys Ser Gln Asn
Glu Asp Gly Pro His Asn, Gln Ile Leu, Val Leu Ile, Val Lys Arg,
Gln, Glu Met Leu, Ile Phe Met, Leu, Tyr Ser Thr Thr Ser Trp Tyr Tyr
Trp, Phe Val Ile, Leu Thr Ser Residue = Original Residue Sub =
Exemplary Substitution
[0115] A skilled artisan will be able to determine suitable
variants of polypeptides as set forth herein using well-known
techniques. One skilled in the art may identify suitable areas of
the molecule that may be changed without destroying activity by
targeting regions not believed to be important for activity. The
skilled artisan also will be able to identify residues and portions
of the molecules that are conserved among similar polypeptides. In
further embodiments, even areas that may be important for
biological activity or for structure may be subject to conservative
amino acid substitutions without destroying the biological activity
or without adversely affecting the polypeptide structure.
[0116] Additionally, one skilled in the art can review
structure-function studies identifying residues in similar
polypeptides that are important for activity or structure. In view
of such a comparison, one can predict the importance of amino acid
residues in a protein that correspond to amino acid residues
important for activity or structure in similar proteins. One
skilled in the art may opt for chemically similar amino acid
substitutions for such predicted important amino acid residues.
[0117] One skilled in the art can also analyze the 3-dimensional
structure and amino acid sequence in relation to that structure in
similar polypeptides. In view of such information, one skilled in
the art may predict the alignment of amino acid residues of an
antibody with respect to its three dimensional structure. One
skilled in the art may choose not to make radical changes to amino
acid residues predicted to be on the surface of the protein, since
such residues may be involved in important interactions with other
molecules. Moreover, one skilled in the art may generate test
variants containing a single amino acid substitution at each
desired amino acid residue. These variants can then be screened
using assays for IL-23 activity, (see examples below) thus yielding
information regarding which amino acids can be changed and which
must not be changed. In other words, based on information gathered
from such routine experiments, one skilled in the art can readily
determine the amino acid positions where further substitutions
should be avoided either alone or in combination with other
mutations.
[0118] A number of scientific publications have been devoted to the
prediction of secondary structure. See, Moult, 1996, Curr. Op. in
Biotech. 7:422-427; Chou et al., 1974, Biochem. 13:222-245; Chou et
al., 1974, Biochemistry 113:211-222; Chou et al., 1978, Adv.
Enzymol. Relat. Areas Mol. Biol. 47:45-148; Chou et al., 1979, Ann.
Rev. Biochem. 47:251-276; and Chou et al., 1979, Biophys. J.
26:367-384. Moreover, computer programs are currently available to
assist with predicting secondary structure. One method of
predicting secondary structure is based upon homology modeling. For
example, two polypeptides or proteins that have a sequence identity
of greater than 30%, or similarity greater than 40% often have
similar structural topologies. The recent growth of the protein
structural database (PDB) has provided enhanced predictability of
secondary structure, including the potential number of folds within
a polypeptide's or protein's structure. See, Holm et al., 1999,
Nucl. Acid. Res. 27:244-247. It has been suggested (Brenner et al.,
1997, Curr. Op. Struct. Biol. 7:369-376) that there are a limited
number of folds in a given polypeptide or protein and that once a
critical number of structures have been resolved, structural
prediction will become dramatically more accurate.
[0119] Additional methods of predicting secondary structure include
"threading" (Jones, 1997, Curr. Opin. Struct. Biol. 7:377-387;
Sippl et al., 1996, Structure 4:15-19), "profile analysis" (Bowie
et al., 1991, Science 253:164-170; Gribskov et al., 1990, Meth.
Enzym. 183:146-159; Gribskov et al., 1987, Proc. Nat. Acad. Sci.
84:4355-4358), and "evolutionary linkage" (See, Holm, 1999, supra;
and Brenner, 1997, supra).
[0120] In some embodiments, amino acid substitutions are made that:
(1) reduce susceptibility to proteolysis, (2) reduce susceptibility
to oxidation, (3) alter binding affinity for forming protein
complexes, (4) alter ligand or antigen binding affinities, and/or
(4) confer or modify other physicochemical or functional properties
on such polypeptides, such as maintaining the structure of the
molecular backbone in the area of the substitution, for example, as
a sheet or helical conformation; maintaining or altering the charge
or hydrophobicity of the molecule at the target site, or
maintaining or altering the bulkiness of a side chain.
[0121] For example, single or multiple amino acid substitutions (in
certain embodiments, conservative amino acid substitutions) may be
made in the naturally-occurring sequence. Substitutions can be made
in that portion of the antibody that lies outside the domain(s)
forming intermolecular contacts). In such embodiments, conservative
amino acid substitutions can be used that do not substantially
change the structural characteristics of the parent sequence (e.g.,
one or more replacement amino acids that do not disrupt the
secondary structure that characterizes the parent or native antigen
binding protein). Examples of art-recognized polypeptide secondary
and tertiary structures are described in Proteins, Structures and
Molecular Principles (Creighton, Ed.), 1984, W. H. New York:
Freeman and Company; Introduction to Protein Structure (Branden and
Tooze, eds.), 1991, New York: Garland Publishing; and Thornton et
al., 1991, Nature 354:105.
[0122] Additional variants include cysteine variants wherein one or
more cysteine residues in the parent or native amino acid sequence
are deleted from or substituted with another amino acid (e.g.,
serine). Cysteine variants are useful, inter alia when antibodies
(for example) must be refolded into a biologically active
conformation. Cysteine variants may have fewer cysteine residues
than the native protein, and typically have an even number to
minimize interactions resulting from unpaired cysteines.
[0123] The heavy and light chain variable region and CDRs that are
disclosed can be used to prepare antigen binding proteins that
contain an antigen binding region that can specifically bind to an
IL-23 polypeptide. "Antigen binding region" means a protein, or a
portion of a protein, that specifically binds a specified antigen,
such as the region that contains the amino acid residues that
interact with an antigen and confer on the antigen binding protein
its specificity and affinity for the target antigen. An antigen
binding region may include one or more CDRs and certain antigen
binding regions also include one or more "framework" regions. For
example, one or more of the CDRs listed in TABLE 3 can be
incorporated into a molecule (e.g., a polypeptide) covalently or
noncovalently to make an immunoadhesion. An immunoadhesion may
incorporate the CDR(s) as part of a larger polypeptide chain, may
covalently link the CDR(s) to another polypeptide chain, or may
incorporate the CDR(s) noncovalently. The CDR(s) enable the
immunoadhesion to bind specifically to a particular antigen of
interest (e.g., an IL-23 polypeptide).
[0124] Other antigen binding proteins include mimetics (e.g.,
"peptide mimetics" or "peptidomimetics") based upon the variable
regions and CDRs that are described herein. These analogs can be
peptides, non-peptides or combinations of peptide and non-peptide
regions. Fauchere, 1986, Adv. Drug Res. 15:29; Veber and
Freidinger, 1985, TINS p. 392; and Evans et al., 1987, J. Med.
Chem. 30:1229. Peptide mimetics that are structurally similar to
therapeutically useful peptides may be used to produce a similar
therapeutic or prophylactic effect. Such compounds are often
developed with the aid of computerized molecular modeling.
Generally, peptidomimetics are proteins that are structurally
similar to an antigen binding protein displaying a desired
biological activity, such as the ability to bind IL-23, but
peptidomimetics have one or more peptide linkages optionally
replaced by a linkage selected from, for example: --CH.sub.2NH--,
--CH.sub.2S--, --CH.sub.2--CH.sub.2--, --CH--CH-- (cis and trans),
--COCH.sub.2--, --CH(OH)CH.sub.2--, and --CH.sub.2SO--, by methods
well known in the art. Systematic substitution of one or more amino
acids of a consensus sequence with a D-amino acid of the same type
(e.g., D-lysine in place of L-lysine) may be used in certain
embodiments to generate more stable proteins. In addition,
constrained peptides comprising a consensus sequence or a
substantially identical consensus sequence variation may be
generated by methods known in the art (Rizo and Gierasch, 1992,
Ann. Rev. Biochem. 61:387), for example, by adding internal
cysteine residues capable of forming intramolecular disulfide
bridges which cyclize the peptide.
[0125] Derivatives of the antigen binding proteins that are
described herein are also provided. The derivatized antigen binding
proteins can comprise any molecule or substance that imparts a
desired property to the antigen binding protein or fragment, such
as increased half-life in a particular use. The derivatized antigen
binding protein can comprise, for example, a detectable (or
labeling) moiety (e.g., a radioactive, colorimetric, antigenic or
enzymatic molecule, a detectable bead (such as a magnetic or
electrodense (e.g., gold) bead), or a molecule that binds to
another molecule (e.g., biotin or Streptavidin)), a therapeutic or
diagnostic moiety (e.g., a radioactive, cytotoxic, or
pharmaceutically active moiety), or a molecule that increases the
suitability of the antigen binding protein for a particular use
(e.g., administration to a subject, such as a human subject, or
other in vivo or in vitro uses). Examples of molecules that can be
used to derivatize an antigen binding protein include albumin
(e.g., human serum albumin) and polyethylene glycol (PEG).
Albumin-linked and PEGylated derivatives of antigen binding
proteins can be prepared using techniques well known in the art. In
one embodiment, the antigen binding protein is conjugated or
otherwise linked to transthyretin (TTR) or a TTR variant. The TTR
or TTR variant can be chemically modified with, for example, a
chemical selected from the group consisting of dextran,
poly(n-vinyl pyrrolidone), polyethylene glycols, propropylene
glycol homopolymers, polypropylene oxide/ethylene oxide
co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
[0126] Other derivatives include covalent or aggregative conjugates
of IL-23 antigen binding proteins with other proteins or
polypeptides, such as by expression of recombinant fusion proteins
comprising heterologous polypeptides fused to the N-terminus or
C-terminus of an IL-23 antigen binding protein. For example, the
conjugated peptide may be a heterologous signal (or leader)
polypeptide, e.g., the yeast alpha-factor leader, or a peptide such
as an epitope tag. IL-23 antigen binding protein-containing fusion
proteins can comprise peptides added to facilitate purification or
identification of the IL-23 antigen binding protein (e.g.,
poly-His). An IL-23 antigen binding protein also can be linked to
the FLAG peptide as described in Hopp et al., 1988, Bio/Technology
6:1204; and U.S. Pat. No. 5,011,912. The FLAG peptide is highly
antigenic and provides an epitope reversibly bound by a specific
monoclonal antibody (mAb), enabling rapid assay and facile
purification of expressed recombinant protein. Reagents useful for
preparing fusion proteins in which the FLAG peptide is fused to a
given polypeptide are commercially available (Sigma, St. Louis,
Mo.).
[0127] Oligomers that contain one or more IL-23 antigen binding
proteins may be employed as IL-23 antagonists. Oligomers may be in
the form of covalently-linked or non-covalently-linked dimers,
trimers, or higher oligomers. Oligomers comprising two or more
IL-23 antigen binding proteins are contemplated for use, with one
example being a homodimer. Other oligomers include heterodimers,
homotrimers, heterotrimers, homotetramers, heterotetramers, etc.
Oligomers comprising multiple IL-23-binding proteins joined via
covalent or non-covalent interactions between peptide moieties
fused to the IL-23 antigen binding proteins, are also included.
Such peptides may be peptide linkers (spacers), or peptides that
have the property of promoting oligomerization. Among the suitable
peptide linkers are those described in U.S. Pat. Nos. 4,751,180 and
4,935,233. Leucine zippers and certain polypeptides derived from
antibodies are among the peptides that can promote oligomerization
of IL-23 antigen binding proteins attached thereto. Examples of
leucine zipper domains suitable for producing soluble oligomeric
proteins are described in WIPO Publication No. WO 94/10308; Hoppe
et al., 1994, FEBS Letters 344:191; and Fanslow et al., 1994,
Semin. Immunol. 6:267-278. In one approach, recombinant fusion
proteins comprising an IL-23 antigen binding protein fragment or
derivative fused to a leucine zipper peptide are expressed in
suitable host cells, and the soluble oligomeric IL-23 antigen
binding protein fragments or derivatives that form are recovered
from the culture supernatant.
[0128] Such oligomers may comprise from two to four IL-23 antigen
binding proteins. The IL-23 antigen binding protein moieties of the
oligomer may be in any of the forms described above, e.g., variants
or fragments. Preferably, the oligomers comprise IL-23 antigen
binding proteins that have IL-23 binding activity. Oligomers may be
prepared using polypeptides derived from immunoglobulins.
Preparation of fusion proteins comprising certain heterologous
polypeptides fused to various portions of antibody-derived
polypeptides (including the Fc domain) has been described, e.g., by
Ashkenazi et al., 1991, Proc. Natl. Acad. Sci. USA 88:10535; Byrn
et al., 1990, Nature 344:677; and Hollenbaugh et al., 1992
"Construction of Immunoglobulin Fusion Proteins", in Current
Protocols in Immunology, Suppl. 4, pages 10.19.1-10.19.11.
[0129] Also included are dimers comprising two fusion proteins
created by fusing an IL-23 antigen binding protein to the Fc region
of an antibody. The dimer can be made by, for example, inserting a
gene fusion encoding the fusion protein into an appropriate
expression vector, expressing the gene fusion in host cells
transformed with the recombinant expression vector, and allowing
the expressed fusion protein to assemble much like antibody
molecules, whereupon interchain disulfide bonds form between the Fc
moieties to yield the dimer. Such Fc polypeptides include native
and mutein forms of polypeptides derived from the Fc region of an
antibody. Truncated forms of such polypeptides containing the hinge
region that promotes dimerization also are included. Fusion
proteins comprising Fc moieties (and oligomers formed therefrom)
offer the advantage of facile purification by affinity
chromatography over Protein A or Protein G columns. One suitable Fc
polypeptide, described in WIPO Publication No. WO 93/10151 and U.S.
Pat. Nos. 5,426,048 and 5,262,522, is a single chain polypeptide
extending from the N-terminal hinge region to the native C-terminus
of the Fc region of a human IgG1 antibody. Another useful Fc
polypeptide is the Fc mutein described in U.S. Pat. No. 5,457,035,
and in Baum et al., 1994, EMBO J. 13:3992-4001. The amino acid
sequence of this mutein is identical to that of the native Fc
sequence presented in WIPO Publication No. WO 93/10151, except that
amino acid 19 has been changed from Leu to Ala, amino acid 20 has
been changed from Leu to Glu, and amino acid 22 has been changed
from Gly to Ala. The mutein exhibits reduced affinity for Fc
receptors.
[0130] Glycosylation
[0131] The antigen binding protein may have a glycosylation pattern
that is different or altered from that found in the native species.
As is known in the art, glycosylation patterns can depend on both
the sequence of the protein (e.g., the presence or absence of
particular glycosylation amino acid residues, discussed below), or
the host cell or organism in which the protein is produced.
Particular expression systems are discussed below.
[0132] Glycosylation of polypeptides is typically either N-linked
or O-linked. N-linked refers to the attachment of the carbohydrate
moiety to the side chain of an asparagine residue. The tri-peptide
sequences asparagine-X-serine and asparagine-X-threonine, where X
is any amino acid except proline, are the recognition sequences for
enzymatic attachment of the carbohydrate moiety to the asparagine
side chain. Thus, the presence of either of these tri-peptide
sequences in a polypeptide creates a potential glycosylation site.
O-linked glycosylation refers to the attachment of one of the
sugars N-acetylgalactosamine, galactose, or xylose, to a
hydroxyamino acid, most commonly serine or threonine, although
5-hydroxyproline or 5-hydroxylysine may also be used.
[0133] Addition of glycosylation sites to the antigen binding
protein is conveniently accomplished by altering the amino acid
sequence such that it contains one or more of the above-described
tri-peptide sequences (for N-linked glycosylation sites). The
alteration may also be made by the addition of, or substitution by,
one or more serine or threonine residues to the starting sequence
(for O-linked glycosylation sites). For ease, the antigen binding
protein amino acid sequence may be altered through changes at the
DNA level, particularly by mutating the DNA encoding the target
polypeptide at preselected bases such that codons are generated
that will translate into the desired amino acids.
[0134] Another means of increasing the number of carbohydrate
moieties on the antigen binding protein is by chemical or enzymatic
coupling of glycosides to the protein. These procedures are
advantageous in that they do not require production of the protein
in a host cell that has glycosylation capabilities for N- and
O-linked glycosylation. Depending on the coupling mode used, the
sugar(s) may be attached to (a) arginine and histidine, (b) free
carboxyl groups, (c) free sulfhydryl groups such as those of
cysteine, (d) free hydroxyl groups such as those of serine,
threonine, or hydroxyproline, (e) aromatic residues such as those
of phenylalanine, tyrosine, or tryptophan, or (f) the amide group
of glutamine. These methods are described in PCT Publication No. WO
87/05330, and in Aplin and Wriston, 1981, CRC Crit. Rev, Biochem.,
pp. 259-306.
[0135] Removal of carbohydrate moieties present on the starting
antigen binding protein may be accomplished chemically or
enzymatically. Chemical deglycosylation requires exposure of the
protein to the compound trifluoromethanesulfonic acid, or an
equivalent compound. This treatment results in the cleavage of most
or all sugars except the linking sugar (N-acetylglucosamine or
N-acetylgalactosamine), while leaving the polypeptide intact.
Chemical deglycosylation is described by Hakimuddin et al., 1987,
Arch. Biochem. Biophys. 259:52 and by Edge et al., 1981, Anal.
Biochem. 118:131. Enzymatic cleavage of carbohydrate moieties on
polypeptides can be achieved by the use of a variety of endo- and
exo-glycosidases as described by Thotakura et al., 1987, Meth.
Enzymol. 138:350. Glycosylation at potential glycosylation sites
may be prevented by the use of the compound tunicamycin as
described by Duskin et al., 1982, J. Biol. Chem. 257:3105.
Tunicamycin blocks the formation of protein-N-glycoside
linkages.
[0136] Hence, aspects include glycosylation variants of the antigen
binding proteins wherein the number and/or type of glycosylation
site(s) has been altered compared to the amino acid sequences of
the parent polypeptide. In certain embodiments, antigen binding
protein variants comprise a greater or a lesser number of N-linked
glycosylation sites than the parent polypeptide. Substitutions that
eliminate or alter this sequence will prevent addition of an
N-linked carbohydrate chain present in the parent polypeptide. For
example, the glycosylation can be reduced by the deletion of an Asn
or by substituting the Asn with a different amino acid. Antibodies
typically have a N-linked glycosylation site in the Fc region.
[0137] Labels And Effector Groups
[0138] Antigen binding proteins may comprise one or more labels.
The term "label" or "labeling group" refers to any detectable
label. In general, labels fall into a variety of classes, depending
on the assay in which they are to be detected: a) isotopic labels,
which may be radioactive or heavy isotopes; b) magnetic labels
(e.g., magnetic particles); c) redox active moieties; d) optical
dyes; enzymatic groups (e.g. horseradish peroxidase,
.beta.-galactosidase, luciferase, alkaline phosphatase); e)
biotinylated groups; and f) predetermined polypeptide epitopes
recognized by a secondary reporter (e.g., leucine zipper pair
sequences, binding sites for secondary antibodies, metal binding
domains, epitope tags, etc.). In some embodiments, the labeling
group is coupled to the antigen binding protein via spacer arms of
various lengths to reduce potential steric hindrance. Various
methods for labeling proteins are known in the art. Examples of
suitable labeling groups include, but are not limited to, the
following: radioisotopes or radionuclides (e.g., .sup.3H, .sup.14C,
.sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I,
.sup.131I), fluorescent groups (e.g., FITC, rhodamine, lanthanide
phosphors), enzymatic groups (e.g., horseradish peroxidase,
.beta.-galactosidase, luciferase, alkaline phosphatase),
chemiluminescent groups, biotinyl groups, or predetermined
polypeptide epitopes recognized by a secondary reporter (e.g.,
leucine zipper pair sequences, binding sites for secondary
antibodies, metal binding domains, epitope tags). In some
embodiments, the labeling group is coupled to the antigen binding
protein via spacer arms of various lengths to reduce potential
steric hindrance. Various methods for labeling proteins are known
in the art and may be used as is seen fit.
[0139] The term "effector group" means any group coupled to an
antigen binding protein that acts as a cytotoxic agent. Examples
for suitable effector groups are radioisotopes or radionuclides
(e.g., .sup.3H, .sup.14C, .sup.15N, .sup.35S, .sup.90Y, .sup.99Tc,
.sup.111In, .sup.125I, .sup.131I). Other suitable groups include
toxins, therapeutic groups, or chemotherapeutic groups. Examples of
suitable groups include calicheamicin, auristatins, geldanamycin
and maytansine. In some embodiments, the effector group is coupled
to the antigen binding protein via spacer arms of various lengths
to reduce potential steric hindrance.
[0140] Polynucleotides Encoding IL-23 Antigen Binding Proteins
[0141] Polynucleotides that encode the antigen binding proteins
described herein, or portions thereof, are also provided, including
polynucleotides encoding one or both chains of an antibody, or a
fragment, derivative, mutein, or variant thereof, polynucleotides
encoding heavy chain variable regions or only CDRs, polynucleotides
sufficient for use as hybridization probes, PCR primers or
sequencing primers for identifying, analyzing, mutating or
amplifying a polynucleotide encoding a polypeptide, anti-sense
nucleic acids for inhibiting expression of a polynucleotide, and
complementary sequences of the foregoing. The polynucleotides can
be any length. They can be, for example, 5, 10, 15, 20, 25, 30, 35,
40, 45, 50, 75, 85, 95, 100, 125, 150, 175, 200, 250, 300, 350,
400, 450, 500, 750, 1,000, 1,500, 3,000, 5,000 or more nucleic
acids in length, including all values in between, and/or can
comprise one or more additional sequences, for example, regulatory
sequences, and/or be part of a larger polynucleotide, for example,
a vector. The polynucleotides can be single-stranded or
double-stranded and can comprise RNA and/or DNA nucleic acids and
artificial variants thereof (e.g., peptide nucleic acids).
[0142] Polynucleotides encoding certain antigen binding proteins,
or portions thereof (e.g., full length antibody, heavy or light
chain, variable domain, or a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, or
CDRL3) may be isolated from B-cells of mice that have been
immunized with IL-23 or an immunogenic fragment thereof. The
polynucleotide may be isolated by conventional procedures such as
polymerase chain reaction (PCR). Phage display is another example
of a known technique whereby derivatives of antibodies and other
antigen binding proteins may be prepared. In one approach,
polypeptides that are components of an antigen binding protein of
interest are expressed in any suitable recombinant expression
system, and the expressed polypeptides are allowed to assemble to
form antigen binding protein molecules. Phage display is also used
to derive antigen binding proteins having different properties
(i.e., varying affinities for the antigen to which they bind) via
chain shuffling, see Marks et al., 1992, BioTechnology 10:779.
[0143] Due to the degeneracy of the genetic code, each of the
polypeptide sequences depicted herein are also encoded by a large
number of other polynucleotide sequences besides those provided.
For example, heavy chain variable domains provided herein in may be
encoded by polynucleotide sequences SEQ ID NOs: 32, 35, 37, 39, 41,
43, 45, 47, 49, 51, 53, 55, 57, or 59. Light chain variable domains
may be encoded by polynucleotide sequences SEQ ID NOs:2, 5, 6, 8,
10, 12, 14, 16, 18, 20, 22, 24, 26, or 28. One of ordinary skill in
the art will appreciate that the present application thus provides
adequate written description and enablement for each degenerate
nucleotide sequence encoding each antigen binding protein.
[0144] An aspect further provides polynucleotides that hybridize to
other polynucleotide molecules under particular hybridization
conditions. Methods for hybridizing nucleic acids, basic parameters
affecting the choice of hybridization conditions and guidance for
devising suitable conditions are well-known in the art. See, e.g.,
Sambrook, Fritsch, and Maniatis (2001, Molecular Cloning: A
Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y. and Current Protocols in Molecular Biology, 1995,
Ausubel et al., eds., John Wiley & Sons, Inc. As defined
herein, a moderately stringent hybridization condition uses a
prewashing solution containing 5.times. sodium chloride/sodium
citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer
of about 50% formamide, 6.times.SSC, and a hybridization
temperature of 55.degree. C. (or other similar hybridization
solutions, such as one containing about 50% formamide, with a
hybridization temperature of 42.degree. C.), and washing conditions
of 60.degree. C., in 0.5.times.SSC, 0.1% SDS. A stringent
hybridization condition hybridizes in 6.times.SSC at 45.degree. C.,
followed by one or more washes in 0.1.times.SSC, 0.2% SDS at
68.degree. C. Furthermore, one of skill in the art can manipulate
the hybridization and/or washing conditions to increase or decrease
the stringency of hybridization such that polynucleotides
comprising nucleic acid sequences that are at least 65%, 70%, 75%,
80%, 85%, 90%, 91%, 92, 93%, 94%, 95%, 96%, 97%, 98% or 99%
identical to each other, including all values in between, typically
remain hybridized to each other.
[0145] Changes can be introduced by mutation into a polynucleotide,
thereby leading to changes in the amino acid sequence of a
polypeptide (e.g., an antigen binding protein or antigen binding
protein derivative) that it encodes. Mutations can be introduced
using any technique known in the art, such as site-directed
mutagenesis and random mutagenesis. Mutant polypeptides can be
expressed and selected for a desired property. Mutations can be
introduced into a polynucleotide without significantly altering the
biological activity of a polypeptide that it encodes. For example,
substitutions at non-essential amino acid residues. Alternatively,
one or more mutations can be introduced into a polynucleotide that
selectively change the biological activity of a polypeptide that it
encodes. For example, the mutation can quantitatively or
qualitatively change the biological activity, such as increasing,
reducing or eliminating the activity and changing the antigen
specificity of an antigen binding protein.
[0146] Another aspect provides polynucleotides that are suitable
for use as primers or hybridization probes for the detection of
nucleic acid sequences. A polynucleotide can comprise only a
portion of a nucleic acid sequence encoding a full-length
polypeptide, for example, a fragment that can be used as a probe or
primer or a fragment encoding an active portion (e.g., an IL-23
binding portion) of a polypeptide. Probes based on the sequence of
a nucleic acid can be used to detect the nucleic acid or similar
nucleic acids, for example, transcripts encoding a polypeptide. The
probe can comprise a label group, e.g., a radioisotope, a
fluorescent compound, an enzyme, or an enzyme co-factor. Such
probes can be used to identify a cell that expresses the
polypeptide.
[0147] Methods of Expressing Antigen Binding Proteins
[0148] The antigen binding proteins provided herein may be prepared
by any of a number of conventional techniques. For example, IL-23
antigen binding proteins may be produced by recombinant expression
systems, using any technique known in the art. See, e.g.,
Monoclonal Antibodies, Hybridomas: A New Dimension in Biological
Analyses, Kennet et al. (eds.) Plenum Press, New York (1980); and
Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
(1988).
[0149] Expression systems and constructs in the form of plasmids,
expression vectors, transcription or expression cassettes that
comprise at least one polynucleotide as described above are also
provided herein, as well host cells comprising such expression
systems or constructs. As used herein, "vector" means any molecule
or entity (e.g., nucleic acid, plasmid, bacteriophage or virus)
suitable for use to transfer protein coding information into a host
cell. Examples of vectors include, but are not limited to,
plasmids, viral vectors, non-episomal mammalian vectors and
expression vectors, for example, recombinant expression vectors.
Expression vectors, such as recombinant expression vectors, are
useful for transformation of a host cell and contain nucleic acid
sequences that direct and/or control (in conjunction with the host
cell) expression of one or more heterologous coding regions
operatively linked thereto. An expression construct may include,
but is not limited to, sequences that affect or control
transcription, translation, and, if introns are present, affect RNA
splicing of a coding region operably linked thereto. "Operably
linked" means that the components to which the term is applied are
in a relationship that allows them to carry out their inherent
functions. For example, a control sequence, e.g., a promoter, in a
vector that is "operably linked" to a protein coding sequence are
arranged such that normal activity of the control sequence leads to
transcription of the protein coding sequence resulting in
recombinant expression of the encoded protein.
[0150] Another aspect provides host cells into which an expression
vector, such as a recombinant expression vector, has been
introduced. A host cell can be any prokaryotic cell (for example,
E. coli) or eukaryotic cell (for example, yeast, insect, or
mammalian cells (e.g., CHO cells)). Vector DNA can be introduced
into prokaryotic or eukaryotic cells via conventional
transformation or transfection techniques. For stable transfection
of mammalian cells, it is known that, depending upon the expression
vector and transfection technique used, only a small fraction of
cells may integrate the foreign DNA into their genome. In order to
identify and select these integrants, a gene that encodes a
selectable marker (e.g., for resistance to antibiotics) is
generally introduced into the host cells along with the gene of
interest. Preferred selectable markers include those which confer
resistance to drugs, such as G418, hygromycin and methotrexate.
Cells stably transfected with the introduced polynucleotide can be
identified by drug selection (e.g., cells that have incorporated
the selectable marker gene will survive, while the other cells
die), among other methods.
[0151] Antigen binding proteins can be expressed in hybridoma cell
lines (e.g., in particular antibodies may be expressed in
hybridomas) or in cell lines other than hybridomas. Expression
constructs encoding the antigen binding proteins can be used to
transform a mammalian, insect or microbial host cell.
Transformation can be performed using any known method for
introducing polynucleotides into a host cell, including, for
example packaging the polynucleotide in a virus or bacteriophage
and transducing a host cell with the construct by transfection
procedures known in the art, as exemplified by U.S. Pat. Nos.
4,399,216; 4,912,040; 4,740,461; 4,959,455. The optimal
transformation procedure used will depend upon which type of host
cell is being transformed. Methods for introduction of heterologous
polynucleotides into mammalian cells are well known in the art and
include, but are not limited to, dextran-mediated transfection,
calcium phosphate precipitation, polybrene mediated transfection,
protoplast fusion, electroporation, encapsulation of the
polynucleotide(s) in liposomes, mixing nucleic acid with
positively-charged lipids, and direct microinjection of the DNA
into nuclei.
[0152] Recombinant expression constructs typically comprise a
polynucleotide encoding a polypeptide. The polypeptide may comprise
one or more of the following: one or more CDRs such as provided
herein; a light chain variable region; a heavy chain variable
region; a light chain constant region; a heavy chain constant
region (e.g., C.sub.H1, C.sub.H2 and/or C.sub.H3); and/or another
scaffold portion of an IL-23 antigen binding protein. These nucleic
acid sequences are inserted into an appropriate expression vector
using standard ligation techniques. In one embodiment, the heavy or
light chain constant region is appended to the C-terminus of a
heavy or light chain variable region provided herein and is ligated
into an expression vector. The vector is typically selected to be
functional in the particular host cell employed (i.e., the vector
is compatible with the host cell machinery, permitting
amplification and/or expression of the gene can occur). In some
embodiments, vectors are used that employ protein-fragment
complementation assays using protein reporters, such as
dihydrofolate reductase (see, for example, U.S. Pat. No.
6,270,964). Suitable expression vectors can be purchased, for
example, from Invitrogen Life Technologies (Carlsbad, Calif.) or BD
Biosciences (San Jose, Calif.). Other useful vectors for cloning
and expressing the antibodies and fragments include those described
in Bianchi and McGrew, 2003, Biotech. Biotechnol. Bioeng.
84:439-44. Additional suitable expression vectors are discussed,
for example, in Methods Enzymol., vol. 185 (D. V. Goeddel, ed.),
1990, New York: Academic Press.
[0153] Typically, expression vectors used in any of the host cells
will contain sequences for plasmid maintenance and for cloning and
expression of exogenous nucleotide sequences. Such sequences,
collectively referred to as "flanking sequences" in certain
embodiments will typically include one or more of the following
nucleotide sequences: a promoter, one or more enhancer sequences,
an origin of replication, a transcriptional termination sequence, a
complete intron sequence containing a donor and acceptor splice
site, a sequence encoding a leader sequence for polypeptide
secretion, a ribosome binding site, a polyadenylation sequence, a
polylinker region for inserting the polynucleotide encoding the
polypeptide to be expressed, and a selectable marker element. The
expression vectors that are provided may be constructed from a
starting vector such as a commercially available vector. Such
vectors may or may not contain all of the desired flanking
sequences. Where one or more of the flanking sequences described
herein are not already present in the vector, they may be
individually obtained and ligated into the vector. Methods used for
obtaining each of the flanking sequences are well known to one
skilled in the art.
[0154] Optionally, the vector may contain a "tag"-encoding
sequence, i.e., an oligonucleotide molecule located at the 5' or 3'
end of the IL-23 antigen binding protein coding sequence; the
oligonucleotide sequence encodes polyHis (such as hexaHis), or
another "tag" such as FLAG.RTM., HA (hemaglutinin influenza virus),
or myc, for which commercially available antibodies exist. This tag
is typically fused to the polypeptide upon expression of the
polypeptide, and can serve as a means for affinity purification or
detection of the IL-23 antigen binding protein from the host cell.
Affinity purification can be accomplished, for example, by column
chromatography using antibodies against the tag as an affinity
matrix. Optionally, the tag can subsequently be removed from the
purified IL-23 antigen binding protein by various means such as
using certain peptidases for cleavage.
[0155] Flanking sequences may be homologous (i.e., from the same
species and/or strain as the host cell), heterologous (i.e., from a
species other than the host cell species or strain), hybrid (i.e.,
a combination of flanking sequences from more than one source),
synthetic or native. As such, the source of a flanking sequence may
be any prokaryotic or eukaryotic organism, any vertebrate or
invertebrate organism, or any plant, provided that the flanking
sequence is functional in, and can be activated by, the host cell
machinery.
[0156] Flanking sequences useful in the vectors may be obtained by
any of several methods well known in the art. Typically, flanking
sequences useful herein will have been previously identified by
mapping and/or by restriction endonuclease digestion and can thus
be isolated from the proper tissue source using the appropriate
restriction endonucleases. In some cases, the full nucleotide
sequence of a flanking sequence may be known. Here, the flanking
sequence may be synthesized using the methods described herein for
nucleic acid synthesis or cloning.
[0157] Whether all or only a portion of the flanking sequence is
known, it may be obtained using polymerase chain reaction (PCR)
and/or by screening a genomic library with a suitable probe such as
an oligonucleotide and/or flanking sequence fragment from the same
or another species. Where the flanking sequence is not known, a
fragment of DNA containing a flanking sequence may be isolated from
a larger piece of DNA that may contain, for example, a coding
sequence or even another gene or genes. Isolation may be
accomplished by restriction endonuclease digestion to produce the
proper DNA fragment followed by isolation using agarose gel
purification, Qiagen.RTM. column chromatography (Qiagen,
Chatsworth, Calif.), or other methods known to the skilled artisan.
The selection of suitable enzymes to accomplish this purpose will
be readily apparent to one of ordinary skill in the art.
[0158] An origin of replication is typically a part of those
prokaryotic expression vectors purchased commercially, and the
origin aids in the amplification of the vector in a host cell. If
the vector of choice does not contain an origin of replication
site, one may be chemically synthesized based on a known sequence,
and ligated into the vector. For example, the origin of replication
from the plasmid pBR.beta.22 (New England Biolabs, Beverly, Mass.)
is suitable for most gram-negative bacteria, and various viral
origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitus
virus (VSV), or papillomaviruses such as HPV or BPV) are useful for
cloning vectors in mammalian cells. Generally, the origin of
replication component is not needed for mammalian expression
vectors (for example, the SV40 origin is often used only because it
also contains the virus early promoter).
[0159] A transcription termination sequence is typically located 3'
to the end of a polypeptide coding region and serves to terminate
transcription. Usually, a transcription termination sequence in
prokaryotic cells is a G-C rich fragment followed by a poly-T
sequence. While the sequence is easily cloned from a library or
even purchased commercially as part of a vector, it can also be
readily synthesized using methods for nucleic acid synthesis such
as those described herein.
[0160] A selectable marker gene encodes a protein necessary for the
survival and growth of a host cell grown in a selective culture
medium. Typical selection marker genes encode proteins that (a)
confer resistance to antibiotics or other toxins, e.g., ampicillin,
tetracycline, or kanamycin for prokaryotic host cells; (b)
complement auxotrophic deficiencies of the cell; or (c) supply
critical nutrients not available from complex or defined media.
Specific selectable markers are the kanamycin resistance gene, the
ampicillin resistance gene, and the tetracycline resistance gene.
Advantageously, a neomycin resistance gene may also be used for
selection in both prokaryotic and eukaryotic host cells.
[0161] Other selectable genes may be used to amplify the gene that
will be expressed. Amplification is the process wherein genes that
are required for production of a protein critical for growth or
cell survival are reiterated in tandem within the chromosomes of
successive generations of recombinant cells. Examples of suitable
selectable markers for mammalian cells include dihydrofolate
reductase (DHFR) and promoterless thymidine kinase genes. Mammalian
cell transformants are placed under selection pressure wherein only
the transformants are uniquely adapted to survive by virtue of the
selectable gene present in the vector. Selection pressure is
imposed by culturing the transformed cells under conditions in
which the concentration of selection agent in the medium is
successively increased, thereby leading to the amplification of
both the selectable gene and the DNA that encodes another gene,
such as an antigen binding protein that binds to IL-23. As a
result, increased quantities of a polypeptide such as an antigen
binding protein are synthesized from the amplified DNA.
[0162] A ribosome-binding site is usually necessary for translation
initiation of rnRNA and is characterized by a Shine-Dalgarno
sequence (prokaryotes) or a Kozak sequence (eukaryotes). The
element is typically located 3' to the promoter and 5' to the
coding sequence of the polypeptide to be expressed.
[0163] In some cases, such as where glycosylation is desired in a
eukaryotic host cell expression system, one may manipulate the
various pre- or pro-sequences to improve glycosylation or yield.
For example, one may alter the peptidase cleavage site of a
particular signal peptide, or add prosequences, which also may
affect glycosylation. The final protein product may have, in the -1
position (relative to the first amino acid of the mature protein),
one or more additional amino acids incident to expression, which
may not have been totally removed. For example, the final protein
product may have one or two amino acid residues found in the
peptidase cleavage site, attached to the amino-terminus.
Alternatively, use of some enzyme cleavage sites may result in a
slightly truncated form of the desired polypeptide, if the enzyme
cuts at such area within the mature polypeptide.
[0164] Expression and cloning will typically contain a promoter
that is recognized by the host organism and operably linked to the
molecule encoding an IL-23 antigen binding protein. Promoters are
untranscribed sequences located upstream (i.e., 5') to the start
codon of a structural gene (generally within about 100 to 1000 bp)
that control transcription of the structural gene. Promoters are
conventionally grouped into one of two classes: inducible promoters
and constitutive promoters. Inducible promoters initiate increased
levels of transcription from DNA under their control in response to
some change in culture conditions, such as the presence or absence
of a nutrient or a change in temperature. Constitutive promoters,
on the other hand, uniformly transcribe a gene to which they are
operably linked, that is, with little or no control over gene
expression. A large number of promoters, recognized by a variety of
potential host cells, are well known. A suitable promoter is
operably linked to the DNA encoding a heavy chain variable region
or a light chain variable region of an IL-23 antigen binding
protein by removing the promoter from the source DNA by restriction
enzyme digestion and inserting the desired promoter sequence into
the vector.
[0165] Suitable promoters for use with yeast hosts are also well
known in the art. Yeast enhancers are advantageously used with
yeast promoters. Suitable promoters for use with mammalian host
cells are well known and include, but are not limited to, those
obtained from the genomes of viruses such as polyoma virus, fowlpox
virus, adenovirus (such as Adenovirus 2), bovine papilloma virus,
avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B
virus, and Simian Virus 40 (SV40). Other suitable mammalian
promoters include heterologous mammalian promoters, for example,
heat-shock promoters and the actin promoter.
[0166] Additional promoters which may be of interest include, but
are not limited to: SV40 early promoter (Benoist and Chambon, 1981,
Nature 290:304-310); CMV promoter (Thornsen et al., 1984, Proc.
Natl. Acad. U.S.A. 81:659-663); the promoter contained in the 3'
long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980,
Cell 22:787-797); herpes thymidine kinase promoter (Wagner et al.,
1981, Proc. Natl. Acad. Sci. U.S.A. 78:1444-1445); promoter and
regulatory sequences from the metallothionine gene (Prinster et
al., 1982, Nature 296:39-42); and prokaryotic promoters such as the
beta-lactamase promoter (Villa-Kamaroff et al., 1978, Proc. Natl.
Acad. Sci. U.S.A. 75:3727-3731); or the tac promoter (DeBoer et
al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:21-25). Also of
interest are the following animal transcriptional control regions,
which exhibit tissue specificity and have been utilized in
transgenic animals: the elastase I gene control region that is
active in pancreatic acinar cells (Swift et al., 1984, Cell
38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant.
Biol. 50:399-409; MacDonald, 1987, Hepatology 7:425-515); the
insulin gene control region that is active in pancreatic beta cells
(Hanahan, 1985, Nature 315:115-122); the immunoglobulin gene
control region that is active in lymphoid cells (Grosschedl et al.,
1984, Cell 38:647-658; Adames et al., 1985, Nature 318:533-538;
Alexander et al., 1987, Mol. Cell. Biol. 7:1436-1444); the mouse
mammary tumor virus control region that is active in testicular,
breast, lymphoid and mast cells (Leder et al., 1986, Cell
45:485-495); the albumin gene control region that is active in
liver (Pinkert et al., 1987, Genes and Devel. 1:268-276); the
alpha-feto-protein gene control region that is active in liver
(Krumlauf et al., 1985, Mol. Cell. Biol. 5:1639-1648; Hammer et
al., 1987, Science 253:53-58); the alpha 1-antitrypsin gene control
region that is active in liver (Kelsey et al., 1987, Genes and
Devel. 1:161-171); the beta-globin gene control region that is
active in myeloid cells (Mogram et al., 1985, Nature 315:338-340;
Kollias et al., 1986, Cell 46:89-94); the myelin basic protein gene
control region that is active in oligodendrocyte cells in the brain
(Readhead et al., 1987, Cell 48:703-712); the myosin light chain-2
gene control region that is active in skeletal muscle (Sani, 1985,
Nature 314:283-286); and the gonadotropic releasing hormone gene
control region that is active in the hypothalamus (Mason et al.,
1986, Science 234:1372-1378).
[0167] An enhancer sequence may be inserted into the vector to
increase transcription by higher eukaryotes. Enhancers are
cis-acting elements of DNA, usually about 10-300 bp in length, that
act on the promoter to increase transcription. Enhancers are
relatively orientation and position independent, having been found
at positions both 5' and 3' to the transcription unit. Several
enhancer sequences available from mammalian genes are known (e.g.,
globin, elastase, albumin, alpha-feto-protein and insulin).
Typically, however, an enhancer from a virus is used. The SV40
enhancer, the cytomegalovirus early promoter enhancer, the polyoma
enhancer, and adenovirus enhancers known in the art are exemplary
enhancing elements for the activation of eukaryotic promoters.
While an enhancer may be positioned in the vector either 5' or 3'
to a coding sequence, it is typically located at a site 5' from the
promoter. A sequence encoding an appropriate native or heterologous
signal sequence (leader sequence or signal peptide) can be
incorporated into an expression vector, to promote extracellular
secretion of the antibody. The choice of signal peptide or leader
depends on the type of host cells in which the antibody is to be
produced, and a heterologous signal sequence can replace the native
signal sequence. Examples of signal peptides that are functional in
mammalian host cells include the following: the signal sequence for
interleukin-7 described in U.S. Pat. No. 4,965,195; the signal
sequence for interleukin-2 receptor described in Cosman et al.,
1984, Nature 312:768; the interleukin-4 receptor signal peptide
described in EP Patent No. 0367 566; the type I interleukin-1
receptor signal peptide described in U.S. Pat. No. 4,968,607; the
type II interleukin-1 receptor signal peptide described in EP
Patent No. 0 460 846.
[0168] After the vector has been constructed, the completed vector
may be inserted into a suitable host cell for amplification and/or
polypeptide expression. The transformation of an expression vector
for an antigen binding protein into a selected host cell may be
accomplished by well known methods including transfection,
infection, calcium phosphate co-precipitation, electroporation,
microinjection, lipofection, DEAE-dextran mediated transfection, or
other known techniques. The method selected will in part be a
function of the type of host cell to be used. These methods and
other suitable methods are well known to the skilled artisan, and
are set forth, for example, in Sambrook et al., Molecular Cloning:
A Laboratory Manual, 3rd ed., Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, N.Y. (2001).
[0169] A host cell, when cultured under appropriate conditions,
synthesizes protein that can be subsequently collected from the
culture medium (if the host cell secretes it into the medium) or
directly from the host cell producing it (if it is not secreted).
The selection of an appropriate host cell will depend upon various
factors, such as desired expression levels, polypeptide
modifications that are desirable or necessary for activity (such as
glycosylation or phosphorylation) and ease of folding into a
biologically active molecule.
[0170] Mammalian cell lines available as hosts for expression are
well known in the art and include, but are not limited to,
immortalized cell lines available from the American Type Culture
Collection (ATCC), including but not limited to Chinese hamster
ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells,
monkey kidney cells (COS), human hepatocellular carcinoma cells
(e.g., Hep G2), and a number of other cell lines. In certain
embodiments, cell lines may be selected through determining which
cell lines have high expression levels and constitutively produce
antigen binding proteins with IL-23 binding properties. In another
embodiment, a cell line from the B cell lineage that does not make
its own antibody but has a capacity to make and secrete a
heterologous antibody can be also selected.
[0171] Use of Human IL-23 Antigen Binding Proteins for Diagnostic
and Therapeutic Purposes
[0172] Antigen binding proteins are useful for detecting IL-23 in
biological samples and identification of cells or tissues that
produce IL-23. Antigen binding proteins that specifically bind to
IL-23 may be used in diagnosis and/or treatment of diseases related
to IL-23 in a patient in need thereof. For one, the IL-23 antigen
binding proteins can be used in diagnostic assays, e.g., binding
assays to detect and/or quantify IL-23 expressed in blood, serum,
cells or tissue. In addition, IL-23 antigen binding proteins can be
used to reduce, inhibit, interfere with or modulate one or more
biological activities of IL-23 in a cell or tissue. Thus antigen
binding proteins that bind to IL-23 may have therapeutic use in
ameliorating diseases related to IL-23.
[0173] Indications
[0174] The present invention also relates to the use of IL-23
antigen binding proteins for use in the prevention or therapeutic
treatment of medical disorders, such as those disclosed herein. The
IL-23 antigen binding proteins are useful to treat a variety of
conditions in which IL-23 is associated with or plays a role in
contributing to the underlying disease or disorder or otherwise
contributes to a negative symptom.
[0175] Conditions effectively treated by IL-23 antigen binding
proteins play a role in the inflammatory response. Such
inflammatory disorders include periodontal disease; lung disorders
such as asthma; skin disorders such as psoriasis, atopic
dermatitis, contact dermatitis; rheumatic disorders such as
rheumatoid arthritis, progressive systemic sclerosis (scleroderma);
systemic lupus erythematosus; spondyloarthritis including
ankylosing spondylitis, psoriatic arthritis, enteropathic arthritis
and reactive arthritis. Also contemplated is uveitis including
Vogt-Koyanagi-Harada disease, idiopathic anterior and posterior
uveitis, and uveitis associated with spondyloarthritis. Use of
IL-23 antigen binding proteins is also contemplated for the
treatment of autoimmune disorders including multiple sclerosis;
autoimmune myocarditis; type 1 diabetes and autoimmune
thyroiditis.
[0176] Degenerative conditions of the gastrointestinal system are
treatable or preventable with IL-23 antigen binding proteins. Such
gastrointestinal disorders including inflammatory bowel disease:
Crohn's disease, ulcerative colitis and Celiac disease.
[0177] Also included are use of IL-23 antigen binding proteins in
treatments for graft-versus-host disease, and complications such as
graft rejection, resulting from solid organ transplantation, such
as heart, liver, skin, kidney, lung or other transplants, including
bone marrow transplants.
[0178] Also provided herein are methods for using IL-23 antigen
binding proteins to treat various oncologic disorders including
various forms of cancer including colon, stomach, prostate, renal
cell, cervical and ovarian cancers, and lung cancer (SCLC and
NSCLC). Also included are solid tumors, including sarcoma,
osteosarcoma, and carcinoma, such as adenocarcinoma and squamous
cell carcinoma, esophogeal cancer, gastric cancer, gall bladder
carcinoma, leukemia, including acute myelogenous leukemia, chronic
myelogenous leukemia, myeloid leukemia, chronic or acute
lymphoblastic leukemia and hairy cell leukemia, and multiple
myeloma.
[0179] Diagnostic Methods
[0180] The antigen binding proteins of the described can be used
for diagnostic purposes to detect, diagnose, or monitor diseases
and/or conditions associated with IL-23. Examples of methods useful
in the detection of the presence of IL-23 include immunoassays,
such as the enzyme linked immunosorbent assay (ELISA) and the
radioimmunoassay (RIA).
[0181] For diagnostic applications, the antigen binding protein
typically will be labeled with a detectable labeling group.
Suitable labeling groups include, but are not limited to, the
following: radioisotopes or radionuclides (e.g., .sup.3H, .sup.14C,
.sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I,
.sup.131I), fluorescent groups (e.g., FITC, rhodamine, lanthanide
phosphors), enzymatic groups (e.g., horseradish peroxidase,
3-galactosidase, luciferase, alkaline phosphatase),
chemiluminescent groups, biotinyl groups, or predetermined
polypeptide epitopes recognized by a secondary reporter (e.g.,
leucine zipper pair sequences, binding sites for secondary
antibodies, metal binding domains, epitope tags). In some
embodiments, the labelling group is coupled to the antigen binding
protein via spacer arms of various lengths to reduce potential
steric hindrance. Various methods for labelling proteins are known
in the art and may be used.
[0182] Other diagnostic methods are provided for identifying a cell
or cells that express IL-23. In a specific embodiment, the antigen
binding protein is labeled with a labeling group and the binding of
the labeled antigen binding protein to IL-23 is detected. In a
further specific embodiment, the binding of the antigen binding
protein to IL-23 is detected in vivo. In a further specific
embodiment, the IL-23 antigen binding protein is isolated and
measured using techniques known in the art. See, for example,
Harlow and Lane, 1988, Antibodies: A Laboratory Manual, New York:
Cold Spring Harbor (ed. 1991 and periodic supplements); John E.
Coligan, ed., 1993, Current Protocols In Immunology New York: John
Wiley & Sons.
[0183] Other methods provide for detecting the presence of a test
molecule that competes for binding to IL-23 with the antigen
binding proteins provided. An example of one such assay would
involve detecting the amount of free antigen binding protein in a
solution containing an amount of IL-23 in the presence or absence
of the test molecule. An increase in the amount of free antigen
binding protein (i.e., the antigen binding protein not bound to
IL-23) would indicate that the test molecule is capable of
competing for IL-23 binding with the antigen binding protein. In
one embodiment, the antigen binding protein is labeled with a
labeling group. Alternatively, the test molecule is labeled and the
amount of free test molecule is monitored in the presence and
absence of an antigen binding protein.
[0184] Methods of Treatment: Pharmaceutical Formulations, Routes of
Administration
[0185] Pharmaceutical compositions that comprise a therapeutically
effective amount of one or a plurality of the antigen binding
proteins and a pharmaceutically acceptable excipient, diluent,
carrier, solubilizer, emulsifier, preservative, and/or adjuvant are
provided. In addition, methods of treating a patient by
administering such pharmaceutical composition are included. The
term "patient" includes human patients. The terms "treat" and
"treatment" encompass alleviation or prevention of at least one
symptom or other aspect of a disorder, or reduction of disease
severity, and the like. The term "therapeutically effective amount"
or "effective amount" refers to the amount of an IL-23 antigen
binding protein determined to produce any therapeutic response in a
mammal. Such therapeutically effective amounts are readily
ascertained by one of ordinary skill in the art.
[0186] An antigen binding protein need not affect a complete cure,
or eradicate every symptom or manifestation of a disease, to
constitute a viable therapeutic agent. As is recognized in the
pertinent field, drugs employed as therapeutic agents may reduce
the severity of a given disease state, but need not abolish every
manifestation of the disease to be regarded as useful therapeutic
agents. Similarly, a prophylactically administered treatment need
not be completely effective in preventing the onset of a condition
in order to constitute a viable prophylactic agent. Simply reducing
the impact of a disease (for example, by reducing the number or
severity of its symptoms, or by increasing the effectiveness of
another treatment, or by producing another beneficial effect), or
reducing the likelihood that the disease will occur or worsen in a
subject, is sufficient. Certain methods provided herein comprise
administering to a patient an IL-23 antagonist (such as the antigen
binding proteins disclosed herein) in an amount and for a time
sufficient to induce a sustained improvement over baseline of an
indicator that reflects the severity of the particular
disorder.
[0187] As is understood in the pertinent field, pharmaceutical
compositions comprising the molecules of the invention are
administered to a patient in a manner appropriate to the
indication. Pharmaceutical compositions may be administered by any
suitable technique, including but not limited to, parenterally,
topically, or by inhalation. If injected, the pharmaceutical
composition can be administered, for example, via intra-articular,
intravenous, intramuscular, intralesional, intraperitoneal or
subcutaneous routes, by bolus injection, or continuous infusion.
Localized administration, e.g. at a site of disease or injury is
contemplated, as are transdermal delivery and sustained release
from implants. Delivery by inhalation includes, for example, nasal
or oral inhalation, use of a nebulizer, inhalation of the
antagonist in aerosol form, and the like. Other alternatives
include eyedrops; oral preparations including pills, syrups,
lozenges or chewing gum; and topical preparations such as lotions,
gels, sprays, and ointments.
[0188] Use of antigen binding proteins in ex vivo procedures also
is contemplated. For example, a patient's blood or other bodily
fluid may be contacted with an antigen binding protein that binds
IL-23 ex vivo. The antigen binding protein may be bound to a
suitable insoluble matrix or solid support material.
[0189] Advantageously, antigen binding proteins are administered in
the form of a composition comprising one or more additional
components such as a physiologically acceptable carrier, excipient
or diluent. Optionally, the composition additionally comprises one
or more physiologically active agents for combination therapy. A
pharmaceutical composition may comprise an IL-23 antigen binding
protein together with one or more substances selected from the
group consisting of a buffer, an antioxidant such as ascorbic acid,
a low molecular weight polypeptide (such as those having fewer than
10 amino acids), a protein, an amino acid, a carbohydrate such as
glucose, sucrose or dextrins, a chelating agent such as EDTA,
glutathione, a stabilizer, and an excipient. Neutral buffered
saline or saline mixed with conspecific serum albumin are examples
of appropriate diluents. In accordance with appropriate industry
standards, preservatives such as benzyl alcohol may also be added.
The composition may be formulated as a lyophilizate using
appropriate excipient solutions (e.g., sucrose) as diluents.
Suitable components are nontoxic to recipients at the dosages and
concentrations employed. Further examples of components that may be
employed in pharmaceutical formulations are presented in any
Remington's Pharmaceutical Sciences including the 21.sup.st Ed.
(2005), Mack Publishing Company, Easton, Pa.
[0190] Kits for use by medical practitioners include an IL-23
antigen binding protein and a label or other instructions for use
in treating any of the conditions discussed herein. In one
embodiment, the kit includes a sterile preparation of one or more
IL-23 binding antigen binding proteins, which may be in the form of
a composition as disclosed above, and may be in one or more
vials.
[0191] Dosages and the frequency of administration may vary
according to such factors as the route of administration, the
particular antigen binding proteins employed, the nature and
severity of the disease to be treated, whether the condition is
acute or chronic, and the size and general condition of the
subject. Appropriate dosages can be determined by procedures known
in the pertinent art, e.g. in clinical trials that may involve dose
escalation studies.
[0192] A typical dosage may range from about 0.1 pg/kg to up to
about 30 mg/kg or more, depending on the factors mentioned above.
In specific embodiments, the dosage may range from 0.1 pg/kg up to
about 30 mg/kg, optionally from 1 pg/kg up to about 30 mg/kg,
optionally from 10 pg/kg up to about 10 mg/kg, optionally from
about 0.1 mg/kg to 5 mg/kg, or optionally from about 0.3 mg/kg to 3
mg/kg.
[0193] Dosing frequency will depend upon the pharmacokinetic
parameters of the particular human IL-23 antigen binding protein in
the formulation used. Typically, a clinician administers the
composition until a dosage is reached that achieves the desired
effect. The composition may therefore be administered as a single
dose, or as two or more doses (which may or may not contain the
same amount of the desired molecule) over time, or as a continuous
infusion via an implantation device or catheter. Appropriate
dosages may be ascertained through use of appropriate dose-response
data. An IL-23 antigen binding protein of the invention may be
administered, for example, once or more than once, e.g., at regular
intervals over a period of time. In particular embodiments, an
IL-23 antigen binding protein is administered over a period of at
least a month or more, e.g., for one, two, or three months or even
indefinitely. For treating chronic conditions, long-term treatment
is generally most effective. However, for treating acute
conditions, administration for shorter periods, e.g. from one to
six weeks, may be sufficient. In general, the antigen binding
protein is administered until the patient manifests a medically
relevant degree of improvement over baseline for the chosen
indicator or indicators.
[0194] It is contemplated that an IL-23 antigen binding protein be
administered to the patient in an amount and for a time sufficient
to induce an improvement, preferably a sustained improvement, in at
least one indicator that reflects the severity of the disorder that
is being treated. Various indicators that reflect the extent of the
patient's illness, disease or condition may be assessed for
determining whether the amount and time of the treatment is
sufficient. Such indicators include, for example, clinically
recognized indicators of disease severity, symptoms, or
manifestations of the disorder in question. In one embodiment, an
improvement is considered to be sustained if the subject exhibits
the improvement on at least two occasions separated by two to four
weeks. The degree of improvement generally is determined by a
physician, who may make this determination based on signs,
symptoms, biopsies, or other test results, and who may also employ
questionaires that are administered to the subject, such as
quality-of-life questionaires developed for a given disease.
[0195] Particular embodiments of methods and compositions of the
invention involve the use of an IL-23 antigen binding protein and
one or more additional IL-23 antagonists, for example, two or more
antigen binding proteins of the invention, or an antigen binding
protein of the invention and one or more other IL-23 antagonists.
Also provided are IL-23 antigen binding proteins administered alone
or in combination with other agents useful for treating the
condition with which the patient is afflicted. Examples of such
agents include both proteinaceous and non-proteinaceous drugs. Such
agents include therapeutic moieties having anti-inflammatory
properties (for example, non-steroidal anti-inflammatory agents,
steroids, immunomodulators and/or other cytokine inhibitors such as
those that antagonize, for example, IFN-.gamma., GM-CSF, IL-6,
IL-8, IL-17, IL-22 and TNFs), or of an IL-23 antigen binding
protein and one or more other treatments (e.g., surgery,
ultrasound, or treatment effective to reduce inflammation). When
multiple therapeutics are co-administered, dosages may be adjusted
accordingly, as is recognized or known in the pertinent art. Useful
agents that may be combined with IL-23 antigen binding proteins
include those used to treat, for example, Crohn's disease or
ulcerative colitis, such as aminosalicylate (for example,
mesalamine), corticosteroids (including predisone), antibiotics
such as metronidazole or ciprofloxacin (or other antibiotics useful
for treating, for example, patients afflicted with fistulas), and
immunosuppressives such as azathioprine, 6-mercaptopurine,
methotrexate, tacrolimus and cyclosporine. Such agent(s) may be
administered orally or by another route, for example via
suppository or enema. Agents which may be combined with IL-23
binding proteins in treatment of psoriasis include corticosteroids,
calcipotriene and other vitamin D derivatives, acetretin and other
retinoic acid derivatives, methotrexate, tacrolimus, and
cyclosporine used topically or systemically. Such agents can be
administered simultaneously, consecutively, alternately, or
according to any other regimen that allows the total course of
therapy to be effective.
[0196] In addition to human patients, IL-23 antigen binding
proteins are useful in the treatment of non-human animals, such as
domestic pets (dogs, cats, birds, primates, etc.), domestic farm
animals (horses cattle, sheep, pigs, birds, etc). In such
instances, an appropriate dose may be determined according to the
animal's body weight. For example, a dose of 0.2-1 mg/kg may be
used. Alternatively, the dose is determined according to the
animal's surface area, an exemplary dose ranging from 0.1-20 mg/m2,
or more preferably, from 5-12 mg/m2. For small animals, such as
dogs or cats, a suitable dose is 0.4 mg/kg. IL-23 antigen binding
protein (preferably constructed from genes derived from the
recipient species) is administered by injection or other suitable
route one or more times per week until the animal's condition is
improved, or it may be administered indefinitely.
[0197] The following examples, including the experiments conducted
and the results achieved, are provided for illustrative purposes
only and are not to be construed as limiting the scope of the
appended claims.
EXAMPLES
Example 1
Generation of Human IL-23 Antibodies
[0198] XenoMouse.TM. technology (Amgen, Thousand Oaks, Calif.) was
used to develop human monoclonal antibodies that recognize and
inhibit native human IL-23 activity while sparing human IL-12. The
antibodies also recognize and inhibit recombinant cynomologous
IL-23 but do not recognize murine or rat IL-23.
[0199] Antibodies were selected for recognition and complete
inhibition of native human IL-23 obtained from human
monocyte-derived dendritic cells (MoDCs), using the STAT-luciferase
reporter assay described below. Human monocytes were isolated from
peripheral blood mononuclear cells from healthy donors using
negative selection (Monocyte Isolation Kit II, Miltenyi Biotec,
Auburn, Calif.). MoDCs were generated by culturing monocytes with
human GM-CSF (50 ng/ml) and human IL-4 (100 ng/ml) for 7 days in
RPMI 1640 with 10% fetal bovine serum complete medium. MoDCs were
then washed twice with PBS followed by stimulation with human CD40L
(1 pg/ml) for an additional 48 hours. CD40L-stimulated MoDC
supernatant contains IL-23, IL-12 and IL-12/23p40. ELISAs are used
to determine the amount of IL-12p70 (R&D System, Minneapolis,
Minn.), IL-23 (eBiosciences, San Diego, Calif.) and IL-12/23p40
(R&D Systems). The STAT-luciferase assay responds to IL-23 and
not to IL-12 or to free IL-12/23p40, therefore the assay could be
used with crude supernatants to assess IL-23 activity. For use in
the NK cell assay, described below, the native human IL-23 crude
supernatant was purified using an IL-23 affinity column followed by
size exclusion chromatography. Concentration was determined using
an IL-23 specific ELISA (eBiosciences).
[0200] The purified antibody supernatants were also tested against
recombinant human (rhu) IL-23 and recombinant cynomolgous (cyno)
IL-23 in the STAT-luciferase assay. Of the antibodies tested that
completely inhibited recombinant human IL-23, only half of those
antibodies recognized and completely inhibited native human IL-23.
Recognition and complete inhibition of recombinant human IL-23 was
not predictive of, nor correlated to, recognition and complete
inhibition of native human IL-23. As shown in FIGS. 1A and 1B, of
the antibody supernatants that completely inhibited recombinant
human IL-23, only half of those antibodies completely inhibited
native human IL-23. Those antibodies that recognized and completely
inhibited native human IL-23 were selected for further
characterization.
Example 2
Functional Assays
[0201] a) STAT-Luciferase Assay
[0202] It is known that IL-23 binds its heterodimeric receptor and
signals through JAK2 and Tyk2 to activate STAT 1, 3, 4 and 5. In
this assay, cells transfected with a STAT/luciferase reporter gene
are used to assess the ability of the IL-23 antibodies to inhibit
IL-23-induced bioactivity.
[0203] Chinese hamster ovary cells expressing human IL-23 receptor
are transiently transfected with STAT-luciferase reporter
overnight. IL-23 antibodies are serially diluted (12 points of 1:4
serial dilutions starting at 37.5 .mu.g/ml) into 96 well plates.
Native human IL-23 (preparation method is described in Example 1)
is added to each well at a concentration of 2 ng/ml and incubated
at room temperature for 15-20 minutes. The transiently transfected
cells are added (8.times.10.sup.3 cells) to a final volume of 100
.mu.l/well and incubated for 5 hours at 37.degree. C., 10%
CO.sub.2. Following incubation, cells are lysed using 100
.mu.L/well Glo Lysis buffer (1.times.) (Promega, Madison, Wis.) at
room temperature for 5 minutes. Fifty microliters of cell lysate is
added to a 96 well plate along with 50 .mu.L Bright-Glo luciferase
substrate (Promega) and read on a luminometer.
[0204] Statistical analysis can be performed using GraphPad PRISM
software (GraphPad Software, La Jolla, Calif.). Results can be
expressed as the mean.+-.standard deviation (SD).
[0205] As seen in TABLE 5, all IL-23 antibodies potently and
completely inhibited native human IL-23-induced STAT/luciferase
reporter in a dose dependent manner. The antibodies also potently
and completely inhibited recombinant human (rhu) IL-23 and
recombinant cyno (cyno) IL-23. The antibodies all had IC.sub.50
values in the picomolar range.
TABLE-US-00005 TABLE 5 Table of mean IC.sub.50 (pM) values for
IL-23 antibodies in the STAT-luciferase assay. Native huIL-23
rhuIL-23 Cyno IL-23 antibody IC.sub.50 +/- SD Repeats IC.sub.50 +/-
SD Repeats IC.sub.50 +/- SD Repeats A 114 +/- 70 3 190 +/- 99 3 379
+/- 213 3 B 45 +/- 5 4 100 +/- 59 4 130 +/- 60 3 C 107 +/- 31 3 211
+/- 93 3 376 +/- 89 3 D 65 +/- 5 3 107 +/- 30 3 184 +/- 77 3 E 140
+/- 52 3 142 +/- 52 3 188 +/- 59 3 F 86 +/- 47 4 187 +/- 116 4 366
+/- 219 4 G 156 +/- 74 5 296 +/- 133 5 421 +/- 174 5 H 192 +/- 35 4
253 +/- 184 4 1024 +/- 533 4 I 208 +/- 33 3 338 +/- 140 3 650 +/-
42 3 J 83 +/- 54 2 36 +/- 6 2 56 +/- 2 2 K 71 +/- 38 3 43 +/- 20 3
61 +/- 10 3 L 113 +/- 80 3 23 +/- 7 3 47 +/- 1 3 M 34 +/- 11 2 40
+/- 8 2 56 +/- 6 2 N 361 +/- 164 3 145 1 238 1
[0206] b) NK Cell Assay
[0207] It is known that IL-23 acts on natural killer cells to
induce expression of pro-inflammatory cytokines, such as interferon
.gamma. (IFN.gamma.). In this assay, human primary natural killer
(NK) cells are used to assess the ability of the IL-23 antibodies
to inhibit IL-23-induced IFN.gamma. activity in cells expressing
the native receptor for human IL-23.
[0208] NK cells are isolated from multiple human donors via
negative selection (NK Cell Isolation Kit, Miltenyi Biotec, Auburn,
Calif.). Purified NK cells (1.times.10.sup.6 cells/ml) are added to
6 well plates in RPMI 1640 plus 10% fetal bovine serum complete
medium supplemented with recombinant human IL-2 (10 ng/ml, R&D
Systems, Minneapolis, Minn.), to a final volume of 10 ml/well.
Cells are cultured for 7 days at 37.degree. C., 5% CO.sub.2. The
IL-2-activated NK cells are then stimulated with rhuIL-23 or cyno
IL-23 (10 ng/ml) and recombinant human IL-18 (20 ng/ml, R&D
Systems, Minneapolis, Minn.) in the presence of serial dilutions
(11 points of 1:3 serial dilutions starting at 3 .mu.g/ml) of IL-23
antibodies for 24 hours. IFN.gamma. levels are measured in the
supernatant by IFN.gamma. ELISA (R&D Systems, Minneapolis,
Minn.) according to manufacturer's instructions.
[0209] Statistical analysis can be performed using GraphPad PRISM
software. Results can be expressed as the mean.+-.standard
deviation (SD).
[0210] As seen in TABLE 6, all antibodies potently inhibited
rhuIL-23 and cyno IL-23-induced IFN.gamma. expression in NK cells
in a dose dependent manner. The antibodies all had IC.sub.50 values
in the picomolar range. The assay was performed on a subset of
antibodies using native human IL-23 (30 .mu.g/ml, preparation
method is described in Example 1) and rhuIL-18 (40 ng/ml, R&D
Systems) and yielded the results shown in TABLE 6. Consistent with
the selection for IL-23 specific antibodies, these anti-IL-23
antibodies had no effect on IL-12 stimulated IFN.gamma. production
in NK cells using the assay described above, whereas an IL-12p35
specific neutralizing antibody, mAb219 (R&D Systems,
Minneapolis, Minn.) potently inhibited recombinant human IL-12.
TABLE-US-00006 TABLE 6 Table of mean IC.sub.50 (pM) values for IL-
23 antibodies in the NK cell assay. Native huIL-23 rhuIL-23 Cyno
IL-23 anti- Re- Re- Re- body IC.sub.50 +/- SD peats IC.sub.50 +/-
SD peats IC.sub.50 +/- SD peats A 42 +/- 12 2 31 +/- 21 2 B 85 +/-
30 2 48 +/- 30 3 19 +/- 8 2 C 32 +/- 19 4 29 +/- 16 2 D 37 +/- 21 2
29 +/- 19 2 E 158 +/- 50 2 57 +/- 14 3 21 +/- 3 2 F 25 +/- 15 2 21
+/- 17 2 G 152 +/- 72 2 45 +/- 30 3 23 +/- 8 2 H 29 +/- 28 2 33 +/-
17 2 I 69 1 52 1 J 4 +/- 3 2 5 +/- 3 2 K 7 +/- 2 2 8 +/- 6 2 L 3
+/- 1 2 4 +/- 1 2 M 8 1 12 1
[0211] c) Human Whole Blood Assay
[0212] Human whole blood is collected from multiple healthy donors
using Refludan.RTM. (Bayer Pittsburgh, Pa.) as an anti-coagulant.
The final concentration of Refludan.RTM. in whole blood is 10
.mu.g/ml. A stimulation mixture of rhuIL-23 or cyno IL-23 (final
concentration 1 ng/ml)+rhuIL-18 (final concentration 20
ng/ml)+rhuIL-2 (final concentration 5 ng/ml) in RPMI 1640+10% FBS,
is added to a 96 well plate, final volume 20 .mu.l/well. Serially
diluted IL-23 antibodies (11 points of 1:3 serial dilutions
starting from 3 .mu.g/ml) are added at 20 .mu.l/well and incubated
with the stimulation mixture for 30 minutes at room temperature.
Whole blood is then added (120 .mu.l/well) and the final volume
adjusted to 200 .mu.l/well with RPMI 1640+10% FBS. The final
concentration of whole blood is 60%. The plates are incubated for
24 hours at 37.degree. C., 5% CO.sub.2. Cell free supernatants are
harvested and IFN.gamma. levels are measured from the supernatants
by IFN.gamma. ELISA (R&D Systems) according to manufacturer's
instructions.
[0213] Statistical analysis can be performed using GraphPad PRISM
software. Results can be expressed as the mean.+-.standard
deviation (SD).
[0214] As seen in TABLE 7, all antibodies potently inhibited
rhuIL-23-induced and cyno-IL-23-induced IFN.gamma. expression in
whole blood cells in a dose dependent manner. The antibodies all
had IC.sub.50 values in the picomolar range.
TABLE-US-00007 TABLE 7 Table of mean IC.sub.50 (pM) values for
IL-23 antibodies in the IFN.gamma. human whole blood assay rhuIL-23
Cyno IL-23 antibody IC.sub.50 +/- SD Repeats IC.sub.50 +/- SD
Repeats B 117 +/- 94 7 161 +/- 95 6 E 29 +/- 8 3 54 +/- 33 3 G 53
+/- 13 3 93 +/- 44 3 F 66 +/- 13 3 166 +/- 189 3 D 88 +/- 6 3 110
+/- 14 3 C 97 +/- 31 3 186 +/- 194 3
[0215] d) IL-22 Assay
[0216] It is known that IL-23 is a potent inducer of
proinflammatory cytokines. IL-23 acts on activated and memory T
cells and promotes the survival and expansion of Th17 cells which
produce proinflammatory cytokines including IL-22. In this assay,
human whole blood is used to assess the ability of the IL-23
antibodies to inhibit IL-23-induced IL-22 production.
[0217] A whole blood assay is conducted in the same manner as
described above with the modification of using rhuIL-23 or
cynoIL-23 at 1 ng/ml and rhuIL-18 at 10 ng/ml to induce IL-22
production. IL-22 concentration is determined by IL-22 ELISA
(R&D Systems, Minneapolis, Minn.).
[0218] As seen in TABLE 8, the antibodies potently inhibited
rhuIL-23-induced and cyno IL-23-induced IL-22 production in whole
blood cells in a dose dependent manner. The antibodies all had
IC.sub.50 values in the picomolar range.
TABLE-US-00008 TABLE 8 Table of mean IC.sub.50 (pM) values for
IL-23 antibodies in the IL-22 human whole blood assay rhuIL-23 Cyno
IL-23 antibody IC.sub.50 +/- SD Repeats IC.sub.50 +/- SD Repeats B
117 +/- 68 4 113 +/- 65 3 E 87 +/- 109 3 56 +/- 60 3 G 83 +/- 59 3
66 +/- 45 3
Example 3
Determining the Equilibrium Dissociation Constant (K.sub.D) for
Anti-IL-23 Antibodies Using KinExA Technology
[0219] Binding affinity of rhuIL-23 to IL-23 antibodies is
evaluated using a kinetic exclusion assay (KinExA assay, Sapidyne
Instruments, Inc., Boise, Id.). Normal human serum (NHS)-activated
Sepharose 4 fast flow beads (Amersham Biosciences, part of GE
Healthcare, Uppsala, Sweden), are pre-coated with rhuIL-23 and
blocked with 1m Tris buffer with 10 mg/mL BSA. 50 pM of IL-23
antibody is incubated with rhuIL-23 (12 points of 1:2 dilutions
starting from 800 pM) at room temperature for 72 hours before it is
run through the rhuIL-23-coated Sepharose beads. The amount of the
bead-bound antibody was quantified by fluorescent (Cy5) labeled
goat anti-human-Fc antibody (Jackson Immuno Research, West Grove,
Pa.). The binding signal is proportional to the amount of free
antibody at equilibrium.
[0220] The dissociation equilibrium constant (K.sub.D) and the
association rate (K.sub.on) are obtained from curve fitting using
KinExA Pro software. The dissociation rate (K.sub.off) is derived
from: K.sub.D=K.sub.off/K.sub.on
[0221] As seen in TABLE 9, the antibodies have high affinity for
binding to human IL-23. All had K.sub.D values in the low to sub pM
range.
TABLE-US-00009 TABLE 9 Table of K.sub.D (pM), K.sub.on (1/MS) and
K.sub.off (1/s) rates Antibody KD (pM) Kon (1/MS) Koff (1/s) E
0.131 9.12E+05 1.4E-07 D 0.126 1.72E+06 2.2E-07 B 3.99 1.17E+06
4.7E-06 C 2.56 1.36E+06 4.1E-06 F 2.62 5.69E+05 1.5E-06 L 1.08
3.34E+06 3.7E-06 G 2.00 4.00E+05 8.1E-07
Example 4
Structure Determination Using X-Ray Crystallography
[0222] One way to determine the structure of an antibody-antigen
complex is by using X-ray crystallography, see for example, Harlow
and Lane Antibodies: A Laboratory Manual Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y. (1990), p. 23. The
crystal structure of IL-23 has been determined, (see Lupardus and
Garcia, J Mol Biol, 2008, 382: 931-941) and the crystal structure
of an IL-23/Fab complex has been disclosed, (see Beyer et al. J Mol
Biol, 2008. 382(4): 942-55). Structural determination of IL-23 with
Fab fragments of antibodies claimed herein was obtained using X-ray
crystallography.
Protein for Crystallization
[0223] A recombinantly derived human IL-23 heterodimer was used for
the crystallization studies (see Beyer et al., supra). The sequence
of the human p19 subunit comprised of residues 20-189 of SEQ ID NO:
145, the signal sequence of SEQ ID NO:154 and a C-terminal 6-His
tag SEQ ID NO:155. The sequence of the human p40 subunit was
mutated from asparagine to glutamine at position 222 of SEQ ID
NO:147 in order to prevent glycosylation at this site (Beyer, et
al., supra).
[0224] Fabs derived from Antibody B and Antibody E were expressed
on an IgG1 scaffold that incorporated a caspase cleavage site. The
Fabs were processed by means of protease cleavage.
Complex Formation and Crystallization
[0225] The IL-23-Antibody B Fab complex was made by mixing a
2.times. molar excess of the Antibody B Fab with the human
heterodimeric IL-23 described above. The complex was purified by
size exclusion chromatography to remove excess Antibody B Fab and
concentrated to .about.12 mg/ml for crystallization. The
IL-23-Antibody B Fab complex crystallized in 0.1 M Hepes pH 7, 8%
PEG 8000.
[0226] The IL-23-Antibody E Fab complex was made by mixing a
2.times. molar excess of the Antibody E Fab with the human
heterodimeric IL-23 described above. The complex was methylated
using a JBS Methylation Kit according to manufacturer's
instructions (Jena Bioscience, Jena, Germany). The complex was then
treated with PNGase to deglycosylate the protein. Following these
treatments, the complex was purified by size exclusion
chromatography to remove excess Antibody E Fab and concentrated to
13.5 mg/ml for crystallization. The IL-23-Antibody E Fab complex
crystallized in 0.1 M Tris pH 8.5, 0.2 M magnesium chloride, 15%
PEG 4000.
Data Collection and Structure Determination
[0227] IL-23-Antibody B Fab crystals grew in the P2.sub.1 space
group with unit cell dimensions a=70.93, b=71.27, c=107.37 .ANG.,
.beta.=104.98.degree. and diffract to 2.0 .ANG. resolution. The
IL-23-Antibody B Fab structure was solved by molecular replacement
with the program MOLREP (CCP4, The CCP4 suite: programs for protein
crystallography. Acta Crystallogr D Biol Crystallogr, 1994. 50(Pt
5): p. 760-3) using the IL-23 structure (Beyer et al. supra) as the
starting search model. Keeping the IL-23 solution fixed, an
antibody variable domain was used as a search model. Keeping the
IL-23-antibody variable domain solution fixed, an antibody constant
domain was used as a search model. The complete structure was
improved with multiple rounds of model building with Quanta and
refinement with cnx (Brunger, et al., Acta Crystallogr D Biol
Crystallogr, 1998, 54(Pt 5): p. 905-21).
[0228] Distances between protein atoms were calculated using the
program PyMOL (DeLano, W. L. The PyMOL Graphics System. Palo Alto,
2002) (Schrodinger, LLC; New York, N.Y.)). Amino acids were chosen
if at least one atom was located within the required distance
threshold to the partner protein.
[0229] Boundaries of the A, B, C and D helices of the p19 subunit
of IL-23 when bound to the Antibody B Fab include A helix residues
28-47, B helix residues 86-105, C helix residues 119-134 and D
helix residues 154-187 of SEQ ID NO:145.
[0230] The regions of interaction on the IL-23p19 subunit when
bound to the Antibody B Fab include residues within Ser46-Glu58,
Glu112-Glu123 and Pro155-Phe163 of SEQ ID NO:145.
[0231] IL-23p19 subunit amino acid residues with atoms 4 .ANG. or
less from the Antibody B Fab include Ser46, Ala47, His48, Pro49,
Leu50, His53, Met54, Asp55, Glu58, Pro113, Ser114, Leu115, Leu116,
Pro120, Val121, Trp156, Leu159, Leu160, Arg162 and Phe163 of SEQ ID
NO:145. IL-23p19 amino acid residues with atoms between 4 .ANG. and
5 .ANG. from the Antibody B Fab include Val51, Arg57, Glu112,
Asp118, Ser119, Gln123, Pro155 of SEQ ID NO:145.
[0232] IL-23p40 subunit amino acid residues with atoms 4 .ANG. or
less from the Antibody B Fab include Glu 122 and Lys 124 of SEQ ID
NO:147.
[0233] The Antibody B Fab heavy chain amino acid residues with
atoms 4 .ANG. or less from the IL-23 heterodimer include Gly32,
Gly33, Tyr34, Tyr35, His54, Asn58, Thr59, Tyr60, Lys66, Arg101,
Gly102, Phe103, Tyr104 and Tyr105 of SEQ ID NO:46. The Antibody B
Fab heavy chain amino acid residues with atoms .ltoreq.5 .ANG. from
the IL-23 heterodimer include Ser31, Gly32, Gly33, Tyr34, Tyr35,
His54, Ser56, Asn58, Thr59, Tyr60, Lys66, Arg101, Gly102, Phe103,
Tyr104 and Tyr105 of SEQ ID NO:46.
[0234] The Antibody B Fab light chain amino acid residues with
atoms 4 .ANG. or less from the IL-23 heterodimer include Ser30,
Ser31, Trp32, Tyr49, Ser52, Ser53, Ala91, Asn92, Ser93, Phe94, and
Phe96 of SEQ ID NO:15. The Antibody B Fab light chain amino acid
residues with atoms .ltoreq.5 .ANG. from the IL-23 heterodimer
include Ser30, Ser31, Trp32, Tyr49, Ala50, Ser52, Ser53, Ser56,
Ala91, Asn92, Ser93, Phe94, and Phe96 of SEQ ID NO:15
[0235] The IL-23-Antibody E Fab complex crystals grew in the
P222.sub.1 space group with unit cell dimensions a=61.60, b=97.59,
c=223.95 .ANG. and diffract to 3.5 .ANG. resolution. The
IL-23-Antibody E Fab complex structure was solved by molecular
replacement with the program Phaser (CCP4, supra) using the IL-23
structure, an antibody variable domain, and an antibody constant
domain as the three starting search models, as described above. The
complete structure was improved with multiple rounds of model
building with Quanta and refinement with cnx (Brunger, et al.,
supra). The Antibody E Fab constant domain was left out of the
final refined structure due to very poor electron density for that
portion of the protein.
[0236] The regions of interaction on the IL-23p19 subunit
identified when bound to the Antibody E Fab include residues within
Ser46-His53, Glu112-Val120 and Trp156-Phe163 of SEQ ID NO:145.
[0237] IL-23p19 amino acid residues with atoms 4 .ANG. or less from
the Antibody E Fab include Ser46, Ala47, His48, Pro49, Leu50,
Glu112, Pro113, Ser114, Leu115, Leu116, Pro11117, Asp118, Ser119,
Pro120, Trp156, Leu159, Leu160 and Phe163 of SEQ ID NO: 145.
IL-23p19 amino acid residues with atoms between 4 .ANG. and 5 .ANG.
from the Antibody E Fab include His53 of SEQ ID NO:145.
[0238] IL-23p40 amino acid residues with atoms 4 .ANG. or less from
the Antibody E Fab include Lys121, Glu 122, Pro123 and Asn 125 of
SEQ ID NO:147.
[0239] The Antibody E Fab heavy chain amino acid residues with
atoms 4 .ANG. or less from the IL-23 heterodimer include Gly26,
Phe27, Thr28, Ser31, Tyr53, Tyr59, Tyr102, Ser104, Ser105, Trp106,
Tyr107, and Pro108 of SEQ ID NO:31. The Antibody E Fab heavy chain
amino acid residues with atoms .ltoreq.5 .ANG. from the IL-23
heterodimer include Gln1, Gly26, Phe27, Thr28, Ser30, Ser31, Tyr32,
Trp52, Tyr53, Tyr59, Arg100, Tyr102, Thr103, Ser104, Ser105,
Trp106, Tyr107, and Pro108 of SEQ ID NO:31.
[0240] The Antibody E Fab light chain amino acid residues with
atoms 4 .ANG. or less from the IL-23 heterodimer include Ala31,
Gly32, Tyr33, Asp34, Tyr51, Gly52, Asn55, Lys68, and Tyr93 of SEQ
ID NO:1. The Antibody B Fab light chain amino acid residues with
atoms .ltoreq.5 .ANG. from the IL-23 heterodimer include Thr29,
Ala31, Gly32, Tyr33, Asp34, Tyr51, Gly52, Asn55, Lys68, Tyr93, and
Trp100 of SEQ ID NO:1.
Example 5
Determination of IL-23-Antibody Complex Contact Residues Through
Solvent Accessible Surface Area Differences
[0241] The residue contacts in the paratope (the portion of the
antibody that recognizes the antigen) and the portion of the
antigen that it binds bound by the paratope in a human
IL-23-Antibody B Fab complex and in a human IL-23-Antibody E Fab
complex were determined using solvent accessable surface area
differences. The solvent accessible surface area calculations were
performed using Molecular Operating Environment (Chemical Computing
Group, Montreal, Quebec).
[0242] The solvent accessible surface area differences of the
paratope residues in the IL-23-Antibody B Fab complex were
calculated by setting the Antibody B Fab residues as the desired
set. The structural information obtained in Example 4 for the
IL-23-Antibody B Fab complex was used and the residue solvent
accessible surface area of the amino acid residues of the Antibody
B Fab in the presence of the IL-23 heterodimer were calculated and
represent the "bound areas" for the set.
[0243] The residue solvent accessible surface area of each of the
Antibody B Fab residues in the absence of the IL-23 antigen were
calculated and represent the "free areas" of the set.
[0244] The "bound areas" were then subtracted from the "free areas"
resulting in the "solvent exposed surface area difference" for each
residue in the set. The Antibody B Fab residues that had no change
in surface area, or a zero difference, had no contact with the
residues of the IL-23 antigen when complexed. The Antibody B Fab
residues that had a difference value .gtoreq.10 .ANG..sup.2 were
considered to be in significant contact with residues in the IL-23
antigen such that these Antibody B Fab residues were at least
partially to completely occluded when the Antibody B Fab was bound
to human IL-23. This set of Antibody B Fab residues make up the
"covered patch", the residues involved in the structure of the
interface when Antibody B Fab is bound to human IL-23, see Tables
10 and 11. The Antibody B Fab residues in this covered patch may
not be involved in binding interactions with residues of the IL-23
antigen, but mutation of any single residue within the covered
patch could introduce energetic differences that would impact the
binding of Antibody B Fab to human IL-23. With the exception of
Tyr49, all of the residues are located in the CDR regions of the
Antibody B Fab light and heavy chains. These residues were also
within 5 .ANG. or less of the 11-23 antigen when bound to the
Antibody B Fab, as described in Example 4.
TABLE-US-00010 TABLE 10 Solvent Accessibility Surface Area
Differences for Antibody B Fab Light Chain Residue Residue Position
Solvent exposed surface area AHO Number SEQ ID NO: 15 difference
(.ANG..sup.2) Ser32 Ser30 44.9 Ser33 Ser31 41.1 Trp40 Trp32 79.0
Tyr57 Tyr49 40.7 Ala58 Ala50 20.3 Ser68 Ser52 43.6 Ser69 Ser53 38.9
Ser72 Ser56 19.1 Asn110 Asn92 34.0 Phe135 Phe94 51.4
TABLE-US-00011 TABLE 11 Solvent Accessibility Surface Area
Differences for Antibody B Fab Heavy Chain Residue Residue
Positioin Solvent exposed surface area AHO Number SEQ ID NO: 46
difference (.ANG..sup.2) Ser33 Ser31 18.2 Gly34 Gly32 49.5 Gly38
Gly33 33.8 Tyr39 Tyr34 51.4 Tyr40 Tyr35 30.7 His59 His54 29.5 Asn67
Asn58 66.7 Thr68 Thr59 26.0 Tyr69 Tyr60 59.4 Lys75 Lys66 32.6
Arg110 Arg101 47.2 Gly111 Gly102 21.7 Phe112 Phe103 35.5 Tyr133
Tyr104 83.0 Tyr134 Tyr105 91.7
[0245] The solvent accessible surface area differences of the
residues in the IL-23-Antibody E Fab complex were calculated as
described above. The Antibody E Fab residues that had a difference
value .gtoreq.10 .ANG..sup.2 were considered to be in significant
contact with residues in the IL-23 antigen and these Antibody E Fab
residues were at least partially to completely occluded when the
Antibody E Fab was bound to human IL-23. This set of Antibody E Fab
residues make up the covered patch, the residues involved in the
structure of the interface when the Antibody E Fab is bound to
human IL-23, see Tables 12 and 13. The Antibody E Fab residues in
this covered patch may not be involved in binding interactions with
residues of the IL-23 antigen, but mutation of any single residue
within the covered patch could introduce energetic differences that
would impact the binding of Antibody E Fab to human IL-23. For the
most part, these covered patch residues were located within the CDR
regions of the Antibody E Fab heavy and light chains. These
residues were also within 5 .ANG. or less of the IL-23 antigen when
bound to the Antibody E Fab, as described in Example 4.
TABLE-US-00012 TABLE 12 Solvent Accessibility Surface Area
Differences for Antibody E Fab Light Chain Residue Residue Position
Solvent exposed surface area AHO Number SEQ ID NO: 1 difference
(.ANG..sup.2) Ala33 Ala31 11.6 Gly34 Gly32 51.2 Tyr39 Tyr33 47.2
Asp40 Asp34 36.8 Tyr57 Tyr51 16.1 Gly58 Gly52 11.1 Asn69 Asn55 29.4
Lys82 Lys68 20.1 Tyr109 Tyr93 27.3 Ser135 Ser98 11.3
TABLE-US-00013 TABLE 13 Solvent Accessibility Surface Area
Differences for Antibody E Fab Heavy Chain Residue Residue Position
Solvent exposed surface area AHO Number SEQ ID NO: 31 difference
(.ANG..sup.2) Gln1 Gln1 41.1 Gly27 Gly26 24.6 Thr30 Thr28 82.2
Ser33 Ser31 40.7 Tyr39 Tyr32 30.7 Trp59 Trp52 11.3 Tyr60 Tyr53 44.7
Tyr69 Tyr59 42.4 Lys86 Lys76 17.4 Gly111 Gly101 12.8 Tyr112 Tyr102
103.1 Ser114 Ser104 21.0 Ser115 Ser105 91.4 Trp131 Trp106 145.0
Tyr132 Tyr107 71.6 Pro133 Pro108 20.4
[0246] The solvent accessible surface area differences of the
portion of the IL-23 heterodimer bound by the paratope of the
Antibody B Fab were calculated by setting the IL-23 heterodimer
residues as the desired set. The structural information obtained in
Example 4 for the Antibody B Fab-IL-23 complex was used and the
residue solvent accessible surface area of the amino acid residues
of the IL-23 heterodimer in the presence of the Antibody B Fab were
calculated and represent the bound areas for the set.
[0247] The residue solvent accessible surface area of each of the
IL-23 heterodimer residues in the absence of the Antibody B Fab
were calculated and represent the free areas of the set.
[0248] As described above, the bound areas were subtracted from the
free areas resulting in the solvent exposed surface area difference
for each IL-23 residue. The IL-23 heterodimer residues that had no
change in surface area, or a zero difference, had no contact with
the residues of the Antibody B Fab when complexed. The IL-23
heterodimer residues that had a difference value .gtoreq.10
.ANG..sup.2 were considered to be in significant contact with
residues of the Antibody B Fab and these 11-23 heterodimer residues
were at least partially to completely occluded when the human IL-23
heterodimer was bound to the Antibody B Fab. This set of IL-23
heterodimer residues make up the covered patch, the residues
involved in the structure of the interface when the human IL-23
heterodimer is bound to the Antibody E Fab, see Table 14. The 11-23
heterodimer residues in this covered patch may not all be involved
in binding interactions with residues on the Antibody B Fab, but
mutation of any single residue within the covered patch could
introduce energetic differences that would impact the binding of
Antibody B Fab to human IL-23. These residues are also within 4
.ANG. or less from the Antibody B Fab, as described Example 4.
TABLE-US-00014 TABLE 14 Solvent Accessibility Surface Area
Differences for IL-23 heterodimer residues Solvent exposed surface
area difference (.ANG..sup.2) p19 residues (SEQ ID NO: 145) Ser46
26.5 Ala47 12.7 Pro49 59.6 Leu50 122.2 His53 47.8 Met54 13.9 Asp55
20.5 Arg57 14.6 Glu58 96.5 Glu112 29.7 Pro113 64.8 Ser114 30.0
Leu115 31.4 Leu116 60.0 Asp118 14.4 Ser119 19.7 Pro120 64.7 Pro155
19.4 Typ156 61.9 Leu159 72.8 Leu160 27.0 Arg162 14.4 Phe163 67.5
p40 residues (SEQ ID NO: 147) Glu122 29.1 Lys124 60.9
[0249] The solvent accessible surface area differences of the
portion of the IL-23 heterodimer bound by the paratope of the
Antibody E Fab were calculated as described above. The IL-23
heterodimer residues that had a difference value .gtoreq.10
.ANG..sup.2 were considered to be in significant contact with
residues of the Antibody E Fab and these 11-23 heterodimer residues
were at least partially to completely occluded when the human IL-23
heterodimer was bound to the Antibody E Fab. This set of IL-23
heterodimer residues make up the covered patch, the residues
involved in the structure of the interface when the human IL-23
heterodimer is bound to the Antibody E Fab, see Table 15. The Il-23
heterodimer residues in this covered patch may not all be involved
in binding interactions with residues on the Antibody E Fab, but
mutation of any single residue within the covered patch could
introduce energetic differences that would impact the binding of
Antibody E Fab to human IL-23. These residues are also within 5
.ANG. or less from the Antibody E Fab, as described in Example
4.
TABLE-US-00015 TABLE 15 Solvent Accessibility Surface Area
Differences for IL-23 heterodimer residues Solvent exposed surface
area difference (.ANG..sup.2) p19 residues (SEQ ID NO: 145) Ser46
18.7 Ala47 14.9 Pro49 79.8 Leu50 99.5 His53 61.2 Glu112 62.8 Pro113
45.7 Ser114 69.5 Leu115 50.3 Leu116 127.2 Pro117 54.1 Asp118 37.0
Pro120 18.8 Pro155 16.9 Trp156 140.7 Leu159 21.8 Leu160 17.0 Phe163
56.6 p40 residues (SEQ ID NO: 147) Lys121 86.2 Glu122 21.8 Pro123
22.1 Asn125 26.7 Arg283 22.6
Sequence CWU 1
1
1551111PRTHomo sapiens 1Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser
Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Thr Gly Ser Ser
Ser Asn Thr Gly Ala Gly 20 25 30Tyr Asp Val His Trp Tyr Gln Gln Val
Pro Gly Thr Ala Pro Lys Leu 35 40 45Leu Ile Tyr Gly Ser Gly Asn Arg
Pro Ser Gly Val Pro Asp Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Thr Gly Leu65 70 75 80Gln Ala Glu Asp Glu
Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser Ser 85 90 95Leu Ser Gly Trp
Val Phe Gly Gly Gly Thr Arg Leu Thr Val Leu 100 105 1102333DNAHomo
sapiens 2cagtctgtgc tgacgcagcc gccctcagtg tctggggccc cagggcagag
ggtcaccatc 60tcctgcactg ggagcagctc caacaccggg gcaggttatg atgtacactg
gtaccagcaa 120gttccaggaa cagcccccaa actcctcatt tatggtagcg
gcaatcggcc ctcaggggtc 180cctgaccgat tctctggctc caagtctggc
acctcagcct ccctggccat cactggactc 240caggctgagg atgaggctga
ttattactgc cagtcctatg acagcagcct gagtggttgg 300gtgttcggcg
gagggaccag gctgaccgtc ctg 3333111PRTHomo sapiens 3Gln Ser Val Leu
Thr Gln Pro Pro Ser Val Ser Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr
Ile Ser Cys Thr Gly Ser Ser Ser Asn Ile Gly Ala Gly 20 25 30Tyr Asp
Val His Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu 35 40 45Leu
Ile Tyr Gly Ser Asn Asn Arg Pro Ser Gly Val Pro Asp Arg Phe 50 55
60Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Leu65
70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser
Ser 85 90 95Leu Ser Gly Trp Val Phe Gly Gly Gly Thr Lys Leu Thr Val
Leu 100 105 1104115PRTHomo sapiens 4Gln Ala Val Leu Thr Gln Pro Ser
Ser Leu Ser Ala Ser Pro Gly Ala1 5 10 15Ser Ala Ser Leu Thr Cys Thr
Leu Arg Ser Gly Ile Asn Val Gly Thr 20 25 30Tyr Arg Ile Tyr Trp Tyr
Gln Gln Lys Pro Gly Ser Pro Pro Gln Tyr 35 40 45Leu Leu Arg Tyr Lys
Ser Asp Ser Asp Lys Gln Gln Gly Ser Gly Val 50 55 60Pro Ser Arg Phe
Ser Gly Ser Lys Asp Ala Ser Ala Asn Ala Gly Ile65 70 75 80Leu Leu
Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Cys 85 90 95Met
Ile Trp His Ser Ser Ala Ser Val Phe Gly Gly Gly Thr Lys Leu 100 105
110Thr Val Leu 1155345DNAHomo sapiens 5caggctgtgc tgactcagcc
gtcttccctc tctgcatctc ctggagcatc agccagtctc 60acctgcacct tacgcagtgg
catcaatgtt ggtacctaca ggatatactg gtaccagcag 120aagccaggga
gtcctcccca gtatctcctg aggtacaaat cagactcaga taagcagcag
180ggctctggag tccccagccg cttctctgga tccaaagatg cttcggccaa
tgcagggatt 240ttactcatct ctgggctcca gtctgaggat gaggctgact
attactgtat gatttggcac 300agcagcgctt cggtattcgg cggagggacc
aagctgaccg tccta 345614PRTHomo sapiens 6Glu Asn Thr Val Thr Ile Tyr
Tyr Asn Tyr Gly Met Asp Val1 5 107116PRTHomo sapiens 7Gln Pro Val
Leu Thr Gln Pro Pro Ser Ala Ser Ala Ser Leu Gly Ala1 5 10 15Ser Val
Thr Leu Thr Cys Thr Leu Asn Ser Gly Tyr Ser Asp Tyr Lys 20 25 30Val
Asp Trp Tyr Gln Gln Arg Pro Gly Lys Gly Pro Arg Phe Val Met 35 40
45Arg Val Gly Thr Gly Gly Ile Val Gly Ser Lys Gly Asp Gly Ile Pro
50 55 60Asp Arg Phe Ser Val Leu Gly Ser Gly Leu Asn Arg Tyr Leu Thr
Ile65 70 75 80Lys Asn Ile Gln Glu Glu Asp Glu Ser Asp Tyr His Cys
Gly Ala Asp 85 90 95His Gly Ser Gly Ser Asn Phe Val Tyr Val Phe Gly
Thr Gly Thr Lys 100 105 110Val Thr Val Leu 1158348DNAHomo sapiens
8cagcctgtgc tgactcagcc accttctgca tcagcctccc tgggagcctc ggtcacactc
60acctgcaccc tgaacagcgg ctacagtgat tataaagtgg actggtacca gcagagacca
120gggaagggcc cccggtttgt gatgcgagtg ggcactggtg ggattgtggg
atccaagggg 180gatggcatcc ctgatcgctt ctcagtcttg ggctcaggcc
tgaatcggta cctgaccatc 240aagaatatcc aggaagagga tgagagtgac
taccactgtg gggcagacca tggcagtggg 300agcaacttcg tgtatgtctt
cggaactggg accaaggtca ccgtccta 3489116PRTHomo sapiens 9Gln Pro Val
Leu Thr Gln Pro Pro Ser Ala Ser Ala Ser Leu Gly Ala1 5 10 15Ser Val
Thr Leu Thr Cys Thr Leu Ser Ser Gly Tyr Ser Asp Tyr Lys 20 25 30Val
Asp Trp Tyr Gln Gln Arg Pro Gly Lys Gly Pro Arg Phe Val Met 35 40
45Arg Val Gly Thr Gly Gly Ile Val Gly Ser Lys Gly Glu Gly Ile Pro
50 55 60Asp Arg Phe Ser Val Leu Gly Ser Gly Leu Asn Arg Tyr Leu Thr
Ile65 70 75 80Lys Asn Ile Gln Glu Glu Asp Glu Ser Asp Tyr His Cys
Gly Ala Asp 85 90 95His Gly Ser Gly Asn Asn Phe Val Tyr Val Phe Gly
Thr Gly Thr Lys 100 105 110Val Thr Val Leu 11510348DNAHomo sapiens
10cagcctgtgc tgactcagcc accttctgca tcagcctccc tgggagcctc ggtcacactc
60acctgcaccc tgagcagcgg ctacagtgat tataaagtgg actggtacca gcagagacca
120gggaagggcc cccggtttgt gatgcgagtg ggcactggtg ggattgtggg
atccaagggg 180gaaggcatcc ctgatcgctt ctcagtcttg ggctcaggcc
tgaatcggta cctgaccatc 240aagaacatcc aggaagagga tgagagtgac
taccactgtg gggcagacca tggcagtggg 300aacaacttcg tgtatgtctt
cggaactggg accaaggtca ccgtccta 34811116PRTHomo sapiens 11Gln Pro
Glu Leu Thr Gln Pro Pro Ser Ala Ser Ala Ser Leu Gly Ala1 5 10 15Ser
Val Thr Leu Thr Cys Thr Leu Ser Ser Gly Tyr Ser Asp Tyr Lys 20 25
30Val Asp Trp Tyr Gln Leu Arg Pro Gly Lys Gly Pro Arg Phe Val Met
35 40 45Arg Val Gly Thr Gly Gly Thr Val Gly Ser Lys Gly Glu Gly Ile
Pro 50 55 60Asp Arg Phe Ser Val Leu Gly Ser Gly Leu Asn Arg Ser Leu
Thr Ile65 70 75 80Lys Asn Ile Gln Glu Glu Asp Glu Ser Asp Tyr His
Cys Gly Ala Asp 85 90 95His Gly Ser Gly Ser Asn Phe Val Tyr Val Phe
Gly Thr Gly Thr Lys 100 105 110Val Thr Val Leu 11512348DNAHomo
sapiens 12cagcctgagt tgactcagcc accttctgca tcagcctccc tgggagcctc
ggtcacactc 60acctgcaccc tgagcagcgg ctacagtgat tataaagtgg actggtacca
gctgagacca 120gggaagggcc cccggtttgt gatgcgagtg ggcactggtg
ggactgttgg atccaagggg 180gaaggcatcc ctgatcgctt ctcagtcttg
ggctcaggcc tgaatcggtc cctgaccatc 240aagaacatcc aggaagagga
tgagagtgac taccactgtg gggcagacca tggcagtggg 300agcaacttcg
tgtatgtctt cggaactggg accaaggtca ccgtccta 34813107PRTHomo sapiens
13Asp Ile Gln Leu Thr Pro Ser Pro Ser Ser Val Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Ala Gly
Trp 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg
Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Ala Asp Ser Phe Pro Pro 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu
Ile Lys 100 10514321DNAHomo sapiens 14gacatccagt tgaccccgtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gggtattgcc ggctggttag cctggtatca gcagaaacca 120gggaaagccc
ctaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ttgtcaacag gctgacagtt
tccctcccac tttcggcgga 300gggaccaagg tggagatcaa a 32115107PRTHomo
sapiens 15Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Val Ile
Ser Ser Trp 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Ser Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Val Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ala Asn Ser Phe Pro Phe 85 90 95Thr Phe Gly Pro Gly Thr Lys
Val Asp Phe Lys 100 10516321DNAHomo sapiens 16gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
ggttattagc agctggttag cctggtatca gcagaaacca 120gggaaagccc
ctagcctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtgtatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ttgtcaacag gctaacagtt
tcccattcac tttcggccct 300gggaccaaag tggatttcaa a 32117107PRTHomo
sapiens 17Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ser
Ser Ser Trp 20 25 30Phe Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ala Asn Ser Phe Pro Phe 85 90 95Thr Phe Gly Pro Gly Thr Lys
Val Asp Ile Lys 100 10518321DNAHomo sapiens 18gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gggaagtagc agctggtttg cctggtatca gcagaaacca 120gggaaagccc
caaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagac ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ttgtcaacag gctaacagtt
tcccattcac tttcggccct 300gggaccaaag tggatatcaa a 32119107PRTHomo
sapiens 19Asp Ser Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile
Ser Ser Trp 20 25 30Phe Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro
Asn Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ala Asn Ser Phe Pro Phe 85 90 95Thr Phe Gly Pro Gly Thr Lys
Val Asp Ile Lys 100 10520321DNAHomo sapiens 20gacagccaga tgacccagtc
tccatcttcc gtgtctgcct ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gggtattagc agctggtttg cctggtatca gcagaaacca 120gggcaagccc
ctaacctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagaa ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ttgtcaacag gctaacagtt
tcccattcac tttcggccct 300gggaccaaag tggatatcaa a 32121107PRTHomo
sapiens 21Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Gly Gln Val Ile
Ser Ser Trp 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Asp Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ala Thr Ser Phe Pro Leu 85 90 95Thr Phe Gly Gly Gly Thr Lys
Val Glu Ile Lys 100 10522321DNAHomo sapiens 22gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgggtca
ggttattagc agctggttag cctggtatca gcagaaacca 120gggaaagccc
ctaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatcg
180aggttcagcg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gacgattttg caacttacta ttgtcaacag gctaccagtt
ttcccctcac tttcggcgga 300gggaccaagg tggagatcaa a 32123107PRTHomo
sapiens 23Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Phe
Ser Gly Trp 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ala Asn Ser Phe Pro Phe 85 90 95Thr Phe Gly Pro Gly Thr Lys
Val Asp Ile Lys 100 10524321DNAHomo sapiens 24gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gggttttagc ggttggttag cctggtatca gcagaaacca 120gggaaagccc
ctaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagtg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ctgtcaacag gctaacagtt
tcccattcac tttcggccct 300gggaccaaag tggatatcaa a 32125107PRTHomo
sapiens 25Asp Ile Gln Leu Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Val Ile
Ser Ser Trp 20 25 30Phe Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Asn Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Ala Asp Phe Ala Thr Tyr Phe Cys
Gln Gln Ala Asn Ser Phe Pro Phe 85 90 95Thr Phe Gly Pro Gly Thr Lys
Val Asp Val Lys 100 10526321DNAHomo sapiens 26gacatccagt tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
ggttattagc agctggtttg cctggtatca gcagaaacca 120gggaaagccc
ctaacctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gcagattttg caacttactt ttgtcaacag gctaacagtt
tcccattcac tttcggccct 300gggaccaaag tggatgtcaa a 32127107PRTHomo
sapiens 27Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ser
Ser Ser Trp 20 25 30Phe Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Ala Asn Ser Phe Pro Phe 85 90 95Thr Phe Gly Pro Gly Thr Lys
Val Asp Ile Lys 100 10528321DNAHomo sapiens 28gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gggtagtagc agctggtttg cctggtatca acagaaacca 120gggaaagccc
caaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ttgtcaacag gctaacagtt
tcccattcac tttcggccct 300gggaccaaag tggatatcaa a 32129107PRTHomo
sapiens 29Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile
Arg Asn Asp 20 25 30Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Arg Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln His Asn Ser Tyr Pro
Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Glu 100
10530108PRTArtificialConsensus SequenceMISC_FEATURE(2)..(2)Xaa can
be Ile or SerMISC_FEATURE(4)..(4)Xaa can be Met or
LeuMISC_FEATURE(29)..(29)Xaa can be Gly or
ValMISC_FEATURE(30)..(30)Xaa can be Ser, Phe or
IleMISC_FEATURE(32)..(32)Xaa can be Ser or
GlyMISC_FEATURE(34)..(34)Xaa can be Phe or
LeuMISC_FEATURE(43)..(43)Xaa can be Lys or
GlnMISC_FEATURE(46)..(46)Xaa can be Lys, Asn or
SerMISC_FEATURE(67)..(67)Xaa can be Gly or
ValMISC_FEATURE(71)..(71)Xaa can be Asp or
GluMISC_FEATURE(82)..(82)Xaa can be Glu or
AlaMISC_FEATURE(88)..(88)Xaa can be Tyr or
PheMISC_FEATURE(107)..(107)Xaa can be Ile, Val or Phe 30Asp Xaa Gln
Xaa Thr Gln Ser Pro Ser Ser Val Ser Ala Ser Val Gly1 5 10 15Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Xaa Xaa Ser Xaa 20 25 30Trp
Xaa Ala Trp Tyr Gln Gln Lys Pro Gly Xaa Ala Pro Xaa Leu Leu 35 40
45Ile Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser
50 55 60Gly Ser Xaa Ser Gly Thr Xaa Phe Thr Leu Thr Ile Ser Ser Leu
Gln65 70 75 80Pro Xaa Asp Phe Ala Thr Tyr Xaa Cys Gln Gln Ala Asn
Ser Phe Pro 85 90 95Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Xaa Lys
100 10531124PRTHomo sapiens 31Gln Val Gln Leu Val Glu Ser Gly Gly
Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Gly Met His Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Val Ile Trp Tyr Asp
Gly Ser Asn Glu Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg
Asp Arg Gly Tyr Thr Ser Ser Trp Tyr Pro Asp Ala Phe Asp 100 105
110Ile Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser 115
12032372DNAHomo sapiens 32caggtgcagc tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt caccttcagt
agctatggca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
ggtggcagtt atatggtatg atggaagtaa tgaatactat 180gcagactccg
tgaagggccg attcaccatc tccagagaca attccaagaa cacgctgtat
240ctgcaaatga acagcctgag agccgaggac acggctgtgt attactgtgc
gagagatcgg 300gggtatacca gtagctggta ccctgatgct tttgatatct
ggggccaagg gacaatggtc 360accgtctctt ca 37233124PRTHomo sapiens
33Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr 20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Arg Gly Tyr Ser Ser Ser
Trp Tyr Pro Asp Ala Phe Asp 100 105 110Ile Trp Gly Gln Gly Thr Met
Val Thr Val Ser Ser 115 12034121PRTHomo sapiens 34Gln Val Gln Leu
Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Gly Met
His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala
Val Ile Ser Phe Asp Gly Ser Leu Lys Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Glu Arg Thr Thr Leu Ser Gly Ser Tyr Phe Asp Tyr
Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115
12035363DNAHomo sapiens 35caggtgcagc tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt
agctatggca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
ggtggcagtt atatcatttg atggaagtct taaatactat 180gcagactccg
tgaagggccg attcaccatc tccagagaca attccaagaa caccctgtat
240ctgcaaatga acagcctgag agctgaggac acggctgtgt attactgtgc
gagagaacgg 300actactttaa gtgggagcta ctttgactac tggggccagg
gaaccctggt caccgtctcc 360tca 36336121PRTHomo sapiens 36Gln Val Gln
Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40
45Ser Val Ile Ser His Asp Gly Ser Ile Lys Tyr Tyr Ala Asp Ser Val
50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Arg Glu Arg Thr Thr Leu Ser Gly Ser Tyr Phe
Asp Tyr Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115
12037363DNAHomo sapiens 37caggtgcagc tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt
agctatgcca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
gttgtcagtt atatcacatg atggaagtat taaatactat 180gcagactccg
tgaagggccg attcaccatc tccagagaca attccaagaa cacgctgtat
240ctgcaaatga acagcctgag agctgaggac acggctgtgt attactgtgc
gagagaacgg 300actactctaa gtgggagcta ctttgactac tggggccagg
gaaccctggt caccgtctcc 360tca 36338125PRTHomo sapiens 38Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ser
Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45Ser Tyr Ile Ser Ser Arg Ser Ser Thr Ile Tyr Ile Ala Asp Ser Val
50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Asp Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Arg Arg Ile Ala Ala Ala Gly Gly Phe His Tyr
Tyr Tyr Ala Leu 100 105 110Asp Val Trp Gly Gln Gly Thr Thr Val Thr
Val Ser Ser 115 120 12539375DNAHomo sapiens 39gaggtgcagc tggtggagtc
tgggggaggc ctggtacagc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt
caccttcagt agctatagta tgaactgggt ccgccaggct 120ccagggaagg
ggctggagtg ggtttcgtac attagtagta ggagtagtac catatacatc
180gcagactctg tgaagggccg attcaccatc tccagagaca atgccaagaa
ctcactgtat 240ctgcaaatga acagcctgag agacgaagac acggctgtgt
attactgtgc gagacggata 300gcagcagctg gtgggttcca ctactactac
gctttggacg tctggggcca agggaccacg 360gtcaccgtct cctca
37540125PRTHomo sapiens 40Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Thr Tyr 20 25 30Ser Met Asn Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Tyr Ile Ser Ser Ser Ser
Ser Thr Arg Tyr His Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Asp Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Arg
Ile Ala Ala Ala Gly Pro Trp Gly Tyr Tyr Tyr Ala Met 100 105 110Asp
Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115 120
12541375DNAHomo sapiens 41gaggtgcagc tggtggagtc tgggggaggc
ttggtacaac ctggggggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt
acctatagca tgaactgggt ccgccaggct 120ccagggaagg ggctggagtg
ggtttcatac attagtagca gtagtagtac cagataccac 180gcagactctg
tgaagggccg attcaccatc tccagagaca atgccaagaa ctcactgtat
240ctgcaaatga acagcctgag agacgaggac acggctgtgt attactgtgc
gagacgtata 300gcagcagctg gtccgtgggg ctactactac gctatggacg
tctggggcca agggaccacg 360gtcaccgtct cctca 37542125PRTHomo sapiens
42Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Val Val Ser Gly Phe Thr Phe Ser Ser
Phe 20 25 30Ser Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ser Tyr Ile Ser Ser Arg Ser Ser Thr Ile Tyr Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Asp Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Arg Ile Ala Ala Ala Gly Pro
Trp Gly Tyr Tyr Tyr Ala Met 100 105 110Asp Val Trp Gly Gln Gly Thr
Thr Val Thr Val Ser Ser 115 120 12543375DNAHomo sapiens
43gaggtgcagc tggtggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc
60tcctgtgtag tctctggatt caccttcagt agttttagca tgaactgggt ccgccaggct
120ccagggaagg ggctggagtg ggtttcatac attagtagtc gtagtagtac
catatactac 180gcagactctg tgaagggccg attcaccatc tccagagaca
atgccaagaa ctcactgtat 240ctgcaaatga acagcctgag agacgaggac
acggctgtgt attattgtgc gagacgtata 300gcagcagctg gtccgtgggg
ctactactac gctatggacg tctggggcca agggaccacg 360gtcaccgtct cctca
37544118PRTHomo sapiens 44Gln Val Gln Leu Gln Glu Ser Gly Pro Gly
Leu Val Lys Pro Ser Glu1 5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser
Gly Gly Ser Ile Ser Thr Tyr 20 25 30Tyr Trp Ser Trp Ile Arg Gln Pro
Ala Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Leu Ile Tyr Thr Ser Gly
Ser Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60Ser Arg Val Thr Met Ser
Leu Asp Thr Ser Lys Asn Gln Phe Ser Leu65 70 75 80Arg Leu Thr Ser
Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95Arg Asp Arg
Gly Tyr Tyr Tyr Gly Val Asp Val Trp Gly Gln Gly Thr 100 105 110Thr
Val Thr Val Ser Ser 11545354DNAHomo sapiens 45caggtgcagc tgcaggagtc
gggcccagga ctggtgaagc cttcggagac cctgtccctc 60acctgcactg tctctggtgg
ctccatcagt acttactact ggagctggat ccggcagccc 120gccgggaagg
gactggagtg gattgggctt atctatacca gtgggagcac caactacaac
180ccctccctca agagtcgagt caccatgtca ttagacacgt ccaagaacca
gttctccctg 240aggctgacct ctgtgaccgc cgcggacacg gccgtttatt
actgtgcgag agatcgtggg 300tactactacg gtgtggacgt ctggggccag
gggaccacgg tcaccgtctc ctca 35446120PRTHomo sapiens 46Gln Val Gln
Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu
Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser Ser Gly 20 25 30Gly
Tyr Tyr Trp Ser Trp Ile Arg Gln His Pro Gly Lys Gly Leu Glu 35 40
45Trp Ile Gly His Ile His Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser
50 55 60Leu Lys Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln
Phe65 70 75 80Ser Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala
Val Tyr Tyr 85 90 95Cys Ala Lys Asn Arg Gly Phe Tyr Tyr Gly Met Asp
Val Trp Gly Gln 100 105 110Gly Thr Thr Val Thr Val Ser Ser 115
12047360DNAHomo sapiens 47caggtgcagc tgcaggagtc gggcccagga
ctggtgaagc cttcacagac cctgtccctc 60acctgcactg tctctggtgg ctccatcagc
agtggtggtt actactggag ctggatccgc 120cagcacccag ggaagggcct
ggagtggatt gggcacatcc attacagtgg gaacacctac 180tacaacccgt
ccctcaagag tcgagttacc atatcagtag acacgtctaa gaatcagttc
240tccctgaaac tgagctctgt gactgccgcg gacacggccg tgtattactg
tgcgaaaaat 300cgcgggttct actacggtat ggacgtctgg ggccaaggga
ccacggtcac cgtctcctca 36048120PRTHomo sapiens 48Gln Val Gln Leu Gln
Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu Ser Leu
Thr Cys Thr Val Ser Gly Gly Ser Ile Asn Ser Gly 20 25 30Gly Tyr Tyr
Trp Ser Trp Ile Arg Gln His Pro Gly Lys Gly Leu Glu 35 40 45Trp Ile
Gly Tyr Ile Tyr Tyr Ser Gly Ser Ser Tyr Tyr Asn Pro Ser 50 55 60Leu
Lys Ser Arg Val Thr Ile Ser Val Asp Thr Ser Gln Asn Gln Phe65 70 75
80Ser Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr
85 90 95Cys Ala Arg Asp Arg Gly His Tyr Tyr Gly Met Asp Val Trp Gly
Gln 100 105 110Gly Thr Thr Val Thr Val Ser Ser 115 12049360DNAHomo
sapiens 49caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcacagac
cctgtccctc 60acctgcactg tctctggtgg ctccatcaac agtggtggtt actactggag
ctggatccgc 120cagcacccag ggaagggcct ggagtggatt gggtacatct
attacagtgg gagctcctac 180tacaacccgt ccctcaagag tcgagttacc
atatcagtag acacgtctca gaaccagttc 240tccctgaagc tgagctctgt
gactgccgcg gacacggccg tgtattactg tgcgagagat 300cgggggcact
actacggtat ggacgtctgg ggccaaggga ccacggtcac cgtctcctca
36050120PRTHomo sapiens 50Gln Val Gln Leu Gln Glu Ser Gly Pro Gly
Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser
Gly Gly Ser Ile Ser Ser Gly 20 25 30Gly Tyr Tyr Trp Ser Trp Ile Arg
Gln His Pro Gly Lys Gly Leu Glu 35 40 45Trp Ile Gly Tyr Ile Tyr Tyr
Ser Gly Ser Thr Tyr Tyr Asn Pro Ser 50 55 60Leu Lys Ser Arg Val Thr
Ile Ser Val Asp Thr Ser Lys Asn Gln Phe65 70 75 80Ser Leu Lys Leu
Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr 85 90 95Cys Ala Arg
Asp Arg Gly His Tyr Tyr Gly Met Asp Val Trp Gly Gln 100 105 110Gly
Thr Thr Val Thr Val Ser Ser 115 12051360DNAHomo sapiens
51caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcacagac cctgtccctc
60acctgcactg tctctggtgg ctccatcagt agtggtggtt actactggag ctggatccgc
120cagcacccag ggaagggcct ggagtggatt gggtacattt attacagtgg
gagcacctac 180tacaacccgt ccctcaagag tcgagttacc atatcagtag
acacgtctaa gaaccagttc 240tccctgaagc tgagctctgt gactgccgcg
gacacggccg tgtattactg tgcgagagat 300cggggccact actatggaat
ggacgtctgg ggccaaggga ccacggtcac cgtctcctca 36052118PRTHomo sapiens
52Gln Val Gln Leu Gln Glu Ser Gly Pro Arg Leu Val Lys Pro Ser Glu1
5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Asp Ser Ile Ser Ser
Tyr 20 25 30Phe Trp Ser Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu
Trp Leu 35 40 45Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr Asn Pro
Ser Leu Lys 50 55 60Ser Arg Val Thr Ile Ser Ile Asp Thr Ser Lys Asn
Gln Phe Ser Leu65 70 75 80Lys Leu Ser Ser Val Thr Ala Ala Asp Thr
Ala Val Tyr Tyr Cys Thr 85 90 95Arg Asp Arg Gly Ser Tyr Tyr Gly Ser
Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser
11553354DNAHomo sapiens 53caggtgcagc tgcaggagtc gggcccaaga
ctggtgaagc cttcggagac cctgtccctc 60acctgcactg tctctggtga ctccatcagt
agttacttct ggagctggat ccggcagccc 120ccagggaagg gactggagtg
gcttgggtat atctattaca gtgggagcac caactacaac 180ccctccctca
agagtcgagt caccatatca atagacacgt ccaagaacca gttctccctg
240aagctgagct
ctgtgaccgc tgcggacacg gccgtgtatt actgtacgag agatcggggg
300agctactacg gatctgacta ctggggccag ggaaccctgg tcaccgtctc ctca
35454120PRTHomo sapiens 54Gln Val Gln Leu Gln Glu Ser Gly Pro Gly
Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser
Gly Gly Ser Ile Ser Ser Gly 20 25 30Gly Tyr Tyr Trp Thr Trp Ile Arg
Gln His Pro Gly Lys Gly Leu Glu 35 40 45Trp Ile Gly Tyr Ile Tyr Tyr
Ser Gly Asn Thr Tyr Tyr Asn Pro Ser 50 55 60Leu Lys Ser Arg Ile Thr
Ile Ser Val Asp Thr Ser Lys Asn Gln Phe65 70 75 80Ser Leu Ser Leu
Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr 85 90 95Cys Ala Arg
Asn Arg Gly Tyr Tyr Tyr Gly Met Asp Val Trp Gly Gln 100 105 110Gly
Thr Thr Val Thr Val Ser Ser 115 12055360DNAHomo sapiens
55caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcacagac cctgtccctc
60acctgcactg tctctggtgg ctccatcagc agtggtggtt actactggac ctggatccgc
120cagcacccag ggaagggcct ggagtggatt gggtacatct attacagtgg
gaacacctac 180tacaacccgt ccctcaagag tcgaattacc atatcagtgg
acacgtctaa gaaccagttc 240tccctgagcc tgagctctgt gactgccgcg
gacacggccg tgtattactg tgcgagaaat 300cgcgggtact actacggtat
ggacgtctgg ggccaaggga ccacggtcac cgtctcctca 36056120PRTHomo sapiens
56Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1
5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser Ser
Gly 20 25 30Gly Tyr Tyr Trp Ser Trp Ile Arg Gln His Pro Gly Lys Gly
Leu Glu 35 40 45Trp Ile Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Tyr Tyr
Asn Pro Ser 50 55 60Leu Lys Ser Arg Val Thr Met Ser Val Asp Thr Ser
Lys Asn Gln Phe65 70 75 80Ser Leu Lys Leu Ser Ser Val Thr Ala Ala
Asp Thr Ala Val Tyr Tyr 85 90 95Cys Ala Lys Asn Arg Gly Phe Tyr Tyr
Gly Met Asp Val Trp Gly Gln 100 105 110Gly Thr Thr Val Thr Val Ser
Ser 115 12057360DNAHomo sapiens 57caggtgcagc tgcaggagtc gggcccagga
ctggtgaagc cttcacagac cctgtccctc 60acctgcactg tctctggtgg ctccatcagc
agtggtggtt actactggag ctggatccgc 120cagcacccag ggaagggcct
ggagtggatt gggtacatct attacagtgg gagcacctac 180tacaacccgt
ccctcaagag tcgagttacc atgtcagtag acacgtctaa gaaccagttc
240tccctgaaac tgagctctgt gactgccgcg gacacggccg tgtattactg
tgcgaaaaat 300cgcgggttct actacggtat ggacgtctgg ggccaaggga
ccacggtcac cgtctcctca 36058120PRTHomo sapiens 58Gln Val Gln Leu Gln
Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu Ser Leu
Thr Cys Thr Val Ser Gly Gly Ser Ile Asn Ser Gly 20 25 30Gly Tyr Tyr
Trp Ser Trp Ile Arg Gln His Pro Gly Lys Gly Leu Glu 35 40 45Trp Ile
Gly Tyr Ile Tyr Tyr Ser Gly Ser Ser Tyr Tyr Asn Pro Ser 50 55 60Leu
Lys Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe65 70 75
80Ser Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr
85 90 95Cys Ala Arg Asp Arg Gly His Tyr Tyr Gly Met Asp Val Trp Gly
Gln 100 105 110Gly Thr Thr Val Thr Val Ser Ser 115 12059360DNAHomo
sapiens 59caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcacagac
cctgtccctc 60acctgcactg tctctggtgg ctccatcaat agtggtggtt actactggag
ctggatccgc 120cagcacccag ggaagggcct ggagtggatt gggtacatct
attacagtgg gagcagctac 180tacaacccgt ccctcaagag tcgagttacc
atatcagttg acacgtctaa gaaccagttc 240tccctgaagc tgagttctgt
gactgccgcg gacacggccg tgtattactg tgcgagagat 300cgggggcact
actacggtat ggacgtctgg ggccaaggga ccacggtcac cgtctcctca
36060123PRTHomo sapiens 60Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr 20 25 30Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Leu Ile Trp Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu
Asn Thr Val Thr Ile Tyr Tyr Asn Tyr Gly Met Asp Val 100 105 110Trp
Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115
12061116PRTArtificialConsensus SequenceMISC_FEATURE(3)..(3)Xaa can
be Val or GluMISC_FEATURE(25)..(25)Xaa can be Asn or
SerMISC_FEATURE(38)..(38)Xaa can be Gln or
LeuMISC_FEATURE(55)..(55)Xaa can be Ile or
ThrMISC_FEATURE(61)..(61)Xaa can be Asp or
GluMISC_FEATURE(77)..(77)Xaa can be Tyr or
SerMISC_FEATURE(101)..(101)Xaa can be Ser or Asn 61Gln Pro Xaa Leu
Thr Gln Pro Pro Ser Ala Ser Ala Ser Leu Gly Ala1 5 10 15Ser Val Thr
Leu Thr Cys Thr Leu Xaa Ser Gly Tyr Ser Asp Tyr Lys 20 25 30Val Asp
Trp Tyr Gln Xaa Arg Pro Gly Lys Gly Pro Arg Phe Val Met 35 40 45Arg
Val Gly Thr Gly Gly Xaa Val Gly Ser Lys Gly Xaa Gly Ile Pro 50 55
60Asp Arg Phe Ser Val Leu Gly Ser Gly Leu Asn Arg Xaa Leu Thr Ile65
70 75 80Lys Asn Ile Gln Glu Glu Asp Glu Ser Asp Tyr His Cys Gly Ala
Asp 85 90 95His Gly Ser Gly Xaa Asn Phe Val Tyr Val Phe Gly Thr Gly
Thr Lys 100 105 110Val Thr Val Leu 1156214PRTHomo sapiens 62Thr Gly
Ser Ser Ser Asn Thr Gly Ala Gly Tyr Asp Val His1 5 10637PRTHomo
sapiens 63Gly Ser Gly Asn Arg Pro Ser1 56411PRTHomo sapiens 64Gln
Ser Tyr Asp Ser Ser Leu Ser Gly Trp Val1 5 106514PRTHomo sapiens
65Thr Gly Ser Ser Ser Asn Ile Gly Ala Gly Tyr Asp Val His1 5
10667PRTHomo sapiens 66Gly Ser Asn Asn Arg Pro Ser1 5679PRTHomo
sapiens 67Met Ile Trp His Ser Ser Ala Ser Val1 56814PRTHomo sapiens
68Thr Leu Arg Ser Gly Ile Asn Val Gly Thr Tyr Arg Ile Tyr1 5
106911PRTHomo sapiens 69Tyr Lys Ser Asp Ser Asp Lys Gln Gln Gly
Ser1 5 107013PRTHomo sapiens 70Gly Ala Asp His Gly Ser Gly Ser Asn
Phe Val Tyr Val1 5 107111PRTHomo sapiens 71Thr Leu Asn Ser Gly Tyr
Ser Asp Tyr Lys Val1 5 107212PRTHomo sapiens 72Val Gly Thr Gly Gly
Ile Val Gly Ser Lys Gly Asp1 5 107313PRTHomo sapiens 73Gly Ala Asp
His Gly Ser Gly Asn Asn Phe Val Tyr Val1 5 107411PRTHomo sapiens
74Thr Leu Ser Ser Gly Tyr Ser Asp Tyr Lys Val1 5 107512PRTHomo
sapiens 75Val Gly Thr Gly Gly Ile Val Gly Ser Lys Gly Glu1 5
10769PRTHomo sapiens 76Gln Gln Ala Asn Ser Phe Pro Phe Thr1
57711PRTHomo sapiens 77Arg Ala Ser Gln Gly Phe Ser Gly Trp Leu Ala1
5 107812PRTHomo sapiens 78Val Gly Thr Gly Gly Thr Val Gly Ser Lys
Gly Glu1 5 10799PRTHomo sapiens 79Gln Gln Ala Thr Ser Phe Pro Leu
Thr1 58011PRTHomo sapiens 80Arg Ala Ser Gln Val Ile Ser Ser Trp Leu
Ala1 5 10817PRTHomo sapiens 81Ala Ala Ser Ser Leu Gln Ser1
5829PRTHomo sapiens 82Gln Gln Ala Asp Ser Phe Pro Pro Thr1
58311PRTHomo sapiens 83Arg Ala Ser Gln Val Ile Ser Ser Trp Phe Ala1
5 10849PRTHomo sapiens 84Leu Gln His Asn Ser Tyr Pro Pro Thr1
58511PRTHomo sapiens 85Arg Ala Ser Gln Gly Ser Ser Ser Trp Phe Ala1
5 108611PRTHomo sapiens 86Arg Ala Ser Gln Gly Ile Ser Ser Trp Phe
Ala1 5 108711PRTHomo sapiens 87Arg Ala Gly Gln Val Ile Ser Ser Trp
Leu Ala1 5 108811PRTHomo sapiens 88Arg Ala Ser Gln Gly Ile Ala Gly
Trp Leu Ala1 5 108911PRTHomo sapiens 89Arg Ala Ser Gln Gly Ile Arg
Asn Asp Leu Gly1 5 109017PRTHomo sapiens 90Leu Ile Trp Tyr Asp Gly
Ser Asn Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly915PRTHomo
sapiens 91Ser Tyr Gly Met His1 59217PRTHomo sapiens 92Val Ile Trp
Tyr Asp Gly Ser Asn Glu Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly9315PRTHomo sapiens 93Asp Arg Gly Tyr Thr Ser Ser Trp Tyr Pro
Asp Ala Phe Asp Ile1 5 10 15945PRTHomo sapiens 94Ser Tyr Ala Met
His1 59517PRTHomo sapiens 95Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr
Tyr Ala Asp Ser Val Lys1 5 10 15Gly9615PRTHomo sapiens 96Asp Arg
Gly Tyr Ser Ser Ser Trp Tyr Pro Asp Ala Phe Asp Ile1 5 10
15975PRTHomo sapiens 97Thr Tyr Ser Met Asn1 59817PRTHomo sapiens
98Val Ile Ser Phe Asp Gly Ser Leu Lys Tyr Tyr Ala Asp Ser Val Lys1
5 10 15Gly9912PRTHomo sapiens 99Glu Arg Thr Thr Leu Ser Gly Ser Tyr
Phe Asp Tyr1 5 101005PRTHomo sapiens 100Ser Tyr Ser Met Asn1
510117PRTHomo sapiens 101Val Ile Ser His Asp Gly Ser Ile Lys Tyr
Tyr Ala Asp Ser Val Lys1 5 10 15Gly10216PRTHomo sapiens 102Arg Ile
Ala Ala Ala Gly Gly Phe His Tyr Tyr Tyr Ala Leu Asp Val1 5 10
151035PRTHomo sapiens 103Ser Phe Ser Met Asn1 510417PRTHomo sapiens
104Tyr Ile Ser Ser Arg Ser Ser Thr Ile Tyr Ile Ala Asp Ser Val Lys1
5 10 15Gly10516PRTHomo sapiens 105Arg Ile Ala Ala Ala Gly Pro Trp
Gly Tyr Tyr Tyr Ala Met Asp Val1 5 10 151067PRTHomo sapiens 106Ser
Gly Gly Tyr Tyr Trp Thr1 510717PRTHomo sapiens 107Tyr Ile Ser Ser
Ser Ser Ser Thr Arg Tyr His Ala Asp Ser Val Lys1 5 10
15Gly10810PRTHomo sapiens 108Asn Arg Gly Tyr Tyr Tyr Gly Met Asp
Val1 5 101097PRTHomo sapiens 109Ser Gly Gly Tyr Tyr Trp Ser1
511017PRTHomo sapiens 110Tyr Ile Ser Ser Arg Ser Ser Thr Ile Tyr
Tyr Ala Asp Ser Val Lys1 5 10 15Gly11110PRTHomo sapiens 111Asn Arg
Gly Phe Tyr Tyr Gly Met Asp Val1 5 101125PRTHomo sapiens 112Ser Tyr
Phe Trp Ser1 511316PRTHomo sapiens 113Tyr Ile Tyr Tyr Ser Gly Asn
Thr Tyr Tyr Asn Pro Ser Leu Lys Ser1 5 10 1511410PRTHomo sapiens
114Asp Arg Gly His Tyr Tyr Gly Met Asp Val1 5 101155PRTHomo sapiens
115Thr Tyr Tyr Trp Ser1 511616PRTHomo sapiens 116His Ile His Tyr
Ser Gly Asn Thr Tyr Tyr Asn Pro Ser Leu Lys Ser1 5 10
1511710PRTHomo sapiens 117Asp Arg Gly Ser Tyr Tyr Gly Ser Asp Tyr1
5 1011816PRTHomo sapiens 118Tyr Ile Tyr Tyr Ser Gly Ser Thr Tyr Tyr
Asn Pro Ser Leu Lys Ser1 5 10 1511910PRTHomo sapiens 119Asp Arg Gly
Tyr Tyr Tyr Gly Val Asp Val1 5 1012016PRTHomo sapiens 120Tyr Ile
Tyr Tyr Ser Gly Ser Ser Tyr Tyr Asn Pro Ser Leu Lys Ser1 5 10
1512116PRTHomo sapiens 121Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr
Asn Pro Ser Leu Lys Ser1 5 10 1512216PRTHomo sapiens 122Leu Ile Tyr
Thr Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10
1512311PRTArtificialConsensus sequenceMISC_FEATURE(5)..(5)Xaa can
be Gly or ValMISC_FEATURE(6)..(6)Xaa can be Ile, Phe or
SerMISC_FEATURE(8)..(8)Xaa can be Ser or
GlyMISC_FEATURE(10)..(10)Xaa can be Phe or Leu. 123Arg Ala Ser Gln
Xaa Xaa Ser Xaa Trp Xaa Ala1 5 1012412PRTArtificialConsensus
sequenceMISC_FEATURE(3)..(3)Xaa can be Asn or Ser 124Thr Leu Xaa
Ser Gly Tyr Ser Asp Tyr Lys Val Asp1 5
1012514PRTArtificialConsensus sequenceMISC_FEATURE(7)..(7)Xaa can
be Ile or Thr 125Thr Gly Ser Ser Ser Asn Xaa Gly Ala Gly Tyr Asp
Val His1 5 1012612PRTArtificialConsensus
sequenceMISC_FEATURE(6)..(6)Xaa can be Ile or
ThrMISC_FEATURE(12)..(12)Xaa can be Asp or Glu 126Val Gly Thr Gly
Gly Xaa Val Gly Ser Lys Gly Xaa1 5 101277PRTArtificialConsensus
sequenceMISC_FEATURE(3)..(3)Xaa can be Asn or Gly 127Gly Ser Xaa
Asn Arg Pro Ser1 512813PRTArtificialConsensus
sequenceMISC_FEATURE(8)..(8)Xaa can be Ser or Asn 128Gly Ala Asp
His Gly Ser Gly Xaa Asn Phe Val Tyr Val1 5
101297PRTArtificialConsensus sequenceMISC_FEATURE(7)..(7)Xaa can be
Ser or Thr 129Ser Gly Gly Tyr Tyr Trp Xaa1
51305PRTArtificialConsensus sequenceMISC_FEATURE(3)..(3)Xaa can be
Gly or Ala 130Ser Tyr Xaa Met His1 51315PRTArtificialConsensus
sequenceMISC_FEATURE(1)..(1)Xaa can be Ser or
ThrMISC_FEATURE(1)..(1)Xaa can be Ser or ThrMISC_FEATURE(2)..(2)Xaa
can be Tyr or Phe 131Xaa Xaa Ser Met Asn1
513216PRTArtificialConsensus sequenceMISC_FEATURE(1)..(1)Xaa can be
Tyr or HisMISC_FEATURE(3)..(3)Xaa can be Thr or
HisMISC_FEATURE(7)..(7)Xaa can be Ser or AsnMISC_FEATURE(8)..(8)Xaa
can be Thr or Ser 132Xaa Ile Xaa Tyr Ser Gly Xaa Xaa Tyr Tyr Asn
Pro Ser Leu Lys Ser1 5 10 1513317PRTArtificialConsensus
sequenceMISC_FEATURE(4)..(4)Xaa can be Phe or
HisMISC_FEATURE(8)..(8)Xaa can be Leu or Thr 133Val Ile Ser Xaa Asp
Gly Ser Xaa Lys Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly13417PRTArtificialConsensus sequenceMISC_FEATURE(5)..(5)Xaa
can be Arg or SerMISC_FEATURE(9)..(9)Xaa can be Ile or
ArgMISC_FEATURE(11)..(11)Xaa can be Ile, His or Try 134Tyr Ile Ser
Ser Xaa Ser Ser Thr Xaa Tyr Xaa Ala Asp Ser Val Lys1 5 10
15Gly13517PRTArtificialConsensus sequenceMISC_FEATURE(9)..(9)Xaa
can be Lys or Glu 135Val Ile Trp Tyr Asp Gly Ser Asn Xaa Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly13610PRTArtificialConsensus
sequenceMISC_FEATURE(1)..(1)Xaa can be Asn or
AspMISC_FEATURE(4)..(4)Xaa can be His, Tyr or Phe 136Xaa Arg Gly
Xaa Tyr Tyr Gly Met Asp Val1 5 1013716PRTArtificialConsensus
sequenceMISC_FEATURE(7)..(7)Xaa can be Gly or
PheMISC_FEATURE(8)..(8)Xaa can be Phe or TrpMISC_FEATURE(9)..(9)Xaa
can be His or GlyMISC_FEATURE(14)..(14)Xaa can be Leu and Met
137Arg Ile Ala Ala Ala Gly Xaa Xaa Xaa Tyr Tyr Tyr Ala Xaa Asp Val1
5 10 1513815PRTArtificialConsensus sequenceMISC_FEATURE(5)..(5)Xaa
can be Ser or Thr 138Asp Arg Gly Tyr Xaa Ser Ser Trp Tyr Pro Asp
Ala Phe Asp Ile1 5 10 15139112PRTArtificialConsensus
SequenceMISC_FEATURE(29)..(29)Xaa can be Ile or
ThrMISC_FEATURE(41)..(41)Xaa can be Val or
LeuMISC_FEATURE(54)..(54)Xaa can be Gly or
AsnMISC_FEATURE(107)..(107)Xaa can be Arg or Lys 139Gln Ser Val Leu
Thr Gln Pro Pro Ser Val Ser Gly Ala Pro Gly Gln1 5 10 15Arg Val Thr
Ile Ser Cys Thr Gly Ser Ser Ser Asn Xaa Gly Ala Gly 20 25 30Tyr Asp
Val His Trp Tyr Gln Gln Xaa Pro Gly Thr Ala Pro Lys Leu 35 40 45Leu
Ile Tyr Gly Ser Xaa Asn Arg Pro Ser Gly Val Pro Asp Arg Phe 50 55
60Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Thr Gly Leu65
70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser
Ser 85 90 95Leu Ser Gly Trp Val Phe Gly Gly Gly Thr Xaa Arg Leu Thr
Val Leu 100 105 110140120PRTArtificialConsensus
SequenceMISC_FEATURE(30)..(30)Xaa can be And or
SerMISC_FEATURE(37)..(37)Xaa can be Ser or
ThrMISC_FEATURE(52)..(52)Xaa can be Tyr or
HisMISC_FEATURE(54)..(54)Xaa can be Tyr or
HisMISC_FEATURE(58)..(58)Xaa can be Ser or
AsnMISC_FEATURE(59)..(59)Xaa can be Ser or
AsnMISC_FEATURE(69)..(69)Xaa can be Ser or
ThrMISC_FEATURE(71)..(71)Xaa can be Val or
IleMISC_FEATURE(77)..(77)Xaa can be Ile or
MetMISC_FEATURE(83)..(83)Xaa can be Lys or
GlnMISC_FEATURE(99)..(99)Xaa can be Arg or
LysMISC_FEATURE(100)..(100)Xaa can be Asp or
AsnMISC_FEATURE(103)..(103)Xaa can be His, Phe or Try 140Gln Val
Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15Thr
Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Xaa Ser Gly 20 25
30Gly Tyr Tyr Trp Xaa Trp Ile Arg Gln His Pro Gly Lys Gly Leu Glu
35 40 45Trp Ile Gly Xaa Ile Xaa Tyr Ser Gly Xaa Xaa Tyr Tyr Asn Pro
Ser 50 55 60Leu Lys Ser Arg Xaa Thr Xaa Ser Val Asp Thr Ser Xaa Asn
Gln Phe65 70 75 80Ser Leu Xaa Leu Ser Ser Val Thr Ala Ala Asp Thr
Ala Val Tyr Tyr 85 90 95Cys Ala Xaa Xaa Arg Gly Xaa Tyr Tyr Gly Met
Asp Val Trp Gly Gln 100 105 110Gly Thr Thr Val Thr Val Ser Ser 115
120141125PRTArtificialConsensus SequenceMISC_FEATURE(23)..(23)Xaa
can be Ala or ValMISC_FEATURE(24)..(24)Xaa can be Ala or
ValMISC_FEATURE(31)..(31)Xaa can be Thr or
SerMISC_FEATURE(32)..(32)Xaa can be Tyr or
PheMISC_FEATURE(54)..(54)Xaa can be Ser or
ArgMISC_FEATURE(58)..(58)Xaa can be Arg or
IleMISC_FEATURE(60)..(60)Xaa can be His, Try or
IleMISC_FEATURE(105)..(105)Xaa can be Pro or
GlyMISC_FEATURE(106)..(106)Xaa can be Trp or
PheMISC_FEATURE(107)..(107)Xaa can be Gly or
HisMISC_FEATURE(112)..(112)Xaa can be Met or Leu 141Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Xaa Xaa Ser Gly Phe Thr Phe Ser Xaa Xaa 20 25 30Ser Met
Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser
Tyr Ile Ser Ser Xaa Ser Ser Thr Xaa Tyr Xaa Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Asp Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Arg Ile Ala Ala Ala Gly Xaa Xaa Xaa Tyr Tyr Tyr
Ala Xaa 100 105 110Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser
Ser 115 120 125142121PRTArtificialConsensus
SequenceMISC_FEATURE(33)..(33)Xaa can be Gly or
AlaMISC_FEATURE(48)..(48)Xaa can be Val or
LeuMISC_FEATURE(49)..(49)Xaa can be Ala or
SerMISC_FEATURE(53)..(53)Xaa can be Phe or
HisMISC_FEATURE(57)..(57)Xaa can be Leu or Ile 142Gln Val Gln Leu
Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Xaa Met
His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Xaa 35 40 45Xaa
Val Ile Ser Xaa Asp Gly Ser Xaa Lys Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Glu Arg Thr Thr Leu Ser Gly Ser Tyr Phe Asp Tyr
Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115
120143124PRTArtificialConsensus SequenceMISC_FEATURE(58)..(58)Xaa
can be Glu or LysMISC_FEATURE(103)..(103)Xaa can be Thr or Ser
143Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr 20 25 30Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Ala Val Ile Trp Tyr Asp Gly Ser Asn Xaa Tyr Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Arg Gly Tyr Xaa Ser Ser
Trp Tyr Pro Asp Ala Phe Asp 100 105 110Ile Trp Gly Gln Gly Thr Met
Val Thr Val Ser Ser 115 1201441026DNAHomo sapiens 144aactcggtga
acaactgagg gaaccaaacc agagacgcgc tgaacagaga gaatcaggct 60caaagcaagt
ggaagtgggc agagattcca ccaggactgg tgcaaggcgc agagccagcc
120agatttgaga agaaggcaaa aagatgctgg ggagcagagc tgtaatgctg
ctgttgctgc 180tgccctggac agctcagggc agagctgtgc ctgggggcag
cagccctgcc tggactcagt 240gccagcagct ttcacagaag ctctgcacac
tggcctggag tgcacatcca ctagtgggac 300acatggatct aagagaagag
ggagatgaag agactacaaa tgatgttccc catatccagt 360gtggagatgg
ctgtgacccc caaggactca gggacaacag tcagttctgc ttgcaaagga
420tccaccaggg tctgattttt tatgagaagc tgctaggatc ggatattttc
acaggggagc 480cttctctgct ccctgatagc cctgtgggcc agcttcatgc
ctccctactg ggcctcagcc 540aactcctgca gcctgagggt caccactggg
agactcagca gattccaagc ctcagtccca 600gccagccatg gcagcgtctc
cttctccgct tcaaaatcct tcgcagcctc caggcctttg 660tggctgtagc
cgcccgggtc tttgcccatg gagcagcaac cctgagtccc taaaggcagc
720agctcaagga tggcactcag atctccatgg cccagcaagg ccaagataaa
tctaccaccc 780caggcacctg tgagccaaca ggttaattag tccattaatt
ttagtgggac ctgcatatgt 840tgaaaattac caatactgac tgacatgtga
tgctgaccta tgataaggtt gagtatttat 900tagatgggaa gggaaatttg
gggattattt atcctcctgg ggacagtttg gggaggatta 960tttattgtat
ttatattgaa ttatgtactt ttttcaataa agtcttattt ttgtggctaa 1020aaaaaa
1026145189PRTHomo sapiens 145Met Leu Gly Ser Arg Ala Val Met Leu
Leu Leu Leu Leu Pro Trp Thr1 5 10 15Ala Gln Gly Arg Ala Val Pro Gly
Gly Ser Ser Pro Ala Trp Thr Gln 20 25 30Cys Gln Gln Leu Ser Gln Lys
Leu Cys Thr Leu Ala Trp Ser Ala His 35 40 45Pro Leu Val Gly His Met
Asp Leu Arg Glu Glu Gly Asp Glu Glu Thr 50 55 60Thr Asn Asp Val Pro
His Ile Gln Cys Gly Asp Gly Cys Asp Pro Gln65 70 75 80Gly Leu Arg
Asp Asn Ser Gln Phe Cys Leu Gln Arg Ile His Gln Gly 85 90 95Leu Ile
Phe Tyr Glu Lys Leu Leu Gly Ser Asp Ile Phe Thr Gly Glu 100 105
110Pro Ser Leu Leu Pro Asp Ser Pro Val Gly Gln Leu His Ala Ser Leu
115 120 125Leu Gly Leu Ser Gln Leu Leu Gln Pro Glu Gly His His Trp
Glu Thr 130 135 140Gln Gln Ile Pro Ser Leu Ser Pro Ser Gln Pro Trp
Gln Arg Leu Leu145 150 155 160Leu Arg Phe Lys Ile Leu Arg Ser Leu
Gln Ala Phe Val Ala Val Ala 165 170 175Ala Arg Val Phe Ala His Gly
Ala Ala Thr Leu Ser Pro 180 1851461399DNAHomo sapiens 146ctgtttcagg
gccattggac tctccgtcct gcccagagca agatgtgtca ccagcagttg 60gtcatctctt
ggttttccct ggtttttctg gcatctcccc tcgtggccat atgggaactg
120aagaaagatg tttatgtcgt agaattggat tggtatccgg atgcccctgg
agaaatggtg 180gtcctcacct gtgacacccc tgaagaagat ggtatcacct
ggaccttgga ccagagcagt 240gaggtcttag gctctggcaa aaccctgacc
atccaagtca aagagtttgg agatgctggc 300cagtacacct gtcacaaagg
aggcgaggtt ctaagccatt cgctcctgct gcttcacaaa 360aaggaagatg
gaatttggtc cactgatatt ttaaaggacc agaaagaacc caaaaataag
420acctttctaa gatgcgaggc caagaattat tctggacgtt tcacctgctg
gtggctgacg 480acaatcagta ctgatttgac attcagtgtc aaaagcagca
gaggctcttc tgacccccaa 540ggggtgacgt gcggagctgc tacactctct
gcagagagag tcagagggga caacaaggag 600tatgagtact cagtggagtg
ccaggaggac agtgcctgcc cagctgctga ggagagtctg 660cccattgagg
tcatggtgga tgccgttcac aagctcaagt atgaaaacta caccagcagc
720ttcttcatca gggacatcat caaacctgac ccacccaaga acttgcagct
gaagccatta 780aagaattctc ggcaggtgga ggtcagctgg gagtaccctg
acacctggag tactccacat 840tcctacttct ccctgacatt ctgcgttcag
gtccagggca agagcaagag agaaaagaaa 900gatagagtct tcacggacaa
gacctcagcc acggtcatct gccgcaaaaa tgccagcatt 960agcgtgcggg
cccaggaccg ctactatagc tcatcttgga gcgaatgggc atctgtgccc
1020tgcagttagg ttctgatcca ggatgaaaat ttggaggaaa agtggaagat
attaagcaaa 1080atgtttaaag acacaacgga atagacccaa aaagataatt
tctatctgat ttgctttaaa 1140acgttttttt aggatcacaa tgatatcttt
gctgtatttg tatagttaga tgctaaatgc 1200tcattgaaac aatcagctaa
tttatgtata gattttccag ctctcaagtt gccatgggcc 1260ttcatgctat
ttaaatattt aagtaattta tgtatttatt agtatattac tgttatttaa
1320cgtttgtctg ccaggatgta tggaatgttt catactctta tgacctgatc
catcaggatc 1380agtccctatt atgcaaaat 1399147328PRTHomo sapiens
147Met Cys His Gln Gln Leu Val Ile Ser Trp Phe Ser Leu Val Phe Leu1
5 10 15Ala Ser Pro Leu Val Ala Ile Trp Glu Leu Lys Lys Asp Val Tyr
Val 20 25 30Val Glu Leu Asp Trp Tyr Pro Asp Ala Pro Gly Glu Met Val
Val Leu 35 40 45Thr Cys Asp Thr Pro Glu Glu Asp Gly Ile Thr Trp Thr
Leu Asp Gln 50 55 60Ser Ser Glu Val Leu Gly Ser Gly Lys Thr Leu Thr
Ile Gln Val Lys65 70 75 80Glu Phe Gly Asp Ala Gly Gln Tyr Thr Cys
His Lys Gly Gly Glu Val 85 90 95Leu Ser His Ser Leu Leu Leu Leu His
Lys Lys Glu Asp Gly Ile Trp 100 105 110Ser Thr Asp Ile Leu Lys Asp
Gln Lys Glu Pro Lys Asn Lys Thr Phe 115 120 125Leu Arg Cys Glu Ala
Lys Asn Tyr Ser Gly Arg Phe Thr Cys Trp Trp 130 135 140Leu Thr Thr
Ile Ser Thr Asp Leu Thr Phe Ser Val Lys Ser Ser Arg145 150 155
160Gly Ser Ser Asp Pro Gln Gly Val Thr Cys Gly Ala Ala Thr Leu Ser
165 170 175Ala Glu Arg Val Arg Gly Asp Asn Lys Glu Tyr Glu Tyr Ser
Val Glu 180 185 190Cys Gln Glu Asp Ser Ala Cys Pro Ala Ala Glu Glu
Ser Leu Pro Ile 195 200 205Glu Val Met Val Asp Ala Val His Lys Leu
Lys Tyr Glu Asn Tyr Thr 210 215 220Ser Ser Phe Phe Ile Arg Asp Ile
Ile Lys Pro Asp Pro Pro Lys Asn225 230 235 240Leu Gln Leu Lys Pro
Leu Lys Asn Ser Arg Gln Val Glu Val Ser Trp 245 250 255Glu Tyr Pro
Asp Thr Trp Ser Thr Pro His Ser Tyr Phe Ser Leu Thr 260 265 270Phe
Cys Val Gln Val Gln Gly Lys Ser Lys Arg Glu Lys Lys Asp Arg 275 280
285Val Phe Thr Asp Lys Thr Ser Ala Thr Val Ile Cys Arg Lys Asn Ala
290 295 300Ser Ile Ser Val Arg Ala Gln Asp Arg Tyr Tyr Ser Ser Ser
Trp Ser305 310 315 320Glu Trp Ala Ser Val Pro Cys Ser
3251482826DNAHomo sapiens 148acaagggtgg cagcctggct ctgaagtgga
attatgtgct tcaaacaggt tgaaagaggg 60aaacagtctt ttcctgcttc cagacatgaa
tcaggtcact attcaatggg atgcagtaat 120agccctttac atactcttca
gctggtgtca tggaggaatt acaaatataa actgctctgg 180ccacatctgg
gtagaaccag ccacaatttt taagatgggt atgaatatct ctatatattg
240ccaagcagca attaagaact gccaaccaag gaaacttcat ttttataaaa
atggcatcaa 300agaaagattt caaatcacaa ggattaataa aacaacagct
cggctttggt ataaaaactt 360tctggaacca catgcttcta tgtactgcac
tgctgaatgt cccaaacatt ttcaagagac 420actgatatgt ggaaaagaca
tttcttctgg atatccgcca gatattcctg atgaagtaac 480ctgtgtcatt
tatgaatatt caggcaacat gacttgcacc tggaatgctg ggaagctcac
540ctacatagac acaaaatacg tggtacatgt gaagagttta gagacagaag
aagagcaaca 600gtatctcacc tcaagctata ttaacatctc cactgattca
ttacaaggtg gcaagaagta 660cttggtttgg gtccaagcag caaacgcact
aggcatggaa gagtcaaaac aactgcaaat 720tcacctggat gatatagtga
taccttctgc agccgtcatt tccagggctg agactataaa 780tgctacagtg
cccaagacca taatttattg ggatagtcaa acaacaattg aaaaggtttc
840ctgtgaaatg agatacaagg ctacaacaaa ccaaacttgg aatgttaaag
aatttgacac 900caattttaca tatgtgcaac agtcagaatt ctacttggag
ccaaacatta agtacgtatt 960tcaagtgaga tgtcaagaaa caggcaaaag
gtactggcag ccttggagtt cactgttttt 1020tcataaaaca cctgaaacag
ttccccaggt cacatcaaaa gcattccaac atgacacatg 1080gaattctggg
ctaacagttg cttccatctc tacagggcac cttacttctg acaacagagg
1140agacattgga cttttattgg gaatgatcgt ctttgctgtt atgttgtcaa
ttctttcttt 1200gattgggata tttaacagat cattccgaac tgggattaaa
agaaggatct tattgttaat 1260accaaagtgg ctttatgaag atattcctaa
tatgaaaaac agcaatgttg tgaaaatgct 1320acaggaaaat agtgaactta
tgaataataa ttccagtgag caggtcctat atgttgatcc 1380catgattaca
gagataaaag aaatcttcat cccagaacac aagcctacag actacaagaa
1440ggagaataca ggacccctgg agacaagaga ctacccgcaa aactcgctat
tcgacaatac 1500tacagttgta tatattcctg atctcaacac tggatataaa
ccccaaattt caaattttct 1560gcctgaggga agccatctca gcaataataa
tgaaattact tccttaacac ttaaaccacc 1620agttgattcc ttagactcag
gaaataatcc caggttacaa aagcatccta attttgcttt 1680ttctgtttca
agtgtgaatt cactaagcaa cacaatattt cttggagaat taagcctcat
1740attaaatcaa ggagaatgca gttctcctga catacaaaac tcagtagagg
aggaaaccac 1800catgcttttg gaaaatgatt cacccagtga aactattcca
gaacagaccc tgcttcctga 1860tgaatttgtc tcctgtttgg ggatcgtgaa
tgaggagttg ccatctatta atacttattt 1920tccacaaaat attttggaaa
gccacttcaa taggatttca ctcttggaaa agtagagctg 1980tgtggtcaaa
atcaatatga gaaagctgcc ttgcaatctg aacttgggtt ttccctgcaa
2040tagaaattga attctgcctc tttttgaaaa aaatgtattc acatacaaat
cttcacatgg 2100acacatgttt tcatttccct tggataaata cctaggtagg
ggattgctgg gccatatgat 2160aagcatatgt ttcagttcta ccaatcttgt
ttccagagta gtgacatttc tgtgctccta 2220ccatcaccat gtaagaattc
ccgggagctc catgcctttt taattttagc cattcttctg 2280cctcatttct
taaaattaga gaattaaggt cccgaaggtg gaacatgctt catggtcaca
2340catacaggca caaaaacagc attatgtgga cgcctcatgt attttttata
gagtcaacta 2400tttcctcttt attttccctc attgaaagat gcaaaacagc
tctctattgt gtacagaaag 2460ggtaaataat gcaaaatacc tggtagtaaa
ataaatgctg aaaattttcc tttaaaatag 2520aatcattagg ccaggcgtgg
tggctcatgc ttgtaatccc agcactttgg taggctgagg 2580taggtggatc
acctgaggtc aggagttcga gtccagcctg gccaatatgc tgaaaccctg
2640tctctactaa aattacaaaa attagccggc catggtggca ggtgcttgta
atcccagcta 2700cttgggaggc tgaggcagga gaatcacttg aaccaggaag
gcagaggttg cactgagctg 2760agattgtgcc actgcactcc agcctgggca
acaagagcaa aactctgtct ggaaaaaaaa 2820aaaaaa 2826149629PRTHomo
sapiens 149Met Asn Gln Val Thr Ile Gln Trp Asp Ala Val Ile Ala Leu
Tyr Ile1 5 10 15Leu Phe Ser Trp Cys His Gly Gly Ile Thr Asn Ile Asn
Cys Ser Gly 20 25 30His Ile Trp Val Glu Pro Ala Thr Ile Phe Lys Met
Gly Met Asn Ile 35 40 45Ser Ile Tyr Cys Gln Ala Ala Ile Lys Asn Cys
Gln Pro Arg Lys Leu 50 55 60His Phe Tyr Lys Asn Gly Ile Lys Glu Arg
Phe Gln Ile Thr Arg Ile65 70 75 80Asn Lys Thr Thr Ala Arg Leu Trp
Tyr Lys Asn Phe Leu Glu Pro His 85 90 95Ala Ser Met Tyr Cys Thr Ala
Glu Cys Pro Lys His Phe Gln Glu Thr 100 105 110Leu Ile Cys Gly Lys
Asp Ile Ser Ser Gly Tyr Pro Pro Asp Ile Pro 115 120 125Asp Glu Val
Thr Cys Val Ile Tyr Glu Tyr Ser Gly Asn Met Thr Cys 130 135 140Thr
Trp Asn Ala Gly Lys Leu Thr Tyr Ile Asp Thr Lys Tyr Val Val145 150
155 160His Val Lys Ser Leu Glu Thr Glu Glu Glu Gln Gln Tyr Leu Thr
Ser 165 170 175Ser Tyr Ile Asn Ile Ser Thr Asp Ser Leu Gln Gly Gly
Lys Lys Tyr 180 185 190Leu Val Trp Val Gln Ala Ala Asn Ala Leu Gly
Met Glu Glu Ser Lys 195 200 205Gln Leu Gln Ile His Leu Asp Asp Ile
Val Ile Pro Ser Ala Ala Val 210 215 220Ile Ser Arg Ala Glu Thr Ile
Asn Ala Thr Val Pro Lys Thr Ile Ile225 230 235 240Tyr Trp Asp Ser
Gln Thr Thr Ile Glu Lys Val Ser Cys Glu Met Arg 245 250 255Tyr Lys
Ala Thr Thr Asn Gln Thr Trp Asn Val Lys Glu Phe Asp Thr 260 265
270Asn Phe Thr Tyr Val Gln Gln Ser Glu Phe Tyr Leu Glu Pro Asn Ile
275 280 285Lys Tyr Val Phe Gln Val Arg Cys Gln Glu Thr Gly Lys Arg
Tyr Trp 290 295 300Gln Pro Trp Ser Ser Leu Phe Phe His Lys Thr Pro
Glu Thr Val Pro305 310 315 320Gln Val Thr Ser Lys Ala Phe Gln His
Asp Thr Trp Asn Ser Gly Leu 325 330 335Thr Val Ala Ser Ile Ser Thr
Gly His Leu Thr Ser Asp Asn Arg Gly 340 345 350Asp Ile Gly Leu Leu
Leu Gly Met Ile Val Phe Ala Val Met Leu Ser 355 360 365Ile Leu Ser
Leu Ile Gly Ile Phe Asn Arg Ser Phe Arg Thr Gly Ile 370 375 380Lys
Arg Arg Ile Leu Leu Leu Ile Pro Lys Trp Leu Tyr Glu Asp Ile385 390
395 400Pro Asn
Met Lys Asn Ser Asn Val Val Lys Met Leu Gln Glu Asn Ser 405 410
415Glu Leu Met Asn Asn Asn Ser Ser Glu Gln Val Leu Tyr Val Asp Pro
420 425 430Met Ile Thr Glu Ile Lys Glu Ile Phe Ile Pro Glu His Lys
Pro Thr 435 440 445Asp Tyr Lys Lys Glu Asn Thr Gly Pro Leu Glu Thr
Arg Asp Tyr Pro 450 455 460Gln Asn Ser Leu Phe Asp Asn Thr Thr Val
Val Tyr Ile Pro Asp Leu465 470 475 480Asn Thr Gly Tyr Lys Pro Gln
Ile Ser Asn Phe Leu Pro Glu Gly Ser 485 490 495His Leu Ser Asn Asn
Asn Glu Ile Thr Ser Leu Thr Leu Lys Pro Pro 500 505 510Val Asp Ser
Leu Asp Ser Gly Asn Asn Pro Arg Leu Gln Lys His Pro 515 520 525Asn
Phe Ala Phe Ser Val Ser Ser Val Asn Ser Leu Ser Asn Thr Ile 530 535
540Phe Leu Gly Glu Leu Ser Leu Ile Leu Asn Gln Gly Glu Cys Ser
Ser545 550 555 560Pro Asp Ile Gln Asn Ser Val Glu Glu Glu Thr Thr
Met Leu Leu Glu 565 570 575Asn Asp Ser Pro Ser Glu Thr Ile Pro Glu
Gln Thr Leu Leu Pro Asp 580 585 590Glu Phe Val Ser Cys Leu Gly Ile
Val Asn Glu Glu Leu Pro Ser Ile 595 600 605Asn Thr Tyr Phe Pro Gln
Asn Ile Leu Glu Ser His Phe Asn Arg Ile 610 615 620Ser Leu Leu Glu
Lys6251502100DNAHomo sapiens 150ggtggctgaa cctcgcaggt ggcagagagg
ctcccctggg gctgtggggc tctacgtgga 60tccgatggag ccgctggtga cctgggtggt
ccccctcctc ttcctcttcc tgctgtccag 120gcagggcgct gcctgcagaa
ccagtgagtg ctgttttcag gacccgccat atccggatgc 180agactcaggc
tcggcctcgg gccctaggga cctgagatgc tatcggatat ccagtgatcg
240ttacgagtgc tcctggcagt atgagggtcc cacagctggg gtcagccact
tcctgcggtg 300ttgccttagc tccgggcgct gctgctactt cgccgccggc
tcagccacca ggctgcagtt 360ctccgaccag gctggggtgt ctgtgctgta
cactgtcaca ctctgggtgg aatcctgggc 420caggaaccag acagagaagt
ctcctgaggt gaccctgcag ctctacaact cagttaaata 480tgagcctcct
ctgggagaca tcaaggtgtc caagttggcc gggcagctgc gtatggagtg
540ggagaccccg gataaccagg ttggtgctga ggtgcagttc cggcaccgga
cacccagcag 600cccatggaag ttgggcgact gcggacctca ggatgatgat
actgagtcct gcctctgccc 660cctggagatg aatgtggccc aggaattcca
gctccgacga cggcagctgg ggagccaagg 720aagttcctgg agcaagtgga
gcagccccgt gtgcgttccc cctgaaaacc ccccacagcc 780tcaggtgaga
ttctcggtgg agcagctggg ccaggatggg aggaggcggc tgaccctgaa
840agagcagcca acccagctgg agcttccaga aggctgtcaa gggctggcgc
ctggcacgga 900ggtcacttac cgactacagc tccacatgct gtcctgcccg
tgtaaggcca aggccaccag 960gaccctgcac ctggggaaga tgccctatct
ctcgggtgct gcctacaacg tggctgtcat 1020ctcctcgaac caatttggtc
ctggcctgaa ccagacgtgg cacattcctg ccgacaccca 1080cacagaacca
gtggctctga atatcagcgt cggaaccaac gggaccacca tgtattggcc
1140agcccgggct cagagcatga cgtattgcat tgaatggcag cctgtgggcc
aggacggggg 1200ccttgccacc tgcagcctga ctgcgccgca agacccggat
ccggctggaa tggcaaccta 1260cagctggagt cgagagtctg gggcaatggg
gcaggaaaag tgttactaca ttaccatctt 1320tgcctctgcg caccccgaga
agctcacctt gtggtctacg gtcctgtcca cctaccactt 1380tgggggcaat
gcctcagcag ctgggacacc gcaccacgtc tcggtgaaga atcatagctt
1440ggactctgtg tctgtggact gggcaccatc cctgctgagc acctgtcccg
gcgtcctaaa 1500ggagtatgtt gtccgctgcc gagatgaaga cagcaaacag
gtgtcagagc atcccgtgca 1560gcccacagag acccaagtta ccctcagtgg
cctgcgggct ggtgtagcct acacggtgca 1620ggtgcgagca gacacagcgt
ggctgagggg tgtctggagc cagccccagc gcttcagcat 1680cgaagtgcag
gtttctgatt ggctcatctt cttcgcctcc ctggggagct tcctgagcat
1740ccttctcgtg ggcgtccttg gctaccttgg cctgaacagg gccgcacggc
acctgtgccc 1800gccgctgccc acaccctgtg ccagctccgc cattgagttc
cctggaggga aggagacttg 1860gcagtggatc aacccagtgg acttccagga
agaggcatcc ctgcaggagg ccctggtggt 1920agagatgtcc tgggacaaag
gcgagaggac tgagcctctc gagaagacag agctacctga 1980gggtgcccct
gagctggccc tggatacaga gttgtccttg gaggatggag acaggtgcaa
2040ggccaagatg tgatcgttga ggctcagaga gggtgagtga ctcgcccgag
gctacgtagc 2100151662PRTHomo sapiens 151Met Glu Pro Leu Val Thr Trp
Val Val Pro Leu Leu Phe Leu Phe Leu1 5 10 15Leu Ser Arg Gln Gly Ala
Ala Cys Arg Thr Ser Glu Cys Cys Phe Gln 20 25 30Asp Pro Pro Tyr Pro
Asp Ala Asp Ser Gly Ser Ala Ser Gly Pro Arg 35 40 45Asp Leu Arg Cys
Tyr Arg Ile Ser Ser Asp Arg Tyr Glu Cys Ser Trp 50 55 60Gln Tyr Glu
Gly Pro Thr Ala Gly Val Ser His Phe Leu Arg Cys Cys65 70 75 80Leu
Ser Ser Gly Arg Cys Cys Tyr Phe Ala Ala Gly Ser Ala Thr Arg 85 90
95Leu Gln Phe Ser Asp Gln Ala Gly Val Ser Val Leu Tyr Thr Val Thr
100 105 110Leu Trp Val Glu Ser Trp Ala Arg Asn Gln Thr Glu Lys Ser
Pro Glu 115 120 125Val Thr Leu Gln Leu Tyr Asn Ser Val Lys Tyr Glu
Pro Pro Leu Gly 130 135 140Asp Ile Lys Val Ser Lys Leu Ala Gly Gln
Leu Arg Met Glu Trp Glu145 150 155 160Thr Pro Asp Asn Gln Val Gly
Ala Glu Val Gln Phe Arg His Arg Thr 165 170 175Pro Ser Ser Pro Trp
Lys Leu Gly Asp Cys Gly Pro Gln Asp Asp Asp 180 185 190Thr Glu Ser
Cys Leu Cys Pro Leu Glu Met Asn Val Ala Gln Glu Phe 195 200 205Gln
Leu Arg Arg Arg Gln Leu Gly Ser Gln Gly Ser Ser Trp Ser Lys 210 215
220Trp Ser Ser Pro Val Cys Val Pro Pro Glu Asn Pro Pro Gln Pro
Gln225 230 235 240Val Arg Phe Ser Val Glu Gln Leu Gly Gln Asp Gly
Arg Arg Arg Leu 245 250 255Thr Leu Lys Glu Gln Pro Thr Gln Leu Glu
Leu Pro Glu Gly Cys Gln 260 265 270Gly Leu Ala Pro Gly Thr Glu Val
Thr Tyr Arg Leu Gln Leu His Met 275 280 285Leu Ser Cys Pro Cys Lys
Ala Lys Ala Thr Arg Thr Leu His Leu Gly 290 295 300Lys Met Pro Tyr
Leu Ser Gly Ala Ala Tyr Asn Val Ala Val Ile Ser305 310 315 320Ser
Asn Gln Phe Gly Pro Gly Leu Asn Gln Thr Trp His Ile Pro Ala 325 330
335Asp Thr His Thr Glu Pro Val Ala Leu Asn Ile Ser Val Gly Thr Asn
340 345 350Gly Thr Thr Met Tyr Trp Pro Ala Arg Ala Gln Ser Met Thr
Tyr Cys 355 360 365Ile Glu Trp Gln Pro Val Gly Gln Asp Gly Gly Leu
Ala Thr Cys Ser 370 375 380Leu Thr Ala Pro Gln Asp Pro Asp Pro Ala
Gly Met Ala Thr Tyr Ser385 390 395 400Trp Ser Arg Glu Ser Gly Ala
Met Gly Gln Glu Lys Cys Tyr Tyr Ile 405 410 415Thr Ile Phe Ala Ser
Ala His Pro Glu Lys Leu Thr Leu Trp Ser Thr 420 425 430Val Leu Ser
Thr Tyr His Phe Gly Gly Asn Ala Ser Ala Ala Gly Thr 435 440 445Pro
His His Val Ser Val Lys Asn His Ser Leu Asp Ser Val Ser Val 450 455
460Asp Trp Ala Pro Ser Leu Leu Ser Thr Cys Pro Gly Val Leu Lys
Glu465 470 475 480Tyr Val Val Arg Cys Arg Asp Glu Asp Ser Lys Gln
Val Ser Glu His 485 490 495Pro Val Gln Pro Thr Glu Thr Gln Val Thr
Leu Ser Gly Leu Arg Ala 500 505 510Gly Val Ala Tyr Thr Val Gln Val
Arg Ala Asp Thr Ala Trp Leu Arg 515 520 525Gly Val Trp Ser Gln Pro
Gln Arg Phe Ser Ile Glu Val Gln Val Ser 530 535 540Asp Trp Leu Ile
Phe Phe Ala Ser Leu Gly Ser Phe Leu Ser Ile Leu545 550 555 560Leu
Val Gly Val Leu Gly Tyr Leu Gly Leu Asn Arg Ala Ala Arg His 565 570
575Leu Cys Pro Pro Leu Pro Thr Pro Cys Ala Ser Ser Ala Ile Glu Phe
580 585 590Pro Gly Gly Lys Glu Thr Trp Gln Trp Ile Asn Pro Val Asp
Phe Gln 595 600 605Glu Glu Ala Ser Leu Gln Glu Ala Leu Val Val Glu
Met Ser Trp Asp 610 615 620Lys Gly Glu Arg Thr Glu Pro Leu Glu Lys
Thr Glu Leu Pro Glu Gly625 630 635 640Ala Pro Glu Leu Ala Leu Asp
Thr Glu Leu Ser Leu Glu Asp Gly Asp 645 650 655Arg Cys Lys Ala Lys
Met 660152360DNAHomo sapiens 152caggtgcagc tgcaggagtc gggcccagga
ctggtgaagc cttcacagac cctgtccctc 60acctgcactg tctctggtgg ctccatcagc
agtggtggtt actactggag ctggatccgc 120cagcacccag ggaagggcct
ggagtggatt gggcacatcc attacagtgg gaacacctac 180tacaacccgt
ccctcaagag tcgagttacc atatcagtag acacgtctaa gaatcagttc
240tccctgaaac tgagctctgt gactgccgcg gacacggccg tgtattactg
tgcgcgaaat 300cgcgggttct actacggtat ggacgtctgg ggccaaggga
ccacggtcac cgtctcctca 360153120PRTHomo sapiens 153Gln Val Gln Leu
Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu Ser
Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser Ser Gly 20 25 30Gly Tyr
Tyr Trp Ser Trp Ile Arg Gln His Pro Gly Lys Gly Leu Glu 35 40 45Trp
Ile Gly His Ile His Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser 50 55
60Leu Lys Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe65
70 75 80Ser Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr
Tyr 85 90 95Cys Ala Arg Asn Arg Gly Phe Tyr Tyr Gly Met Asp Val Trp
Gly Gln 100 105 110Gly Thr Thr Val Thr Val Ser Ser 115
12015423PRTArtificial SequenceHoneybee melittin signal 154Met Lys
Phe Leu Val Asn Val Ala Leu Val Phe Met Val Val Tyr Ile1 5 10 15Ser
Tyr Ile Tyr Ala Ala Ala 201556PRTArtificial SequenceHis Tag 155His
His His His His His1 5
* * * * *