U.S. patent application number 16/279950 was filed with the patent office on 2019-09-26 for cyclic di-nucleotide induction of type i interferon.
The applicant listed for this patent is The Regents of the University of California. Invention is credited to Dara Burdette, Elie J. Diner, Ming C. Hammond, Russell E. Vance, Stephen C. Wilson.
Application Number | 20190292216 16/279950 |
Document ID | / |
Family ID | 51841746 |
Filed Date | 2019-09-26 |
View All Diagrams
United States Patent
Application |
20190292216 |
Kind Code |
A1 |
Vance; Russell E. ; et
al. |
September 26, 2019 |
Cyclic Di-Nucleotide Induction of Type I Interferon
Abstract
Methods and compositions are provided for increasing the
production of a type I interferon (IFN) in a cell. Aspects of the
methods include increasing the level of a 2'-5' phosphodiester
linkage comprising cyclic-di-nucleotide in a cell in a manner
sufficient to increase production of the type I interferon (IFN) by
the cell. Also provided are compositions and kits for practicing
the embodiments of the methods.
Inventors: |
Vance; Russell E.; (Albany,
CA) ; Hammond; Ming C.; (Berkeley, CA) ;
Burdette; Dara; (Berkeley, CA) ; Diner; Elie J.;
(San Rafael, CA) ; Wilson; Stephen C.; (Berkeley,
CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Regents of the University of California |
Oakland |
CA |
US |
|
|
Family ID: |
51841746 |
Appl. No.: |
16/279950 |
Filed: |
February 19, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14268967 |
May 2, 2014 |
|
|
|
16279950 |
|
|
|
|
61819499 |
May 3, 2013 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07H 21/02 20130101;
A61K 31/7084 20130101; A61P 35/00 20180101; A61P 35/04 20180101;
A61P 37/04 20180101; A61P 31/12 20180101 |
International
Class: |
C07H 21/02 20060101
C07H021/02; A61K 31/7084 20060101 A61K031/7084 |
Goverment Interests
GOVERNMENT RIGHTS
[0002] This invention was made with government support under grant
nos. A1063302, A1075038, A1080749, A1082357, and OD008677 awarded
by the National Institutes of Health. The government has certain
rights in the invention.
Claims
1.-86. (canceled)
87. A method of treating a subject for a neoplastic disease, the
method comprising: administering to the subject an anti-neoplastic
agent in combination with a 2'-5' phosphodiester linkage comprising
cyclic-di-nucleotide to treat the subject for the neoplastic
disease.
88. The method according to claim 87, wherein neoplastic disease is
cancer.
89. The method according to claim 88, wherein the anti-neoplastic
agent is a chemotherapeutic agent.
90. The method according to claim 87, wherein the subject is a
mammal.
91. The method according to claim 90, wherein the mammal is a
human.
92. The method according to claim 87, wherein the
cyclic-di-nucleotide comprises two 2'-5' phosphodiester
linkages.
93. The method according to claim 87, wherein the
cyclic-di-nucleotide comprises a 2'-5' phosphodiester linkage and a
3'-5' phosphodiester linkage.
94. The method according to claim 87, wherein the
cyclic-di-nucleotide comprises a guanosine nucleoside.
95. The method according to claim 87, wherein the
cyclic-di-nucleotide comprises an adenosine nucleoside.
96. The method according to claim 87, wherein the
cyclic-di-nucleotide comprises an adenosine and a guanosine
nucleoside.
97. A method of treating a subject for a neoplastic condition, the
method comprising: administering to the subject a specific binding
moiety in combination with a 2'-5' phosphodiester linkage
comprising cyclic-di-nucleotide to treat the subject for the
condition.
98. The method according to claim 97, wherein the specific binding
moiety is an antibody.
99. The method according to claim 97, wherein neoplastic disease is
cancer.
100. The method according to claim 97, wherein the subject is a
mammal.
101. The method according to claim 100, wherein the mammal is a
human.
102. The method according to claim 97, wherein the
cyclic-di-nucleotide comprises two 2'-5' phosphodiester
linkages.
103. The method according to claim 97, wherein the
cyclic-di-nucleotide comprises a 2'-5' phosphodiester linkage and a
3'-5' phosphodiester linkage.
104. The method according to claim 97, wherein the
cyclic-di-nucleotide comprises a guanosine nucleoside.
105. The method according to claim 97, wherein the
cyclic-di-nucleotide comprises an adenosine nucleoside.
106. The method according to claim 97, wherein the
cyclic-di-nucleotide comprises an adenosine and a guanosine
nucleoside.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] Under 35 U.S.C. .sctn. 119(e), this application claims
priority to the filing date of U.S. Provisional Patent Application
Ser. No. 61/819,499, filed on May 3, 2013; the disclosure of which
applications are incorporated herein by reference.
INTRODUCTION
[0003] Interferons (also referred to as "IFN" or "IFNs") are
proteins having a variety of biological activities, some of which
are antiviral, immunomodulating and antiproliferative. They are
relatively small, species-specific, single chain polypeptides,
produced by mammalian cells in response to exposure to a variety of
inducers such as viruses, polypeptides, mitogens and the like.
Interferons protect animal tissues and cells against viral attack
and are an important host defense mechanism. In most cases,
interferons provide better protection to tissues and cells of the
kind from which they have been produced than to other types of
tissues and cells, indicating that human-derived interferon could
be more efficacious in treating human diseases than interferons
from other species. Interferons may be classified as Type-I,
Type-II and Type-III interferons. Mammalian Type-I interferons
include IFN-.alpha. (alpha), IFN-.beta. (beta), IFN-.kappa.
(kappa), IFN-.delta. (delta), IFN-.epsilon. (epsilon), IFN-.tau.
(tau), IFN-.omega. (omega), and IFN-.zeta. (zeta, also known as
limitin).
[0004] Agents that induce interferon production find use as vaccine
adjuvants and in formulations that initiate effector and memory
T-cell responses. Effective adjuvants enhance specific immune
responses to antigens while minimizing toxic side effects, reducing
the dose and dosage of vaccinations, and broadening the immune
response. There remains a need for effective adjuvants that may be
coformulated with antigens derived from intracellular pathogens and
cancer cells to activate an effective cellular and humoral immune
response to treat intracellular pathogens and reduce tumor burden.
The immunomodulatory activity of interferon proteins, and the
signaling pathways that regulate interferon production, are drawing
interest as a target for designing new adjuvants.
[0005] Interferons have potential in the treatment of a large
number of human cancers since these molecules have anti-cancer
activity that acts at multiple levels. First, interferon proteins
can directly inhibit the proliferation of human tumor cells. The
anti-proliferative activity is also synergistic with a variety of
approved chemotherapeutic agents such as cisplatin, 5FU and
paclitaxel. Secondly, the immunomodulatory activity of interferon
proteins can lead to the induction of an anti-tumor immune
response. This response includes activation of NK cells,
stimulation of macrophage activity and induction of MHC class I
surface expression, leading to the induction of anti-tumor
cytotoxic T lymphocyte activity. In addition, interferons play a
role in cross-presentation of antigens in the immune system.
Moreover, some studies further indicate that IFN-.beta. protein may
have anti-angiogenic activity. Angiogenesis, new blood vessel
formation, is critical for the growth of solid tumors. Evidence
indicates that IFN-.beta. may inhibit angiogenesis by inhibiting
the expression of pro-angiogenic factors such as bFGF and VEGF.
Lastly, interferon proteins may inhibit tumor invasiveness by
modulating the expression of enzymes, such as collagenase and
elastase, which are important in tissue remodeling.
[0006] Interferons also appear to have antiviral activities that
are based on two different mechanisms. For instance, type I
interferon proteins (.alpha. and .beta.) can directly inhibit the
replication of human hepatitis B virus ("HBV") and hepatitis C
virus ("HCV"), but can also stimulate an immune response that
attacks cells infected with these viruses.
SUMMARY
[0007] Methods and compositions are provided for increasing the
production of a type I interferon (IFN) in a cell. Aspects of the
methods include increasing the level of a 2'-5' phosphodiester
linkage comprising cyclic-di-nucleotide in a cell in a manner
sufficient to increase production of the type I interferon (IFN) by
the cell. Also provided are compositions and kits for practicing
the subject methods.
[0008] In one aspect, provided herein is a method for increasing
the production of a type I interferon (IFN) in a cell by increasing
the level of a 2'-5' phosphodiester linkage containing
cyclic-di-nucleotide in the cell in a manner sufficient to increase
production of the type I interferon (IFN) by the cell.
[0009] In certain embodiments, the method includes the step of
contacting the cell with the cyclic-di-nucleotide. In certain
embodiments, the cyclic-di-nucleotide has two 2'-5' phosphodiester
linkages. In other embodiments, the cyclic-di-nucleotide has a
2'-5' phosphodiester linkage and a 3'-5' phosphodiester
linkage.
[0010] In certain embodiments, the cyclic-di-nucleotide comprises a
guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide
contains two guanosine nucleosides. In certain embodiments, the
cyclic-di-nucleotide comprises an adenosine nucleoside. In some
embodiments, the cyclic-di-nucleotide contains two adenosine
nucleosides. In other embodiments, the cyclic-di-nucleotide
comprises an adenosine nucleoside and a guanosine nucleoside.
[0011] In certain embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00001##
wherein X and Y are each:
##STR00002##
[0012] In some embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00003##
[0013] In certain embodiments of the method, the level of the
cyclic-di-nucleotide is increased by increasing the activity of a
cGAMP synthase (cGAS) in the cell. In some embodiments, the
activity of the cGAS is increased by enhancing expression of a
nucleic acid encoding cGAS. In some embodiments, the activity of
the cGAS is increased by introducing a nucleic acid encoding the
cGAS into the cell.
[0014] In certain embodiments, the method is for increasing the
production of interferon (IFN) alpha. In other embodiments, the IFN
is interferon beta.
[0015] In certain embodiments, the method is for increasing the
production of a type I interferon (IFN) in a mammalian cell. In
particular embodiments, mammalian cell is a human cell. In some
embodiments, the cell is in vitro. In other embodiments, the cell
is in vivo.
[0016] In another aspect, provided herein is a method for
increasing the production of a type I interferon (IFN) in a
subject, the method includes the step of administering to the
subject an amount of a 2'-5' phosphodiester linkage comprising
cyclic-di-nucleotide active agent effective to increase the
production of the type I interferon in the subject.
[0017] The active agent can include, but is not limited to, any of
the 2'-5' phosphodiester linkage containing cyclic-di-nucleotides
described herein. In certain embodiments, the cyclic-di-nucleotide
has two 2'-5' phosphodiester linkages. In other embodiments, the
cyclic-di-nucleotide has a 2'-5' phosphodiester linkage and a 3'-5'
phosphodiester linkage.
[0018] In some embodiments, the cyclic-di-nucleotide contains a
guanosine nucleoside. In certain embodiments, the
cyclic-di-nucleotide contains two guanosine nucleosides. In some
embodiments, the cyclic-di-nucleotide contains an adenosine
nucleoside. In specific embodiments, the cyclic-di-nucleotide
contains two adenosine nucleosides. In other embodiments, the
cyclic-di-nucleotide contains an adenosine and a guanosine
nucleoside. In some embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00004##
wherein X and Y are each:
##STR00005##
[0019] In some embodiments of the subject method, the
cyclic-di-nucleotide has the following formula:
##STR00006##
In certain embodiments, the 2'-5' phosphodiester linkage comprising
cyclic-di-nucleotide active agent includes an agent that increases
cellular activity of a cGAMP synthase (cGAS). In specific
embodiments, the agent comprises a nucleic acid encoding the
cGAS.
[0020] In certain embodiments, the method is for increasing the
production of interferon (IFN) alpha in a subject. In other
embodiments, the method is for increasing the production of
interferon beta in a subject.
[0021] In certain embodiments, the subject has a viral infection.
In certain embodiments, the subject has a bacterial infection. In
other embodiments, the subject has a neoplastic disease. In certain
embodiments, the subject is mammal. In some embodiments, the mammal
is a human.
[0022] In another aspect, provided herein is a method for
increasing a stimulator of interferon genes (STING) mediated
response in a subject, the method includes the step of
administering to the subject an amount of a STING active agent
effective to increase a STING mediated response in the subject. In
certain embodiments, the STING mediated response is non-responsive
to a cyclic-di-nucleotide having two 3'-5' phosphodiester
bonds.
[0023] The STING active agent can include, but is not limited to,
any of the 2'-5' phosphodiester linkage containing
cyclic-di-nucleotides described herein. In certain embodiments, the
cyclic-di-nucleotide has two 2'-5' phosphodiester linkages. In
other embodiments, the cyclic-di-nucleotide has a 2'-5'
phosphodiester linkage and a 3'-5' phosphodiester linkage.
[0024] In some embodiments, the cyclic-di-nucleotide contains a
guanosine nucleoside. In certain embodiments, the
cyclic-di-nucleotide contains two guanosine nucleosides. In some
embodiments, the cyclic-di-nucleotide contains an adenosine
nucleoside. In specific embodiments, the cyclic-di-nucleotide
contains two adenosine nucleosides. In other embodiments, the
cyclic-di-nucleotide contains an adenosine and a guanosine
nucleoside. In some embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00007##
wherein X and Y are each:
##STR00008##
[0025] In some embodiments of the subject method, the
cyclic-di-nucleotide has the following formula:
##STR00009##
[0026] In certain embodiments, the STING active agent includes an
agent that increases cellular activity of a cGAMP synthase (cGAS).
In specific embodiments, the agent comprises a nucleic acid
encoding the cGAS.
[0027] In certain embodiments, the STING active agent includes an
agent that increases cellular activity of STING. In specific
embodiments, the agent comprises a nucleic acid encoding the
STING.
[0028] In certain embodiments, the subject has a viral infection.
In certain embodiments, the subject has a bacterial infection. In
other embodiments, the subject has a neoplastic disease. In certain
embodiments, the subject is mammal. In some embodiments, the mammal
is a human.
[0029] In another aspect, provided herein is a cyclic-di-nucleotide
comprising a 2'-5' phosphodiester linkage. Such
cyclic-di-nucleotides are useful, for example, in practicing the
subject methods, including, but not limited to, methods for
increasing the production of a type I interferon in a cell or a
subject.
[0030] In certain embodiments, the cyclic-di-nucleotide has two
2'-5' phosphodiester linkages. In other embodiments, the
cyclic-di-nucleotide has a 2'-5' phosphodiester linkage and a 3'-5'
phosphodiester linkage.
[0031] In certain embodiments, the cyclic-di-nucleotide contains a
guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide
contains two guanosine nucleosides. In certain embodiments, the
cyclic-di-nucleotide contains an adenosine nucleoside. In some
embodiments, the cyclic-di-nucleotide contains two adenosine
nucleosides. In other embodiments, the cyclic-di-nucleotide
contains an adenosine and a guanosine nucleoside.
[0032] In some embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00010##
wherein X and Y are each:
##STR00011##
[0033] In certain embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00012##
[0034] In another aspect, provided herein is a composition
containing a 2'-5' phosphodiester linkage containing
cyclic-di-nucleotiden and a pharmaceutically acceptable
carrier.
[0035] In certain embodiments, the cyclic-di-nucleotide has two
2'-5' phosphodiester linkages. In other embodiments, the
cyclic-di-nucleotide has a 2'-5' phosphodiester linkage and a 3'-5'
phosphodiester linkage.
[0036] In certain embodiments of the composition, the
cyclic-di-nucleotide contains a guanosine nucleoside. In some
embodiments, the cyclic-di-nucleotide contains two guanosine
nucleosides. In certain embodiments, the cyclic-di-nucleotide
contains an adenosine nucleoside. In some embodiments, the
cyclic-di-nucleotide contains two adenosine nucleosides. In other
embodiments, the cyclic-di-nucleotide contains an adenosine and a
guanosine nucleoside.
[0037] In certain embodiments of the composition, the
cyclic-di-nucleotide has the following formula:
##STR00013##
wherein X and Y are each:
##STR00014##
[0038] In certain embodiments of the composition, the
cyclic-di-nucleotide has the following formula:
##STR00015##
BRIEF DESCRIPTION OF THE FIGURES
[0039] The invention is best understood from the following detailed
description when read in conjunction with the accompanying
drawings. It is emphasized that, according to common practice, the
various features of the drawings are not to-scale. On the contrary,
the dimensions of the various features are arbitrarily expanded or
reduced for clarity. Included in the drawings are the following
figures:
[0040] FIGS. 1A-1F show the variable responsiveness of human STING
variants to cyclic-di-nucleotides maps to arginine 232. (A) THP-1
cells were transduced with vectors encoding an shRNA targeting
STING or a control shRNA. Cells were then stimulated with
cyclic-di-GMP (cdG), dsDNA, cyclic-di-AMP (cdA),
poly-inosine:cytosine (pI:C), or Sendai Virus, and induction of
human interferon-.beta. mRNA was assessed by quantitative reverse
transcriptase PCR. (B) Western blotting confirmed that knockdown of
STING was effective. (C) HEK293T cells were transfected with the
indicated amounts of various mouse (m) or human (h) STING
expression plasmid and then stimulated 6 h later by transfection
with synthetic cdG (5 .mu.M). GT denotes the null 1199N allele of
Sting from Goldenticket (Gt) mice. STING activation was assessed by
use of a co-transfected IFN-luciferase reporter construct. (D) Gt
(STING-null) macrophages were transduced with retroviral vectors
encoding the indicated STING alleles and were then stimulated 48 h
later by transfection with cdG (5 .mu.M) or dsDNA 70-mer
oligonucleotide (0.5 .mu.g/mL). IFN induction was measured by
qRT-PCR. ND, not detected. (E) Binding assay of STING to
32P-c-di-GMP. STING proteins were expressed in HEK293T cells and
cell lysates were subjected to UVcrosslinking with .sup.32P-cdG,
and resolved by SDS-PAGE. Binding was quantified by
autoradiography. Western blots of cell lysates with an anti-STING
polyclonal antibody confirmed similar expression of the various
STING proteins. (F) Responsiveness of mSTING to cGAMP is affected
by mutations of R231. The indicated mutants were tested as in
C.
[0041] FIG. 2 shows the sequence alignment of hSTING variants.
hSTING was cloned from THP-1 cells compared to the reference STING
allele (NCBI NP_938023.1).
[0042] FIG. 3 shows that R232 of human STING is required for
responsiveness to c-di-GMP, but not for binding of c-di-GMP. (A)
293T cells were transfected with the indicated alleles of mouse
(m)STING or human (h)STING and were then stimulated with c-di-GMP
(cdG). STING activity was detected by the induction of a
co-transfected IFN-luciferase reporter construct and expressed as
fold-induction over luciferase activity of unstimulated cells. (B)
Lysates of transfected 293T cells were UV crosslinked in the
presence of .alpha.32P-c-di-GMP, resolved by SDS-PAGE, and then
analyzed by autoradiography. Lysates were also western blotted for
STING and ACTIN as expression controls in parallel.
[0043] FIG. 4 shows that G230A and H232R are both required for
optimal responsiveness to c-di-nucleotides but are not required for
binding to c-di-nucleotides. (A, B) 293T cells were transfected
with the indicated alleles of mouse (m)STING or human (h)STING and
were then stimulated with c-di-GMP (cdG). STING activity was
detected by the induction of a cotransfected IFN-luciferase
reporter construct.
[0044] FIG. 5 shows that STING variants are responsive to cGAS. (A)
HEK293T cells were transfected with the indicated STING alleles and
with human and mouse cGAS (wt and GS>AA mutants) as indicated.
STING activation was assessed by a co-transfected IFN-luciferase
reporter construct. (B) HEK293T cells were transfected with the
indicated STING alleles and with a mammalian expression vector
encoding a cGAMP synthase (DncV) from V. cholerae. STING activation
was assessed as in A. (C) In vitro enzymatically generated products
of rWspR, rDncV and rcGAS were transfected into digitonin
permeabilized HEK293T cells expressing the indicated mouse and
human STING proteins. Chemically synthesized cyclic-di-GMP (cdG)
and cGAMP were included as controls. STING activation was assessed
as in A and B.
[0045] FIG. 6 shows that cGAS produces a non-canonical cyclic
dinucleotide containing a 2'-5' phosphodiester linkage. (A)
Purified recombinant WspR, DncV and cGAS were mixed with
.alpha..sup.32P-GTP or .alpha..sup.32P-ATP and the indicated
unlabeled nucleotides. Reactions were mixed with TLC running buffer
and nucleic acid species were resolved on a PEI-Cellulose TLC
plate. (B) WspR, DncV and cGAS products labeled with
.alpha..sup.32P-GTP were digested with nuclease P1 and Snake Venom
Phosphodiesterase and nucleic acid species were resolved on a
PEI-Cellulose TLC plate. (C) .sup.1H-.sup.31P HMBC of HPLC-purified
cGAS product acquired at 600 MHz and 50.degree. C. Critical
through-bond correlations for the phosphodiester bonds are
indicated. NMR elucidated structure of cGAS product is also
shown.
[0046] FIGS. 7A-7D provide additional NMR analysis of the cGAS
product. All data acquisition was performed in D20 and at
50.degree. C. (A, B) Multiplicity-edited 1H-13C HSQC experiment in
a 900 MHz field. Positive phased signals corresponding to methine
and methyl protons are shown in green, negative phased signals
corresponding to methylene protons are shown in blue.
(C).sup.1H-.sup.1H COSY experiment in a 600 MHz field.
(D).sup.1H-.sup.1H NOESY experiment in a 900 MHz field.
DETAILED DESCRIPTION
[0047] Methods and compositions are provided for increasing the
production of a type I interferon (IFN) in a cell. Aspects of the
methods include increasing the level of a 2'-5' phosphodiester
linkage comprising cyclic-di-nucleotide in a cell in a manner
sufficient to increase production of the type I interferon (IFN) by
the cell. Also provided are compositions and kits for practicing
embodiments of the subject methods.
[0048] Before the present invention is described in greater detail,
it is to be understood that this invention is not limited to
particular embodiments described, as such may, of course, vary. It
is also to be understood that the terminology used herein is for
the purpose of describing particular embodiments only, and is not
intended to be limiting, since the scope of the present invention
will be limited only by the appended claims.
[0049] Where a range of values is provided, it is understood that
each intervening value, to the tenth of the unit of the lower limit
unless the context clearly dictates otherwise, between the upper
and lower limit of that range and any other stated or intervening
value in that stated range, is encompassed within the invention.
The upper and lower limits of these smaller ranges may
independently be included in the smaller ranges and are also
encompassed within the invention, subject to any specifically
excluded limit in the stated range. Where the stated range includes
one or both of the limits, ranges excluding either or both of those
included limits are also included in the invention.
[0050] Certain ranges are presented herein with numerical values
being preceded by the term "about." The term "about" is used herein
to provide literal support for the exact number that it precedes,
as well as a number that is near to or approximately the number
that the term precedes. In determining whether a number is near to
or approximately a specifically recited number, the near or
approximating recited number may be a number which, in the context
in which it is presented, provides the substantial equivalent of
the specifically recited number.
[0051] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention belongs. Although
any methods and materials similar or equivalent to those described
herein can also be used in the practice or testing of the present
invention, representative illustrative methods and materials are
now described.
[0052] All publications and patents cited in this specification are
herein incorporated by reference as if each individual publication
or patent were specifically and individually indicated to be
incorporated by reference and are incorporated herein by reference
to disclose and describe the methods and/or materials in connection
with which the publications are cited. The citation of any
publication is for its disclosure prior to the filing date and
should not be constructed as an admission that the present
invention is not entitled to antedate such publication by virtue of
prior invention. Further, the dates of publication provided may be
different from the actual publication dates which may need to be
independently confirmed.
[0053] It is noted that, as used herein and in the appended claims,
the singular forms "a", "an", and "the" include plural referents
unless the context clearly dictates otherwise. It is further noted
that the claims may be drafted to exclude any optional element. As
such, this statement is intended to serve as antecedent basis for
use of such exclusive terminology as "solely," "only" and the like
in connection with the recitation of claim elements, or use of a
"negative" limitation.
[0054] As will be apparent to those of skill in the art upon
reading this disclosure, each of the individual embodiments
described and illustrated herein has discrete components and
features which may be readily separated from or combined with the
features of any of the other several embodiments without departing
from the scope or spirit of the present invention. Any recited
method can be carried out in the order of events recited or in any
other order which is logically possible.
Methods
[0055] As summarized above, methods of increasing the production of
a type I interferon (IFN) in a cell, e.g., in vitro or in vivo are
provided. By increasing type-I interferon production is meant that
the subject methods increase type-I interferon production in a
cell, as compared to a control. The magnitude of the increase may
vary, and in some instances is 2-fold or greater, such as 5-fold or
greater, including 10-fold or greater, as compared to a suitable
control. As such, in some instances, the methods are methods of
increasing type-I interferon production in a cell, e.g., by a
magnitude of 2-fold or greater, such as 5-fold or greater,
including 10-fold or greater, as compared to a suitable control. In
those embodiments where, prior to practice of the methods,
interferon production is not-detectable, the increase may result in
detectable amounts of interferon production. Interferon production
can be measured using any suitable method, including, but not
limited to, vesicular stomatitis virus (VSV) challenge bioassay,
enzyme-linked immunosorbent assay (ELISA) replicon based bioassays
or by using a reporter gene (e.g., luciferase) cloned under
regulation of a Type I interferon signaling pathway. See, e.g.,
Meager J. Immunol. Methods 261:21-36 (2002); Vrolijk et al. C. J.
Virol. Methods 110:201-209 (2003); and Francois et al. Antimicrob
Agents Chemother 49(9):3770-3775 (2005).
[0056] The methods may be used to increase the production of any
type I interferon including, but not limited to: IFN-.alpha.
(alpha), IFN-.beta. (beta), IFN-.kappa. (kappa), IFN-.delta.
(delta), IFN-.epsilon. (epsilon), IFN-.tau. (tau), IFN-.omega.
(omega), and IFN-.zeta. (zeta, also known as limitin). In some
embodiments, the method is for increasing the production of
IFN-.alpha.. In some embodiments, the method is for increasing
IFN-.beta..
[0057] Aspects of the methods include increasing the level of a
2'-5' phosphodiester linkage comprising cyclic-di-nucleotide in a
cell in a manner sufficient to increase production of the type I
interferon by the cell. By increasing the level of a 2'-5'
phosphodiester linkage comprising cyclic-di-nucleotide is meant
that the subject methods increase the amount of a 2'-5'
phosphodiester linkage comprising cyclic-di-nucleotide as compared
to a control. As demonstrated in the Experimental Section below,
2'-5' phosphodiester linkage comprising cyclic-di-nucleotides can
increase the levels of type I interferon production. The magnitude
of the increase may vary, and in some instances is 2-fold or
greater, such as 5-fold or greater, including 10-fold or greater,
15-fold greater, 20-fold greater, 25-fold greater, 30-fold greater,
35-fold greater, 40-fold greater, 45-fold greater, 50-fold greater,
or 100 fold greater, as compared to a suitable control.
[0058] Increasing the level of a 2'-5' phosphodiester linkage
comprising cyclic-di-nucleotide levels can be accomplished using a
variety of different approaches. In some instances, the method
includes providing a target cell with a cyclic-di-nucleotide active
agent that increases 2'-5' phosphodiester linkage comprising
cyclic-di-nucleotide levels in the target cell.
Cyclic-di-nucleotide active agents may vary, and include, but are
not limited to: small molecules, nucleic acid, protein, and peptide
agents.
[0059] In some embodiments, the cyclic-di-nucleotide active agent
increases IFN-.alpha. (alpha), IFN-.beta. (beta), IFN-.kappa.
(kappa), IFN-.delta. (delta), IFN-.epsilon. (epsilon), IFN-.tau.
(tau), IFN-.omega. (omega), and/or IFN-.zeta. (zeta, also known as
limitin) in a cell or subject as compared to a control that has not
been contacted with the cyclic-di-nucleotide active agent. In such
embodiments, the increase is from 1.5-fold increase to 50-fold
increase or more, including 2-fold increase to 45-fold increase,
5-fold increase to 40-fold increase, 10-fold increase to 35-fold
increase, 15-fold increase to 30-fold increase, 20-fold increase to
30-fold increase, and the like.
[0060] In some instances, the cyclic-di-nucleotide active agent is
a 2'-5' phosphodiester linkage containing cyclic-di-nucleotide or a
functional analogue thereof. 2'-5' phosphodiester linkage
containing cyclic-di-nucleotide include, but are not limited to,
those 2'-5' phosphodiester linkage containing cyclic-di-nucleotides
described herein.
[0061] As used herein "cyclic-di-nucleotide" refers to a compound
containing two nucleosides (i.e., a first and second nucleoside),
wherein the 2' or 3' carbon of each nucleoside is linked to the 5'
carbon of the other nucleoside by a phosphodiester bond. Therefore,
a 2'-5' phosphodiester linkage containing cyclic-di-nucleotide
refers to a cyclic-di-nucleotide, wherein the 2' carbon of at least
the first or second nucleosides is linked to the 5' carbon of the
other nucleoside. 2'-5' phosphodiester linkage containing
cyclic-di-nucleotide are discussed in greater detail below.
[0062] Functional analogues of 2'-5' phosphodiester linkage
containing cyclic-di-nucleotides are those compounds that exhibit
similar functional activity (e.g., increasing the production of a
type I IFN) and may have a similar structure to a 2'-5'
phosphodiester linkage containing cyclic-di-nucleotide. In some
instances, the functional analogue is a small molecule agent.
Naturally occurring or synthetic small molecule compounds of
interest include numerous chemical classes, such organic molecules,
including small organic compounds having a molecular weight of more
than 50 and less than about 2,500 daltons. Candidate agents
comprise functional groups necessary for structural interaction
with proteins, particularly hydrogen bonding, and typically include
at least an amine, carbonyl, hydroxyl or carboxyl group, preferably
at least two of the functional chemical groups. The candidate
agents may comprise cyclical carbon or heterocyclic structures
and/or aromatic or polyaromatic structures substituted with one or
more of the above functional groups. Candidate agents are also
found among biomolecules including peptides, saccharides, fatty
acids, steroids, purines, pyrimidines, derivatives, structural
analogs or combinations thereof. Such molecules may be identified,
among other ways, by employing suitable screening protocols.
[0063] In some instances, the cyclic-di-nucleotide active agent is
an agent that increases the cellular activity of a cyclic GMP-AMP
synthase (cGAS). As discussed in the Experimental Section, below,
increasing the levels cGMP synthase (cGAS) can increase the
production and/or activity of cyclic-di-nucleotide in a cell. As
such, a target cell may be contacted with an agent that increases
cGMP synthase production and/or cellular activity in a manner
sufficient to increase the production of Type I interferon in the
cell. In some embodiments, the cyclic-di-nucleotide active agent is
a nucleic acid encoding a cGAS. Nucleic acids encoding various cGAS
enzymes include, but are not limited to, those described in: Sun et
al. Science 339(6121):786-91 and those deposited in GENBANK and
assigned deposit numbers: NM_138441.2 and NP_612450.2 (human);
NM_173386.4 and NP_775562.2 (Mus musculus).
[0064] In certain embodiments, the nucleic acid encoding cGAS has
the following sequence:
TABLE-US-00001 (SEQ ID NO: 01)
agcctggggttccccttcgggtcgcagactcttgtgtgcccgccagtagt
gcttggtttccaacagctgctgctggctcttcctcttgcggccttttcct
gaaacggattcttctttcggggaacagaaagcgccagccatgcagccttg
gcacggaaaggccatgcagagagcttccgaggccggagccactgccccca
aggcttccgcacggaatgccaggggcgccccgatggatcccaccgagtct
ccggctgcccccgaggccgccctgcctaaggcgggaaagttcggccccgc
caggaagtcgggatcccggcagaaaaagagcgccccggacacccaggaga
ggccgcccgtccgcgcaactggggcccgcgccaaaaaggcccctcagcgc
gcccaggacacgcagccgtctgacgccaccagcgcccctggggcagaggg
gctggagcctcctgcggctcgggagccggctctttccagggctggttctt
gccgccagaggggcgcgcgctgctccacgaagccaagacctccgcccggg
ccctgggacgtgcccagccccggcctgccggtctcggcccccattctcgt
acggagggatgcggcgcctggggcctcgaagctccgggcggttttggaga
agttgaagctcagccgcgatgatatctccacggcggcggggatggtgaaa
ggggttgtggaccacctgctgctcagactgaagtgcgactccgcgttcag
aggcgtcgggctgctgaacaccgggagctactatgagcacgtgaagattt
ctgcacctaatgaatttgatgtcatgtttaaactggaagtccccagaatt
caactagaagaatattccaacactcgtgcatattactttgtgaaatttaa
aagaaatccgaaagaaaatcctctgagtcagtttttagaaggtgaaatat
tatcagcttctaagatgctgtcaaagtttaggaaaatcattaaggaagaa
attaacgacattaaagatacagatgtcatcatgaagaggaaaagaggagg
gagccctgctgtaacacttcttattagtgaaaaaatatctgtggatataa
ccctggctttggaatcaaaaagtagctggcctgctagcacccaagaaggc
ctgcgcattcaaaactggctttcagcaaaagttaggaagcaactacgact
aaagccattttaccttgtacccaagcatgcaaaggaaggaaatggtttcc
aagaagaaacatggcggctatccttctctcacatcgaaaaggaaattttg
aacaatcatggaaaatctaaaacgtgctgtgaaaacaaagaagagaaatg
ttgcaggaaagattgtttaaaactaatgaaataccttttagaacagctga
aagaaaggtttaaagacaaaaaacatctggataaattctcttcttatcat
gtgaaaactgccttctttcacgtatgtacccagaaccctcaagacagtca
gtgggaccgcaaagacctgggcctctgctttgataactgcgtgacatact
ttcttcagtgcctcaggacagaaaaacttgagaattattttattcctgaa
ttcaatctattctctagcaacttaattgacaaaagaagtaaggaatttct
gacaaagcaaattgaatatgaaagaaacaatgagtttccagtttttgatg
aattttgagattgtatttttagaaagatctaagaactagagtcaccctaa
atcctggagaatacaagaaaaatttgaaaaggggccagacgctgtggctc ac.
[0065] In some embodiments, the nucleic acid encoding cGAS is a
nucleic acid with 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%,
60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to
99%, 90% to 99% or, 95% to 99% sequence identity with a wild type
cGAS nucleic acid sequence. In some embodiments, the nucleic acid
encoding cGAS is a nucleic acid with 40% to 50%, 50% to 60%, 60% to
70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a
wild type cGAS nucleic acid sequence. In some embodiments, the
nucleic acid encoding cGAS is a nucleic acid with 40% or more, 45%
or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or
more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or
more sequence identity with a wild type cGAS nucleic acid
sequence.
[0066] In some instances, the cyclic-di-nucleotide active agent is
a vector containing a nucleic acid encoding cGAS. Vectors may be
provided directly to the subject cells. In other words, the cells
are contacted with vectors having the nucleic acid encoding the
cyclic-di-nucleotide active agent(s) (e.g., a nucleic acid encoding
cGAS) such that the vectors are taken up by the cells. Methods for
contacting cells with nucleic acid vectors that are plasmids, such
as electroporation, calcium chloride transfection, and lipofection,
are well known in the art. For viral vector delivery, the cells are
contacted with viral particles comprising the nucleic acid encoding
the cyclic-di-nucleotide agent(s). Retroviruses, for example,
lentiviruses, are particularly suitable to the method of the
invention. Commonly used retroviral vectors are "defective", i.e.,
unable to produce viral proteins required for productive infection.
Rather, replication of the vector requires growth in a packaging
cell line. To generate viral particles comprising nucleic acids of
interest, the retroviral nucleic acids comprising the nucleic acid
are packaged into viral capsids by a packaging cell line. Different
packaging cell lines provide a different envelope protein
(ecotropic, amphotropic or xenotropic) to be incorporated into the
capsid, this envelope protein determining the specificity of the
viral particle for the cells (ecotropic for murine and rat;
amphotropic for most mammalian cell types including human, dog and
mouse; and xenotropic for most mammalian cell types except murine
cells). The appropriate packaging cell line may be used to ensure
that the cells are targeted by the packaged viral particles.
Methods of introducing the retroviral vectors comprising the
nucleic acid encoding the reprogramming factors into packaging cell
lines and of collecting the viral particles that are generated by
the packaging lines are well known in the art.
[0067] Vectors used for providing the nucleic acids encoding the
cyclic-di-nucleotide activity active agent(s) to the subject cells
may include suitable promoters for driving the expression, that is,
transcriptional activation, of the nucleic acid of interest. In
other words, the nucleic acid of interest will be operably linked
to a promoter. This may include ubiquitously acting promoters, for
example, the CMV-.beta.-actin promoter, or inducible promoters,
such as promoters that are active in particular cell populations or
that respond to the presence of drugs such as tetracycline. By
transcriptional activation, it is intended that transcription will
be increased above basal levels in the target cell by 10 fold or
more, by 100 fold or more, by 1000 fold or more. In addition,
vectors used for providing cyclic-di-nucleotide active agent(s) to
the subject cells may include nucleic acid sequences that encode
for selectable markers in the target cells, so as to identify cells
that have taken up the cyclic-di-nucleotide activity active
agent(s).
[0068] Cyclic-di-nucleotide active agent(s) may also be provided to
cells as polypeptides. For example, in some instances the
cyclic-di-nucleotide active agent is a cGAS polypeptide. Amino acid
sequences of various cGAS enzymes include, but are not limited to,
those described in: Sun et al. Science 339(6121):786-91 and those
deposited in GENBANK and assigned deposit numbers: NM_138441.2 and
NP_612450.2 (human); NM_173386.4 and NP_775562.2 (Mus
musculus).
[0069] In certain embodiments, the cGAS polypeptide has the
following sequence:
TABLE-US-00002 (SEQ ID NO: 02)
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAG
KFGPARKSGSRQKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSA
PGAEGLEPPAAREPALSRAGSCRQRGARCSTKPRPPPGPWDVPSPGLPVS
APILVRRDAAPGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKC
DSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLEEYSNTRAYY
FVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMK
RKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVR
KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCEN
KEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQN
PQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKR
SKEFLTKQIEYERNNEFPVFDEF.
[0070] In some embodiments, the cGAS polypeptide is a polypeptide
that has 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to
99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%,
90% to 99% or, 95% to 99% sequence identity with a wild type cGAS
amino acid sequence. In some embodiments, the cGAS polypeptide is a
polypeptide that has 40% to 50%, 50% to 60%, 60% to 70%, 70% to
80%, 80% to 90%, or 90 to 99% sequence identity with a wild type
cGAS amino acid sequence. In some embodiments, the cGAS polypeptide
is a polypeptide that has 40% or more, 45% or more, 50% or more,
55% or more, 60% or more, 70% or more, 75% or more, 80% or more,
85% or more, 90% or more, 95% or more or 99% or more sequence
identity with a wild type cGAS amino acid sequence.
[0071] Such polypeptides may optionally be fused to a polypeptide
domain that increases solubility of the product. The domain may be
linked to the polypeptide through a defined protease cleavage site,
e.g., a TEV sequence, which is cleaved by TEV protease. The linker
may also include one or more flexible sequences, e.g., from 1 to 10
glycine residues. In some embodiments, the cleavage of the fusion
protein is performed in a buffer that maintains solubility of the
product, e.g., in the presence of from 0.5 to 2 M urea, in the
presence of polypeptides and/or polynucleotides that increase
solubility, and the like. Domains of interest include endosomolytic
domains, e.g., influenza HA domain; and other polypeptides that aid
in production, e.g., IF2 domain, GST domain, GRPE domain, and the
like. The polypeptide may be formulated for improved stability. For
example, the peptides may be PEGylated, where the polyethyleneoxy
group provides for enhanced lifetime in the blood stream.
[0072] Additionally or alternatively, the cyclic-di-nucleotide
active agent(s) may be fused to a polypeptide permeant domain to
promote uptake by the cell. A number of permeant domains are known
in the art and may be used in the non-integrating polypeptides of
the present invention, including peptides, peptidomimetics, and
non-peptide carriers. For example, a permeant peptide may be
derived from the third alpha helix of Drosophila melanogaster
transcription factor Antennapaedia, referred to as penetratin,
which comprises the amino acid sequence RQIKIWFQNRRMKWKK (SEQ ID
NO:03). As another example, the permeant peptide comprises the
HIV-1 tat basic region amino acid sequence, which may include, for
example, amino acids 49-57 of naturally-occurring tat protein.
Other permeant domains include poly-arginine motifs, for example,
the region of amino acids 34-56 of HIV-1 rev protein,
nona-arginine, octa-arginine, and the like. (See, for example,
Futaki et al. Curr Protein Pept Sci. 4(2): 87-96 (2003); and Wender
et al. Proc. Natl. Acad. Sci. U.S.A. 97(24):13003-8 (2000);
published U.S. Patent applications 20030220334; 20030083256;
20030032593; and 20030022831, herein specifically incorporated by
reference for the teachings of translocation peptides and
peptoids). The nona-arginine (R9) sequence is one of the more
efficient PTDs that have been characterized (Wender et al. 2000;
Uemura et al. 2002). The site at which the fusion is made may be
selected in order to optimize the biological activity, secretion or
binding characteristics of the polypeptide. The optimal site will
be determined by routine experimentation.
[0073] In practicing embodiments of the methods provided herein, an
effective amount of the active agent, i.e., a cyclic-di-nucleotide
active agent (such as described above), is provided in the target
cell or cells. As used herein "effective amount" or "efficacious
amount" means the amount of the active agent that, when contacted
with the cell, e.g., by being introduced into the cell in vitro, by
being administered to a subject, etc., is sufficient to result in
increased levels of a cyclic-di-nucleotide in the cell. The
"effective amount" will vary depending on cell and/or the organism
and/or compound and or the nature of the desired outcome and/or the
disease and its severity and the age, weight, etc., of the subject
to be treated.
[0074] In some instances, the effective amount of the active agent
is provided in the cell by contacting the cell with the active
agent. Contact of the cell with the active agent may occur using
any convenient protocol. The protocol may provide for in vitro or
in vivo contact of the active agent with the target cell, depending
on the location of the target cell. For example, where the target
cell is an isolated cell, e.g., a cell in vitro (i.e., in culture),
or a cell ex vivo ("ex vivo" being cells or organs are modified
outside of the body, where such cells or organs are typically
returned to a living body), the active agent may be introduced
directly into the cell under cell culture conditions permissive of
viability of the target cell. Such techniques include, but are not
necessarily limited to: viral infection, transfection, conjugation,
protoplast fusion, electroporation, particle gun technology,
calcium phosphate precipitation, direct microinjection, viral
vector delivery, and the like. The choice of method is generally
dependent on the type of cell being contacted and the nature of the
active agent, and the circumstances under which the transformation
is taking place (e.g., in vitro, ex vivo, or in vivo). A general
discussion of these methods can be found in Ausubel, et al, Short
Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995. As
another example, where the target cell or cells are part of a
multicellular organism, the active agent may be administered to the
organism or subject in a manner such that the agent is able to
contact the target cell(s), e.g., via an in vivo protocol. By "in
vivo," it is meant in the target construct is administered to a
living body of an animal.
[0075] In some embodiments, the cyclic-di-nucleotide active agent
is employed to modulate c-di-AMP activity in mitotic or
post-mitotic cells in vitro or ex vivo, i.e., to produce modified
cells that can be reintroduced into an individual. Mitotic and
post-mitotic cells of interest in these embodiments include any
eukaryotic cell, e.g., pluripotent stem cells, for example, ES
cells, iPS cells, and embryonic germ cells; somatic cells, for
example, hematopoietic cells, fibroblasts, neurons, muscle cells,
bone cells, vascular endothelial cells, gut cells, and the like,
and their lineage-restricted progenitors and precursors; and
neoplastic, or cancer, cells, i.e., cells demonstrating one or more
properties associated with cancer cells, e.g., hyperproliferation,
contact inhibition, the ability to invade other tissue, etc. In
certain embodiments, the eukaryotic cells are cancer cells. In
certain embodiments, the eukaryotic cells are hematopoietic cells,
e.g., macrophages, NK cells, etc. Cells may be from any mammalian
species, e.g., murine, rodent, canine, feline, equine, bovine,
ovine, primate, human, etc. Cells may be from established cell
lines or they may be primary cells, where "primary cells", "primary
cell lines", and "primary cultures" are used interchangeably herein
to refer to cells and cells cultures that have been derived from a
subject and allowed to grow in vitro for a limited number of
passages, i.e., splittings, of the culture. For example, primary
cultures are cultures that may have been passaged 0 times, 1 time,
2 times, 4 times, 5 times, 10 times, or 15 times, but not enough
times go through the crisis stage. Typically, the primary cell
lines of the present invention are maintained for fewer than 10
passages in vitro.
[0076] If the cells are primary cells, they may be harvested from
an individual by any convenient method. For example, blood cells,
e.g., leukocytes, e.g., macrophages, may be harvested by apheresis,
leukocytapheresis, density gradient separation, etc., while cells
from tissues such as skin, muscle, bone marrow, spleen, liver,
pancreas, lung, intestine, stomach, etc. may be harvested by
biopsy. An appropriate solution may be used for dispersion or
suspension of the harvested cells. Such solution will generally be
a balanced salt solution, e.g., normal saline, PBS, Hank's balanced
salt solution, etc., conveniently supplemented with fetal calf
serum or other naturally occurring factors, in conjunction with an
acceptable buffer at low concentration, generally from 5-25 mM.
Convenient buffers include HEPES, phosphate buffers, lactate
buffers, etc. The cells may be used immediately, or they may be
stored, frozen, for long periods of time, being thawed and capable
of being reused. In such cases, the cells may be frozen in 10%
DMSO, 50% serum, 40% buffered medium, or some other such solution
as is commonly used in the art to preserve cells at such freezing
temperatures, and thawed in a manner as commonly known in the art
for thawing frozen cultured cells.
[0077] The cyclic-di-nucleotide active agent(s) may be produced by
eukaryotic cells or by prokaryotic cells, it may be further
processed by unfolding, e.g., heat denaturation, DTT reduction,
etc. and may be further refolded, using methods known in the
art.
[0078] Modifications of interest that do not alter primary sequence
include chemical derivatization of polypeptides, e.g., acylation,
acetylation, carboxylation, amidation, etc. Also included are
modifications of glycosylation, e.g., those made by modifying the
glycosylation patterns of a polypeptide during its synthesis and
processing or in further processing steps; e.g., by exposing the
polypeptide to enzymes which affect glycosylation, such as
mammalian glycosylating or deglycosylating enzymes. Also embraced
are sequences that have phosphorylated amino acid residues, e.g.,
phosphotyrosine, phosphoserine, or phosphothreonine.
[0079] Also included in the subject invention are
cyclic-di-nucleotide active agent polypeptides (e.g., cGAS
polypeptides) that have been modified using ordinary molecular
biological techniques and synthetic chemistry so as to improve
their resistance to proteolytic degradation or to optimize
solubility properties or to render them more suitable as a
therapeutic agent. Analogs of such polypeptides include those
containing residues other than naturally occurring L-amino acids,
e.g., D-amino acids or non-naturally occurring synthetic amino
acids. D-amino acids may be substituted for some or all of the
amino acid residues.
[0080] The cyclic-di-nucleotide active agent (s) may be prepared by
in vitro synthesis, using any suitable method. Various commercial
synthetic apparatuses are available, for example, automated
synthesizers by Applied Biosystems, Inc., Beckman, etc. By using
synthesizers, naturally occurring amino acids may be substituted
with unnatural amino acids. The particular sequence and the manner
of preparation will be determined by convenience, economics, purity
required, and the like.
[0081] If desired, various groups may be introduced into the
peptide during synthesis or during expression, which allow for
linking to other molecules or to a surface. Thus cysteines can be
used to make thioethers, histidines for linking to a metal ion
complex, carboxyl groups for forming amides or esters, amino groups
for forming amides, and the like.
[0082] The cyclic-di-nucleotide active agent(s) may also be
isolated and purified in accordance with conventional methods of
recombinant synthesis. A lysate may be prepared of the expression
host and the lysate purified using HPLC, exclusion chromatography,
gel electrophoresis, affinity chromatography, or other purification
technique. For the most part, the compositions which are used will
include 20% or more by weight of the desired product, such as 75%
or more by weight of the desired product, including 95% or more by
weight of the desired product, and for therapeutic purposes, may be
99.5% or more by weight, in relation to contaminants related to the
method of preparation of the product and its purification (where
the percentages may be based upon total protein).
[0083] To modulate cyclic-di-nucleotide activity and/or production,
the cyclic-di-nucleotide active agent(s)--be they small molecules
(e.g., 2'-5' phosphodiester linkage containing
cyclic-di-nucleotides) polypeptides or nucleic acids that encode
cyclic-di-nucleotide active agent polypeptides (e.g., cGAS)--may be
provided to the cells for a sufficient period of time, e.g., from
30 minutes to 24 hours, e.g., 1 hour, 1.5 hours, 2 hours, 2.5
hours, 3 hours, 3.5 hours 4 hours, 5 hours, 6 hours, 7 hours, 8
hours, 12 hours, 16 hours, 18 hours, 20 hours, or any other period
from 30 minutes to 24 hours, which may be repeated with a frequency
of every day to every 4 days, e.g., every 1.5 days, every 2 days,
every 3 days, or any other frequency from about every day to about
every four days. The agent(s) may be provided to the subject cells
one or more times, e.g., one time, twice, three times, or more than
three times, and the cells allowed to incubate with the agent(s)
for some amount of time following each contacting event e.g., 16-24
hours, after which time the media is replaced with fresh media and
the cells are cultured further.
[0084] In certain embodiments, two or more, three or more, four or
more, five or more, six or more, seven or more, eight or more, nine
or more, or ten or more different cyclic-di-nucleotide active
agents are provided to a cell in a manner sufficient to increase
production of a type I interferon by the cell. In some instances,
the active agents include two or more different 2'-5'
phosphodiester linkage comprising cyclic-di-nucleotides. In certain
embodiments, the active agents include a 2'-5' phosphodiester
linkage containing cyclic-di-nucleotide and a nucleic acid encoding
cGAS or a cGAS polypeptide. In instances in which two or more
different cyclic-di-nucleotide active agents are provided to the
cell, i.e., a cyclic-di-nucleotide active agent cocktail, the
cyclic-di-nucleotide active agent(s) may be provided
simultaneously, e.g., as two cyclic-di-nucleotides delivered
simultaneously or a cyclic-di-nucleotide and a vector containing a
nucleic acid encoding cGAS delivered simultaneously. Alternatively,
they may be provided consecutively, e.g., the first
cyclic-di-nucleotide active agent being provided first, followed by
the cyclic-di-nucleotide active agent, etc. or vice versa.
[0085] An effective amount of cyclic-di-nucleotide active agent(s)
are provided to the cells to result in a change in
cyclic-di-nucleotide levels. An effective amount of
cyclic-di-nucleotide active agent is the amount to result in a
2-fold increase or more in the amount of cyclic-di-nucleotide
production observed relative to a negative control, e.g., a cell
contacted with an empty vector or irrelevant polypeptide. That is
to say, an effective amount or dose of a cyclic-di-nucleotide
active agent will result in a 2-fold increase, a 3-fold increase, a
4-fold increase or more in the amount of cyclic-di-nucleotide
observed, in some instances a 5-fold increase, a 6-fold increase or
more, sometimes a 7-fold or 8-fold increase or more in the amount
of activity observed, e.g., an increase of 10-fold, 50-fold, or
100-fold or more, in some instances, an increase of 200-fold,
500-fold, 700-fold, or 1000-fold or more, in the amount of activity
observed. The amount of activity may be measured by any suitable
method. For example, the amount of interferon produced by the cell
may be assessed after contact with the cyclic-di-nucleotide active
agent(s), e.g., 2 hours, 4 hours, 8 hours, 12 hours, 24 hours, 36
hours, 48 hours, 72 hours or more after contact with the
cyclic-di-nucleotide active agent(s).
[0086] Contacting the cells with the cyclic-di-nucleotide active
agent(s) may occur in any culture media and under any culture
conditions that promote the survival of the cells. For example,
cells may be suspended in any appropriate nutrient medium that is
convenient, such as Iscove's modified DMEM or RPMI 1640,
supplemented with fetal calf serum or heat inactivated goat serum
(about 5-10%), L-glutamine, a thiol, particularly
2-mercaptoethanol, and antibiotics, e.g., penicillin and
streptomycin. The culture may contain growth factors to which the
cells are responsive. Growth factors, as defined herein, are
molecules capable of promoting survival, growth and/or
differentiation of cells, either in culture or in the intact
tissue, through specific effects on a transmembrane receptor.
Growth factors include polypeptides and non-polypeptide
factors.
[0087] Following the methods described above, a cell may be
modified ex vivo to have an increase in cyclic-di-nucleotide
levels. In some embodiments, it may be desirous to select for the
modified cell, e.g., to create an enriched population of modified
cells. Any convenient modification to the cells that marks the
cells as modified with a cyclic-di-nucleotide active agent may be
used. For example, a selectable marker may be inserted into the
genome of the cell, so that the population of cells may be enriched
for those comprising the genetic modification by separating the
genetically marked cells from the remaining population. Separation
may be by any convenient separation technique appropriate for the
selectable marker used. For example, if a fluorescent marker has
been inserted, cells may be separated by fluorescence activated
cell sorting, whereas if a cell surface marker has been inserted,
cells may be separated from the heterogeneous population by
affinity separation techniques, e.g., magnetic separation, affinity
chromatography, "panning" with an affinity reagent attached to a
solid matrix, or other convenient technique. Techniques providing
accurate separation include fluorescence activated cell sorters,
which can have varying degrees of sophistication, such as multiple
color channels, low angle and obtuse light scattering detecting
channels, impedance channels, etc. The cells may be selected
against dead cells by employing dyes associated with dead cells
(e.g., propidium iodide). Any technique may be employed which is
not unduly detrimental to the viability of the genetically modified
cells.
[0088] Cell compositions that are highly enriched for cells
comprising cyclic-di-nucleotide active agent(s) are achieved in
this manner. By "highly enriched", it is meant that the genetically
modified cells will be 70% or more, 75% or more, 80% or more, 85%
or more, 90% or more of the cell composition, for example, about
95% or more, or 98% or more of the cell composition. In other
words, the composition may be a substantially pure composition of
cells comprising cyclic-di-nucleotide active agent(s).
[0089] Cells comprising cyclic-di-nucleotide active agent(s)
produced by the methods described herein may be used immediately.
Alternatively, the cells may be frozen at liquid nitrogen
temperatures and stored for long periods of time, being thawed and
capable of being reused. In such cases, the cells may be frozen in
10% DMSO, 50% serum, 40% buffered medium, or some other such
solution as is commonly used in the art to preserve cells at such
freezing temperatures, and thawed in a manner as commonly known in
the art for thawing frozen cultured cells.
[0090] The cells comprising cyclic-di-nucleotide active agent(s)
may be cultured in vitro under various culture conditions. The
cells may be expanded in culture, i.e., grown under conditions that
promote their proliferation. Culture medium may be liquid or
semi-solid, e.g., containing agar, methylcellulose, etc. The cell
population may be suspended in an appropriate nutrient medium, such
as Iscove's modified DMEM or RPMI 1640, normally supplemented with
fetal calf serum (about 5-10%), L-glutamine, a thiol, particularly
2-mercaptoethanol, and antibiotics, e.g., penicillin and
streptomycin. The culture may contain growth factors to which the
regulatory T cells are responsive. Growth factors, as defined
herein, are molecules capable of promoting survival, growth and/or
differentiation of cells, either in culture or in the intact
tissue, through specific effects on a transmembrane receptor.
Growth factors include polypeptides and non-polypeptide
factors.
[0091] Cells that have been modified with cyclic-di-nucleotide
active agent(s) may be transplanted to a subject to treat a disease
or as an antiviral, antipathogenic, or anticancer therapeutic or
for biological research. The subject may be a neonate, a juvenile,
or an adult. Of particular interest are mammalian subjects.
Mammalian species that may be treated with the present methods
include canines and felines; equines; bovines; ovines; etc. and
primates, particularly humans. Animal models, particularly small
mammals, e.g., murine, lagomorpha, etc., may be used for
experimental investigations.
[0092] Cells may be provided to the subject alone or with a
suitable substrate or matrix, e.g., to support their growth and/or
organization in the tissue to which they are being transplanted. In
some instances, at least 1.times.10.sup.3 cells will be
administered, for example 5.times.10.sup.3 cells, 1.times.10.sup.4
cells, 5.times.10.sup.4 cells, 1.times.10.sup.5 cells,
1.times.10.sup.6 cells or more.
[0093] The cells may be introduced to the subject via any of the
following routes: parenteral, subcutaneous, intravenous,
intracranial, intraspinal, intraocular, or into spinal fluid. The
cells may be introduced by injection, catheter, or the like.
Examples of methods for local delivery, that is, delivery to the
site of injury, include, e.g., through an Ommaya reservoir, e.g.,
for intrathecal delivery (see, e.g., U.S. Pat. Nos. 5,222,982 and
5,385,582, incorporated herein by reference); by bolus injection,
e.g., by a syringe, e.g., into a joint; by continuous infusion,
e.g., by cannulation, e.g., with convection (see e.g., US
Application No. 20070254842, incorporated here by reference); or by
implanting a device upon which the cells have been reversibly
affixed (see e.g., US Application Nos. 20080081064 and 20090196903,
incorporated herein by reference).
[0094] In other aspects of the invention, the cyclic-di-nucleotide
active agent(s) are employed to increase the production of type I
interferon in vivo. In these in vivo embodiments, the
cyclic-di-nucleotide active agent(s) are administered directly to
the individual. In some embodiments, the cyclic-di-nucleotide
active agent administered to the subject contains a 2'-5'
phosphodiester linkage containing cyclic-di-nucleotide.
[0095] Cyclic-di-nucleotide active agent(s) may be administered by
any suitable methods for the administration of peptides, small
molecules and nucleic acids to a subject. The cyclic-di-nucleotide
active agent(s) can be incorporated into a variety of formulations.
More particularly, the cyclic-di-nucleotide active agent(s) of the
present invention can be formulated into pharmaceutical
compositions by combination with appropriate pharmaceutically
acceptable carriers or diluents. Pharmaceutical compositions that
can be used in practicing the subject methods are described
below.
[0096] In such instances, an effective amount of the
cyclic-di-nucleotide active agent is administered to the subject.
By an "effective amount" or a "therapeutically effective amount" of
the cyclic-di-nucleotide active agent it is meant an amount that is
required to reduce the severity, the duration and/or the symptoms
of the disease. In some embodiments, the effective amount of a
pharmaceutical composition containing a cyclic-di-nucleotide active
agent, as provided herein, is between 0.025 mg/kg and 1000 mg/kg
body weight of a human subject. In certain embodiments, the
pharmaceutical composition is administered to a human subject at an
amount of 1000 mg/kg body weight or less, 950 mg/kg body weight or
less, 900 mg/kg body weight or less, 850 mg/kg body weight or less,
800 mg/kg body weight or less, 750 mg/kg body weight or less, 700
mg/kg body weight or less, 650 mg/kg body weight or less, 600 mg/kg
body weight or less, 550 mg/kg body weight or less, 500 mg/kg body
weight or less, 450 mg/kg body weight or less, 400 mg/kg body
weight or less, 350 mg/kg body weight or less, 300 mg/kg body
weight or less, 250 mg/kg body weight or less, 200 mg/kg body
weight or less, 150 mg/kg body weight or less, 100 mg/kg body
weight or less, 95 mg/kg body weight or less, 90 mg/kg body weight
or less, 85 mg/kg body weight or less, 80 mg/kg body weight or
less, 75 mg/kg body weight or less, 70 mg/kg body weight or less,
or 65 mg/kg body weight or less.
[0097] In another aspect, provided herein is a method for
increasing a stimulator of interferon genes (STING) mediated
response in a subject, e.g., a STING mediated immune response. In
certain embodiments, the method includes the step of administering
to the subject an amount of a STING active agent effective to
increase a STING mediated response in the subject. A "STING"
mediated response refers to any response that is mediated by STING,
including, but not limited to, immune responses to bacterial
pathogens, viral pathogens, and eukaryotic pathogens. See, e.g.,
Ishikawa et al. Immunity 29: 538-550 (2008); Ishikawa et al. Nature
461: 788-792 (2009); and Sharma et al. Immunity 35: 194-207 (2011).
STING also functions in certain autoimmune diseases initiated by
inappropriate recognition of self DNA (see, e.g., Gall et al.
Immunity 36: 120-131 (2012), as well as for the induction of
adaptive immunity in response to DNA vaccines (see, e.g., Ishikawa
et al. Nature 461: 788-792 (2009). By increasing a STING mediated
response in a subject is meant an increase in a STING mediated
response in a subject as compared to a control subject (e.g., a
subject who is not administered a STING active agent). In certain
embodiments, the method is for increasing a stimulator of
interferon genes (STING) mediated response in a subject, wherein
the STING mediated response is non-responsive to a
cyclic-di-nucleotide having two 3'-5' phosphodiester bonds (i.e., a
canonical cyclic dinucleotide).
[0098] As described in the Experimental Section below,
cyclic-di-nucleotides having 2'-5' phosphodiester bonds have been
shown to activate STING signaling. Moreover, such
cyclic-di-nucleotides having 2'-5' phosphodiester bonds have been
shown to stimulate alleles of STING that are non-responsive to
cyclic-di-nucleotides that have two phosphodiester bonds. As such,
in some embodiments, the STING active agent is a
cyclic-di-nucleotide active agent described herein (e.g.,
cyclic-di-nucleotide, nucleic acid encoding cGAS).
[0099] In other embodiments the STING active agent is a nucleic
acid encoding STING or a STING polypeptide. Nucleic acids encoding
various STINGs include, but are not limited to, those described in:
Nitta et al. Hepatology 57(1): 46-58 (2013) and Jin et al. J.
Immunol. 190(6): 2835-2843 (2013) and those deposited in GENBANK
and assigned deposit numbers: NM_198282.2 and NP_938023.1 (human);
NM_028261.1 and NP_082537.1 (Mus musculus); and NM_057386.4 and
NP_476734.1 (Drosophila melanogaster).
[0100] In certain embodiments, the nucleic acid encoding STING has
the following sequence:
TABLE-US-00003 (SEQ ID NO: 04)
gttcatttttcactcctccctcctaggtcacacttttcagaaaaagaatc
tgcatcctggaaaccagaagaaaaatatgagacggggaatcatcgtgtga
tgtgtgtgctgcctttggctgagtgtgtggagtcctgctcaggtgttagg
tacagtgtgtttgatcgtggtggcttgaggggaacccgctgttcagagct
gtgactgcggctgcactcagagaagctgcccttggctgctcgtagcgccg
ggccttctctcctcgtcatcatccagagcagccagtgtccgggaggcaga
agatgccccactccagcctgcatccatccatcccgtgtcccaggggtcac
ggggcccagaaggcagccttggttctgctgagtgcctgcctggtgaccct
ttgggggctaggagagccaccagagcacactctccggtacctggtgctcc
acctagcctccctgcagctgggactgctgttaaacggggtctgcagcctg
gctgaggagctgcgccacatccactccaggtaccggggcagctactggag
gactgtgcgggcctgcctgggctgccccctccgccgtggggccctgttgc
tgctgtccatctatttctactactccctcccaaatgcggtcggcccgccc
ttcacttggatgcttgccctcctgggcctctcgcaggcactgaacatcct
cctgggcctcaagggcctggccccagctgagatctctgcagtgtgtgaaa
aagggaatttcaacgtggcccatgggctggcatggtcatattacatcgga
tatctgcggctgatcctgccagagctccaggcccggattcgaacttacaa
tcagcattacaacaacctgctacggggtgcagtgagccagcggctgtata
ttctcctcccattggactgtggggtgcctgataacctgagtatggctgac
cccaacattcgcttcctggataaactgccccagcagaccggtgaccatgc
tggcatcaaggatcgggtttacagcaacagcatctatgagcttctggaga
acgggcagcgggcgggcacctgtgtcctggagtacgccacccccttgcag
actttgtttgccatgtcacaatacagtcaagctggctttagccgggagga
taggcttgagcaggccaaactcttctgccggacacttgaggacatcctgg
cagatgcccctgagtctcagaacaactgccgcctcattgcctaccaggaa
cctgcagatgacagcagcttctcgctgtcccaggaggttctccggcacct
gcggcaggaggaaaaggaagaggttactgtgggcagcttgaagacctcag
cggtgcccagtacctccacgatgtcccaagagcctgagctcctcatcagt
ggaatggaaaagcccctccctctccgcacggatttctcttgagacccagg
gtcaccaggccagagcctccagtggtctccaagcctctggactgggggct
ctcttcagtggctgaatgtccagcagagctatttccttccacagggggcc
ttgcagggaagggtccaggacttgacatcttaagatgcgtcttgtcccct
tgggccagtcatttcccctctctgagcctcggtgtcttcaacctgtgaaa
tgggatcataatcactgccttacctccctcacggttgttgtgaggactga
gtgtgtggaagtttttcataaactttggatgctagtgtacttagggggtg
tgccaggtgtctttcatggggccttccagacccactccccacccttctcc
ccttcctttgcccggggacgccgaactctctcaatggtatcaacaggctc
cttcgccctctggctcctggtcatgttccattattggggagccccagcag
aagaatggagaggaggaggaggctgagtttggggtattgaatcccccggc
tcccaccctgcagcatcaaggttgctatggactctcctgccgggcaactc
ttgcgtaatcatgactatctctaggattctggcaccacttccttccctgg
ccccttaagcctagctgtgtatcggcacccccaccccactagagtactcc
ctctcacttgcggtttccttatactccacccctttctcaacggtcctttt
ttaaagcacatctcagattacccaaaaaaaaaaaaaaaaaa.
[0101] In some embodiments, the nucleic acid encoding STING is a
nucleic acid with 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%,
60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to
99%, 90% to 99% or, 95% to 99% sequence identity with a wild type
STING nucleic acid sequence. In some embodiments, the nucleic acid
encoding STING is a nucleic acid with 40% to 50%, 50% to 60%, 60%
to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with
a wild type STING nucleic acid sequence. In some embodiments, the
nucleic acid encoding STING is a nucleic acid with 40% or more, 45%
or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or
more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or
more sequence identity with a wild type STING nucleic acid
sequence.
[0102] Amino acid sequences of STING include, but are not limited
to, those described in: Nitta et al. Hepatology 57(1): 46-58 (2013)
and Jin et al. J. Immunol. 190(6): 2835-2843 (2013) and those
deposited in GENBANK and assigned deposit numbers: NM_198282.2 and
NP_938023.1 (human); NM_028261.1 and NP_082537.1 (Mus musculus);
and NM_057386.4 and NP_476734.1 (Drosophila melanogaster).
[0103] In certain embodiments, the STING polypeptide has the
following sequence:
TABLE-US-00004 (SEQ ID NO: 05)
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLH
LASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLL
LSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEK
GNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYI
LLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLEN
GQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSA
VPSTSTMSQEPELLISGMEKPLPLRTDFS.
[0104] In other embodiments, the STING polypeptide has the
following sequence:
TABLE-US-00005 (SEQ ID NO: 06)
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLH
LASLQLGLLLNGVCSLAEELHHIHSRYRGSYWRTVRACLGCPLRRGALLL
LSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEK
GNFNVAHGLAWSYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYIL
LPLDCGVPDNLSMADPNIRFLDKLPQQTADRAGIKDRVYSNSIYELLENG
QRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILAD
APESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAV
PSTSTMSQEPELLISGMEKPLPLRTDFS.
[0105] In some embodiments, the STING polypeptide is a polypeptide
that has 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to
99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%,
90% to 99% or, 95% to 99% sequence identity with a wild type STING
amino acid sequence. In some embodiments, the cGAS polypeptide is a
polypeptide that has 40% to 50%, 50% to 60%, 60% to 70%, 70% to
80%, 80% to 90%, or 90 to 99% sequence identity with a wild type
STING amino acid sequence. In some embodiments, the STING
polypeptide is a polypeptide that has 40% or more, 45% or more, 50%
or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or
more, 85% or more, 90% or more, 95% or more or 99% or more sequence
identity with a wild type STING amino acid sequence.
[0106] The above methods find use in a variety of different
applications. Certain applications are now reviewed in the
following Utility section.
Utility
[0107] The methods and compositions provided herein find use in a
variety of applications, where such applications include increasing
type I interferon (e.g., interferon-.beta.) in a subject is
desired. In addition, the methods and compositions provided herein
find use in a variety of applications, where such applications
include increasing STING mediated response in a subject is desired.
Specific applications of interest include those in which a subject
is treated for a disease condition that would benefit from an
increase in type I interferon by providing the subject with a
therapeutically effective amount of a cyclic-di-nucleotide active
agent. In some instances, it may be desirable to increase a type I
interferon or STING mediated response in a healthy individual,
e.g., for the prevention of a disease or condition. As such, in
some embodiments, the methods and compositions provided herein can
be used to produce an `adjuvant` effect in a vaccine to prevent an
infection or other disease, wherein the active agent stimulates
immunological memory to protect against future disease or
infection.
[0108] In some embodiments, subjects suitable for treatment with a
method described herein include individuals having an immunological
or inflammatory disease or disorder including, but not limited to a
cancer, an autoimmune disease or disorder, an allergic reaction, a
chronic infectious disease and an immunodeficiency disease or
disorder.
[0109] In some embodiments, subjects suitable for treatment with a
method of the present invention include individuals having a
cellular proliferative disease, such as a neoplastic disease (e.g.,
cancer). Cellular proliferative disease is characterized by the
undesired propagation of cells, including, but not limited to,
neoplastic disease conditions, e.g., cancer.
[0110] Examples of cellular proliferative disease include, but not
limited to, abnormal stimulation of endothelial cells (e.g.,
atherosclerosis), solid tumors and tumor metastasis, benign tumors,
for example, hemangiomas, acoustic neuromas, neurofibromas,
trachomas, and pyogenic granulomas, vascular malfunctions, abnormal
wound healing, inflammatory and immune disorders, Bechet's disease,
gout or gouty arthritis, abnormal angiogenesis accompanying, for
example, rheumatoid arthritis, psoriasis, diabetic retinopathy,
other ocular angiogenic diseases such as retinopathy of prematurity
(retrolental fibroplastic), macular degeneration, corneal graft
rejection, neurovascular glaucoma and Oster Webber syndrome,
psoriasis, restenosis, fungal, parasitic and viral infections such
cytomegaloviral infections. Subjects to be treated according to the
methods of the invention include any individual having any of the
above-mentioned disorders.
[0111] In other embodiments, subjects suitable for treatment with a
subject method include individuals who have been clinically
diagnosed as infected with a virus. In some embodiments, the virus
is a hepatitis virus (e.g., HAV, HBV, HCV, delta, etc.),
particularly HCV, are suitable for treatment with the methods of
the instant invention. Individuals who are infected with HCV are
identified as having HCV RNA in their blood, and/or having anti-HCV
antibody in their serum. Such individuals include naive individuals
(e.g., individuals not previously treated for HCV, particularly
those who have not previously received IFN-.alpha.-based or
ribavirin-based therapy) and individuals who have failed prior
treatment for HCV.
[0112] In some embodiments, subjects suitable for treatment with a
method provided herein include an individual with a
neurodegenerative disease or disorder, including, but not limited
to, Parkinson's disease, Alzheimer's disease, Huntington's disease,
and Amyotrophic lateral sclerosis (ALS).
[0113] In other embodiments, subjects suitable for treatment with a
method of the present invention include individuals having multiple
sclerosis. Multiple sclerosis refers to an autoimmune
neurodegenerative disease, which is marked by inflammation within
the central nervous system with lymphocyte attack against myelin
produced by oligodendrocytes, plaque formation and demyelization
with destruction of the myelin sheath of axons in the brain and
spinal cord, leading to significant neurological disability over
time. Typically, at onset an otherwise healthy person presents with
the acute or sub acute onset of neurological symptomatology
(attack) manifested by unilateral loss of vision, vertigo, ataxia,
dyscoordination, gait difficulties, sensory impairment
characterized by paresthesia, dysesthesia, sensory loss, urinary
disturbances until incontinence, diplopia, dysarthria or various
degrees of motor weakness until paralysis. The symptoms may be
painless, remain for several days to a few weeks, and then
partially or completely resolve. After a period of remission, a
second attack will occur. During this period after the first
attack, the patient is defined to suffer from probable MS. Probable
MS patients may remain undiagnosed for years. When the second
attack occurs the diagnosis of clinically definite MS (CDMS) is
made (Poser criteria 1983; C. M. Poser et al., Ann. Neurol. 1983;
13, 227).
[0114] The terms "subject" and "patient" mean a member or members
of any mammalian or non-mammalian species that may have a need for
the pharmaceutical methods, compositions and treatments described
herein. Subjects and patients thus include, without limitation,
primate (including humans), canine, feline, ungulate (e.g., equine,
bovine, swine (e.g., pig)), avian, and other subjects. Humans and
non-human animals having commercial importance (e.g., livestock and
domesticated animals) are of particular interest.
[0115] "Mammal" means a member or members of any mammalian species,
and includes, by way of example, canines; felines; equines;
bovines; ovines; rodentia, etc. and primates, particularly humans.
Non-human animal models, particularly mammals, e.g., primate,
murine, lagomorpha, etc. may be used for experimental
investigations.
[0116] "Treating" or "treatment" of a condition or disease
includes: (1) preventing at least one symptom of the conditions,
i.e., causing a clinical symptom to not significantly develop in a
mammal that may be exposed to or predisposed to the disease but
does not yet experience or display symptoms of the disease, (2)
inhibiting the disease, i.e., arresting or reducing the development
of the disease or its symptoms, or (3) relieving the disease, i.e.,
causing regression of the disease or its clinical symptoms. As used
herein, the term "treating" is thus used to refer to both
prevention of disease, and treatment of pre-existing conditions.
For example, where the cyclic-di-nucleotide active agent is
administered, the prevention of cellular proliferation can be
accomplished by administration of the subject compounds prior to
development of overt disease, e.g., to prevent the regrowth of
tumors, prevent metastatic growth, etc. Alternatively the compounds
are used to treat ongoing disease, by stabilizing or improving the
clinical symptoms of the patient.
Combination Therapy
[0117] For use in the subject methods, the cyclic-di-nucleotide
active agent described herein may be administered in combination
with other pharmaceutically active agents, including other agents
that treat the underlying condition or a symptom of the condition.
"In combination with" as used herein refers to uses where, for
example, the first compound is administered during the entire
course of administration of the second compound; where the first
compound is administered for a period of time that is overlapping
with the administration of the second compound, e.g., where
administration of the first compound begins before the
administration of the second compound and the administration of the
first compound ends before the administration of the second
compound ends; where the administration of the second compound
begins before the administration of the first compound and the
administration of the second compound ends before the
administration of the first compound ends; where the administration
of the first compound begins before administration of the second
compound begins and the administration of the second compound ends
before the administration of the first compound ends; where the
administration of the second compound begins before administration
of the first compound begins and the administration of the first
compound ends before the administration of the second compound
ends. As such, "in combination" can also refer to regimen involving
administration of two or more compounds. "In combination with" as
used herein also refers to administration of two or more compounds
that may be administered in the same or different formulations, by
the same of different routes, and in the same or different dosage
form type.
[0118] Examples of other agents for use in combination therapy of
neoplastic disease include, but are not limited to, thalidomide,
marimastat, COL-3, BMS-275291, squalamine, 2-ME, SU6668, neovastat,
Medi-522, EMD121974, CAI, celecoxib, interleukin-12, IM862, TNP470,
avastin, gleevec, herceptin, and mixtures thereof. Examples of
chemotherapeutic agents for use in combination therapy include, but
are not limited to, daunorubicin, daunomycin, dactinomycin,
doxorubicin, epirubicin, idarubicin, esorubicin, bleomycin,
mafosfamide, ifosfamide, cytosine arabinoside,
bis-chloroethylnitrosurea, busulfan, mitomycin C, actinomycin D,
mithramycin, prednisone, hydroxyprogesterone, testosterone,
tamoxifen, dacarbazine, procarbazine, hexamethylmelamine,
pentamethylmelamine, mitoxantrone, amsacrine, chlorambucil,
methylcyclohexylnitrosurea, nitrogen mustards, melphalan,
cyclophosphamide, 6-mercaptopurine, 6-thioguanine, cytarabine,
5-azacytidine, hydroxyurea, deoxycoformycin,
4-hydroxyperoxycyclophosphor-amide, 5-fluorouracil (5-FU),
5-fluorodeoxyuridine (5-FUdR), methotrexate (MTX), colchicine,
taxol, vincristine, vinblastine, etoposide (VP-16), trimetrexate,
irinotecan, topotecan, gemcitabine, teniposide, cisplatin and
diethylstilbestrol (DES).
[0119] Other antiviral agents can also be delivered in the
treatment methods of the invention. For example, compounds that
inhibit inosine monophosphate dehydrogenase (IMPDH) may have the
potential to exert direct anti viral activity, and such compounds
can be administered in combination with the mutant Listeria, as
described herein. Drugs that are effective inhibitors of hepatitis
C NS3 protease may be administered in combination with the mutant
Listeria, as described herein. Hepatitis C NS3 protease inhibitors
inhibit viral replication. Other agents such as inhibitors of HCV
NS3 helicase are also attractive drugs for combinational therapy,
and are contemplated for use in combination therapies described
herein. Ribozymes such as Heptazyme.TM. and phosphorothioate
oligonucleotides which are complementary to HCV protein sequences
and which inhibit the expression of viral core proteins are also
suitable for use in combination therapies described herein.
Examples of other agents for use in combination therapy of multiple
sclerosis include, but are not limited to; glatiramer;
corticosteroids; muscle relaxants, such as Tizanidine (Zanaflex)
and baclofen (Lioresal); medications to reduce fatigue, such as
amantadine (Symmetrel) or modafinil (Provigil); and other
medications that may also be used for depression, pain and bladder
or bowel control problems that can be associated with MS.
[0120] In the context of a combination therapy, combination therapy
compounds may be administered by the same route of administration
(e.g., intrapulmonary, oral, enteral, etc.) that the
cyclic-di-nucleotide active agents are administered. In the
alternative, the compounds for use in combination therapy with the
cyclic-di-nucleotide active agent may be administered by a
different route of administration.
Adjuvants
[0121] In certain embodiments, the cyclic di-nucleotide active
agent functions as an adjuvant when administered together with a
drug or vaccine to treat or prevent a disease or condition,
including, but not limited to, those diseases and conditions
provided herein. In some embodiments, the cyclic di-nucleotide
active agents are administered together with a vaccine. Such active
agents that are administered with a vaccine can function as an
adjuvant to enhance the immune response elicited by the vaccine,
including stimulating immunological memory to protect against
future diseases and/or infections.
[0122] In certain embodiments, the cyclic di-nucleotide or STING
active agents administered as an adjuvant for a vaccine can enhance
the effectiveness of the vaccine by, e.g., increasing the
immunogenicity of weaker antigens, reducing the amount of antigen
required to elicit a immune response, reducing the frequency of
immunization necessary to maintain protective immunity, enhance the
efficacy of vaccines in immunocompromised or other individuals with
reduced immune responses, and/or increase immunity at a target
tissue, such as mucosal immunity. In such embodiments, the cyclic
di-nucleotide active agents, when co-administered with one or more
antigens, can induce a particular cytokine profile to promote
cellular and humoral immunity against the antigen and increase the
effectiveness of vaccination.
[0123] Antigens used to prepare vaccines may be derived from a
variety of microorganisms such as viruses, bacteria and parasites
that contain substances that are not normally present in the body,
as well as tumor cells. These substances can be used as antigens to
produce an immune response to destroy both the antigen and cells
containing the antigen, such as a bacterial cell or cancer cell. In
certain instances, isolated or crude antigens of microbial
pathogens can be used in vaccines to treat infectious disease;
isolated or crude tumor cell antigens can be used in vaccines to
treat cancer; isolated or crude antigens known to be associated
with a pathologically aberrant cell can be used to treat a variety
of diseases in which it is beneficial to target particular cells
for destruction.
[0124] Microorganisms that may be a source of antigen include
clinically relevant microorganisms, such as bacteria, including
pathogenic bacteria; viruses (e.g., Influenza, Measles,
Coronavirus); parasites (e.g., Trypanosome, Plasmodium,
Leishmania); fungi (e.g., Aspergillus, Candida, Coccidioides,
Cryptococcus); and the like. For example, the antigen may be from
bacteria, particularly pathogenic bacteria, such as the causative
agent of anthrax (Bacillus anthracis), plague (Yersinia pestis),
tuberculosis (Mycobacterium tuberculosis), salmonellosis
(Salmonella enterica), stomach cancer (Helicobacter pylori),
sexually transmitted diseases (Chlamydia trachomatis or Neisseria
gonorrhea), and the like. Other representative examples include
antigens from certain viruses, such as influenza virus(es), Norwalk
virus, smallpox virus, West Nile virus, SARS virus, MERS virus,
respiratory syncytial virus, measles virus, and the like. Fungi of
interest include, but are not limited to Candida albicans or
Aspergillus spp., and parasites of interest include the causative
agents of trypanosomiasis, leishmania, pneumonic plague, and lyme
disease (Borrellia burgdorferi).
[0125] A pathologically aberrant cell to be used in a vaccine can
be obtained from any source such as one or more individuals having
a pathological condition or ex vivo or in vitro cultured cells
obtained from one or more such individuals, including a specific
individual to be treated with the resulting vaccine.
[0126] A vaccine formulation for use with an adjuvant containing
cyclic di-nucleotide active agents may include, e.g., attenuated
and inactivated viral and bacterial pathogens from infected
patients or propagated cultures, purified macromolecules,
polysaccharides, toxoids, recombinant antigens, organisms
containing a foreign gene from a pathogen, synthetic peptides,
polynucleic acids, antibodies and tumor cells.
[0127] Recombinant antigens may be obtained, for example, by
isolating and cloning a gene encoding any immunogenic polypeptide,
in, e.g., bacterial, yeast, insect, reptile or mammalian cells
using recombinant methods well known in the art and described, for
example in Sambrook et al., Molecular Cloning: A Laboratory Manual,
Cold Spring Harbor Laboratory, New York (1992) and in Ansubel et
al., Current Protocols in Molecular Biology, John Wiley and Sons,
Baltimore, Md. (1998). A number of genes encoding surface antigens
from viral, bacterial and protozoan pathogens have been
successfully cloned, expressed and used as antigens for vaccine
development. For example, the major surface antigen of hepatitis B
virus, HbsAg, the b subunit of choleratoxin, the enterotoxin of E.
coli, the circumsporozoite protein of the malaria parasite, and a
glycoprotein membrane antigen from Epstein-Barr virus, as well as
tumor cell antigens, have been expressed in various well known
vector/host systems, purified and used in vaccines.
[0128] A vaccine formulation containing cyclic di-nucleotide or
STING active agents may advantageously contain other vaccine
adjuvants and carriers. These carriers and adjuvants include, but
are not limited to, ion exchange resins, alumina, aluminum
stearate, lecithin, serum proteins, such as human serum albumin,
buffer substances such as phosphates, glycine, sorbic acid,
potassium sorbate, partial glyceride mixtures of saturated
vegetable fatty acids, phosphate buffered saline solution, water,
emulsions (e.g. oil/water emulsion), salts or electrolytes such as
protamine sulfate, disodium hydrogen phosphate, potassium hydrogen
phosphate, sodium chloride, zinc salts, colloidal silica, magnesium
trisilicate, polyvinyl pyrrolidone, cellulose-based substances and
polyethylene glycol.
[0129] Any convenient method for determining if a vaccine compound
or formulation induces an innate, humoral, cell-mediated, or any
combination of these types of immune response may be employed. For
example, the ability of a vaccine compound or formulation to induce
an innate immune response through STING can be determined using
methods described herein as well as other methods. Such methods for
detecting an innate immune response can be generally performed
within hours of vaccine administration. The ability of a vaccine
compound or formulation to induce a humoral response can be
determined by measuring the titer of antigen-specific antibodies in
an animal primed with the vaccine and boosted with the antigen, or
determining the presence of antibodies cross-reactive with an
antigen by ELISA, Western blotting or other well-known methods.
Cellular immune responses can be determined, for example, by
measuring cytotoxic T cell response to antigen using a variety of
methods, such as, e.g., FACS sorting, and other methods well known
in the art. Methods of detecting humoral and cellular immune
responses can be generally performed days or weeks after vaccine
administration.
Cyclic-Di-Nucleotides
[0130] In another aspect, provided herein are 2'-5' phosphodiester
linkage containing cyclic-di-nucleotides. As used herein,
"cyclic-di-nucleotide" refers to a compound containing two
nucleosides (i.e., a first and second nucleoside), wherein the 2'
or 3' carbon of each nucleoside is linked to the 5' carbon of the
other nucleoside by a phosphodiester bond. Therefore, a 2'-5'
phosphodiester linkage containing cyclic-di-nucleotide refers to a
cyclic-di-nucleotide, wherein the 2' carbon of at least one of the
nucleosides is linked to the 5' carbon of the other nucleoside. As
discussed herein, 2'-5' phosphodiester linkage containing
cyclic-di-nucleotides can be used in practicing the methods
described herein for increasing production of a type I interferon
in a cell or subject. As used herein a "cyclic-di-nucleotide" also
includes all of the stereoisomeric forms of the
cyclic-di-nucleotides described herein.
[0131] As used herein, a "nucleoside" refers to a composition
containing a nitrogenous base covalently attached to a sugar (e.g.,
ribose or deoxyribose) or an analog thereof. Examples of
nucleosides include, but are not limited to cytidine, uridine,
adenosine, guanosine, thymidine and inosine. In some embodiments,
the nucleoside contains a deoxyribose sugar. Analogs of nucleosides
include, but are not limited to dexoyadenosine analogues (e.g.,
Didanosine and Vidarabine); deoxycytidine analogues (e.g.,
Cytarabine, Ematricitabine, Lamivudine, and Zalcitabine);
deoxyguanosine analogues (Abacavir and Entecavir); (deoxy-)
thymidine analogues (e.g., Stavudine, Telbivudine, and Zidovudine);
and deoxyuridine analogues (e.g., Idoxuridine and
Trifluridine).
[0132] While not being bound by any particular theory of operation,
and as shown in the examples below, cyclic-di-nucleotides can
increase type-I IFN production in a cell. In certain embodiments,
cyclic-di-nucleotides increase type-I IFN production through a
mechanism that involves stimulator of interferon genes (STING).
[0133] Cyclic-di-nucleotides include those specifically described
herein as well as isoforms (e.g., tautomers) of those specifically
described herein that can be used in practicing the subject
methods. Cyclic-di-nucleotides can be obtained using any suitable
method. For example, cyclic-di-nucleotides may be made by chemical
synthesis using nucleoside derivatives as starting material.
Cyclic-di-nucleotides can also be produced by in vitro synthesis,
using recombinant purified cGAMP synthase (cGAS), as described in
the Experimental Section below. Moreover, the structures of such
cyclic-di-nucleotides can be confirmed using NMR analysis.
[0134] Cyclic-di-nucleotides provided herein can be described by
the following nomenclature: cyclic[X.sub.1 (A-5')pX.sub.2(B-5')p],
wherein X.sub.1 and X.sub.2 are the first and second nucleoside, A
is the carbon of the first nucleoside (e.g., 2' or 3' position)
that is linked to the 5' carbon of the second nucleoside via a
phosphodiester bond and B is the carbon of the second nucleoside
(e.g., 2' or 3' position) that is linked to the 5' carbon of the
first nucleoside by a phosphodiester bond. For instance, based on
this nomenclature, cyclic[G(2'-5')pA(3'-5')p] has the following
formula:
##STR00016##
[0135] In certain embodiments, the cyclic-di-nucleotide contains a
2'-5' phosphodiester bond. In particular embodiments, the
cyclic-di-nucleotide further contains a 3'-5' phosphodiester bond
(e.g., cyclic[X.sub.1 (2'-5')pX.sub.2(3'-5')p] or
cyclic[X.sub.1(3'-5')pX.sub.2(2'-5')p]). In other embodiments, the
cyclic-di-nucleotide contains two 2'-5' phosphodiester bonds
(cyclic[X.sub.1(2'-5')pX.sub.2(2'-5')p]).
[0136] In certain embodiments, the cyclic-di-nucleotide is:
[0137] cyclic[A(2'-5')pA2'-5')p];
[0138] cyclic[T(2'-5')pT(2'-5')p];
[0139] cyclic[G(2'-5')pG (2'-5')p];
[0140] cyclic[C(2'-5')pC(2'-5')p]; or
[0141] cyclic[U(2'-5')pU(2'-5')p].
[0142] In certain embodiments, the cyclic-di-nucleotide is:
[0143] cyclic[A(2'-5')pA(3'-5')p];
[0144] cyclic[T(2'-5')pT(3'-5')p];
[0145] cyclic[G(2'-5')pG (3'-5')p];
[0146] cyclic[C(2'-5')pC(3'-5')p];
[0147] cyclic[U (2'-5')pU (3'-5')p];
[0148] cyclic[A(2'-5')pT(3'-5')p];
[0149] cyclic[T(2'-5')pA(3'-5')p];
[0150] cyclic[A(2'-5')pG (3'-5')p];
[0151] cyclic[G(2'-5')pA(3'-5')p];
[0152] cyclic[A(2'-5')pC (3'-5')p];
[0153] cyclic[C(2'-5')pA(3'-5')p];
[0154] cyclic[A(2'-5')pU(3'-5')p];
[0155] cyclic[U(2'-5')pA(3'-5')p];
[0156] cyclic[T(2'-5')pG(3'-5')p];
[0157] cyclic[G (2'-5')pT(3'-5')p];
[0158] cyclic[T2'-5')pC(3'-5')p];
[0159] cyclic[C(2'-5')pT(3'-5')p];
[0160] cyclic[T(2'-5')pU(3'-5')p];
[0161] cyclic[U(2'-5')pT(3'-5')p];
[0162] cyclic[G (2'-5')pC(3'-5')p];
[0163] cyclic[C2'-5')pG(3'-5')p];
[0164] cyclic[G(2'-5')pU(3'-5')p];
[0165] cyclic[U (2'-5')pG (3'-5')p];
[0166] cyclic[C(2'-5')pU(3'-5')p]; or
[0167] cyclic[U(2'-5')pC(3'-5')p].
[0168] In certain embodiments, the cyclic-di-nucleotide has the
following formula:
##STR00017##
wherein X and Y can be any organic molecule including a nitrogenous
base. As used herein a "nitrogenous base" refers to
nitrogen-containing molecules having the chemical properties of a
base including, but not limited to, pyrimidine derivatives (e.g.,
cytosine, thymine, and uracil) and purine derivatives (e.g.,
adenine and guanine), as well as substituted pyrimidine and purine
derivatives, pyrimidine and purine analogs, and their tautomers. In
certain embodiments, X and Y are each one of the following:
##STR00018##
[0169] In certain embodiments, the cyclic-di-nucleotide has the
following formula (cyclic[G(2'5')pA(3'5')p]):
##STR00019##
[0170] In certain embodiments, the cyclic-di-nucleotide has the
following formula (cyclic[G(3'5')pA(2'5')p]):
##STR00020##
[0171] In other embodiments, the cyclic-di-nucleotide has the
following formula cyclic[G(2'5')pA(2'5')p]:
##STR00021##
[0172] In other embodiments, the cyclic-di-nucleotide has the
following formula cyclic[A(2'5')pA(3'5')p]:
##STR00022##
[0173] In yet other embodiments, the cyclic-di-nucleotide has the
following formula cyclic[G(2'5')pG(3'5')p]:
##STR00023##
[0174] In certain embodiments, the cyclic-di-nucleotide has the
following formula cyclic[A(2'5')pA(2'5')p]:
##STR00024##
[0175] In certain embodiments, the cyclic-di-nucleotide has the
following formula cyclic[G(2'5')pG(2'5')p]:
##STR00025##
[0176] In certain embodiments, the cyclic-di-nucleotide has one of
the following formulas:
##STR00026## ##STR00027## ##STR00028## ##STR00029##
##STR00030##
wherein R is any amino acid side chain.
Pharmaceutical Compositions
[0177] In another aspect, provided herein is a pharmaceutical
composition that contains any of the cyclic-di-nucleotide active
agents provided herein and a pharmaceutically acceptable carrier.
In certain embodiments of the pharmaceutical composition, the
cyclic-di-nucleotide active agent is one or more
cyclic-di-nucleotides.
[0178] The term "pharmaceutically acceptable" means approved by a
regulatory agency of the Federal or a state government or listed in
the U.S. Pharmacopeia or other generally recognized foreign
pharmacopeia for use in animals, and more particularly in humans.
The term "carrier" refers to a diluent, adjuvant, excipient, or
vehicle with which the mitochondrial transport protein inhibitor is
administered. Such pharmaceutical carriers can be, for example,
sterile liquids, such as saline solutions in water and oils,
including those of petroleum, animal, vegetable or synthetic
origin, such as peanut oil, soybean oil, mineral oil, sesame oil
and the like. A saline solution is a preferred carrier when the
pharmaceutical composition is administered intravenously. Saline
solutions and aqueous dextrose and glycerol solutions can also be
employed as liquid carriers, particularly for injectable solutions.
Suitable pharmaceutical excipients include starch, glucose,
lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel,
sodium stearate, glycerol monostearate, talc, sodium chloride,
dried skim milk, glycerol, propylene glycol, water, ethanol and the
like. The composition, if desired, can also contain minor amounts
of wetting or emulsifying agents, or pH buffering agents. These
compositions can take the form of solutions, suspensions, emulsion,
tablets, pills, capsules, powders, sustained-release formulations
and the like. The composition can be formulated as a suppository,
with traditional binders and carriers such as triglycerides. The
inhibitors can be formulated as neutral or salt forms.
Pharmaceutically acceptable salts include those formed with free
amino groups such as those derived from hydrochloric, phosphoric,
acetic, oxalic, tartaric acids, etc., and those formed with free
carboxyl groups such as those derived from sodium, potassium,
ammonium, calcium, ferric hydroxides, isopropylamine,
triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
Examples of suitable pharmaceutical carriers are described in
"Remington's Pharmaceutical Sciences" by E. W. Martin, hereby
incorporated by reference herein in its entirety. Such compositions
will contain a therapeutically effective amount of the
mitochondrial transport protein (e.g., a Miro protein, a TRAK
protein, or Khc) inhibitor, preferably in purified form, together
with a suitable amount of carrier so as to provide the form for
proper administration to the patient. The formulation should suit
the mode of administration.
[0179] The pharmaceutical composition can also include any of a
variety of stabilizing agents, such as an antioxidant for example.
When the pharmaceutical composition includes a polypeptide, the
polypeptide can be complexed with various well-known compounds that
enhance the in vivo stability of the polypeptide, or otherwise
enhance its pharmacological properties (e.g., increase the
half-life of the polypeptide, reduce its toxicity, enhance
solubility or uptake). Examples of such modifications or complexing
agents include sulfate, gluconate, citrate and phosphate. The
polypeptides of a composition can also be complexed with molecules
that enhance their in vivo attributes. Such molecules include, for
example, carbohydrates, polyamines, amino acids, other peptides,
ions (e.g., sodium, potassium, calcium, magnesium, manganese), and
lipids.
[0180] Further guidance regarding formulations that are suitable
for various types of administration can be found in Remington's
Pharmaceutical Sciences, Mace Publishing Company, Philadelphia,
Pa., 17th ed. (1985). For a brief review of methods for drug
delivery, see, Langer, Science 249:1527-1533 (1990).
[0181] The components used to formulate the pharmaceutical
compositions are preferably of high purity and are substantially
free of potentially harmful contaminants (e.g., at least National
Food (NF) grade, generally at least analytical grade, and more
typically at least pharmaceutical grade). Moreover, compositions
intended for in vivo use may be sterile. To the extent that a given
compound must be synthesized prior to use, the resulting product is
typically substantially free of any potentially toxic agents,
particularly any endotoxins, which may be present during the
synthesis or purification process. Compositions for parental
administration are also sterile, substantially isotonic and made
under GMP conditions.
[0182] The pharmaceutical composition can be formulated for
intravenous, oral, via implant, transmucosal, transdermal,
intramuscular, intrathecal, or subcutaneous administration. In some
embodiments, the pharmaceutical composition is formulated for
intravenous administration. In other embodiments, the
pharmaceutical composition is formulated for subcutaneous
administration. The following delivery systems, which employ a
number of routinely used pharmaceutical carriers, are only
representative of the many embodiments envisioned for administering
the instant compositions.
[0183] Injectable drug delivery systems include solutions,
suspensions, gels, microspheres and polymeric injectables, and can
comprise excipients such as solubility-altering agents (e.g.,
ethanol, propylene glycol and sucrose) and polymers (e.g.,
polycaprylactones and PLGAs). Implantable systems include rods and
discs, and can contain excipients such as PLGA and
polycaprylactone. Osteopontin or nucleic acids of the invention can
also be administered attached to particles using a gene gun.
[0184] Oral delivery systems include tablets and capsules. These
can contain excipients such as binders (e.g.,
hydroxypropylmethylcellulose, polyvinyl pyrilodone, other
cellulosic materials and starch), diluents (e.g., lactose and other
sugars, starch, dicalcium phosphate and cellulosic materials),
disintegrating agents (e.g., starch polymers and cellulosic
materials) and lubricating agents (e.g., stearates and talc).
[0185] Transmucosal delivery systems include patches, tablets,
suppositories, pessaries, gels and creams, and can contain
excipients such as solubilizers and enhancers (e.g., propylene
glycol, bile salts and amino acids), and other vehicles (e.g.,
polyethylene glycol, fatty acid esters and derivatives, and
hydrophilic polymers such as hydroxypropylmethylcellulose and
hyaluronic acid).
[0186] Dermal delivery systems include, for example, aqueous and
nonaqueous gels, creams, multiple emulsions, microemulsions,
liposomes, ointments, aqueous and nonaqueous solutions, lotions,
aerosols, hydrocarbon bases and powders, and can contain excipients
such as solubilizers, permeation enhancers (e.g., fatty acids,
fatty acid esters, fatty alcohols and amino acids), and hydrophilic
polymers (e.g., polycarbophil and polyvinylpyrolidone). In one
embodiment, the pharmaceutically acceptable carrier is a liposome
or a transdermal enhancer.
[0187] In certain embodiments, the pharmaceutical composition
containing the cyclic-di-nucleotide active agent is formulated to
cross the blood brain barrier (BBB). One strategy for drug delivery
through the blood brain barrier (BBB) entails disruption of the
BBB, either by osmotic means such as mannitol or leukotrienes, or
biochemically by the use of vasoactive substances such as
bradykinin. A BBB disrupting agent can be co-administered with the
therapeutic compositions when the compositions are administered by
intravascular injection. Other strategies to go through the BBB may
entail the use of endogenous transport systems, including caveoil-1
mediated transcytosis, carrier-mediated transporters such as
glucose and amino acid carriers, receptor-mediated transcytosis for
insulin or transferrin, and active efflux transporters such as
p-glycoprotein. Active transport moieties may also be conjugated to
the therapeutic compounds for use in the invention to facilitate
transport across the endothelial wall of the blood vessel.
Alternatively, drug delivery of the ND pharmaceutical composition
behind the BBB may be by local delivery, for example by intrathecal
delivery, e.g., through an Ommaya reservoir (see, e.g., U.S. Pat.
Nos. 5,222,982 and 5,385,582, incorporated herein by reference); by
bolus injection, e.g., by a syringe, e.g., intravitreally or
intracranially; by continuous infusion, e.g., by cannulation, e.g.,
with convection (see, e.g., US Application No. 20070254842,
incorporated here by reference); or by implanting a device upon
which the inhibitor pharmaceutical composition has been reversably
affixed (see e.g., US Application Nos. 20080081064 and 20090196903,
incorporated herein by reference).
[0188] In certain embodiments, the pharmaceutical composition
containing the cyclic-di-nucleotide or STING active agents is
formulated in a delivery vehicle, e.g., to enhance cytosolic
transport. Any convenient protocol may be employed to facilitate
delivery of the cyclic-di-nucleotide active agent across the plasma
membrane of a cell and into the cytosol. In certain embodiments,
the cyclic-di-nucleotide or STING active agents and an antigen
effective for use in a vaccine may be formulated together to be
delivered by the same delivery vehicle in the pharmaceutical
composition.
[0189] In some instances, the cyclic-di-nucleotide or STING active
agents may be encapsulated in a delivery vehicle comprising
liposomes in the pharmaceutical composition. Methods of using
liposomes for drug delivery and other therapeutic uses are known in
the art. See, e.g., U.S. Pat. No. 8,329,213, 6,465,008, 5,013,556,
US Application No. 20070110798, and Andrews et al., Mol Pharm 2012
9:1118, which are incorporated herein by reference. Liposomes may
be modified to render their surface more hydrophilic by adding
polyethylene glycol ("pegylated") to the bilayer, which increases
their circulation time in the bloodstream. These are known as
"stealth" liposomes and are especially useful as carriers for
hydrophilic (water soluble) molecules, such as the
cyclic-di-nucleotide active agents.
[0190] In certain embodiments, nano- or microparticles made from
biodegradable materials such as poly(lactic acid),
poly(.gamma.-glutamic acid), poly(glycolic acid),
polylactic-co-glycolic acid. Polyethylenimine, or alginate
microparticles, and cationic microparticles, including dedrimers,
such as cyclodextrins, may be employed as delivery vehicles for
cyclic-di-nucleotide or STING active agents to promote cellular
uptake. See, e.g., U.S. Pat. No. 8,187,571, Krishnamachari et al.,
Adv Drug Deliv Rev 2009 61:205, Garzon et al., 2005 Vaccine
23:1384, incorporated herein by reference.
[0191] In another embodiment, photochemical internalization may be
employed to enhance cytosolic uptake of cyclic-di-nucleotide or
STING active agents. See, e.g., US Application No. 20120226217,
incorporated herein by reference. In such embodiments, the
cyclic-di-nucleotide or STING active agents may be co-administered
with a photosensitizing agent. Then, exposure of the target cells
to light of a specific wavelength triggers internalization of the
cyclic-di-nucleotide or STING active agents.
[0192] In certain embodiments, the delivery vehicle for delivering
the cyclic-di-nucleotide or STING active agents can also be
targeting delivery vehicles, e.g., a liposome containing one or
more targeting moieties or biodistribution modifiers on the surface
of the liposome. A targeting moiety can be any agent that is
capable of specifically binding or interacting with a desired
target.
[0193] The specific binding agent can be any molecule that
specifically binds to a protein, peptide, biomacromolecule, cell,
tissue, etc. that is being targeted (e.g., a protein peptide,
biomacromolecule, cell, tissue, etc. wherein the
cyclic-di-nucleotide or STING active agent exerts its desired
effect). Depending on the nature of the target site, the specific
binding agent can be, but is not limited to, an antibody against an
epitope of a peptidic analyte, or any recognition molecule, such as
a member of a specific binding pair. For example, suitable specific
binding pairs include, but are not limited to: a member of a
receptor/ligand pair; a ligand-binding portion of a receptor; a
member of an antibody/antigen pair; an antigen-binding fragment of
an antibody; a hapten; a member of a lectin/carbohydrate pair; a
member of an enzyme/substrate pair; biotin/avidin;
biotin/streptavidin; digoxin/antidigoxin; a member of a peptide
aptamer binding pair; and the like.
[0194] In certain embodiments, the specific binding moiety includes
an antibody. An antibody as defined here may include fragments of
antibodies which retain specific binding to antigen, including, but
not limited to, Fab, Fv, scFv, and Fd fragments, chimeric
antibodies, humanized antibodies, single-chain antibodies, and
fusion proteins comprising an antigen-binding portion of an
antibody and a non-antibody protein. The antibodies may also
include Fab', Fv, F(ab').sub.2, and or other antibody fragments
that retain specific binding to antigen.
[0195] In certain embodiments, the targeting moiety is a binding
agent that specifically interacts with a molecule expressed on a
tumor cell or an immune cell (e.g., CD4, CD8, CD69, CD62L, and the
like), such that the targeting delivery vehicle containing the
cyclic-di-nucleotide or STING active agents is delivered to the
site of a tumor or to specific immune cells.
[0196] Where desired, any combinations of the above listed delivery
vehicles may be used advantageously to enhance delivery of the
cyclic-di-nucleotide or STING active agents to the target
cells.
[0197] Components of the pharmaceutical composition can be supplied
either separately or mixed together in unit dosage form, for
example, as a dry lyophilized powder or water free concentrate.
Where the composition is to be administered by infusion, it can be
dispensed with an infusion bottle containing sterile pharmaceutical
grade water or saline. Where the composition is administered by
injection, an ample of sterile water for injection or saline can be
provided so that the ingredients may be mixed prior to
administration.
[0198] In some embodiments, the pharmaceutical composition is
supplied as a dry sterilized lyophilized powder that is capable of
being reconstituted to the appropriate concentration for
administration to a subject. In some embodiments, the
pharmaceutical composition is supplied as a water free concentrate.
In some embodiments, the pharmaceutical composition is supplied as
a dry sterile lyophilized powder at a unit dosage of at least 0.5
mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at
least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at
least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at
least 75 mg.
[0199] Solutions, suspensions and powders for reconstitutable
delivery systems include vehicles such as suspending agents (e.g.,
gums, xanthans, cellulosics and sugars), humectants (e.g.,
sorbitol), solubilizers (e.g., ethanol, water, PEG and propylene
glycol), surfactants (e.g., sodium lauryl sulfate, Spans, Tweens,
and cetyl pyridine), preservatives and antioxidants (e.g.,
parabens, vitamins E and C, and ascorbic acid), anti-caking agents,
coating agents, and chelating agents (e.g., EDTA).
[0200] In some embodiments, the pharmaceutical composition is
formulated as a salt form. Pharmaceutically acceptable salts
include those formed with anions such as those derived from
hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and
those formed with cations such as those derived from sodium,
potassium, ammonium, calcium, ferric hydroxides, isopropylamine,
triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
[0201] In certain embodiments, the pharmaceutical composition
contains a prodrug derivative of any of the cyclic-di-nucleotide or
STING active agents provided herein. Such prodrugs can be
subsequently converted to an active form of the
cyclic-di-nucleotide or STING active agent in the body of the
subject administered the pharmaceutical composition.
Kits
[0202] Kits with unit doses of the subject cyclic-di-nucleotide
active agents, e.g., one or more cyclic-di-nucleotides, e.g., in
oral or injectable doses, are provided. In the subject kits, the
one or more components are present in the same or different
containers, as may be convenient or desirable.
[0203] In addition to the containers containing the unit doses will
be instructions describing the use and attendant benefits of the
cyclic-di-nucleotide in treating a pathological condition of
interest. Instructions may be provided in a variety of different
formats. In certain embodiments, the instructions may include
complete protocols for practicing the subject methods or means for
obtaining the same (e.g., a website URL directing the user to a
webpage which provides the instructions), where these instructions
may be printed on a substrate, where substrate may be one or more
of: a package insert, the packaging, reagent containers and the
like.
[0204] The following examples are put forth so as to provide those
of ordinary skill in the art with a complete disclosure and
description of how to make and use the present invention, and are
not intended to limit the scope of what the inventors regard as
their invention nor are they intended to represent that the
experiments below are all or the only experiments performed.
Efforts have been made to ensure accuracy with respect to numbers
used (e.g., amounts, temperature, etc.) but some experimental
errors and deviations should be accounted for. Unless indicated
otherwise, parts are parts by weight, molecular weight is weight
average molecular weight, temperature is in degrees Centigrade, and
pressure is at or near atmospheric.
EXPERIMENTAL
1. Results and Discussion
[0205] Recognition of pathogen-derived nucleic acid is a major
mechanism by which innate immune responses are initiated in mammals
(Barbalat et al., Annu Rev Immunol (2011) 29: 185). Several
families of germ-line encoded nucleic acid sensors have been
described, including the Toll-like receptors (TLRs) and RIG-I-like
receptors (RLRs) (Palm et al., Immunol Rev (2009) 227: 221;
Takeuchi et al., Cell (2010) 140: 805). Upon binding nucleic acids,
these sensors initiate signaling cascades that lead to the
production of cytokines and other immune effector proteins that
provide host defense.
[0206] The cytosolic presence of foreign double-stranded (ds) DNA
triggers a potent antiviral response dominated by the production of
type I interferons (IFNs) (Ishii et al., Nat. Immunol. (2006) 7:
40; Stetson et al., Immunity (2006) 24: 93). However, the molecular
mechanism linking dsDNA to interferon production has not been well
characterized (Burdette & Vance, Nat. Immunol. (2013) 14: 19).
A host protein, STING, was identified and shown to be required for
the IFN response to cytosolic dsDNA (Ishikawa & Barber, Nature
(2008) 455: 674; Ishikawa et al., Nature (2009) 461: 788; Sun et
al., Proc Natl Acad Sci USA (2009) 106: 8653; and Zhong et al.,
Immunity (2008) 29: 538). STING was also shown to be required for
the interferon response to bacterially-derived second messengers
called cyclic-di-nucleotides (CDNs) (Jin et al., J Immunol (2011)
187: 2595; and Sauer et al., Infect Immun (2011) 79: 688). CDNs are
secreted or released into the cytosol by certain bacterial
pathogens (Woodward et al., Science (2010) 328: 1703) and bind
directly to STING (Burdette et al., Nature (2011) 478: 515).
Interestingly, however, a mutant (R231A) allele of mouse STING was
identified that abolished responsiveness to CDNs but did not
appreciably affect the interferon response to cytosolic DNA (Id).
In contrast, 293T cells expressing wild-type mouse STING are
responsive to CDNs but not to dsDNA. Thus, although the IFN
responses to cytosolic CDNs and dsDNA both require STING, the
responses to these chemically distinct ligands can be genetically
uncoupled.
[0207] Based on two studies (Sun, et al., Science (2013) 339: 786;
and Wu et al., Science (2013) 339: 826), it was proposed that the
cytosolic presence of dsDNA leads to the production of a CDN,
cyclic-GMP-AMP (cGAMP), by a DNA-dependent sensor called cGAMP
synthase (cGAS). cGAMP was shown to bind and activate STING.
However, it remained unclear how the STING R231A mutant could still
initiate responses to dsDNA despite lacking responsiveness to CDNs.
Therefore, the mechanism by which cGAS activates STING was
investigated.
[0208] Previous studies (Sauer et al., Burdette et al.) focused
primarily on mouse STING and it was not yet clear whether human
STING could respond to CDNs (Conlon et al., J Immunol, (2013) 190:
5216). As previously reported (Sun et al., Wu et al.) it was found
that the human THP-1 cell line responded robustly to CDNs in a
manner dependent on STING (FIG. 1A, B). hSTING was cloned from
THP-1 cells and compared its amino acid sequence to the previously
widely studied reference allele (NP_938023.1; denoted here as
hSTING.sup.REF) (7) (FIG. 2). It was found that hSTING.sup.REF and
hSTING.sup.THP-1 differ at four amino acid positions. Notably,
hSTING.sup.REF encodes a histidine (H) at amino acid position 232,
whereas hSTING.sup.THP-1 encodes an arginine (R) at this position,
which corresponds to R231 in mSTING that is critical for
responsiveness to CDNs. Therefore, the functionality of individual
hSTING alleles were tested by expressing these alleles in 293T
cells that lack endogenous STING (Burdette et al.). As previously
observed (Burdette et al.), overexpression of mSTING in 293T cells
is sufficient to induce ligand-independent activation of an
IFN-luciferase reporter construct; however, transfection of 293T
cells with lower amounts of mSTING renders the cells responsive to
CDNs. Likewise, 293T cells expressing hSTING.sup.THP-1 were
responsive to CDN stimulation. In contrast, cells expressing
hSTING.sup.REF were poorly or non-responsive (FIG. 1C).
Interestingly, it was observed that three recent crystal structures
of STING bound to cyclic-di-GMP were of the poorly-responsive
hSTING.sup.REF protein (Huang, et al., Nature Struct. & Mol.
Biol. (2012) 19: 728; Ouyang et al., Immunity (2012) 36: 1073; Yin
et al., Mol Cell (2012) 46: 735).
[0209] 293T cells are not responsive to stimulation by dsDNA,
presumably due to lack of expression of cGAS (Sun et al.) or
perhaps other DNA sensors. Therefore, to test whether the hSTING
variants could respond to DNA stimulation, STING-null
(`goldenticket`) (Sauer et al.), but (cGAS+) macrophages were
transduced with hSTING expression vectors. Interestingly, even the
hSTING.sup.REF variant that is non-responsive to CDNs conferred
responsiveness to dsDNA (FIG. 1D). hSTING.sup.REF therefore
phenocopies the R231A mutant of mouse STING, previously described
that uncouples responsiveness to CDNs and dsDNA (Burdette et al.).
Like the mSTING.sup.R231A variant, hSTING.sup.REF still bound to
CDNs (FIG. 1E) (Huang et al., Ouyang et al., and Yin et al.),
indicating that this allele is compromised at a step downstream of
CDN binding.
[0210] Consistent with the above results with hSTING alleles, an
R231H mutant of mSTING was poorly responsive to CDNs, as were R232A
or R232H variants of hSTING.sup.THP (FIG. 3A). It was therefore
concluded that arginine 231/232 is critical for responsiveness to
CDNs in mouse/human STING. Introduction of an H232R mutation in
hSTING.sup.REF, however was not sufficient to restore the
responsiveness to CDNs; indeed, it was observed that a second
substitution (G230A) was also required (FIG. 4). Again, all the
variant STING alleles that were tested bound cyclic-di-GMP,
consistent with the fact that residues 230 and 232 are located in
loops that cover but do not form the CDN binding pocket (FIG. 3B)
(Burdette & Vance).
[0211] Importantly, mSTING.sup.R231A was also non-responsive to
chemically synthesized cGAMP (FIG. 1F) (Kellenberger, et al., J Am
Chem Soc. (2013). 135:4906). This raised the question of whether
R231A/R232H variants of STING would be responsive to the cGAS
enzyme that is believed to activate STING via production of cGAMP.
It was found that human or mouse cGAS expression was sufficient to
robustly activate hSTING.sup.REF and mSTING.sup.R231A variants,
even at very low levels of cGAS expression (FIG. 5A). Several
explanations were considered for this result. One explanation is
that the response is due simply to overexpression of the synthase
in mammalian cells; however, overexpression of a bacterial enzyme
that produces cGAMP (DncV from V. cholerae) (Davies, Cell
(2012)149: 358) did not activate hSTING.sup.REF or mSTING.sup.R231A
but did activate wild-type mSTING and hSTING.sup.THP-1 (FIG. 5B).
An alternative hypothesis is that cGAS might physically interact
with STING and thereby activate STING in a manner independent of
cGAMP production. However, this explanation also appears to be
incorrect. As previously demonstrated (Sun et al.), overexpression
of catalytically dead mutants of human or mouse cGAS failed to
activate STING (GS>AA; FIG. 2A), arguing that cGAS signaling
depends on the production of a second messenger rather than on a
direct physical interaction with STING. To confirm this
interpretation, the enzymatic product of cGAS was produced by
providing ATP, GTP and dsDNA to purified recombinant cGAS in vitro.
As a negative control, dsDNA (required to stimulate cGAS activity)
was omitted from a parallel reaction. The resulting cGAS products
were then purified and transfected into 293T cells expressing STING
variants. In contrast to synthetic cGAMP, the cGAS product was able
to activate hSTING.sup.REF and mSTING.sup.R231A (FIG. 5C). This
experiment ruled out a model in which cGAS activates hSTING.sup.REF
via a direct physical interaction.
[0212] It was therefore hypothesized that the actual product of
cGAS might not be a canonical CDN as previously proposed (Sun et
al., Wu et al.). It was hypothesized that cGAS might produce a
novel CDN containing 2'-5' phosphodiester bond(s) that would be
able to stimulate variant STING alleles. Importantly, such a
non-canonical CDN would be of an identical mass to the canonical
3'-5' phosphodiester-linked CDNs and the two products would not,
therefore, have been easy to distinguish by previously published
mass spectrometric analyses of the cGAS product (Sun et al., Wu et
al.) To test this hypothesis radiolabelled .alpha..sup.32P-GTP or
.alpha..sup.32P-ATP were provided to recombinant purified cGAS or
V. cholerae DncV and the products were analyzed by thin-layer
chromatography. As reported previously, DncV produced some c-di-AMP
if provided only ATP, and some c-di-GMP if provided only GTP, but
preferred to make cGAMP when provided both ATP and GTP (Davies, et
al., Cell (2012)149: 358). (FIG. 6A). Interestingly, cGAS required
both ATP and GTP substrates and the resulting product migrates
significantly differently than any of the canonical CDNs produced
by DncV,
suggesting that cGAS produces a novel non-canonical CDN (FIG.
6A).
[0213] cGAS and DncV products were analyzed by specific nuclease
digestion. The cGAS product was partially cleaved by nuclease P1,
which selectively digests 3'-5' phosphodiester linkages, suggesting
that the cGAS product contains at least one 3'-5' phosphodiester
linkage (FIG. 6B). However, nuclease P1 digestion was incomplete as
it did not lead to generation of GMP, in contrast to treatment of
the cGAS product with snake venom phosphodiesterase, which cleaved
both 2'-5' and 3'-5' phosphodiester linkages (FIG. 3B). This
suggests that the cGAS product contains a 2'-5' phosphodiester
linkage.
[0214] CDNs have been proposed to be useful as vaccine adjuvants or
immunotherapeutics (Chen, et al., Vaccine (2010) 28:3080). A
synthetic STING activator, DMXAA, has been tested in human clinical
trials as a novel chemotherapeutic agent. Unfortunately, DMXAA was
not found to be efficacious in humans, likely because it is unable
to stimulate hSTING (Conlon et al.). In this context, our results
are significant as they indicate that non-canonical 2'-5' linked
CDNs function as potent pan-agonists of diverse STING variants,
including those variants that are only poorly responsive to
canonical CDNs or DMXAA.
II. Materials and Methods:
A. Mice and Cell Lines
[0215] THP-1 cells were grown in RPMI 1640 supplemented with 10%
FBS, penicillin-streptomycin and L-glutamine. HEK293T cells were
grown in DMEM supplemented with 10% FBS, penicillin-streptomycin
and L-glutamine. Gp2 retroviral packaging cell lines were
maintained in DMEM supplemented with 10% FBS,
penicillin-streptomycin and L-glutamine. Animal protocols were
approved by the University of California, Berkeley Animal Care and
Use Committee.
B. STING Knockdown
[0216] Knockdown of human STING (clone ID NM_198282.1-901s1c1) was
achieved using pLKO.1 (The RNAi Consortium). The sequence for
knockdown of human STING is 5'-GCA GAG CTA TTT CCT TCC ACA (SEQ ID
NO:07) which correspond to 5'-CCG GGC AGA GCT ATT TCC TTC CAC ACT
CGA GTG TGG AAG GAA ATA GCT CTG CTT TTT G (SEQ ID NO:08) forward
oligo and 5'-AAT TCA AAA AGC AGA GCT ATT TCC TTC CAC ACT CGA GTG
TGG AAG GAA ATA GCT CTG C (SEQ ID NO:09) reverse oligo. Oligos were
annealed and cloned into AgeI and EcoRI digested pLKO.1 (Addgene)
and retrovirally transduced into THP-1 cells in parallel with
scramble shRNA control constructs. Stable cell lines were selected
with puromycin. THP-1 cells were differentiated with 1 .mu.g/mL PMA
for 24 hours. Cells were allowed to rest for 24 hours and then
restimulated for 6 hours with the indicated ligands. IFN induction
was measured by qRT-PCR as described below.
C. Cell Stimulation and Reagents
[0217] Bone marrow macrophages and HEK293T cells were stimulated
using Lipofectamine 2000 (Invitrogen). Unless otherwise specified,
cyclic-di-GMP, cyclic-di-AMP, polyI:C and Vaccinia Virus 70mer DNA
was prepared as described previously (Burdette et al.) and used at
similar concentrations. Sendai virus was purchased from Charles
River Laboratories. cGAMP was synthesized as previously described
(Kellenberger et al).
D. Cloning, Mutagenesis and Plasmids
[0218] The THP-1 STING allele was amplified from cDNA using 5'
hSTING HindIII(5'-ATCGAA GCT TCC ACC ATG CCC CAC TCC AGC CTG) (SEQ
ID NO:10) and 3' hSTING NotI (5'-ATC GGC GGC CGC TCA GGC ATA GTC
AGG CAC GTC ATA AGG ATA AGA GAA ATC CGT GCG GAG AG) (SEQ ID NO:11).
Resulting PCR product was cloned into pCDNA3 using HindIII/NotI
digestion. THP-1 STING was amplified and cloned into MSCV2.2 using
the 3' primer listed above and 5' hSTING XhoI (5'-ATC GCT CGA GCC
ACC ATG CCC CAC TCC AGC CTG)(SEQ ID NO:12) and XhoI/NotI digestion.
IFN-luciferase, TK-Renilla and mouse STING plasmids were used as
previously described (Burdette et al.). Mutations in human STING
were introduced using Quikchange Site Directed Mutagenesis Kit
(Stratagene). cDNA clones corresponding to mouse and human cGAS
(MGC Fully Sequenced Human MB21D1 cDNA, Accession: BC108714.1,
Clone ID: 6015929; EST Fully Sequenced Mouse E330016A19Rik cDNA,
Accession: BC145653.1, Clone ID: 40130956) were obtained from Open
Biosystems and correspond to those described previously (Sun et
al., Wu et al.). Mouse cGAS was amplified from cDNA clones with an
N-terminal flag tag with forward oligo 5'-mcGAS-KpnI (5'-ATC GGG
TAC CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG GAA GAT CCG CGT AGA
AGG) (SEQ ID NO:13) and reverse oligo 3'-mcGAS-NotI (5'-ATC GGC GGC
CGC TCA AAG CTT GTC AAA AAT TGG) (SEQ ID NO:14). Likewise, hcGAS
was amplified with forward oligo 5'-hcGAS-flag-KpnI (5'-ATC GGG TAC
CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG CAG CCT TGG CAC GGA AAG
G) (SEQ ID NO:15) and reverse 3'-hcGAS-NotI (5'ATC GGC GGC CGC TCA
AAA TTC ATC AAA AAC TGG AAA C)(SEQ ID NO:16). Both PCR products
were cloned into pcDNA3 at KpnI and NotI restriction enzyme sites.
DncV was amplified using DncV fwd BamHI (5'-GCA TGG ATC CGC CAC CAT
GAC TTG GAA CTT TCA CCA G) (SEQ ID NO:17) and DncV rev NotI (5'-GCA
TGC GGC CGC TCA GCC ACT TAC CAT TGT GCT GC) (SEQ ID NO:18) and
cloned into pCDNA3 using BamHI and NotI. For cloning into MSCV2.2,
DncV was amplified using DncV fwd XhoI (5'-GCA TCT CGA GCC ACC ATG
ACT TGG AAC TTT CAC CAG) (SEQ ID NO:19) and DncV rev NotI.
Resulting DNA was cloned into MSCV 2.2 digested with XhoI/NotI.
Constructs for bacterial mcGAS overexpression were constructed as
follows. N terminal His6-SUMO tag amplified by PCR using His6 SUMO
Nco (5'-TAA TAA GGA GAT ATA CCA TGG GCA GCA GCC) (SEQ ID NO:20) and
His6 SUMO Sal (5'-GAA TTC GTC GAC ACC AAT CTG TTC TCT GTG AGC) (SEQ
ID NO:21) off of pCDF-Duet2 template (gift from M. Rape lab,
UC-Berkeley) and cloned into pET28a using Ncol and Sail to make
pET28a-H6SUMO. Full length mcGAS was PCR amplified from the mouse
cDNA clone described above using mcGAS fwd Sal (5'-GAT GTC GAC ATG
GAA GAT CCG CGT AGA AGG ACG) (SEQ ID NO:22) and mcGAS rev Xho
(5'-ATC CTC GAG TCA AAG CTT GTC AAA AAT TGG AAA CC) (SEQ ID NO:23)
and cloned into pET28a-H6SUMO using Sail and XhoI to make
pET28a-H6SUMO-mcGAS that expresses full length mcGAS fused to an
N-terminal His6 SUMO tag.
E. Protein Purifications
[0219] WspR construct (pQE-WspR*) was a generous gift from Steve
Lory (Harvard). WspR purification and c-di-GMP synthesis reactions
were carried out as previously described (Merighi, et al., Mol
Microbiol (2007)65: 876). Overexpression strains and plasmids for
DncV and mutant DncV were provided by J. Mekalanos. DncV protein
was overexpressed and purified as previously described (Davies et
al.). Briefly, DncV protein production was induced in mid-log phase
for 3 h at 37.degree. C. with 1 mM IPTG. Cells were lysed and DncV
protein was purified under denaturing conditions. Cleared lysate
was incubated with Ni-NTA and eluted in Urea Elution buffer (2M
Urea, 10 mM Tris pH=8.0, 150 mM NaCl, 250 mM Imidazole). Eluted
protein was dialyzed to 25 mM Tris-Cl, pH=7.5, 300 mM NaCl, 5 mM
Mg(OAc)2, 10% glycerol, 2 mM DTT. H6SUMO-mcGAS was expressed in
Rosetta(DE3) pLysS cells by overnight induction with 0.5 mM IPTG at
18.degree. C. Cells were lysed into 50 mM Tris-Cl, pH=8, 300 mM
NaCl, 20 mM Imidazole, 5 mM BME and 0.2 mM PMSF by French Press.
Cleared lysate was incubated with Ni-NTA and bound protein was
eluted with 20 mM Tris-Cl, pH=7.4, 150 mM NaCl, 300 mM Imidazole.
Eluant was dialyzed to 20 mM Tris-Cl, pH=7.4, 150 mM NaCl, 5 mM
.beta.-mercaptoethanol with 10% glycerol. Protein was flash frozen
and stored at -80.degree. C.
F. cGAS Product Purification and Structural Characterization
[0220] The cGAS product was purified using reverse-phase HPLC on an
Agilent 1260 Infinity HPLC equipped with an Agilent Polaris C18-A
column (5 .mu.m, 250 mm.times.10 mm, 180 .ANG.). Purification
conditions include a 100% to 0% gradient of solvent A over 20 min
at 50.degree. C. and a flow rate of 5 mL/min, where solvent A is
100 mM ammonium acetate in water and solvent B is acetonitrile.
Purified elution fractions were evaporated multiple times in order
to remove excess ammonia. Resonance assignments were made using
COSY, .sup.1H-.sup.13C HSQC, NOESY, .sup.1H-.sup.13C HMBC, and
1H-.sup.31P HMBC. Characterization of cGAS product: .sup.1H NMR
(900 MHz, D20, 50.degree. C., .delta.): 8.44 (1H, s), 8.42 (1H, s),
8.03 (1H, s), 6.31 (1H, s), 6.09 (1H, J=8 Hz, d), 5.75 (1H, m),
5.18 (1H, m), 4.93 (1H, s), 4.74, 4.62, 4.59 (1H, J=12 Hz, d), 4.55
(1H, s), 4.38 (1H, m), 4.33 (1H, J=12 Hz, d), 4.28 (1H, J=12 Hz,
d); 31P {.sup.1H decoupled}NMR (600 MHz, D20, 50.degree. C., 6):
(all resonances are singlets) -0.96, -1.86; HRMS (m/z): [M-H]-
monoisotopic mass calculated for
C.sub.20H.sub.24N.sub.10O.sub.13P.sub.2, 673.0927; found, 673.0909.
[M+Na 2H]- monoisotopic mass calculated for
C.sub.20H.sub.24N.sub.10O.sub.13P.sub.2, 695.0752; found,
695.0728.
G. Luciferase Assay
[0221] HEK293T cells were plated in TC-treated 96-well plates at
0.5%-%106% cells % ml-1. The next day, the cells were transfected
with indicated constructs, together with IFN-.beta.-firefly
luciferase and TK Renilla luciferase reporter constructs. Following
stimulation for 6% h with the indicated ligands, the cells were
lysed in passive lysis buffer (Promega) for 5% min at 25.degree. C.
The cell lysates were incubated with firefly luciferase substrate
(Biosynth) and the Renilla luciferase substrate coelenterazine
(Biotium), and luminescence was measured on a SpectraMax L
microplate reader (Molecular Devices). The relative Ifnb expression
was calculated as firefly luminescence relative to Renilla
luminescence.
H. In Vitro Cyclic-Di-Nucleotide Synthesis
[0222] In vitro DncV reactions were carried out in 20 mM Tris-Cl,
pH=8, 20 Mg(OAc)2, 10% glycerol and 1 mM DTT, 0.1 mg/mL BSA.
Reactions contained 250 .mu.M GTP, 250 .mu.M ATP or 125 .mu.M GTP
and 125 .mu.M ATP as indicated in figures. In addition, 33 nM
.alpha.32P-GTP (3000 Ci/mmol, Perkin-Elmer) or 33 nM .alpha.32P-ATP
(3000 Ci/mmol, Perkin-Elmer) was included in reaction where
indicated. Reactions were started by addition of 1 .mu.M purified
DncV protein. In vitro cGAS reactions were carried out in 40 mM
Tris-Cl, pH=7.5, 100 mM NaCl, 10 mM MgCl2. Cold nucleotide and
alpha-labeled GTP is at the same concentrations as in DncV
reactions. Reactions were started by addition of 200 nM purified
cGAS. Where indicated, herring testes DNA (Sigma) was added to
reactions at a final concentration of 0.1 mg/mL. WspR reactions
were performed as described previously (14). Reactions were
incubated for 1 hour at 37.degree. C., boiled for 5 min at
95.degree. C., and spun for 10 minutes at 13,000 rpm. Reactions
were removed and mixed 1:5 with TLC running buffer (1:1.5 (v/v)
saturated NH4SO4 and 1.5M KH2PO4, pH 3.6) and spotted on
PEIcellulose TLC plate (Sigma). Following solvent migration, the
TLC plate was exposed to a phosphorimager screen and imaged using
Typhoon scanner. For in vitro product transfection into 293T cells,
reactions were scaled up, radiolabeled nucleotide was omitted and
the concentration of ATP and GTP was increased to 2 mM.
I. Nuclease Digests
[0223] Nuclease P1 from Penicillium citrinum and Snake venom
phosphodiesterase I from Crotalus adamanteus were purchased from
Sigma. Reactions from in vitro cyclic-di-nucleotide synthesis
labeled with .alpha.32P-GTP were diluted 1:5 in either P1 buffer
(40 mM Tris-Cl, pH=6, 2 mM ZnCl2) or SVPD buffer (40 mM Tris-Cl,
pH=8, 10 mM MgCl2) followed by digestion with 2.5 mU of nuclease P1
or SVPD, respectively. Digestions were incubated for 45 minutes at
37.degree. C. and nucleotide products were resolved by TLC.
J. NMR Data
[0224] In the .sup.1H-.sup.31P HMBC spectrum shown in FIG. 6C, the
phosphorous nucleus, P-11, is correlated to the 2' ribose proton
(H-12) of guanosine as well as to the 5' ribose methylene protons
(H-10) and the 4' ribose proton (H-9) of adenosine. The other
phosphorous nucleus (P-22) is correlated to the 3' ribose proton
(H-8) of adenosine as well as to the 5' ribose methylene protons
(H-21) and 4' ribose proton (H-20) of guanosine. Thus, the
regiochemistry of the phosphodiester linkages was determined to be
cyclic[G(2'-5')pA(3'-5')p]. In order to assign the above peaks, it
was critical to accurately identify the ribose spin systems
corresponding to guanosine and adenosine, respectively. The protons
corresponding to the adenine nucleobase (H-2, H-5) and guanine
nucleobase (H-17) were assigned based upon reference spectra for
the individual nucleobases, 1H-13C HMBC, and 1H-13C HSQC NMR (FIGS.
7A and 7B). The 1H-1H NOESY experiment showed through-space
interactions between the adenine proton H-5 and the 3' ribose
proton (H-8) as well as between the guanine proton H-17 and the 1'
ribose proton (H-18) (FIG. 7D). The remaining protons in the
corresponding ribose spin systems were identified by 1H-1H COSY
(FIG. 7C), and multiplicity edited 1H-13C HSQC (FIGS. 7A and 7B),
which distinguished the 5' methylene protons in particular (H-10
and H-21).
K. RNA, cDNA Synthesis, and Quantitative RT-PCR
[0225] RNA from mammalian cell lines was extracted using Trizol
reagent (Invitrogen) or RNeasy Mini Kit (Qiagen). RNA was treated
with RQ1 RNase-free DNase (Promega). RNA was reverse transcribed
with Superscript III (Invitrogen). Mouse ifnB was quantified
relative to mouse rps17 as described previously (Woodward et al).
Human ifnB was quantified relative to human S9 as described
previously (Wu et al).
[0226] The preceding merely illustrates the principles of the
invention. It will be appreciated that those skilled in the art
will be able to devise various arrangements which, although not
explicitly described or shown herein, embody the principles of the
invention and are included within its spirit and scope.
Furthermore, all examples and conditional language recited herein
are principally intended to aid the reader in understanding the
principles of the invention and the concepts contributed by the
inventors to furthering the art, and are to be construed as being
without limitation to such specifically recited examples and
conditions. Moreover, all statements herein reciting principles,
aspects, and embodiments of the invention as well as specific
examples thereof, are intended to encompass both structural and
functional equivalents thereof. Additionally, it is intended that
such equivalents include both currently known equivalents and
equivalents developed in the future, i.e., any elements developed
that perform the same function, regardless of structure. The scope
of the present invention, therefore, is not intended to be limited
to the exemplary embodiments shown and described herein. Rather,
the scope and spirit of the present invention is embodied by the
appended claims.
[0227] All publications and patent applications cited in this
specification are herein incorporated by reference as if each
individual publication or patent application were specifically and
individually indicated to be incorporated by reference. The
citation of any publication is for its disclosure prior to the
filing date and should not be construed as an admission that the
present invention is not entitled to antedate such publication by
virtue of prior invention.
Sequence CWU 1
1
2311802DNAHomo sapiens 1agcctggggt tccccttcgg gtcgcagact cttgtgtgcc
cgccagtagt gcttggtttc 60caacagctgc tgctggctct tcctcttgcg gccttttcct
gaaacggatt cttctttcgg 120ggaacagaaa gcgccagcca tgcagccttg
gcacggaaag gccatgcaga gagcttccga 180ggccggagcc actgccccca
aggcttccgc acggaatgcc aggggcgccc cgatggatcc 240caccgagtct
ccggctgccc ccgaggccgc cctgcctaag gcgggaaagt tcggccccgc
300caggaagtcg ggatcccggc agaaaaagag cgccccggac acccaggaga
ggccgcccgt 360ccgcgcaact ggggcccgcg ccaaaaaggc ccctcagcgc
gcccaggaca cgcagccgtc 420tgacgccacc agcgcccctg gggcagaggg
gctggagcct cctgcggctc gggagccggc 480tctttccagg gctggttctt
gccgccagag gggcgcgcgc tgctccacga agccaagacc 540tccgcccggg
ccctgggacg tgcccagccc cggcctgccg gtctcggccc ccattctcgt
600acggagggat gcggcgcctg gggcctcgaa gctccgggcg gttttggaga
agttgaagct 660cagccgcgat gatatctcca cggcggcggg gatggtgaaa
ggggttgtgg accacctgct 720gctcagactg aagtgcgact ccgcgttcag
aggcgtcggg ctgctgaaca ccgggagcta 780ctatgagcac gtgaagattt
ctgcacctaa tgaatttgat gtcatgttta aactggaagt 840ccccagaatt
caactagaag aatattccaa cactcgtgca tattactttg tgaaatttaa
900aagaaatccg aaagaaaatc ctctgagtca gtttttagaa ggtgaaatat
tatcagcttc 960taagatgctg tcaaagttta ggaaaatcat taaggaagaa
attaacgaca ttaaagatac 1020agatgtcatc atgaagagga aaagaggagg
gagccctgct gtaacacttc ttattagtga 1080aaaaatatct gtggatataa
ccctggcttt ggaatcaaaa agtagctggc ctgctagcac 1140ccaagaaggc
ctgcgcattc aaaactggct ttcagcaaaa gttaggaagc aactacgact
1200aaagccattt taccttgtac ccaagcatgc aaaggaagga aatggtttcc
aagaagaaac 1260atggcggcta tccttctctc acatcgaaaa ggaaattttg
aacaatcatg gaaaatctaa 1320aacgtgctgt gaaaacaaag aagagaaatg
ttgcaggaaa gattgtttaa aactaatgaa 1380atacctttta gaacagctga
aagaaaggtt taaagacaaa aaacatctgg ataaattctc 1440ttcttatcat
gtgaaaactg ccttctttca cgtatgtacc cagaaccctc aagacagtca
1500gtgggaccgc aaagacctgg gcctctgctt tgataactgc gtgacatact
ttcttcagtg 1560cctcaggaca gaaaaacttg agaattattt tattcctgaa
ttcaatctat tctctagcaa 1620cttaattgac aaaagaagta aggaatttct
gacaaagcaa attgaatatg aaagaaacaa 1680tgagtttcca gtttttgatg
aattttgaga ttgtattttt agaaagatct aagaactaga 1740gtcaccctaa
atcctggaga atacaagaaa aatttgaaaa ggggccagac gctgtggctc 1800ac
18022522PRTHomo sapiens 2Met Gln Pro Trp His Gly Lys Ala Met Gln
Arg Ala Ser Glu Ala Gly1 5 10 15Ala Thr Ala Pro Lys Ala Ser Ala Arg
Asn Ala Arg Gly Ala Pro Met 20 25 30Asp Pro Thr Glu Ser Pro Ala Ala
Pro Glu Ala Ala Leu Pro Lys Ala 35 40 45Gly Lys Phe Gly Pro Ala Arg
Lys Ser Gly Ser Arg Gln Lys Lys Ser 50 55 60Ala Pro Asp Thr Gln Glu
Arg Pro Pro Val Arg Ala Thr Gly Ala Arg65 70 75 80Ala Lys Lys Ala
Pro Gln Arg Ala Gln Asp Thr Gln Pro Ser Asp Ala 85 90 95Thr Ser Ala
Pro Gly Ala Glu Gly Leu Glu Pro Pro Ala Ala Arg Glu 100 105 110Pro
Ala Leu Ser Arg Ala Gly Ser Cys Arg Gln Arg Gly Ala Arg Cys 115 120
125Ser Thr Lys Pro Arg Pro Pro Pro Gly Pro Trp Asp Val Pro Ser Pro
130 135 140Gly Leu Pro Val Ser Ala Pro Ile Leu Val Arg Arg Asp Ala
Ala Pro145 150 155 160Gly Ala Ser Lys Leu Arg Ala Val Leu Glu Lys
Leu Lys Leu Ser Arg 165 170 175Asp Asp Ile Ser Thr Ala Ala Gly Met
Val Lys Gly Val Val Asp His 180 185 190Leu Leu Leu Arg Leu Lys Cys
Asp Ser Ala Phe Arg Gly Val Gly Leu 195 200 205Leu Asn Thr Gly Ser
Tyr Tyr Glu His Val Lys Ile Ser Ala Pro Asn 210 215 220Glu Phe Asp
Val Met Phe Lys Leu Glu Val Pro Arg Ile Gln Leu Glu225 230 235
240Glu Tyr Ser Asn Thr Arg Ala Tyr Tyr Phe Val Lys Phe Lys Arg Asn
245 250 255Pro Lys Glu Asn Pro Leu Ser Gln Phe Leu Glu Gly Glu Ile
Leu Ser 260 265 270Ala Ser Lys Met Leu Ser Lys Phe Arg Lys Ile Ile
Lys Glu Glu Ile 275 280 285Asn Asp Ile Lys Asp Thr Asp Val Ile Met
Lys Arg Lys Arg Gly Gly 290 295 300Ser Pro Ala Val Thr Leu Leu Ile
Ser Glu Lys Ile Ser Val Asp Ile305 310 315 320Thr Leu Ala Leu Glu
Ser Lys Ser Ser Trp Pro Ala Ser Thr Gln Glu 325 330 335Gly Leu Arg
Ile Gln Asn Trp Leu Ser Ala Lys Val Arg Lys Gln Leu 340 345 350Arg
Leu Lys Pro Phe Tyr Leu Val Pro Lys His Ala Lys Glu Gly Asn 355 360
365Gly Phe Gln Glu Glu Thr Trp Arg Leu Ser Phe Ser His Ile Glu Lys
370 375 380Glu Ile Leu Asn Asn His Gly Lys Ser Lys Thr Cys Cys Glu
Asn Lys385 390 395 400Glu Glu Lys Cys Cys Arg Lys Asp Cys Leu Lys
Leu Met Lys Tyr Leu 405 410 415Leu Glu Gln Leu Lys Glu Arg Phe Lys
Asp Lys Lys His Leu Asp Lys 420 425 430Phe Ser Ser Tyr His Val Lys
Thr Ala Phe Phe His Val Cys Thr Gln 435 440 445Asn Pro Gln Asp Ser
Gln Trp Asp Arg Lys Asp Leu Gly Leu Cys Phe 450 455 460Asp Asn Cys
Val Thr Tyr Phe Leu Gln Cys Leu Arg Thr Glu Lys Leu465 470 475
480Glu Asn Tyr Phe Ile Pro Glu Phe Asn Leu Phe Ser Ser Asn Leu Ile
485 490 495Asp Lys Arg Ser Lys Glu Phe Leu Thr Lys Gln Ile Glu Tyr
Glu Arg 500 505 510Asn Asn Glu Phe Pro Val Phe Asp Glu Phe 515
520316PRTArtificial SequenceSynthetic Polypeptide 3Arg Gln Ile Lys
Ile Trp Phe Gln Asn Arg Arg Met Lys Trp Lys Lys1 5 10
1542191DNAHomo sapiens 4gttcattttt cactcctccc tcctaggtca cacttttcag
aaaaagaatc tgcatcctgg 60aaaccagaag aaaaatatga gacggggaat catcgtgtga
tgtgtgtgct gcctttggct 120gagtgtgtgg agtcctgctc aggtgttagg
tacagtgtgt ttgatcgtgg tggcttgagg 180ggaacccgct gttcagagct
gtgactgcgg ctgcactcag agaagctgcc cttggctgct 240cgtagcgccg
ggccttctct cctcgtcatc atccagagca gccagtgtcc gggaggcaga
300agatgcccca ctccagcctg catccatcca tcccgtgtcc caggggtcac
ggggcccaga 360aggcagcctt ggttctgctg agtgcctgcc tggtgaccct
ttgggggcta ggagagccac 420cagagcacac tctccggtac ctggtgctcc
acctagcctc cctgcagctg ggactgctgt 480taaacggggt ctgcagcctg
gctgaggagc tgcgccacat ccactccagg taccggggca 540gctactggag
gactgtgcgg gcctgcctgg gctgccccct ccgccgtggg gccctgttgc
600tgctgtccat ctatttctac tactccctcc caaatgcggt cggcccgccc
ttcacttgga 660tgcttgccct cctgggcctc tcgcaggcac tgaacatcct
cctgggcctc aagggcctgg 720ccccagctga gatctctgca gtgtgtgaaa
aagggaattt caacgtggcc catgggctgg 780catggtcata ttacatcgga
tatctgcggc tgatcctgcc agagctccag gcccggattc 840gaacttacaa
tcagcattac aacaacctgc tacggggtgc agtgagccag cggctgtata
900ttctcctccc attggactgt ggggtgcctg ataacctgag tatggctgac
cccaacattc 960gcttcctgga taaactgccc cagcagaccg gtgaccatgc
tggcatcaag gatcgggttt 1020acagcaacag catctatgag cttctggaga
acgggcagcg ggcgggcacc tgtgtcctgg 1080agtacgccac ccccttgcag
actttgtttg ccatgtcaca atacagtcaa gctggcttta 1140gccgggagga
taggcttgag caggccaaac tcttctgccg gacacttgag gacatcctgg
1200cagatgcccc tgagtctcag aacaactgcc gcctcattgc ctaccaggaa
cctgcagatg 1260acagcagctt ctcgctgtcc caggaggttc tccggcacct
gcggcaggag gaaaaggaag 1320aggttactgt gggcagcttg aagacctcag
cggtgcccag tacctccacg atgtcccaag 1380agcctgagct cctcatcagt
ggaatggaaa agcccctccc tctccgcacg gatttctctt 1440gagacccagg
gtcaccaggc cagagcctcc agtggtctcc aagcctctgg actgggggct
1500ctcttcagtg gctgaatgtc cagcagagct atttccttcc acagggggcc
ttgcagggaa 1560gggtccagga cttgacatct taagatgcgt cttgtcccct
tgggccagtc atttcccctc 1620tctgagcctc ggtgtcttca acctgtgaaa
tgggatcata atcactgcct tacctccctc 1680acggttgttg tgaggactga
gtgtgtggaa gtttttcata aactttggat gctagtgtac 1740ttagggggtg
tgccaggtgt ctttcatggg gccttccaga cccactcccc acccttctcc
1800ccttcctttg cccggggacg ccgaactctc tcaatggtat caacaggctc
cttcgccctc 1860tggctcctgg tcatgttcca ttattgggga gccccagcag
aagaatggag aggaggagga 1920ggctgagttt ggggtattga atcccccggc
tcccaccctg cagcatcaag gttgctatgg 1980actctcctgc cgggcaactc
ttgcgtaatc atgactatct ctaggattct ggcaccactt 2040ccttccctgg
ccccttaagc ctagctgtgt atcggcaccc ccaccccact agagtactcc
2100ctctcacttg cggtttcctt atactccacc cctttctcaa cggtcctttt
ttaaagcaca 2160tctcagatta cccaaaaaaa aaaaaaaaaa a 21915379PRTHomo
sapiens 5Met Pro His Ser Ser Leu His Pro Ser Ile Pro Cys Pro Arg
Gly His1 5 10 15Gly Ala Gln Lys Ala Ala Leu Val Leu Leu Ser Ala Cys
Leu Val Thr 20 25 30Leu Trp Gly Leu Gly Glu Pro Pro Glu His Thr Leu
Arg Tyr Leu Val 35 40 45Leu His Leu Ala Ser Leu Gln Leu Gly Leu Leu
Leu Asn Gly Val Cys 50 55 60Ser Leu Ala Glu Glu Leu Arg His Ile His
Ser Arg Tyr Arg Gly Ser65 70 75 80Tyr Trp Arg Thr Val Arg Ala Cys
Leu Gly Cys Pro Leu Arg Arg Gly 85 90 95Ala Leu Leu Leu Leu Ser Ile
Tyr Phe Tyr Tyr Ser Leu Pro Asn Ala 100 105 110Val Gly Pro Pro Phe
Thr Trp Met Leu Ala Leu Leu Gly Leu Ser Gln 115 120 125Ala Leu Asn
Ile Leu Leu Gly Leu Lys Gly Leu Ala Pro Ala Glu Ile 130 135 140Ser
Ala Val Cys Glu Lys Gly Asn Phe Asn Val Ala His Gly Leu Ala145 150
155 160Trp Ser Tyr Tyr Ile Gly Tyr Leu Arg Leu Ile Leu Pro Glu Leu
Gln 165 170 175Ala Arg Ile Arg Thr Tyr Asn Gln His Tyr Asn Asn Leu
Leu Arg Gly 180 185 190Ala Val Ser Gln Arg Leu Tyr Ile Leu Leu Pro
Leu Asp Cys Gly Val 195 200 205Pro Asp Asn Leu Ser Met Ala Asp Pro
Asn Ile Arg Phe Leu Asp Lys 210 215 220Leu Pro Gln Gln Thr Gly Asp
His Ala Gly Ile Lys Asp Arg Val Tyr225 230 235 240Ser Asn Ser Ile
Tyr Glu Leu Leu Glu Asn Gly Gln Arg Ala Gly Thr 245 250 255Cys Val
Leu Glu Tyr Ala Thr Pro Leu Gln Thr Leu Phe Ala Met Ser 260 265
270Gln Tyr Ser Gln Ala Gly Phe Ser Arg Glu Asp Arg Leu Glu Gln Ala
275 280 285Lys Leu Phe Cys Arg Thr Leu Glu Asp Ile Leu Ala Asp Ala
Pro Glu 290 295 300Ser Gln Asn Asn Cys Arg Leu Ile Ala Tyr Gln Glu
Pro Ala Asp Asp305 310 315 320Ser Ser Phe Ser Leu Ser Gln Glu Val
Leu Arg His Leu Arg Gln Glu 325 330 335Glu Lys Glu Glu Val Thr Val
Gly Ser Leu Lys Thr Ser Ala Val Pro 340 345 350Ser Thr Ser Thr Met
Ser Gln Glu Pro Glu Leu Leu Ile Ser Gly Met 355 360 365Glu Lys Pro
Leu Pro Leu Arg Thr Asp Phe Ser 370 3756379PRTArtificial
SequenceDerived from Homo sapiens 6Met Pro His Ser Ser Leu His Pro
Ser Ile Pro Cys Pro Arg Gly His1 5 10 15Gly Ala Gln Lys Ala Ala Leu
Val Leu Leu Ser Ala Cys Leu Val Thr 20 25 30Leu Trp Gly Leu Gly Glu
Pro Pro Glu His Thr Leu Arg Tyr Leu Val 35 40 45Leu His Leu Ala Ser
Leu Gln Leu Gly Leu Leu Leu Asn Gly Val Cys 50 55 60Ser Leu Ala Glu
Glu Leu His His Ile His Ser Arg Tyr Arg Gly Ser65 70 75 80Tyr Trp
Arg Thr Val Arg Ala Cys Leu Gly Cys Pro Leu Arg Arg Gly 85 90 95Ala
Leu Leu Leu Leu Ser Ile Tyr Phe Tyr Tyr Ser Leu Pro Asn Ala 100 105
110Val Gly Pro Pro Phe Thr Trp Met Leu Ala Leu Leu Gly Leu Ser Gln
115 120 125Ala Leu Asn Ile Leu Leu Gly Leu Lys Gly Leu Ala Pro Ala
Glu Ile 130 135 140Ser Ala Val Cys Glu Lys Gly Asn Phe Asn Val Ala
His Gly Leu Ala145 150 155 160Trp Ser Tyr Tyr Ile Gly Tyr Leu Arg
Leu Ile Leu Pro Glu Leu Gln 165 170 175Ala Arg Ile Arg Thr Tyr Asn
Gln His Tyr Asn Asn Leu Leu Arg Gly 180 185 190Ala Val Ser Gln Arg
Leu Tyr Ile Leu Leu Pro Leu Asp Cys Gly Val 195 200 205Pro Asp Asn
Leu Ser Met Ala Asp Pro Asn Ile Arg Phe Leu Asp Lys 210 215 220Leu
Pro Gln Gln Thr Ala Asp Arg Ala Gly Ile Lys Asp Arg Val Tyr225 230
235 240Ser Asn Ser Ile Tyr Glu Leu Leu Glu Asn Gly Gln Arg Ala Gly
Thr 245 250 255Cys Val Leu Glu Tyr Ala Thr Pro Leu Gln Thr Leu Phe
Ala Met Ser 260 265 270Gln Tyr Ser Gln Ala Gly Phe Ser Arg Glu Asp
Arg Leu Glu Gln Ala 275 280 285Lys Leu Phe Cys Gln Thr Leu Glu Asp
Ile Leu Ala Asp Ala Pro Glu 290 295 300Ser Gln Asn Asn Cys Arg Leu
Ile Ala Tyr Gln Glu Pro Ala Asp Asp305 310 315 320Ser Ser Phe Ser
Leu Ser Gln Glu Val Leu Arg His Leu Arg Gln Glu 325 330 335Glu Lys
Glu Glu Val Thr Val Gly Ser Leu Lys Thr Ser Ala Val Pro 340 345
350Ser Thr Ser Thr Met Ser Gln Glu Pro Glu Leu Leu Ile Ser Gly Met
355 360 365Glu Lys Pro Leu Pro Leu Arg Thr Asp Phe Ser 370
375721DNAArtificial sequenceSynthetic Polynucleotide 7gcagagctat
ttccttccac a 21858DNAArtificial sequenceSynthetic Polynucleotide
8ccgggcagag ctatttcctt ccacactcga gtgtggaagg aaatagctct gctttttg
58958DNAArtificial sequenceSynthetic Polynucleotide 9aattcaaaaa
gcagagctat ttccttccac actcgagtgt ggaaggaaat agctctgc
581033DNAArtificial sequenceSynthetic Polynucleotide 10atcgaagctt
ccaccatgcc ccactccagc ctg 331162DNAArtificial sequenceSynthetic
Polynucleotide 11atcggcggcc gctcaggcat agtcaggcac gtcataagga
taagagaaat ccgtgcggag 60ag 621233DNAArtificial sequenceSynthetic
Polynucleotide 12atcgctcgag ccaccatgcc ccactccagc ctg
331360DNAArtificial sequenceSynthetic Polynucleotide 13atcgggtacc
ccaccatgga ttacaaggat gacgatgaca aggaagatcc gcgtagaagg
601433DNAArtificial sequenceSynthetic Polynucleotide 14atcggcggcc
gctcaaagct tgtcaaaaat tgg 331560DNAArtificial sequenceSynthetic
Polynucleotide 15atcgggtacc ccaccatgga ttacaaggat gacgatgaca
agcagccttg gcacggaaag 601637DNAArtificial sequenceSynthetic
Polynucleotide 16atcggcggcc gctcaaaatt catcaaaaac tggaaac
371737DNAArtificial sequenceSynthetic Polynucleotide 17gcatggatcc
gccaccatga cttggaactt tcaccag 371835DNAArtificial sequenceSynthetic
Polynucleotide 18gcatgcggcc gctcagccac ttaccattgt gctgc
351936DNAArtificial sequenceSynthetic Polynucleotide 19gcatctcgag
ccaccatgac ttggaacttt caccag 362030DNAArtificial sequenceSynthetic
Polynucleotide 20taataaggag atataccatg ggcagcagcc
302133DNAArtificial sequenceSynthetic Polynucleotide 21gaattcgtcg
acaccaatct gttctctgtg agc 332233DNAArtificial sequenceSynthetic
Polynucleotide 22gatgtcgaca tggaagatcc gcgtagaagg acg
332335DNAArtificial sequenceSynthetic Polynucleotide 23atcctcgagt
caaagcttgt caaaaattgg aaacc 35
* * * * *