U.S. patent application number 16/258289 was filed with the patent office on 2019-08-29 for anti-alpha-v integrin antibody for the treatment of prostate cancer.
The applicant listed for this patent is Merck Patent GmbH. Invention is credited to Klaus Brischwein, Ulrike Dau, Benoit Destenaves, Karin Groll, Axel Hoffmann, Heinrich Lannert, Otmar Pfaff, Frederic Christian Pipp, Sabine Raab, Juergen Reindl, Michael Zuehlsdorf.
Application Number | 20190263913 16/258289 |
Document ID | / |
Family ID | 45569571 |
Filed Date | 2019-08-29 |
United States Patent
Application |
20190263913 |
Kind Code |
A1 |
Hoffmann; Axel ; et
al. |
August 29, 2019 |
ANTI-ALPHA-V INTEGRIN ANTIBODY FOR THE TREATMENT OF PROSTATE
CANCER
Abstract
The invention is directed to the treatment of prostate cancer by
means of antibodies. Above all, the invention relates to the
administration of an anti-alpha-v integrin (receptor) antibody to
patients suffering from prostate cancer, especially
castration-resistant prostate cancer (CRPC), optionally accompanied
by lymph node and bone tissue metastases (mCRPC). In particular,
the invention relates to the therapy of said patients by means of
the anti-angiogenic antibody DI17E6 and structural mutants
thereof.
Inventors: |
Hoffmann; Axel; (Wehrheim,
DE) ; Lannert; Heinrich; (Schwetzingen, DE) ;
Brischwein; Klaus; (Muenchen, DE) ; Pipp; Frederic
Christian; (Gruendau, DE) ; Reindl; Juergen;
(Rossdorf, DE) ; Groll; Karin; (Muehltal, DE)
; Zuehlsdorf; Michael; (Darmstadt, DE) ; Pfaff;
Otmar; (Frankfurt Am Main, DE) ; Raab; Sabine;
(Rosbach, DE) ; Dau; Ulrike; (Darmstadt, DE)
; Destenaves; Benoit; (Peron, FR) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Merck Patent GmbH |
Darmstadt |
|
DE |
|
|
Family ID: |
45569571 |
Appl. No.: |
16/258289 |
Filed: |
January 25, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15401971 |
Jan 9, 2017 |
|
|
|
16258289 |
|
|
|
|
13984669 |
Oct 28, 2013 |
9555110 |
|
|
PCT/EP2012/000548 |
Feb 7, 2012 |
|
|
|
15401971 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 39/395 20130101;
C07K 2317/567 20130101; A61P 13/08 20180101; C07K 16/2848 20130101;
C07K 2317/76 20130101; C07K 2317/90 20130101; C07K 16/2839
20130101; A61K 39/39558 20130101; C07K 2317/24 20130101; A61P 43/00
20180101; A61P 35/00 20180101; A61K 45/06 20130101; A61P 39/00
20180101; C07K 16/3069 20130101; A61K 2039/545 20130101; A61P 5/28
20180101; A61K 2039/505 20130101; A61P 35/04 20180101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 39/395 20060101 A61K039/395; C07K 16/30 20060101
C07K016/30; A61K 45/06 20060101 A61K045/06 |
Foreign Application Data
Date |
Code |
Application Number |
Feb 11, 2011 |
EP |
11001135.0 |
Claims
1. A method of treating a patient suffering from castrate-resistant
prostate cancer (CRPC), the method comprising administering to the
patient an anti-alpha integrin antibody in an amount of 500 mg or
higher per two weeks for 4-8 months, or 1000 mg or higher per month
for 4-8 months, wherein the antibody comprises: a light chain
comprising a variable region having an amino acid sequence having
at least 95% sequence identity with the variable region amino acid
sequence of SEQ ID NO:1, and a constant region having an amino acid
sequence having at least 98% sequence identity with the constant
region amino acid sequence of SEQ ID NO:1, and a heavy chain
comprising a variable region having an amino acid sequence having
at least 95% sequence identity with the variable region amino acid
sequence of SEQ ID NO:2, and a constant region having an amino acid
sequence having at least 98% sequence identity with the constant
region amino acid sequence of SEQ ID NO:2.
2. The method of claim 1, wherein the cancer is metastasizing.
3. The method of claim 2, wherein the cancer is associated with
lymph node metastases.
4. The method of claim 2, wherein the cancer is associated with
bone metastases.
5. (canceled)
6. The method of claim 1, wherein the patient experiences a
reduction in a prostate specific antigen (PSA) value within 4-6
months of starting treatment.
7. The method of claim 1, wherein the number of circulating tumor
cells (CTC) declines during antibody treatment.
8. The method of claim 1, wherein the patient's prostate was
removed before treatment.
9. The method of claim 1, wherein the patient was pretreated with
chemotherapeutics and/or radiation.
10-11. (canceled)
12. The method of claim 1, wherein the antibody is administered as
monotherapy.
13. (canceled)
14. The method of claim 1, wherein the antibody comprises a
modification to one or more amino acids within the heavy chain
framework regions corresponding to A9, E13, M20, K38, R40, A72,
S76, Q82, G85, T87, S91, or S113 or SEQ ID NO:2.
15-16. (canceled)
17. The method of claim 1, wherein the patient's CRPC is
progressive after chemotherapy.
18. The method of claim 1, wherein the patient is treated after
prostatectomy or other prostate cancer related surgery or
radiotherapy.
19. The method of claim 1, wherein the method comprises a
sequential or simultaneous administration with an hormonal
agent.
20. The method of claim 1, wherein the method comprises sequential
or simultaneous administration with a cytostatic or cytotoxic agent
selected from the group consisting of a chemotherapeutic agent,
radiation, a tyrosine kinase inhibitor, and an angiogenesis
inhibitor.
21. The method of claim 20, wherein said tyrosine kinase inhibitor
is an anti-ErbB antibody selected from the group consisting of an
anti-EGFR antibody, an anti-Her2 antibody, and an anti-Her3
antibody, and said angiogenesis inhibitor is an alpha-v integrin
inhibitor.
22-27. (canceled)
28. The method of claim 1, wherein the antibody comprises a light
chain comprising the amino acid sequence of SEQ ID NO:1 and a heavy
chain comprising the amino acid sequence of SEQ ID NO:2, wherein
the antibody is administered to said patient in an amount of
1000-2000 mg per month.
29. The method of claim 1, wherein the antibody is administered to
said patient in an amount of 500-1000 mg per two weeks or 1000-2000
mg per month.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 15/401,971, filed Jan. 9, 2017, which is a
continuation of U.S. patent application Ser. No. 13/984,669, filed
Oct. 28, 2013, now U.S. Pat. No. 9,555,110, which is a U.S.
national phase application under 35 U.S.C. .sctn. 371 of
International Patent Application No. PCT/EP2012/000548, filed Feb.
7, 2012, which claims priority to and the benefit of European
Patent Application No. 11001135.0, filed Feb. 11, 2011, the
contents of each of which are incorporated by reference herein in
their entirety.
FIELD OF THE INVENTION
[0002] The invention is directed to the treatment of prostate
cancer by means of antibodies. Above all, the invention relates to
the administration of an anti-alpha-v integrin (receptor) antibody
to patients suffering from prostate cancer, especially
castration-resistant prostate cancer (CRPC) without or after
chemotherapy, optionally accompanied by lymph node and bone tissue
metastases (mCRPC). In particular, the invention relates to the
therapy of said patients by means of the anti-angiogenic antibody
DI17E6 and structural mutants thereof.
BACKGROUND OF THE INVENTION
[0003] Prostate cancer is the most commonly occurring cancer aside
skin cancer in the US, and is the second most common cause of male
cancer deaths.
[0004] Prostate cancer is classified in four stages: Stage I
prostate cancer is found in the prostate only and cannot be felt
during a digital rectal exam nor is it visible by imaging. In stage
II prostate cancer, the tumor has grown inside the prostate but has
not extended beyond it, whereas in stage III, the cancer has spread
outside the prostate, but to a minimal extent only. Often, prostate
cancer in stage III will have spread only to nearby tissues, such
as the seminal vesicles. Finally, in stage IV, the cancer has
spread outside the prostate to other tissues, such as the lymph
nodes, bones, liver, and/or lungs or brain.
[0005] The spectrum of prostate cancers that are progressing
despite castrate levels of testosterone includes tumors that have
shown varying degrees and durations of response to primary hormone
treatment, and clinical manifestations that range from a rising
prostate-specific antigen (PSA) alone, a rising PSA with osseous
and/or soft-tissue spread, or a predominantly visceral disease
pattern.
[0006] Currently approved treatment of prostate cancer includes
surgical castration, chemical castration, or a combination of
surgical and chemical castration. Removal of the testes, the
primary testosterone producing organ, reduces the levels of
circulating androgens, to less than 5% of normal levels. This
reduction in androgen levels inhibits prostate tumor growth.
Although the anti-tumor effects of surgical castration are direct,
the anti-tumor effects can be temporary. Surgical castration often
leads to clonal selection of androgen-independent prostate tumor
cells. This results in re-growth of the prostate tumor in a form
that proliferates without testosterone or DHT Stimulation. Chemical
castration (also called medical castration) is often substituted
for surgical castration, as an initial treatment. Despite its high
prevalence, treatment options for men having prostate cancer remain
relatively limited and typically depend on the stage of the
cancer.
[0007] Treatment options include surgical treatments such as
radical prostatectomy, in which the prostate is completely removed
and radiation, applied through an external beam that directs the
dose to the prostate from outside the body or via low-dose
radioactive seeds that are implanted within the prostate to kill
cancer cells locally. Anti-androgen hormone therapy also is used in
the treatment of prostate cancer, either alone or in conjunction
with surgery or radiation. Hormone therapy typically aims at
blocking the pituitary from producing hormones that stimulate
testosterone production by use of castration or administration of
hormone analogs and requires that patients have injections of these
hormone analogs for protracted periods. Finally, chemotherapeutic
approaches have been used to treat advanced prostate cancer,
usually as a last resort when other approaches have failed. Since a
couple of years, the combination of docetaxel and prednisone was
established as the new standard of care for patients who have
progressed on androgen deprivation.
[0008] None of the treatments described above are curative and
prostate cancer being androgen dependent at first, often will
progress despite surgical and hormonal-based therapies, and become
resistant over time, leading to a cancer type which is called
"hormone refractory cancer" or "castration resistant cancer"
(CRPC).
[0009] Clinical disease manifestations of CRPC are commonly related
to bone metastases and may include pain, pathologic fractures, and
spinal cord compression, with local recurrences that may be
associated with pelvic discomfort, renal dysfunction due to
ureteral compression, bladder outlet obstruction, and sexual
dysfunction. Further, while bone cancer is the predominant result
of CRPC, patients may develop soft-tissue metastases (lymph
node(s)) and visceral metastasis in liver, lung, brain, and other
organs. Patients with CRPC are minimally responsive to chemotherapy
and the majority of patients die due to progressive prostate cancer
within 20 months of initiating treatment. Bisphosphonates are
commonly used in patients with castrate-resistant prostate cancer
who have bone metastases.
[0010] It has been shown that prostate tumors remain dormant and
clinically undetectable until they begin to secrete angiogenic
factors and down-regulate the expression of angiogenic inhibitors.
In general, it can be stated that angiogenesis is critical to the
genesis of prostate tumors. Therefore, it was not completely
surprising that anti-angiogenic agents inhibit prostate cancer cell
growth.
[0011] In prostate cancer, tumor cells express an abnormal integrin
repertoire and are surrounded by a markedly aberrant extracellular
matrix (ECM). These changes have profound consequences, given the
ability of each integrin to regulate specific cell functions.
Expression of .beta.3 and .beta.1 subunits activates specific
signaling pathways and support distinct cancer cell functions.
.beta.3 is uniquely required in cancer cells for increasing cdc2
levels as well as cdc2 kinase activity. These effects are specific
for .beta.3 and are not observed for .beta.6. Up-regulation of
.beta.3 and .beta.6 integrin variants has been described. Zheng et
al. (Cancer Research 1999; 59, 1655-1664) used human prostate
cancer cells isolated from sixteen surgical specimens, to show that
these cells express .alpha.v.beta.3, whereas normal prostate
epithelial cells do not. Similarly, .alpha.v.beta.6 was found to be
expressed in adenocarcinoma (Li et al.; Molecular and Cellular
Biology 2007; 27, 4444).
[0012] The use of integrin inhibitors is likely to affect both
cancer cell survival and angiogenesis since integrins are expressed
by tumor cells as well as by endothelial cells. Although it is hard
to discriminate between an effect on tumor growth and an effect on
angiogenesis, a maximal response of these inhibitors can be
predicted when the targeted integrin is expressed by both tumor and
endothelial cells.
[0013] Bone is the most frequent metastatic site for prostate
cancer. Bisanz et al. (Molecular Therapy 2005; 12, 634-643)
illustrate a positive role for alpha-v integrins on prostate tumor
survival in the bone. Analysis of human prostate cancer bone
xenografts shows that intratumoral administration of liposome
encapsulated human alpha-v siRNAs significantly inhibits the growth
of PC3 tumors in bone and increases apoptosis of prostate tumor
cells. Further studies (McCabe et al., Oncogene 2007; 26,
6238-6243) demonstrate that .alpha.v.beta.3 integrin activation on
tumor cells is essential for the recognition of key bone specific
matrix proteins. These data suggest that the .alpha.v.beta.3
integrin modulates prostate cancer growth in distant
metastasis.
[0014] Since integrins mediate the interactions between tumor cells
and bone microenvironment and facilitate growth in bone, a
potential application of the use of integrin inhibitors is to
prevent prostate cancer bone lesions. These lesions are
osteoblastic and/or osteolytic and are frequently detected in
prostate cancer patients (over 80% of prostate cancer patients have
established bone metastasis at autopsy).
[0015] A recent study has shown that the .alpha.v.beta.3 integrin
promotes bone gain mediated by prostate cancer cells that
metastasize to the bone and point to .alpha.v.beta.3 as a potential
therapeutic target to block prostate cancer osteoblastic lesions.
Immunohistochemical analysis has demonstrated the presence of
.alpha.v integrin in a large proportion of human prostate cancer
tissues samples.
[0016] These and other results suggest that anti-integrin agents
may have both direct and indirect antitumor activity. But there are
only few clinical trials reporting that peptide or non-peptide
integrin inhibitors are effective agents in prostate cancer
therapy.
[0017] Therefore, there is a need to provide a potent anti-integrin
agent for use in the therapy of prostate cancer, especially
castration-resistant prostate cancer developing bone
metastases.
SUMMARY OF THE INVENTION
[0018] It has been found by the inventors that the known monoclonal
anti-alpha v antibody DI-17E6 (designated herein also as EMR62242
or EMD 525797) is highly effective in (i) a monotherapy based
clinical setting and (ii) in a combinatorial clinical setting
together with hormonal agents and/or chemotherapeutic agents and/or
tyrosine kinase inhibitors or other angiogenesis inhibitors in the
treatment of prostate cancer.
[0019] In a first aspect of the invention, it was shown in clinical
trials that the known specifically engineered hybrid monoclonal
anti-alpha-v antibody DI17E6 is well tolerated in prostate tumor
patients without significant side effects at doses of at least 500
mg mAb each two weeks administered by infusion during a treatment
period of at least four months (FIG. 3, Table 3).
[0020] In a second aspect of the invention it was shown, when
administering DI17E6 with doses of at least 500 mg each two weeks
is effective in the treatment of prostate cancer, preferably
castrate-resistant prostate cancer (CRPC). As a result, the number
of prostate derived circulating tumor cells (CTC) in the blood of
these patients can be significantly reduced within the treatment
period, above all if this number was originally (at the beginning
of the treatment) very high (FIG. 1).
[0021] In a third aspect of the invention it was shown that the
value of prostate specific antigen (PSA) can be significantly
reduced in CRPC patients. The effect is dependent on the duration
of the treatment and the disease status of the patient. In general
after five or more months of treatment a PSA value can be obtained,
which corresponds in less progressive cases to PSA values of
healthy males, in other more severe cases, where the PSA value was
dramatically high at the beginning of the antibody treatment, the
PSA value after treatment can be reduced more than 10-fold (FIGS.
4, 5)
[0022] In a fourth aspect of the invention it could be demonstrated
that by the administration of DI17E6 in a dose of at least 500 mg
each two weeks the metastatic affection of bone and lymph nodes can
be significantly reduced.
[0023] In a further aspect of the invention, it could be shown that
DI17E6 reveals a dose-dependent response in prostate cancer
patients, preferably castrate-resistant prostate cancer (CRPC)
patients, with increasing efficacy at higher doses, wherein a dose
of about 500 mg and higher each two weeks is effective, whereas a
dose of about 250 mg DI17E6 or less is not effective in prostate
cancer, preferably CRPC patients (FIG. 3, 5).
[0024] It should be noted that DI17E6 is effective preferably in a
monotherapy setting, wherein no further cytotoxic drug (such as
cabazitaxel, docetaxel, doxorubicin, irinotecan etc.) was
administered. This is the first time, where an engineered
monoclonal antibody is effective in a tumor therapeutic approach
without the necessity of the administration of a chemotherapeutic
agent.
[0025] It should be further noted that according to the first
results in said clinical trials DI17E6 seems to be the more
effective the more progressive the disease is. Thus, DI17E6 elicits
a stronger effect on PSA values, circulating tumor cells and
metastases in patients after ineffective hormone- and/or
chemotherapy and even after surgery impacts such as prostatectomy
as compared to patients in a less progressive disease state without
such surgery or even without pretreatment with chemotherapeutics
and/or hormones. In summary, DI17E6 is very promising in the
treatment of CRPC above all in patients with a progressive or
end-stage disease status after chemotherapy treatment.
[0026] A further result is that DI17E6 is able to induce tumor
shrinkage and tumor lesion (FIG. 6), especially in solid prostate
tumors or tumor metastases deriving thereof, which are resistant to
chemotherapy and/or radiotherapy.
[0027] Furthermore, there is evidence that treatment with DI17E6
(in monotherapy) reduces pain, which usually occurs in prostate
cancer. Thus, the drug presents benefits in terms of pain and pain
interference score (FIGS. 4B, 5B). It could be observed that the
decrease of pain during treatment is correlated with the decreasing
PSA level in said patients.
[0028] DI17E6 is well tolerated without premedication, and does not
show clinically relevant does-related changes in assessed safety
parameters, such as drug-related treatment emergent adverse events
(TEAE) (Table 3).
[0029] In a further aspect of the invention, it could be shown that
there is a strong correlation between bone metabolism biomarkers,
including STC-1, ADAMTS-1, M30, M65, IL6 and IL8, and dose levels
(FIG. 7). At high doses >1500 mg a significant drop in
osteopontin can be observed in the majority of CROP patients.
[0030] The pharmacokinetic profile of DI17E6 is dependent on dose
after single and multiple doses with a half-life of approximately
250 h at the 1500 mg dose level.
[0031] The safety results of the phase 1, open-label study show
that repeated infusions of single-agent DI17E6 (EMD 525797) at each
of four dose levels are generally well tolerated and appear to be
safe in patients with mCRPC and progressive disease preferably
following prior chemotherapy. There are no dose-limiting toxicities
(DLT) and no infusion reactions. With regard to dose, no trends in
the distribution of TEAEs, NCI-CTCAE (version 3.0) grade or drug
relationship are observed. In addition, there is no evidence of
accumulation of any specific event within individual cohorts.
Eleven patients experienced TEAEs that are considered to be
drug-related. In this regard, skin symptoms such as pruritus,
erythema and rash, which are reported in a total of four patients,
are predictable adverse events associated with DI17E6 (EMD 525797)
given that integrins are responsible for the maintenance of the
epithelial phenotype. Symptoms of mucosal inflammation and swollen
tongue may also be characteristic of the mechanism of action of EMD
525797, but together with fatigue, might also be signs of the
underlying disease. The hematologic and biochemic toxicity shifts
observed in eight patients could also be explained by underlying
disease, as well as concomitant medications.
[0032] PK assessment after single and multiple doses of study drug
suggest that DI17E6 (EMD 525797) behaved in accordance with a
receptor-mediated clearance model as described for other antibodies
targeting membrane-associated receptors. Consistent with the
findings of an earlier study in healthy volunteers, PKs of DI17E6
(EMD 525797) in mCRPC patients are dose-dependent with clearance
determined predominantly by the availability of unbound receptors.
At the doses used in the present study, it can be assumed that at
doses of 1000 mg or higher, almost all receptors are saturated and
have a minor contribution to drug clearance. Immunologically
triggered antibodies directed against DI17E6 can be detected in
some (16%) patients; however, no impact on PKs or safety could be
found.
[0033] In castrate-resistant prostate cancer patients with bone
metastases following prior chemotherapy, the median progression
free survival is expected to be 8 to 10 weeks. Antitumor activity
evaluations showed that DI17E6 (EMD 525797), as single-agent
therapy, achieved an objective partial tumor response in a single
patient in the 500 mg cohort. In 9 of 18 patients (50%) receiving
DI17E6 (EMD 525797) at a dose of 500 mg or higher, no radiographic
disease progression can be observed for 16 weeks or longer. In two
patients, long-term treatment with DI17E6 (EMD 525797) at a dose of
500 mg is associated with significant reductions in PSA levels and
clinical benefit in terms of pain interference. At least one
patient also showed primary tumor shrinkage and normalization of
target lymph node size. Thus, DI17E6 (EMD 525797) appears to show
single-agent activity in at least some patients with late-stage
mCRPC.
[0034] In conclusion, single-agent EMD 525797 given as single and
multiple doses is shown to be well tolerated in patients with mCRPC
with bone metastases and progressive disease following prior
chemotherapy with no spontaneous remissions. No safety concern can
be identified and there is preliminary evidence of clinical benefit
in numerous patients. Due to its target and safety profile, DI17E6
(EMD 525797) is a promising agent for combination therapy.
[0035] To sum up, the subject matter of this invention is directed
to the following: [0036] The use of anti-av integrin antibody
DI17E6 or a biologically active variant, or modification thereof,
for the treatment of patients, or for the manufacture of a
medicament for the treatment of patients, said patients suffering
from prostate cancer, preferably castrate-resistant prostate cancer
(CRPC), preferably wherein said CRPC is accompanied by high levels
of serum PSA in a range of 25 10.000 ng/ml, more specifically in
levels of more than 25 ng/ml, or more than 50 ng/ml, or more than
100 ng/ml, or more than 250 mg/ml, or more than 500 ng/ml, or more
than 1000 ng/ml, or more than 2500 ng/ml or more than 5000 ng/ml,
or more than 7500 ng/ml. [0037] The respective use of DI17E6
antibody, wherein the cancer is metastasizing, preferably into bone
and/or lymph node tissue. [0038] The respective use of DI17E6
antibody, wherein the prostate-specific antigen (PSA) value is
declined more than 5-fold, 10-fold, 20-fold, preferably 10-fold
during treatment compared to the value before starting antibody
treatment. [0039] The respective use of DI17E6 antibody, wherein
the reduction of the PSA value was achieved within 4-8 months of
treatment, preferably after 4 months, more preferably after 6
months. [0040] The respective use of DI17E6 antibody, wherein the
number of the circulating tumor cells (CTC) is declined during
antibody treatment. [0041] The respective use of DI17E6 antibody in
a CRPC patient whose prostate has been removed, or alternatively,
has been treated by radiation. [0042] The respective use of DI17E6
antibody for reducing pain which occurs in prostate cancer,
preferably in CRPC preferably accompanied by bone metastasis.
[0043] The respective use of DI17E6 antibody, wherein the patient
was pretreated with chemotherapeutics and/or hormonal agents,
preferably when the cancer is progressive after said pretreatment
with the chemotherapeutic and/or hormonal agent. [0044] The
respective use of DI17E6 antibody, wherein the effective dose of
the antibody is 500 mg-1500 mg per two weeks, preferably 500-1000
mg per two weeks, or 1000-2000 mg per month. [0045] The respective
use of DI17E6 antibody, wherein the effective dose of 500-1000 mg
is administered by a single infusion. [0046] The respective use of
DI17E6 antibody, wherein the antibody is administered in a
monotherapy setting without additional chemotherapeutic agents.
[0047] The respective use of DI17E6 antibody, wherein the antibody
is administered in a combinatory setting with a
cytotoxic/cytostatic or an hormonal agent sequentially or
simultaneously. [0048] The respective use of DI17E6 antibody,
wherein in said combinatory setting the cytostatic or cytotoxic
agent is selected from the group consisting of: a chemotherapeutic
agent, radiation, a tyrosine kinase inhibitor, and an angiogenesis
inhibitor; said tyrosine kinase inhibitor being an anti-ErbB
antibody selected from the group consisting of an anti-EGFR
antibody, an anti-Her2 antibody, and an anti-Her3 antibody, and
said angiogenesis inhibitor being an alpha-v integrin inhibitor,
preferably an RGD peptide, such as cilengitide. [0049] The
respective use of DI17E6 antibody, wherein the biologically active
variant or modification comprises the CDR regions and heavy and
light chain variable regions, which are 80%-95% identical in amino
acid sequence compared to the variable regions of DI17E6. [0050]
The respective use of DI17E6 antibody, wherein the biological
active variant or modification comprises a constant region, which
is at least 80%-98% identical with the amino acid sequence compared
to the constant region of DI17E6. [0051] The respective use of
DI17E6 antibody, comprising one or more modifications within the
heavy chain framework regions
TABLE-US-00001 [0051] FR1: (SEQ ID No. 16)
QVQLQQSGAELAEPGASVKMSCKASGYTFS FR2: (SEQ ID No. 17) WVKQRPGQGLEWIG
FR3: (SEQ ID No. 18) KATMTADTSSSTAYMQLSGLTSEDSAVYYCAS FR4: (SEQ ID
No. 19) WGQGTSVTVSS,
wherein one or more of the bold and underlined positions are
mutated and are different compared to the original respective
sequence. [0052] The respective use of a modified DI17E6 antibody
comprising a human IgG1 constant region instead of human IgG2, or a
human IgG2 hinge region instead of the human IgG1 hinge. [0053] A
method of treating castrate-resistant prostate cancer (CRPC) in a
patient, preferably accompanied by bone metastases, comprising
administering the anti-av integrin antibody DI17E6 or a
biologically active variant, or modification thereof preferably in
a dose of 500-1000 mg each two weeks preferably for a period of at
least three months. [0054] A method of declining the pathologically
increased PSA serum level of a patient suffering from prostate
cancer, preferably castrate-resistant prostate cancer (CRPC) more
than 5-fold, preferably more than 10-fold by administering to said
patient the hybrid monoclonal antibody DI17 in an effective dose of
at least 500 mg each two weeks, or at least 1000 mg per month,
wherein the pathological increased PSA serum level before staring
antibody treatment is at least 25 ng/ml, preferably at least 50
ng/ml. [0055] A respective method, wherein the cancer is
metastasizing in bone and/or lymph node tissue.
BRIEF DESCRIPTION OF THE FIGURES
[0056] FIG. 1 shows a table summarizing the results of the
measuring of circulating tumor cells (CTC) in six selected CRPC
patients of dose level (1) 250 mg, (2) 500 mg, and (3) 1000 mg.
X-axis indicates days of treatment. Y-axis indicates circulating
tumor cells (CTC).
[0057] FIG. 2 shows dose-depend pharmacokinetic profile of DI17E6
(EMD 525797) for 250 mg, 500 mg, 1000 mg and 1500 mg Ab
administered per each 4 weeks. X-axis indicates time after first
infusion (h); Y-axis indicates serum concentration (.mu.g/ml).
[0058] FIG. 3 shows the treatment duration of a cohort of CRPC
patients after the treatment with DI17E6; X-axis: number of weeks
treatment; Y-axis: Dose levels (dose level 1: 250 mg, dose level 2:
500 mg, dose level 3: 1000 mg, dose level 4: 1500 mg)
[0059] FIG. 4A shows the change of the PSA level (ng/ml serum) in a
specific CRPC patient (2001) without prostatectomy showing bone
metastases during the treatment with DI17E6 (treatment start 24,
Aug. 2009). (A). X-axis indicates the duration of treatment (days);
Y-axis indicates PSA level (ng/ml). FIG. 4B shows the average pain
interference score as defined below of the same patient of FIG. 4A.
X-axis indicates the duration of treatment (days); Y-axis indicates
average pain interference score.
[0060] FIG. 5A shows the PSA course of a second CRPC patient with
progressive disease after chemotherapy showing bone metastases and
prostatectomy during the treatment with DI17E6 (treatment start 1,
Sep. 2009). (A). X-axis indicates the duration of treatment (days);
Y-axis indicates PSA level (ng/ml). FIG. 5B shows the average pain
interference score as defined below of the same patient of FIG. 5A.
X-axis indicates the duration of treatment (days); Y-axis indicates
average pain interference score.
[0061] FIG. 6A-B show a CT scan of a patient from the 500 mg cohort
showing significant shrinkage of primary tumor lesions. FIG. 6A
shows before treatment with DI-17E6. FIG. 6B shows after the
17.sup.th treatment with DI-17E6 (after 4 months).
[0062] FIG. 7 shows the occurrence of bone markers/circulating bone
markers after the treatment with DI17E6. 1=dose level 1; 2=dose
level 2.
DETAILED DESCRIPTION OF THE INVENTION
[0063] DI17E6 is an engineered specifically tailored IgG2 hybrid
monoclonal antibody directed to alpha-v integrin (receptor). Cancer
therapy by means of this antibody reduces side effects associated
with this type of therapy, above all immune reactions, thereby
reducing immunogenicity. The antibody is described in detail in WO
2009/010290.
[0064] Its hypervariable regions (CDRs) derive from murine mAb 17E6
(EMD 73034). This parent mouse IgG1 antibody is described, for
example by Mitjans et al. (1995; J. Cell Sci. 108, 2825) and
patents U.S. Pat. No. 5,985,278 and EP 719 859. Mouse mAb 17E6 is
produced by hybridoma cell line 272-17E6 and deposited under
accession number DSM ACC2160.
[0065] Its light chain domains derive from humanized monoclaonal
anti-EGFR antibody 425 (matuzumab). This antibody is described in
detail for example in EP 0 531 47261, and derives from its murine
counterpart 425 (mouse MAb 425, ATCC H.beta.9629), The antibody was
raised against the human A431 carcinoma cell line and found to bind
to a polypeptide epitope on the external domain of the human
epidermal growth factor receptor (EGFR). Matuzumab has shown in
clinical trials high efficacy.
[0066] Generally DI17E6 as used according to the invention
comprises: [0067] (i) a CDR light and a heavy chain region deriving
from mouse monoclonal anti-.alpha.v integrin antibody 17E6 [0068]
(ii) a light chain framework region which is taken from humanized
monoclonal anti-EGFR antibody 425, [0069] (iii) a heavy chain
framework region deriving from mouse monoclonal anti-.alpha.v
integrin antibody 17E6, optionally comprising one or more mutations
of amino acids at specific positions, and [0070] (iv) a heavy chain
constant region deriving from human IgG2 and a human constant kappa
light chain region, wherein in said IgG2 domain the IgG2 hinge
region was replaced by the human IgG1 hinge domain, and; [0071]
wherein optionally one or more mutations within the IgG2 has been
carried out.
[0072] Specifically, DI17E6 (designated as
"DI-17E6.gamma.2h(N297Q)" or "EMD 525797") as used for the
treatment as claimed and in the clinical trials as described above
and below, has the following amino acid sequence:
TABLE-US-00002 (i) variable and constant light chain sequences (SEQ
ID No. 1): DIQMTQSPSSLSASVGDRVTITCRASQDISNYLAWYQQKPGKAPKLLIYY
TSKIHSGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQGNTFPYTFGQ
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC
and (ii) variable and constant heavy chain sequences (SEQ ID No.
2): QVQLQQSGGELAKPGASVKVSCKASGYTFSSFWMHWVRQAPGQGLEWIGY
INPRSGYTEYNEIFRDKATMTTDTSTSTAYMELSSLRSEDTAVYYCASFL
GRGAMDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYT
CNVDHKPSNTKVDKTVEPKSSDKTHTCPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQAQSTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYT
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK,
wherein the underlined sequences represent the variable regions
with the CDRs (in bold, identical with the parent mouse antibody).
The modified IgG1 hinge region is represented by EPKSSDKTHTCPPCP
(SEQ ID No. 3), and AQ is a substitution within the IgG2
domain.
[0073] However, as it was shown in WO 2009/010290, also variants of
DI17E6 can be used according to the teaching of this invention.
Thus, DI17E6 variants comprising one or more modifications within
the heavy chain framework regions
TABLE-US-00003 FR1: (SEQ ID No. ) QVQLQQSGAELAEPGASVKMSCKASGYTFS
FR2: (SEQ ID No. 17) WVKQRPGQGLEWIG FR3: (SEQ ID No. )
KATMTADTSSSTAYMQLSGLTSEDSAVYYCAS FR4: (SEQ ID No. 19)
WGQGTSVTVSS,
wherein one or more of the bold and underlined positions are
mutated, can be used in the treatment of prostate cancer patients
as described. In more detail, the following position heavy chain
framework region is mutated at one, more or all of the following
positions can be mutated: A9, E13, M20, K38, R40, A72, S76, Q82,
G85, T87, S91 and S113. These variants show the same or very
similar biological activity and efficacy as compared to DI17E6
defined by its sequences above.
[0074] In general, the invention as described includes also
modifications and variants of the DI17E6 antibody that are
functionally and/or pharmaceutically identical or similar to
unmodified DI17E6, and wherein the CDR regions and heavy and light
chain variable regions are at least 80%, or at least 85%, or at
least 90%, or at least 95% identical in their amino acid sequence
compared to the respective variable regions of DI17E6. In addition,
the invention also includes modifications and variants of the
DI17E6 antibody that are functionally and/or pharmaceutically
identical or similar to unmodified DI17E6, and wherein the constant
regions are at least 80%, or at least 85%, or at least 90%, or at
least 98% identical in their amino acid sequence compared to the
respective constant regions of DI17E6. Changes is the constant
regions of the IgG chains of the antibody may improve specific
properties like immunogenicity, ADCC, and so on.
[0075] In a further aspect, the DI17E6 antibody as used according
to the invention can be fused to a cytotoxic agent, preferably a
cytokine, such as IL2, IL8, IFNb, IFNa, TNFa, GM-CSF, G-CSF, or as
specified below. The cytokine can be fuses via its N-terminal to
the C-terminal of the antibody heavy chains, or via its C-terminal
to the N-terminal of the heavy and light chain of the antibody.
[0076] According to the invention, DI17E6 is highly effective in
patients suffering from prostate cancer, above all in patients
whose tumor is progressive after chemotherapy and/or hormonal
therapy and/or prostate surgery such as prostatectomy.
[0077] In order to strengthen or prolong efficacy of DI17E6 or its
modifications described a combination therapy together with
cytotoxic or cytostatic agents is applicable. The cytostatic or
cytotoxic agent can be administered in sequential steps with the
antibody or simultaneously in doses that are quite common and
convenient in the clinical treatment of cancer. Preferred
cytotoxic/cytostatic agents according to the invention are
anti-angiogenic agents as described below in more detail, anti-EGFR
or -Her3 agents including respective antibodies, such as
Herceptin.RTM. (trastuzumab), Erbitux.RTM. (cetuximab) or
panitumumab. In a preferred embodiment the combination therapy of
DI17E6 together with cetuximab is effective in prostate cancer,
especially in CRPC according to this invention.
[0078] For the same purpose DI17E6 can be administered together
(sequentially or simultaneously) with hormonal agents according to
known regimen.
[0079] The term "castrate-resistant" or "castration-resistant" us
used herein refers to a status in prostate cancer wherein the
disease is progressing with serum testosterone controlled below a
castrate level, which is usually <50 ng/100 ml. The term is
synonymously used with "hormone-resistant" or "hormone-refractory"
or "androgen-independent".
[0080] The term "pain interference (total) score" means a score for
pain as a result of the disease occurring during administration of
the effective drug. Pain interference is assessed using the Brief
Pain Inventory (BPI). BPI is used to evaluate pain interference
with the following: (a) general activity, (b) mood, (c) walking
ability, (d) normal work, (e) relations with other people, (f)
sleep, and (g) enjoyment of life. Total score for pain interference
is calculated as: (Mean score of non-missing
questions).times.(7/number of non-missing questions). If four or
more questions are missing, the pain interference total score is
set to missing.
[0081] The term "cytotoxic agent" as used herein refers to a
substance that inhibits or prevents the function of cells by
causing destruction of cells. The term is intended to include
radioactive isotopes, chemotherapeutic agents, and toxins such as
enzymatically active toxins of bacterial, fungal, plant or animal
origin, or fragments thereof. The term may include also members of
the cytokine family, preferably IFN.gamma. as well as
anti-neoplastic agents having also cytotoxic activity.
[0082] The term "cytostatic agent" as used herein refers to a
substance that inhibits or suppresses cellular growth and
multiplication without destroying cells.
[0083] The term "cytokine" is a generic term for proteins released
by one cell population which act on another cell as intercellular
mediators. Examples of such cytokines are lymphokines, monokines,
and traditional polypeptide hormones. Included among the cytokines
are growth hormone such as human growth hormone, N-methionyl human
growth hormone, and bovine growth hormone; parathyroid hormone;
thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein
hormones such as follicle stimulating hormone (FSH), thyroid
stimulating hormone (TSH), and luteinizing hormone (LH); hepatic
growth factor; fibroblast growth factor; prolactin; placental
lactogen; mouse gonadotropin-associated peptide; inhibin; activin;
vascular endothelial growth factor (VEGF); integrin; thrombopoietin
(TPO); nerve growth factors such as NGF.beta.; platelet-growth
factor; transforming growth factors (TGFs) such as TGF.alpha. and
TGF.beta.; erythropoietin (EPO); interferons such as IFN.alpha.,
IFN.beta., and IFN.gamma.; colony stimulating factors such as
M-CSF, GM-CSF and G-CSF; interleukins such as IL-1, IL-1a, IL-2,
IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; and
TNF.alpha. or TNF.beta.. Preferred cytokines according to the
invention are interferons and TNF.alpha..
[0084] An "anti-angiogenic agent" refers to a natural or synthetic
compound which blocks, or interferes with to some degree, the
development of blood vessels. The anti-angiogenic molecule may, for
instance, be a biological molecule that binds to and blocks an
angiogenic growth factor or growth factor receptor. The preferred
anti-angiogenic molecule herein binds to an receptor, preferably to
an integrin receptor or to VEGF receptor. The term includes
according to the invention also integrin (receptor) inhibitors.
[0085] The term "integrin inhibitors" or "integrin receptor
inhibitors" refers to a natural or synthetic molecule that blocks
and inhibit an integrin receptor. In some cases, the term includes
antagonists directed to the ligands of said integrin receptors
(such as for .alpha..sub.v.beta..sub.3: vitronectin, fibrin,
fibrinogen, von Willebrand's factor, thrombospondin, laminin; for
.alpha..sub.v.beta..sub.5: vitronectin; for
.alpha..sub.v.beta..sub.1:fibronectin and vitronectin; for
.alpha..sub.v.beta..sub.6: fibronectin). Antagonists directed to
the integrin receptors are preferred according to the invention.
Integrin (receptor) antagonists may be natural or synthetic
peptides, non-peptides, peptidomimetica, immunoglobulins, such as
antibodies or functional fragments thereof, or immunoconjugates
(fusion proteins). Preferred integrin inhibitors of the invention
are directed to receptor of .alpha..sub.v integrins (e.g.
.alpha..sub.v.beta..sub.3, .alpha..sub.v.beta..sub.5,
.alpha..sub.v.beta..sub.6 and sub-classes). Preferred integrin
inhibitors are .alpha..sub.v antagonists, and in particular
.alpha..sub.v.beta..sub.3 antagonists. Preferred .alpha..sub.v
antagonists according to the invention are RGD peptides,
peptidomimetic (non-peptide) antagonists and anti-integrin receptor
antibodies such as antibodies blocking .alpha..sub.v receptors.
Exemplary, non-immunological .alpha..sub.v.beta..sub.3 antagonists
are described in the teachings of U.S. Pat. Nos. 5,753,230 and
5,766,591. Preferred antagonists are linear and cyclic
RGD-containing peptides. Cyclic peptides are, as a rule, more
stable and elicit an enhanced serum half-life. The most preferred
integrin antagonist of the invention is, however,
cyclo-(Arg-Gly-Asp-DPhe-NMeVal) (EMD 121974, Cilengitide.RTM.,
Merck KgaA, Germany; EP 0770 622) which is efficacious in blocking
the integrin receptors .alpha..sub.v.beta..sub.3,
.alpha..sub.v.beta..sub.1, .alpha..sub.v.beta..sub.6,
.alpha..sub.v.beta..sub.8, .alpha..sub.IIb.beta..sub.3. A
combination therapy of DI17E6 together with Cilengitide in prostate
cancer and preferably CRPC patients is effective according to the
invention.
[0086] The term "chemotherapeutic agent" or "anti-neoplastic agent"
is regarded according to the understanding of this invention as a
member of the class of "cytotoxic agents", as specified above, and
includes chemical agents that exert anti-neoplastic effects, i.e.,
prevent the development, maturation, or spread of neoplastic cells,
directly on the tumor cell, and not indirectly through mechanisms
such as biological response modification. Suitable chemotherapeutic
agents according to the invention are preferably natural or
synthetic chemical compounds, but biological molecules, such as
proteins, polypeptides etc. are not expressively excluded. There
are large numbers of anti-neoplastic agents available in commercial
use, in clinical evaluation and in pre-clinical development, which
could be included in the present invention for treatment of
tumors/neoplasia by combination therapy with TNF.alpha. and the
anti-angiogenic agents as cited above. It should be pointed out
that the chemotherapeutic agents can be administered optionally
together with above-said antibody drug. Examples of
chemotherapeutic or agents include alkylating agents, for example,
nitrogen mustards, ethyleneimine compounds, alkyl sulphonates and
other compounds with an alkylating action such as nitrosoureas,
cisplatin and dacarbazine; antimetabolites, for example, folic
acid, purine or pyrimidine antagonists; mitotic inhibitors, for
example, vinca alkaloids and derivatives of podophyllotoxin;
cytotoxic antibiotics and camptothecin derivatives. Preferred
chemotherapeutic agents or chemotherapy include amifostine
(ethyol), cabazitaxel, cisplatin, dacarbazine (DTIC), dactinomycin,
docetaxel, mechlorethamine, streptozocin, cyclophosphamide,
carrnustine (BCNU), lomustine (CCNU), doxorubicin (adriamycin),
doxorubicin lipo (doxil), gemcitabine (gemzar), daunorubicin,
daunorubicin lipo (daunoxome), procarbazine, ketokonazole,
mitomycin, cytarabine, etoposide, methotrexate, 5-fluorouracil
(5-FU), vinblastine, vincristine, bleomycin, paclitaxel (taxol),
docetaxel (taxotere), aldesleukin, asparaginase, busulfan,
carboplatin, cladribine, camptothecin, CPT-11,
10-hydroxy-7-ethyl-camptothecin (SN38), dacarbazine, floxuridine,
fludarabine, hydroxyurea, ifosfamide, idarubicin, mesna, interferon
alpha, interferon beta, irinotecan, mitoxantrone, topotecan,
leuprolide, megestrol, melphalan, mercaptopurine, plicamycin,
mitotane, pegaspargase, pentostatin, pipobroman, plicamycin,
streptozocin, tamoxifen, teniposide, testolactone, thioguanine,
thiotepa, uracil mustard, vinorelbine, chlorambucil and
combinations thereof. Most preferred chemotherapeutic agents
according to the invention in combination with DI17E6 are
cabazitaxel, cisplatin, docetaxel, gemcitabine, doxorubicin,
paclitaxel (taxol), irinotecan and bleomycin.
[0087] DI17E6 is administered usually by intravenous injection,
however other administration forms convenient in the art for
antibody/protein drugs are applicable. All standard infusion
solutions and formulation are applicable, such as described in WO
2005/077414 or WO 2003/053465, including liposomal formulations. It
is, in addition, favorable to provide human serum albumin
nanoparticles loaded with DI17E6 and optionally (to increase
cytotoxicity) chemotherapeutic drugs (Biomaterials 2010, 8,
2388-98; Wagner et al.).
[0088] The following examples describe the invention in more
details but do not limit the invention and its scope as
claimed.
EXAMPLES
Example 1: Study Design
[0089] A Phase I trial was initiated to determine safety,
pharmacokinetics, and antitumor activity of CRPC patients treated
with DI17E6 including effects on prostate-specific antigen,
circulating tumor cells (CTC), and soft tissue and bone metastases.
All patients were suffering from a progressing disease after
chemotherapy. Patients were treated with iv-infusions of 250, 500,
1000 or 1500 mg DI17E6 given over 1 hour.
[0090] Eligible patients were aged 18 years or older and had
histologically or cytologically proven prostate cancer with
evidence of bone metastases after prior chemotherapy. Patients had
either undergone bilateral orchiectomy or were receiving continuous
androgen deprivation therapy with a gonadotropin releasing hormone
agonist or antagonist and had stopped anti-androgen therapy for at
least 4 weeks prior to enrolment. Patients were required to either
be on stable (i.e. at least 3 months) ongoing bisphosphonate
therapy or without any bisphosphonate therapy, with a total serum
testosterone level less than 50 ng/dL. All patients had evidence of
progressive disease, defined as at least two prostate-specific
antigen (PSA) values above the individual nadir level with a
minimum increase of 10% each determined at least two weeks prior to
screening; nodal or visceral progression was sufficient for
inclusion independent of PSA. In addition, patients had to have an
Eastern Cooperative Oncology Group (ECOG) score of 0 to 2, a life
expectancy of at least 3 months, and adequate hematologic, renal
and hepatic function. An institutional review board at each study
center approved the study protocol, and all patients provided
written informed consent.
[0091] In this phase 1, multicenter, open-label, dose-escalation
study, mCRPC patients were administered three intravenous infusions
of EMD 525797 at doses of 250, 500, 1000, or 1500 mg given over one
hour every two weeks prior to response assessment at the end of
week 6. Patients without evidence of progressive disease were
eligible to receive further fortnightly doses until disease
progression or unacceptable toxicity. Dose-limiting toxicities
(DLTs) were assessed during the first six weeks and patients were
followed for safety until four weeks after the last administration
of EMD 525797. Patients were recruited in four sequential dose
cohorts; after the last of six patients within a dose cohort had
reached the end of week 6, a Safety Monitoring Committee determined
subsequent dose escalation.
[0092] Twenty-six male patients aged between 43 and 80 years
(median age, 66 years) were enrolled and received at least one
intravenous infusion of EMD 525797, constituting the safety
population. All patients were of Caucasian origin. In general,
demographic characteristics were comparable across the four dose
cohorts (Table 1a), with a median time since first diagnosis of 5.2
years (range, 2-18 years) and a median time from diagnosis to first
metastatic disease of 0.1 years (range, 0-16 years). Two patients
withdrew before the end of the DLT period and were subsequently
replaced, with 24 patients receiving three doses of EMD 525797
through treatment Week 6.
TABLE-US-00004 TABLE 1a Patient baseline demographics (safety
population). DI17E6 (EMD 525797) dose cohort 250 mg 500 mg 1000 mg
1500 mg Total Characteristic (N = 8) (N = 6) (N = 6) (N = 6) (N =
26) Age, years, mean (range) 67 (57-78) 63 (47-77) 62 (43-79) 66
(52-80) 65 (43-80) Weight, kg, mean 82.2 85.8 80.5 93.7 85.3 BMI,
kg/m.sup.2, mean 26.2 28.1 26.0 28.9 27.2 TNM stage* at diagnosis,
n (%) II 1 (12.5) 3 (50.0) 0 1 (16.7) 5 (19.2) III 2 (25.0) 1
(16.7) 0 1 (16.7) 4 (15.4) IV 5 (62.5) 2 (33.3) 5 (83.3) 2 (33.3)
14 (53.8) Missing 0 0 1 (16.7) 2 (33.3) 3 (11.5) Previous
anticancer therapy, n (%) Hormonal therapy 8 (100) 6 (100) 5 (83.3)
6 (100) 25 (96.2) Immunotherapy 1 (12.5) 0 0 0 1 (3.8) Radiotherapy
7 (87.5) 3 (50.0) 3 (50.0) 4 (66.7) 17 (65.4) Chemotherapy 8 (100)
6 (100) 6 (100) 6 (100) 26 (100) Surgery 6 (75) 2 (33.3) 3 (50.0) 2
(33.3) 13 (50.0) BMI, body mass index; TNM, tumor, node,
metastasis.
[0093] In summary (Table 1b):
TABLE-US-00005 Objectives Safety, tolerability and PK after
multiple rising i.v. doses Determine changes in markers of bone
metabolism during treatment Investigate changes in efficacy
parameters within the whole dose range Identification of potential
pharmacodynamic markers Subject Subjects with prostate cancer with
evidence of bone population metastases after prior chemotherapy
with e.g. taxane or mitoxantrone Number of Per dose level n = 6
subjects Dose selection 250, 500, 1000, 1500 mg as 1 h i.v.
infusion Treatment 6 weeks (every second week) and 4 weeks follow
up. duration Option for further treatment if patient is non-
progressive. Dose Dose escalation will be based on the toxicity
escalation assessment (DLT) after 6 weeks.
[0094] The clinical results from this Phase I clinical trial is
being conducted at 3 sites in Germany and at one site in Belgium
and show single agent and biological activity in subjects with
castration-resistant prostate cancer with bone metastases and
progressive disease after chemotherapy.
Example 2: Treatment Duration
[0095] 24 patients (43-80 years) received 3 doses (weeks 1, 3 and
5) prior to response assessment at the end of week 6. Patients
without progressive disease could receive further doses every 2
weeks. Dose-limiting toxicities (DLTs) were assessed over the first
6 weeks and patients were followed for safety until 4 weeks after
the last administration of DI17E6.
[0096] Table 2 summarizes drug exposure per patient in each cohort.
Patients had a mean EMD 525797 exposure duration of 117.5 days
(median, 74.5 days; range, 14-534 days). Thirteen of 24 patients
had a longer exposure time than expected (>84 days), with two
patients in the 500 mg cohort remaining on treatment for 297 and
534 days, and one patient in the 1000 mg cohort receiving treatment
for 310 days. No DLTs were reported within the DLT period of 6
weeks. All patients experienced at least one TEAE and no
dose-dependent relationship in TEAEs was observed.
TABLE-US-00006 TABLE 2a DI17E6 exposure per patient in each of the
dose cohorts Pt 250 mg 500 mg 1000 mg 1500 mg 1 42 297 113 91 2 42
380+ 121 84+ 3 42 85 198+ 72+ 4 42 142 41 64+ 5 56 140 56 77+ 6 98
56 43 57+ 7 14* 8 28* + = ongoing treatment; *dropped out pts (1
and 2 infusions only)
[0097] The study protocol stated, that subjects will receive every
other week at least 3 doses (250, 500, 1000 mg/each 2 weeks) of
DI17E6 and that subjects without evidence of progressive disease
will receive further treatment doses every other week.
[0098] Treatment duration in all 4 cohorts (state: August 2010).
Cohort 2 with 500 mg/each 2 weeks, two patients (2001 and 2002) in
late stage (estimated mOS <12 months) are more than 10 months
with unexpected tumor response on treatment.
TABLE-US-00007 TABLE 2b This table shows the values of the
treatment duration (state: August 2010). Dose Patients/No. week
treatment Level 1001 1002 1003 1004 1005 1006 1008 1010 2001 2002
2003 2006 2007 2008 1 6.3 6.3 3.3 8.0 6.1 8.1 4.1 13.0 2 42.3 48.3
12.1 18.3 20.0 8.4 3 4 Dose Patients/No. week treatment Level 3001
3002 3003 3004 3005 3006 4002 4003 4004 4006 4008 4011 1 2 3 14.1
17.5 24.3 6.0 7.1 6.5 4 9.4 5.2 8.3 9.1 8.1 2.43 Dose level 1: 250
mg DI17E6; dose level 2: 500 mg DI17E6; dose level 3: 1000 mg
DI17E6, and dose level 4: 1500 mg DI17E6.
Example 3: Safety/Side Effects
[0099] Table 3 summarizes drug-related TEAEs. Eleven patients
(42.3%) experienced drug-related TEAEs, which were most commonly
reported in the system organ class "Skin and subcutaneous tissue
disorders" (4 patients total; pruritus generalized, erythema,
rash), "General disorders and administration site conditions" (3
patients total; fatigue, mucosal inflammation, edema peripheral),
"Gastrointestinal disorders" (2 patients total; dry mouth, swollen
tongue, upper gastrointestinal hemorrhage), and "Infections and
infestations" (2 patients total; rhinitis, septicemia). Only two
patients (7.7%) had a drug-related grade 3 or 4 TEAE: one patient
in the 500 mg cohort experienced a grade 3 increase of
gamma-glutamyltransferase (GGT) and a single patient in the 1000 mg
cohort experienced a grade 3 septicemia.
[0100] Two patients experienced serious TEAEs that were considered
to be related to treatment. These were a grade 1 upper
gastrointestinal hemorrhage in a patient in the 250 mg cohort and a
grade 3 septicemia in one patient in the 1000 mg cohort. At
screening, this latter patient had an ongoing diagnosis of urinary
tract infection and recurrent events of septicemia of which the
last event was considered related to DI17E6 (EMD 525797). Four
patients died and investigators assessed all deaths as not
reasonably related to EMD 525797.
[0101] Six patients (23.1%) permanently discontinued treatment due
to TEAEs, including 4 patients in the 250 mg cohort (upper
gastrointestinal hemorrhage at day 12, muscular weakness at day 53,
paraplegia at day 46, and ureteric obstruction at day 30), and 1
patient each in the 500 mg (grade 3 GGT increase at day 534) and
1500 mg (metastases to central nervous system at day 85) cohorts.
No administration site skin reactions were reported. Post-baseline
hematology and biochemistry toxicity shifts to grade 3 or 4
occurred in 8 patients. However, there were no obvious trends in
laboratory findings, vital signs or ECG recordings. Overall, 65.4%
of patients had the same worst ECOG performance status on treatment
compared with baseline.
TABLE-US-00008 TABLE 3 Drug-related treatment emergent adverse
events* (TEAEs). TEAEs related to EMD 525797 n (%) Patients with
events 11 (42) Skin and subcutaneous tissue disorders 4 (15)
Pruritus generalized 2 (8) Erythema 1 (4) Rash 1 (4) General
disorders and administration site conditions 3 (12) Fatigue 1 (4)
Mucosal inflammation 1 (4) Edema peripheral 1 (4) Gastrointestinal
disorders 2 (8) Dry mouth 1 (4) Swollen tongue 1 (4) Upper
gastrointestinal hemorrhage 1 (4) Infections and infestations 2 (8)
Rhinitis 1 (4) Septicemia.sup..dagger. 1 (4) Eye disorders 1 (4)
Vision blurred 1 (4) Investigations 1 (4) Blood pressure increase 1
(4) Musculoskeletal and connective tissue disorders 1 (4)
Arthralgia 1 (4) Nervous system disorders 1 (4) Dysgeusia 1 (4)
Respiratory, thoracic, and mediastinal disorders 1 (4) Dyspnea 1
(4) *MedDRA Primary System Organ Class. MedDRA Preferred Term
Version 13.0. .sup..dagger.Grade 3 occurred after the first 6 weeks
(dose limiting toxicity period).
[0102] Examples of Observed Side Effect:
(i) A 62 year-old male experienced grade 1 upper gastrointestinal
bleeding 13 days after the first and only infusion of DI17E6 (250
mg). The subject presented with non-serious hematemesis and was
hospitalized. Gastroscopy showed a lesion in the distal esophagus.
Active bleeding was excluded, the subject was treated with
omeprazole, and the event resolved (ii) A 79 year-old patient
developed septicemia (grade 2) due to e. faecalis 1 days after the
most recent and 9 weeks after the first infusion of DI17E6 (EMD
525797) (1000 mg). The patient was hospitalized and discharged with
recovery. A month later, the patient developed a second septicemia
episode (grade3) again due to e. faecalis 4 days after the most
recent and 2,5 months after the first infusion. The patient was
hospitalized and discharged with recovery. Another month later, the
patient developed a third septicemia episode (grade3) 4 days after
the most recent and 3,5 months after the first infusion, which was
attributed to EMD 525797.
[0103] In summary: [0104] Accumulating safety data have been
reviewed at all 4 SMCs [0105] Overall no DLTs have been observed:
DLT is defined as any grade 3 or 4 hematological or
non-hematological toxicity occurring until end of week 6 suspected
to be reasonably related to the investigational product by the
Investigator and/or Sponsor except for allergic/hypersensitivity
reactions and any out-of-range laboratory values without clinical
correlate which are reversible within 7 days. [0106] No MTD reached
until now [0107] Overall only 2 SAEs have been observed as related
to study medication
Example 4: Pharmacokinetics and Pharmacodynamics
[0108] After single and multiple doses, EMD 525797 showed a
dose-dependent, non-linear PK profile (FIG. 2). After the first
1-hour intravenous infusion, C.sub.max of DI17E6 (EMD 525797) was
generally reached within 1-2 hours after the start of dosing. The
elimination half-life increased with dose as a consequence of EMD
525797 clearance increasing with dose, whereas mean volume of
distribution remained constant over the dose range (Table 4).
[0109] As in FIG. 2 (table 4) depicted, administration of cohort 2
CRPC patients with 500 mg/each 2 weeks reached serum levels with
IC.sub.95, whereas patients from cohort 1 with 250 mg/each 2 weeks
failed. The serum trough concentration of EMD 525797 in cohort 2,
500 mg/each 2 weeks, is above the IC.sub.95 and reach the IC.sub.99
of the non-linear CL pathway (250 mg/each 2 weeks failed).
TABLE-US-00009 TABLE 4 250 mg 500 mg 1000 mg 1500 mg (N = 6) (N =
6) (N = 6) (N = 6) C.sub.max' .mu.g/mL, mean .+-. SD 57.1 .+-. 13.8
131.9 .+-. 22.8 376.6 .+-. 64.1 498.8 .+-. 132.8 T.sub.max' h,
median (range) 1 (1-5) 3 (1-5) 1 (1-4) 1 (1-8) C.sub.min' .mu.g/mL,
mean .+-. SD 2.7 .+-. 4.1 28.0 .+-. 12.3 102.8 .+-. 28.2 150.7 .+-.
47.4 V.sub.ss' L, mean .+-. SD 4.75 .+-. 1.19 4.35 .+-. 0.17 3.36
.+-. 0.36 4.46 .+-. 1.22 AUC.sub.T' .mu.g/mL * h, mean .+-. 6694
.+-. 21225 .+-. 6505 68145 .+-. 12811 87535 .+-. 21575 SD 3746
Ratio_AUC, mean .+-. SD 1.42 .+-. 0.46 1.37 .+-. 0.39 1.70 .+-.
0.36 1.70 .+-. 0.18 Ratio_C.sub.max' mean .+-. SD 1.11 .+-. 0.17
1.21 .+-. 0.22 1.25 .+-. 0.12 1.33 .+-. 0.18 AUC.sub.T', area under
the concentration-time curve within one complete dosing interval;
C.sub.max' maximum serum concentration, C.sub.min' through serum
concentration; Ratio_AUC, relative area under the curve
[AUC.sub.T(Dose period3)/AUC.sub.T(Dose period 1)];
Ratio_C.sub.max' relative maximum serum concentration
[C.sub.max(Dose period 3)/C.sub.max(Dose period 1)]; t.sub.max'
time to reach C.sub.max'; V.sub.ss' apparent volume of distribution
at steady stage.
[0110] After multiple doses, DI17E6 (EMD 525797) maximal serum
concentrations and exposure accumulated dose-dependently up to a
maximum value (dosing period 3/dosing period 1) of 1.33 and 1.70,
respectively, at 1500 mg.
[0111] In most patients, CTC concentrations remained stable around
baseline values (data not shown). In two patients, considerable
decreases in CTC concentrations were observed at around 14 and 42
days after the start of treatment, respectively.
[0112] Anti-EMD 525797 antibodies were detected in 4 of 25 (16.0%)
evaluable patients. All four patients were in the 250 mg cohort;
two patients reverted to seronegative status after two weeks, one
patient had no follow-up, and one patient remained seropositive
over the entire study period.
Example 5: Circulating Tumor Cells (CTC)
[0113] Assessment of circulating tumor cells (CTC) using CellSearch
has been cleared by the Food and Drug Administration as a
prognostic factor for patients with metastatic prostate cancer.
Several groups have shown that CTC are detected at high frequency
in CRPC and are correlated with clinical outcomes (de Bono et al.
2008, Clin Cancer Res, Scher et al. The Lancet 2009).
[0114] In FIG. 1 the effect of DI17E6 on circulating tumor cells
(CTC) is depicted. Patient No. 2002 from cohort with a dose of 500
mg per each 2 weeks shows a decrease in CTC. Other patients had
originally low level of CTC and therefore no significant change
after 3 infusions at week 7. This effect was not observed in cohort
1 with 250 mg per each two weeks, where a steep increase can be
observed in 5 out of 7 patients at Week 7.
Example 6: Bone Markers
[0115] Bone resorption is responsible for the major morbidity in
Prostate cancer. Skeletal events are important in the progression
of Prostate cancer. Markers to evaluate bone resorption and bone
formation were assessed in the study. A pairwise correlation for
all markers per cohort was performed and a potential dose effect
for cohort II observed.
[0116] Bone markers are clustering together in cohort II and not in
cohort I. The biological meaning is not completely, but this could
indicate a dose effect in relation to the bone markers in the
treatment of Prostate cancer with DI-17E6. It could be that DI-17E6
"normalizes" the bone activity so that the bone resorption markers
and the bone formation markers are regulated in a more balanced way
closer to a normal state than in the disease state. It has been
shown that in mCRPC bone resorption markers are often
overexpressed. Outstanding biomarkers which can be observed in
context with the administration of DI17E6 are ADAMTS-1, STC1, IL6
and IL8.
[0117] As in FIG. 7 depicted, two dose levels (250 mg and 500 mg)
are compared. The 500 mg dose shows three clusters (box right sight
of dose level 2=500 mg) of a pair-wise correlation.
Example 7: Change in PSA Level and Pain Score by Treatment with
DI17E6
[0118] FIGS. 4A and 5A show the change of serum PSA levels in two
patients during treatment with 500 mg/each 2 weeks DI 17E6.
[0119] The level of PSA is related to tumour growth and has a
positive correlation with tumor burden. A decrease of more than 50%
in the PSA level as compared with the baseline has been proposed as
a biological response criterion.
[0120] In clinical practice, PSA is measured accurately and easily.
Most physicians base their decision about continuing treatment on a
general impression of the patients well-being and on their PSA
kinetics.
[0121] Two patients (see charts from subjects 2001 and 2002) from
the 500 mg dose cohort show a more than 8 fold decrease of the PSA
values during treatment compared to baseline values (FIG. 4A,
5A).
TABLE-US-00010 TABLE 5 PSA values from all subjects from screening
to week 7. patient screening w1d1 w3d15 w5d29 w7d43 1002 104.4
130.5 169.7 195.3 222 1004 5.7 5.9 11.3 8.7 6.6 1005 34.3 44.7 46.6
47 48.5 1006 1914 1622 1572 1531 1448 1001 60.1 68.1 88.9 123.9
167.2 1008 472 609.5 821.5 2001 77.5 83.3 81.5 129.6 111.3 2002
4774 6699 6500 5943 7878 2005 91.1 94.3 135.6 137.9 148.66 2007
28.9 25 33.3 40.4 2003 150.4 171.1 212.1 259.2 2009 1723 1788 2194
2694 3155 3003 83.00 84.40 102.60 108.50 109.50 3004 152.40 156.90
206.30 208.50 279.60 3001 354.80 450.50 539.60 528.00 3005 173.00
167.50 195.70 182.10 241.00 3006 2273.00 2337.00 2848.00 3430.00
3492.00 3002 49.90 59.70 84.10 100.00 63.80 4002 346.00 426.00
432.00 555.00 547.00 4003 2182.00 2495.00 2320.00 2731.00 2668.00
4004 238.00 290.00 294.00 236.00 319.00 4005 114.10 150.30 216.00
353.50 568.10 4009 1589.00 1458.00 1342.00 1167.00 1084.00 4011
481.20 534.70 690.40 627.40
[0122] Pain interference was assessed using the Brief Pain
Inventory (BPI). BPI was used to evaluate pain interference with
the following: (a) general activity, (b) mood, (c) walking ability,
(d) normal work, (e) relations with other people, (f) sleep, and
(g) enjoyment of life. Total score for pain interference was
calculated as: (Mean score of non-missing
questions).times.(7/number of non-missing questions). If four or
more questions were missing, the pain interference total score was
set to missing.
[0123] The pain score progression during administration is depicted
in FIGS. 4B, 5B. It can be seen by comparing with the PSA
progression (FIG. 4A, 5A) that during treatment with DI17E6 the
improvement pain is correlated with the decrease of the PSA level.
The increase of the pain score in FIG. 4B between days 276 and 296
was due to an arthralagia event independent on the drug effect.
Example 8: Decrease of Primary Tumor and Soft Tumor Lesions (Lymph
Nodes)
[0124] Bone scans and computed tomography scans (CT) were performed
to detect stable/response disease. Subjects with progression in
bone or CT scan using PCWG2 and RECIST criteria stopped
treatment.
[0125] Some patients showed a clinically significant decrease in
the primary tumor (prostate) and target lesions (lymph nodes). The
CT scan illustrating the shrinkage of both primary and target
lesions is presented in FIG. 6.
TABLE-US-00011 TABLE 6 Patient 2001, 500 mg/q2w, partial remission
in the primary tumor and in measurable lesions assessed in CT
scans. 17.08.2009 Patient No. 2001 predose 29.09.2009 28.12.2009
25.03.2010 Lymph node (LN) 38 .times. 36 38 .times. 28 16 .times.
13 17 .times. 10 inguinal right LN retro- 30 .times. 19 31 .times.
19 16 .times. 5 8 .times. 3 LN ilical right 22 .times. 15 24
.times. 16 13 .times. 4 10 .times. 4 Prostate Primary 4.7 .times. 5
cm 3.1 .times. 3.3 cm
[0126] Response was assessed by CT/MRI scan and documented
according to Response Evaluation Criteria in Solid Tumors (RECIST)
criteria. At baseline, tumor lesions were categorized as measurable
or non-measurable based on the ability to measure the lesion
accurately in at least one dimension. Disease progression was
defined as at least a 20% increase in the sum of the longest
diameter of measurable lesions compared to nadir or the appearance
of new lesions.
[0127] Secondary efficacy measures were assessed at screening and
throughout the study (PSA and pain interference total score) or at
week 6 (response assessment), and at 4- or 12-week intervals,
respectively, thereafter for patients continuing treatment beyond
week 6.
Sequence CWU 1
1
71214PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptidemisc_feature(1)..(107)Variable regions with
the CRDs of the light
chainmisc_feature(24)..(34)CDR1misc_feature(50)..(56)CDR2misc_feature(89)-
..(97)CDR3 1Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile
Ser Asn Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Tyr Thr Ser Lys Ile His Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Tyr Thr Phe Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys
Gln Gln Gly Asn Thr Phe Pro Tyr 85 90 95Thr Phe Gly Gln Gly Thr Lys
Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile
Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser
Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150
155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu
Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His
Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
2102447PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptidemisc_feature(1)..(118)Variable regions with
the CDRs of the heavy
chainmisc_feature(31)..(35)CDR1misc_feature(50)..(53)CDR2misc_feature(99)-
..(107)CDR3misc_feature(217)..(231)IgG1 hinge
regionmisc_feature(296)..(297)Substitution within the IgG2 region
2Gln Val Gln Leu Gln Gln Ser Gly Gly Glu Leu Ala Lys Pro Gly Ala1 5
10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser Ser
Phe 20 25 30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Ile 35 40 45Gly Tyr Ile Asn Pro Arg Ser Gly Tyr Thr Glu Tyr Asn
Glu Ile Phe 50 55 60Arg Asp Lys Ala Thr Met Thr Thr Asp Thr Ser Thr
Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Phe Leu Gly Arg Gly Ala Met
Asp Tyr Trp Gly Gln Gly Thr 100 105 110Thr Val Thr Val Ser Ser Ala
Ser Thr Lys Gly Pro Ser Val Phe Pro 115 120 125Leu Ala Pro Cys Ser
Arg Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly 130 135 140Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145 150 155
160Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro
Ser Ser 180 185 190Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp
His Lys Pro Ser 195 200 205Asn Thr Lys Val Asp Lys Thr Val Glu Pro
Lys Ser Ser Asp Lys Thr 210 215 220His Thr Cys Pro Pro Cys Pro Ala
Pro Pro Val Ala Gly Pro Ser Val225 230 235 240Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 245 250 255Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 260 265 270Val
Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 275 280
285Thr Lys Pro Arg Glu Glu Gln Ala Gln Ser Thr Phe Arg Val Val Ser
290 295 300Val Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys305 310 315 320Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro
Ile Glu Lys Thr Ile 325 330 335Ser Lys Thr Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro 340 345 350Pro Ser Arg Glu Glu Met Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu 355 360 365Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 370 375 380Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp Ser385 390 395
400Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
405 410 415Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu 420 425 430His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys 435 440 445315PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 3Glu Pro Lys Ser Ser Asp Lys
Thr His Thr Cys Pro Pro Cys Pro1 5 10 15411PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
peptidemisc_feature(6)..(6)Position may be mutated 4Trp Gly Gln Gly
Thr Ser Val Thr Val Ser Ser1 5 10530PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptidemisc_feature(9)..(9)Position may be
mutatedmisc_feature(13)..(13)Position may be
mutatedmisc_feature(20)..(20)Position may be mutated 5Gln Val Gln
Leu Gln Gln Ser Gly Ala Glu Leu Ala Glu Pro Gly Ala1 5 10 15Ser Val
Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser 20 25
30614PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptidemisc_feature(3)..(3)Position may be
mutatedmisc_feature(5)..(5)Position may be mutated 6Trp Val Lys Gln
Arg Pro Gly Gln Gly Leu Glu Trp Ile Gly1 5 10732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptidemisc_feature(6)..(6)Position may be
mutatedmisc_feature(10)..(10)Position may be
mutatedmisc_feature(16)..(16)Position may be
mutatedmisc_feature(19)..(19)Position may be
mutatedmisc_feature(21)..(21)Position may be
mutatedmisc_feature(25)..(25)Position may be mutated 7Lys Ala Thr
Met Thr Ala Asp Thr Ser Ser Ser Thr Ala Tyr Met Gln1 5 10 15Leu Ser
Gly Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys Ala Ser 20 25
30
* * * * *