U.S. patent application number 16/414424 was filed with the patent office on 2019-08-29 for immunoglobulins binding human vγ9vδ2 t cell receptors.
This patent application is currently assigned to LAVA THERAPEUTICS B.V.. The applicant listed for this patent is LAVA THERAPEUTICS B.V.. Invention is credited to Johannes Jelle VAN DER VLIET, Renee Marinus Willem VERHEUL.
Application Number | 20190263908 16/414424 |
Document ID | / |
Family ID | 50896416 |
Filed Date | 2019-08-29 |
![](/patent/app/20190263908/US20190263908A1-20190829-D00001.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00002.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00003.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00004.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00005.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00006.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00007.png)
![](/patent/app/20190263908/US20190263908A1-20190829-D00008.png)
United States Patent
Application |
20190263908 |
Kind Code |
A1 |
VAN DER VLIET; Johannes Jelle ;
et al. |
August 29, 2019 |
Immunoglobulins binding human Vγ9Vδ2 T cell receptors
Abstract
The invention is in the field of medicine and relates to
immunology, and relates in particular to human V.gamma.9V.delta.2 T
cell receptor binding immunoglobulin molecules. Human
V.gamma.9V.delta.2 T cell receptor binding immunoglobulin molecules
are in particular for use in medical treatment and/or useful in
assays with human V.gamma.9V.delta.2 T cells, wherein human
V.gamma.9V.delta.2 T cells may be modulated
Inventors: |
VAN DER VLIET; Johannes Jelle;
(Amsterdam, NL) ; VERHEUL; Renee Marinus Willem;
(Amsterdam, NL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
LAVA THERAPEUTICS B.V. |
s-Hertogenbosch |
|
NL |
|
|
Assignee: |
LAVA THERAPEUTICS B.V.
s-Hertogenbosch
NL
|
Family ID: |
50896416 |
Appl. No.: |
16/414424 |
Filed: |
May 16, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15302927 |
Oct 7, 2016 |
|
|
|
PCT/NL2015/050235 |
Apr 10, 2015 |
|
|
|
16414424 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 2039/505 20130101;
C07K 2317/70 20130101; C07K 16/30 20130101; C07K 2317/622 20130101;
C07K 2317/569 20130101; C07K 2317/76 20130101; C07K 2317/21
20130101; C07K 2317/75 20130101; C07K 2317/73 20130101; A61P 35/00
20180101; C07K 2317/22 20130101; C07K 2317/565 20130101; C07K
2317/31 20130101; C07K 16/2809 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28 |
Foreign Application Data
Date |
Code |
Application Number |
Apr 10, 2014 |
NL |
2012604 |
Claims
1-26. (canceled)
27. A bispecific immunoglobulin molecule comprising an antibody
that activates human V.gamma.9V.delta.2 T cells linked to a
target-specific antibody, wherein said antibody that activates
human V.gamma.9V.delta.2 T cells binds the V.delta.2 chain of a
V.gamma.9V.delta.2 T cell receptor.
28. The bispecific immunoglobulin molecule according to claim 27,
wherein said target specific antibody is a tumor-antigen-specific
antibody.
29. The bispecific immunoglobulin molecule according to claim 27,
wherein said antibody that activates human V.gamma.9V.delta.2 T
cells is a single chain or a single domain antibody.
30. The bispecific immunoglobulin molecule according to claim 27,
wherein said antibody that activates human V.gamma.9V.delta.2 T
cells is a single chain antibody and said target-specific antibody
is a single chain antibody.
31. The bispecific immunoglobulin molecule according to claim 27,
wherein said antibody that activates human V.gamma.9V.delta.2 T
cells is a single domain antibody and said target-specific antibody
is a single domain antibody.
32. A bispecific immunoglobulin molecule comprising a VHH that
activates human V.gamma.9V.delta.2 T cells linked to a
target-specific VHH, wherein said VHH that activates human
V.gamma.9V.delta.2 T cells binds the V.delta.2 chain of a
V.gamma.9V.delta.2 T cell receptor.
33. A bispecific immunoglobulin molecule comprising an antibody
that activates human V.gamma.9V.delta.2 T cells linked to a
target-specific antibody, wherein said antibody that activates
human V.gamma.9V.delta.2 T cells binds V.gamma.9V.delta.2
double-positive T cells and V.delta.2 single-positive T cells, but
not V.gamma.9 single-positive T cells.
34. The bispecific immunoglobulin molecule according to claim 28,
wherein said bispecific immunoglobulin molecule at a concentration
of 10 nM is capable of inducing lysis of a higher percentage of
A431 tumor cells during overnight incubation than reference
bispecific immunoglobulin molecules which do not have both the
antibody that activates human V.gamma.9V.delta.2 T cells and the
tumor-antigen-specific antibody.
35. A method for the treatment of cancer comprising administration,
to a subject in need thereof, of a bispecific immunoglobulin
molecule comprising an antibody that activates human
V.gamma.9V.delta.2 T cells linked to a tumor-antigen specific
antibody, wherein said antibody that activates human
V.gamma.9V.delta.2 T cells binds the V.delta.2 chain of a
V.gamma.9V.delta.2 T cell receptor.
Description
FIELD OF THE INVENTION
[0001] The present invention is in the field of medicine and
relates to immunology. The invention relates to immunoglobulins
binding T cells. In particular, the invention relates to
immunoglobulins binding human V.gamma.9V.delta.2 T cell receptors.
The invention provides for immunoglobulin molecules that bind a
human V.gamma.9V.delta.2 T cell receptor, such as antibodies,
single chain antibodies, or single domain antibodies, wherein the
human V.gamma.9V.delta.2 T cells may be modulated.
BACKGROUND
[0002] The majority of .gamma..delta. peripheral blood lymphocytes
(PBLs) in human adults express T-cell receptors (TCRs) comprising
V.gamma.9 and V.delta.2 regions. V.gamma.9V.delta.2 T cells can
react against a wide array of pathogens and tumour cells. This
broad reactivity is understood to be conferred by phosphoantigens
which are able to specifically activate this T-cell subset in a TCR
dependent fashion. The broad antimicrobial and anti-tumour
reactivity of V.gamma.9V.delta.2 T-cells suggest a direct
involvement in immune control of cancers and infections. In
addition to fighting disease, in some diseases or medical treatment
V.gamma.9V.delta.2 T cells may be overstimulated or inadvertently
activated,
[0003] Hence, agents that can activate V.gamma.9V.delta.2 T cells
can be useful in the treatment of infections or cancer as these may
promote V.gamma.9V.delta.2 T cell reactivity towards the pathogen
or infected cells or cancer. Furthermore, agents that block
activation of V.gamma.9V.delta.2 T cells may be useful in diseases
or medical treatment where it is advantageous to reduce
V.gamma.9V.delta.2 T cell activation, i.e. wherein
V.gamma.9V.delta.2 T cells are overstimulated or inadvertently
activated. Finally, agents that can bind a V.gamma.9V.delta.2 T
cell, but do not have an effect on (phosphoantigen) activation of
V.gamma.9V.delta.2 T cells are useful for labelling cells, for
example for selecting or identifying V.gamma.9V.delta.2 T cells.
Hence, there is a need in the art to provide for agents that can
bind to V.gamma.9V.delta.2 T cells, and for agents that can block
phosphoantigen activation of V.gamma.9V.delta.2 T cells or can
activate V.gamma.9V.delta.2 T cells.
SUMMARY OF THE INVENTION
[0004] The current invention now provides for novel agents that can
bind to V.gamma.9V.delta.2 T cells. The agents provided are
immunoglobulins. The immunoglobulins provided bind to a
V.gamma.9V.delta.2 T cell receptor. Surprisingly, it was found that
the immunoglobulins provided by the current invention have a
substantial sequence identity. Hence, in a first aspect of the
invention, human V.gamma.9V.delta.2 T cell receptor binding
immunoglobulin molecules are provided, comprising a CDR1 region and
a CDR 2 region,
[0005] wherein the CDR1 region comprises an amino acid sequence
with at least 40% sequence identity with the amino acid sequence of
SEQ ID NO. 31 GRTFSNYAMG; and wherein the CDR2 region comprises an
amino acid sequence with at least 60% sequence identity with the
amino acid sequence of SEQ ID NO. 32 AISWSGGSTYYADSVKG; wherein
preferably the immunoglobulin molecule is a single domain
antibody.
[0006] Furthermore, such immunoglobulins comprise a CDR3 region,
wherein the CDR3 region contributes to V.gamma.9V.delta.2 T cell
receptor binding and may have an effect on the action of the
immunoglobulin molecule. This may, without being bound by theory,
implicate the CDR3 sequence in the functionality of the
immunoglobulin molecule, i.e. type of modulation such as blocking
activation of V.gamma.9V.delta.2 T cells, inducing activation of
V.gamma.9V.delta.2 T cells or neither blocking activation nor
inducing activation of V.gamma.9V.delta.2 T cells. The
immunoglobulins of the invention are in particular for use in
medical treatments and for use in assays involving
V.gamma.9V.delta.2 T cells.
[0007] Preferably, the immunoglobulin molecules according to the
invention comprise a CDR3 region, wherein the CDR3 region comprises
an amino acid sequence selected from the group consisting of amino
acid sequences SEQ ID NO. 3, 6, 9, 11, 14, 17, 20, 22, 25, 27, 29,
30, 33, 35, 37, 40, 43, and 46. These CDR3 regions combined with
the CDR1 and CDR2 sequences provided for binding and functions, as
discussed in detail below.
FIGURES
[0008] FIG. 1: Alignment of the VHH sequences wherein the framework
regions (1, 2, 3 and 4) are indicated as well as CDR1, CDR2 and
CDR3. The code for each of the VHHs is indicated as well (i.e. 5C7
is the sequence of VHH 5C7).
[0009] FIG. 2: VHH 5E7 and VHH 6F6 do not activate
V.gamma.9V.delta.2 T cells. Data indicate relative expression of
the activation marker CD25, the pro-inflammatory cytokine
IFN-.gamma., and the cytotoxic molecule granzyme B by healthy
donor-derived V.gamma.9V.delta.2 T cells in comparison with the
positive control (phosphoantigen (pAg+) expressing HeLa cells)
[0010] FIG. 3: VHH 5E7 neutralizes phosphoantigen induced
activation of healthy donor-derived V.gamma.9V.delta.2 T cells. A
representative example demonstrates the dose dependent
neutralization of phosphoAg-induced V.gamma.9V.delta.2 T cell
activation using VHH 5E7 while a non-specific VHH (negative
control) cannot neutralize phosphoAg-induced V.gamma.9V.delta.2 T
cell activation. Vertical axis indicates activation of
V.gamma.9V.delta.2 T cells as assessed by CD25 expression,
horizontal axis indicates different VHH concentrations.
V.gamma.9V.delta.2 T cell stimulations were performed using
phosphoantigen expressing HeLa cells, generated by pretreating HeLa
cells with increasing doses of the aminobisphosphonate pamidronate
(which results in increasing levels of phosphoantigen expression by
HeLa cells).
[0011] FIG. 4: V.gamma.9V.delta.2 TCR specific VHH are capable of
inducing activation and cytokine production in healthy
donor-derived V.gamma.9V.delta.2 T cells. Data indicate relative
expression of the activation marker CD25 and the pro-inflammatory
cytokine IFN-.gamma. by healthy donor-derived V.gamma.9V.delta.2 T
cells in comparison with the positive control (phosphoantigen
(pAg+) expressing HeLa cells; standardized to 1) and a negative
control VHH. Each bar represents an individual V.gamma.9V.delta.2
TCR specific VHH; individual VHHs differ with respect to their
capacity to induce activation and cytokine production in
V.gamma.9V.delta.2 T cells.
[0012] FIG. 5: Dose dependent activation of healthy donor-derived
V.gamma.9V.delta.2 T cells. Data indicate changes in CD25
expression (MFI) after 24 hr stimulation with increasing
concentrations (10-100-500 nM) of either a non-activating
anti-V.gamma.9V.delta.2 TCR VHH or an activating
anti-V.gamma.9V.delta.2 TCR VHH.
[0013] FIG. 6: V.gamma.9V.delta.2 TCR specific VHH can promote
tumour cell death when fused to a tumor antigen specific VHH as a
bispecific molecule. Representative example of experiment in which
V.gamma.9V.delta.2 T cells were co-cultured overnight with the
tumor cell line A431 in the presence (with) or absence (w/o) of a
bispecfic nanobody construct consisting of a tumor-antigen specific
VHH fused to an activating anti-V.gamma.9V.delta.2 TCR VHH. Data
indicate CD25 expression (activation), and CD107a expression
(degranulation) of V.gamma.9V.delta.2 T cells and 7AAD+ tumor cells
(indicating tumor cell death).
[0014] FIG. 7: T cell receptor V.gamma.9 and/or V.delta.2 binding
specificity as determined using flow-cytometry: Representative
flow-cytometric histogram indicates binding of a V.gamma.9V.delta.2
TCR specific VHH (open histogram) and a negative control VHH
(filled histogram) to V.gamma.9V.delta.2 TCR expressing cells.
[0015] FIG. 8: Clone VHH 5C7 does not activate healthy
donor-derived V.gamma.9V.delta.2 T cells nor neutralize
phosphoantigen induced activation of healthy donor-derived
V.gamma.9V.delta.2 T cells. Representative example demonstrating no
inhibitory nor activating effect of VHH 5C7 on phosphoAg-induced
V.gamma.9V.delta.2 T cell activation. Vertical axis indicates
activation of V.gamma.9V.delta.2 T cells as assessed by CD25
expression, horizontal axis indicates different VHH concentrations.
V.gamma.9V.delta.2 T cell stimulations were performed using
phosphoantigen expressing HeLa cells, generated by pretreating HeLa
cells with increasing doses of the aminobisphosphonate pamidronate
(which results in increasing levels of phosphoantigen expression by
HeLa cells).
[0016] FIG. 9: Schematic of immunoglobulins.
[0017] A) A human antibody consisting of two heavy chains and two
light chains; B) A single chain antibody (or heavy chain only
antibody) consisting of two single chains (or two heavy chains)
that can dimerize via disulphide bridges, wherein each chain
contains a variable domain. Such a single chain antibody (or heavy
chain only antibody) can be a llama antibody; C) A single domain
antibody contains one variable antibody domain e.g. of a single
chain antibody (or heavy chain only antibody). A single domain
antibody can consist only of the binding region as depicted. The
variable domain is indicated in grey, whereas the constant regions
are indicated in white. The variable domain of the light chain is
indicated in black.
DEFINITIONS
[0018] In the following description and examples a number of terms
are used. In order to provide a clear and consistent understanding
of the specifications and claims and clauses, including the scope
to be given to such terms, the following definitions are provided.
Unless otherwise defined herein, all technical and scientific terms
used have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention belongs. The
disclosures of all publications, patent applications, patents and
other references are incorporated herein in their entirety by
reference.
[0019] Methods of carrying out the conventional techniques used in
methods of the invention will be evident to the skilled worker. The
practice of conventional techniques in molecular biology,
biochemistry, computational chemistry, cell culture, recombinant
DNA, bioinformatics, genomics, sequencing and related fields are
well-known to those of skill in the art and are discussed, for
example, in the following literature references: Sambrook et al.,
Molecular Cloning. A Laboratory Manual, 2nd Edition, Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989; Ausubel et
al., Current Protocols in Molecular Biology, John Wiley & Sons,
New York, 1987 and periodic updates; and the series Methods in
Enzymology, Academic Press, San Diego.
[0020] In this document and in its claims and clauses, the verb "to
comprise" and its conjugations is used in its non-limiting sense to
mean that items following the word are included, but items not
specifically mentioned are not excluded. It encompasses the verbs
"consisting essentially of" as well as "consisting of".
[0021] As used herein, the singular forms "a," "an" and "the"
include plural referents unless the context clearly dictates
otherwise. For example, a method for isolating "a" DNA molecule, as
used above, includes isolating a plurality of molecules (e.g. 10s,
100s, 1000s, 10s of thousands, 100s of thousands, millions, or more
molecules).
[0022] Aligning and alignment: With the term "aligning" and
"alignment" is meant the comparison of two or more amino acid
sequences based on the presence of short or long stretches of
identical or similar amino acids. Several methods for alignment of
amino acid sequences are known in the art, as will be further
explained below. With the term "aligning" and "alignment" is also
meant the comparison of two or more nucleotide sequences based on
the presence of short or long stretches of identical or similar
nucleotides. Several methods for alignment of nucleotide sequences
are known in the art, as will be further explained below.
[0023] "Expression of a gene" or "expression of a protein" refers
to the process wherein a DNA region, which is operably linked to
appropriate regulatory regions, particularly a promoter, is
transcribed into an RNA, which is capable of being translated by
machinery of the cell into a protein or peptide (or active peptide
fragment) that is encoded by the nucleotide sequence or which is
active itself (e.g. in posttranscriptional gene silencing or
RNAi).
[0024] As used herein, the term "operably linked" refers to a
linkage of polynucleotide elements in a functional relationship. A
nucleic acid is "operably linked" when it is placed into a
functional relationship with another nucleic acid sequence. For
instance, a promoter, or rather a transcription regulatory
sequence, is operably linked to a coding sequence if it affects the
transcription of the coding sequence. Operably linked means that
the DNA sequences being linked are typically contiguous and, where
necessary to join two or more protein encoding regions, contiguous
and in reading frame.
[0025] The term "genetic construct" means a DNA sequence comprising
a region (transcribed region), which is transcribed into an RNA
molecule (e.g. an mRNA) in a cell, operably linked to suitable
regulatory regions (e.g. a promoter). A genetic construct may thus
comprise several operably linked sequences, such as a promoter, a
5' leader sequence comprising e.g. sequences involved in
translation initiation, a (protein) encoding region, splice donor
and acceptor sites, intronic and exonic sequences, and a 3'
non-translated sequence (also known as 3' untranslated sequence or
3'UTR) comprising e.g. transcription termination sequence
sites.
[0026] "sequence identity" is a measure of the identity of
nucleotide sequences or amino acid sequences. In general, the
sequences are aligned so that the highest order match is obtained.
"Identity" per se has an art-recognized meaning and can be
calculated using published techniques. See, e.g.: (COMPUTATIONAL
MOLECULAR BIOLOGY, Lesk, A. M., ed., Oxford University Press, New
York, 1988; BIOCOMPUTING: INFORMATICS AND GENOME PROJECTS, Smith,
D. W., ed., Academic Press, New York, 1993; COMPUTER ANALYSIS OF
SEQUENCE DATA, PART I, Griffin, A. M., and Griffin, H. G., eds.,
Humana Press, New Jersey, 1994; SEQUENCE ANALYSIS IN MOLECULAR
BIOLOGY, von Heinje, G., Academic Press, 1987; and SEQUENCE
ANALYSIS PRIMER; Gribskov, M. and Devereux, J., eds., M Stockton
Press, New York, 1991). While a number of methods exist to measure
identity between two polynucleotide or polypeptide sequences, the
term "identity" is well known to skilled artisans (Carillo, H., and
Lipton, D., SIAM J. Applied Math (1988) 48:1073). Methods commonly
employed to determine identity or similarity between two sequences
include, but are not limited to, those disclosed in GUIDE TO HUGE
COMPUTERS, Martin J. Bishop, ed., Academic Press, San Diego, 1994,
and Carillo, H., and Lipton, D., SIAM J. Applied Math (1988)
48:1073. Methods to determine identity and similarity are codified
in computer programs. Preferred computer program methods to
determine identity and similarity between two sequences include,
but are not limited to, GCS program package (Devereux, J., et al.,
Nucleic Acids Research (1984) 12(1):387), BLASTP, BLASTN, FASTA
(Atschul, S. F. et al., J. Molec. Biol. (1990) 215:403).
[0027] As an illustration, by an amino acid sequence with at least,
for example, 70% "sequence identity" to a reference amino acid
sequence of SEQ ID NO: 31 it is intended that the amino acid
sequence is identical to the reference sequence except that the
polypeptide sequence may include up to 3 amino acid alterations per
each of the 10 amino acids of the reference amino acid of SEQ ID
NO: 31. Hence, the percentage of identity of an amino acid sequence
to a reference amino acid sequence is to be calculated over the
full length of the reference amino acid sequence. In other words,
to obtain an amino acid sequence comprising at least 70% identical
to a reference amino acid sequence, up to 30% of the amino acid
residues in the reference sequence may be deleted or substituted
with another amino acid, or a number of amino acids up to 30% of
the total amino acid residues in the reference sequence may be
inserted into the reference sequence. These alterations of the
reference sequence may occur at the amino- or carboxy-terminal
positions of the reference amino acid sequence or anywhere between
those terminal positions, interspersed either individually among
residues in the reference sequence or in one or more contiguous
groups within the reference sequence.
[0028] A "nucleic acid" or "nucleic acid sequence" according to the
present invention may include any polymer or oligomer of pyrimidine
and purine bases, preferably cytosine, thymine, and uracil, and
adenine and guanine, respectively (See Albert L. Lehninger,
Principles of Biochemistry, at 793-800 (Worth Pub. 1982), which is
herein incorporated by reference in its entirety for all purposes).
The present invention contemplates any deoxyribonucleotide,
ribonucleotide or peptide nucleic acid component, and any chemical
variants thereof, such as methylated, hydroxymethylated or
glycosylated forms of these bases, and the like. The polymers or
oligomers may be heterogeneous or homogenous in composition, and
may be isolated from naturally occurring sources or may be
artificially or synthetically produced. In addition, the nucleic
acids may be DNA or RNA, or a mixture thereof, and may exist
permanently or transitionally in single-stranded or double-stranded
form, including homoduplex, heteroduplex, and hybrid states.
[0029] As used herein, the term "cancer" refers to or describes the
physiological condition in mammals that is typically characterized
by unregulated cell growth. Examples of cancer include, but are not
limited to, breast cancer, colon cancer, lung cancer, prostate
cancer, hepatocellular cancer, gastric cancer, pancreatic cancer,
cervical cancer, ovarian cancer, liver cancer, bladder cancer,
cancer of the urinary tract, thyroid cancer, renal cancer,
carcinoma, skin cancer, blood cancer, leukemia, melanoma, head and
neck cancer, and brain cancer. As used herein, "cancer" is also
referred to as malignant neoplasm.
[0030] The terms "amino acid sequence" or "protein" or "peptide"
refer to molecules consisting of a chain of amino acids, without
reference to a specific mode of action, size, 3 dimensional
structure or origin. A "fragment" or "portion" of thereof may thus
still be referred to as an "amino acid sequence" or "protein" or
"peptide". An "isolated amino acid sequence" is used to refer to an
amino acid sequence which is no longer in its original natural
environment, for example in vitro or in a recombinant bacterial or
human host cell.
[0031] "T cells", or "T lymphocytes", belong to a group of white
blood cells named lymphocytes, which play a role in cell-mediated
immunity. T cells originate from hematopoietic stem cells in the
bone marrow, mature in the thymus (that is where the T is derived
from), and gain their full function in peripheral lymphoid tissues.
During T-cell development, CD4.sup.-CD8.sup.- T-cells (negative for
both the CD4 and CD8 co-receptor) are committed either to an
.alpha..beta. or .gamma..delta. fate as a result of an initial
.beta. or .delta. TCR gene rearrangement. Cells that undergo early
.beta. chain rearrangement express a pre-TCR structure composed of
a complete .beta. chain and a pre-TCR.alpha. chain on the cell
surface. Such cells switch to a CD4.sup.+CD8.sup.+ state, rearrange
the TCR.alpha. chain locus, and express a mature .alpha..beta.TCR
on the surface. CD4.sup.-CD8.sup.-T cells that successfully
complete the .gamma. gene rearrangement before the .beta. gene
rearrangement express a functional .gamma..delta.TCR and remain
CD4.sup.-CD8.sup.-. (Claudio Tripodo et al. Gamma delta T cell
lymphomas Nature Reviews Clinical Oncology 6, 707-717 (December
2009). The T cell receptor associates with the CD3 protein complex.
Mature T cells, i.e. expressing a .alpha..beta.TCR or a
.gamma..delta.TCR, express the T cell receptor complex on the cell
surface. The .gamma..delta.T-cells, which constitute about 1-5% of
the total population of T cells in human peripheral blood, can be
divided in further subpopulations. A subpopulation of
.gamma..delta.T-cells constitutes V.gamma.9V.delta.2 T-cells, which
express a V.gamma.9V.delta.2 TCR. Within the extracellular domain
of a T cell receptor complementarity determining regions (CDR1,
CDR2, CDR3) are located. These regions are in general the most
variable domains and contribute significantly to the diversity
among TCRs. CDR regions are composed during the development of a
T-cell where so-called Variable--(V), Diversity--(D), and
Joining--(J)-gene segments are randomly combined to generate
diverse TCRs.
[0032] "V.gamma.9V.delta.2 T-cells" are cells that may be
functionally defined in that they are specifically and rapidly
activated by a set of non-peptidic phosphorylated isoprenoid
precursors, collectively named phosphoantigens. Phosphoantigens are
produced by virtually all living cells. The most common
phosphoantigen found in animal and human cells (including cancer
cells) is isopentenyl pyrophosphate (IPP) and its isomer
dimethylallyl pyrophosphate (DMAPP). IPP is a metabolite from the
mevalonate pathway. (E)-4-Hydroxy-3-methyl-but-2-enyl pyrophosphate
(HMBPP or HMB-PP) is an intermediate of the non-mevalonate pathway
of isoprenoid biosynthesis. HMBPP is an essential metabolite in
most pathogenic bacteria, including Mycobacterium tuberculosis, as
well as in parasitic protozoans, such as Plasmodium (causing
malaria) and Toxoplasma gondii. Activation of V.gamma.9V.delta.2
T-cells comprises clonal expansion, cytoxic activity and expression
of cytokines. "V.gamma.9V.delta.2 T-cells" are also defined by
expression of the V.gamma.9V.delta.2 T-cell receptor. For example,
cells may be selected using an antibody specific for the
V.gamma.9V.delta.2 T-cell receptor such as described below. These
selected cells have undergone rearrangement of the .gamma. and
.delta. gene and encode a V.gamma.9 T-cell receptor chain and a
V.delta.2 T-cell receptor chain. From such selected cells, the
nucleic acid (or amino acid) sequence corresponding to the
V.gamma.9 T-cell receptor chain and the V.delta.2 T-cell receptor
chain may be determined.
[0033] The person skilled in the art is well capable of selecting
and/or identifying cell populations characterized by expression of
an antigen or receptor on the surface of the cell such as described
throughout herein. It is understood that with regard to expression
on the surface of cells, such as CD3, CD4, CD8, CD25, CD69,
.gamma..delta.TCR and V.gamma.9V.delta.2 TCR, this is typically
done in a population of cells of which a portion of cells has a
much higher level of expression of the antigen or receptor when
compared to cells having a lower level of expression. Hence, the
terms positive or negative are to be understood as being relative,
i.e. positive cells have a much higher expression level as compared
to cells being negative. Cells being negative in this sense may
thus still have an expression level which may be detected.
Expression on the surface of cells may be analysed using
Fluorescence Activated Cell Sorting (FACS), and many specific
antibodies are commercially available, e.g. such as for CD3, CD4,
CD8, CD25, CD69, .gamma..delta.TCR, V.gamma.9 TCR chain and
V.delta.2 TCR chain, that are suitable for such FACS analysis, such
as described in the examples and as available. Such specific
antibodies are immunoglobulins that bind with their respective
antigen or receptor. V.gamma.9V.delta.2 T-cells can hence also be
defined and selected as being positive for V.gamma.9V.delta.2 TCR
in FACS. Antibodies suitable for FACS or similar separation
techniques (such as e.g. antibodies conjugated to magnetic beads)
are widely available. Conditions are selected, such as provided by
the antibody manufacturer that allows the selection of negative
and/or positive cells. Examples of antibodies that may be suitable
for selection of V.gamma.9V.delta.2 T cells, or engineered
V.gamma.9V.delta.2 T-cells such as available from BD Pharmingen
(BD, 1 Becton Drive, Franklin Lakes, N.J. USA) are V.gamma.9-PE
(clone B3, #555733), V.delta.2-FITC (clone B6, #555738),
.gamma..delta.TCR-APC (clone B1, #555718) or such as available from
Beckman Coulter is pan-.gamma..delta.TCR-PE (clone IMMU510,
#IM1418U). Examples of antibodies that may be suitable for
detecting CD25 and CD69 are CD25-PE (clone M-A251, #555432) and
CD69-FITC (clone L78, #347823) available from BD Pharmingen.
DETAILED DESCRIPTION OF THE INVENTION
[0034] In a first aspect of the invention, a human
V.gamma.9V.delta.2 T cell receptor binding immunoglobulin molecule
is provided, comprising a CDR1 region and a CDR 2 region, wherein
the CDR1 region comprises an amino acid sequence with at least 40%
sequence identity with the amino acid sequence of SEQ ID NO. 31
GRTFSNYAMG; wherein the CDR2 region comprises an amino acid
sequence with at least 60% sequence identity with the amino acid
sequence of SEQ ID NO. 32 AISWSGGSTYYADSVKG; wherein preferably the
immunoglobulin molecule is a single domain antibody.
[0035] A human V.gamma.9V.delta.2 T cell receptor binding
immunoglobulin molecule according to the invention, is an
immunoglobulin molecule that binds e.g. to a V.gamma.9V.delta.2 T
cell receptor such as defined by the amino acid sequences of the
V.gamma.9 and V.delta.2T cell receptor chains as listed in SEQ ID
NO. 71 and 72. Binding to such a T cell receptor can be detected
e.g. via FACS analysis, such as described in the example section.
For example, cells expressing a V.gamma.9V.delta.2 T cell receptor,
e.g. SEQ ID NO. 71 and 72, are contacted with either a control
immunoglobulin molecule or an immunoglobulin molecule binding to a
V.gamma.9V.delta.2 T cell receptor. Alternatively,
V.gamma.9V.delta.2 T cells derived from a healthy human donor as
described in the examples can be contacted with either a control
immunoglobulin molecule or an immunoglobulin molecule binding to a
V.gamma.9V.delta.2 T cell receptor. The amount of immunoglobulin
bound to the cell is increased when the specific immunoglobulin
molecule is compared with a control immunoglobulin molecule that
does not bind to a V.gamma.9V.delta.2 T cell receptor (see for
example FIG. 7). A human V.gamma.9V.delta.2 T cell receptor binding
immunoglobulin molecule according to the invention can be defined
e.g. as being an immunoglobulin that results in a minimal 2-fold
increase in mean-fluorescence intensity (MFI), relative to a
control immunoglobulin, as determined by flow cytometry. The MFI is
the mean of the fluorescence intensity in the fluorescence channel
that is chosen (FITC, PE, PerCP, etc.). As a negative control
antibody a single domain antibody (or VHH, nanobody) against
azo-dye reactive red 6 (RR6) can be used (Spinelli S et al,
Biochemistry 2000; 39:1217-1222). Hence, the skilled person is well
capable of selecting appropriate conditions to determine binding of
an immunoglobulin molecule with the V.gamma.9V.delta.2 T cell
receptor. Immunoglobulin binding can be expressed in terms of
specificity and affinity. The specificity determines which antigen
or epitope thereof is bound by the immunoglobulin molecule.
[0036] An "immunoglobulin molecule" (abbreviated as "Ig") as used
herein is well-known in the art and comprises the term "antibody".
The term "immunoglobulin" as used herein refers to any polypeptide
comprising an antigen-binding site with complementarity determining
regions (CDR). The term includes, but is not limited to antibodies,
monoclonal antibodies, monospecific antibodies, multispecific
antibodies, humanized antibodies, chimeric antibodies, human
antibodies, single chain antibodies, heavy chain only antibodies,
llama antibodies, single domain antibodies and nanobodies (e.g.
VHH). The term "immunoglobulin molecule" may also include
immunoglobulin fragments such Fab, F(ab')2, Fv, scFv, Fd, dAb, and
other antibody fragments or other constructs comprising CDRs that
retain antigen-binding function. Typically, such fragments comprise
an antigen-binding domain. The immunoglobulin molecules or
fragments thereof may be any of the known antibody isotypes and
their conformations, for example, IgA, such as IgA1 or IgA2, IgD,
IgE, IgG, such as IgG1, IgG2a, IgG2b, IgG3, IgG4, or IgM class, or
may constitute mixtures thereof in any combination, such as a
mixture of antibodies from the IgG1 and IgG2a class.
[0037] Immunoglobulins are immune system-related proteins. Human
antibodies consist of four polypeptides--two heavy chains and two
light chains joined to form a "Y"-shaped molecule (see FIG. 9A).
The amino acid sequence in the tips of the "Y" varies greatly among
different antibodies. Each of the tips has a specificity for
binding antigen. The variable region of human antibodies includes
the ends of the light and heavy chains, i.e. the variable domains
of the light and heavy chains. The constant region determines the
mechanism used to e.g. activate the immune system.
[0038] Antibodies are divided into five major classes, IgM, IgG,
IgA, IgD, and IgE, based on their heavy chain constant region
structure and immune function. Also subclasses of the heavy chain
are known. For example, IgG heavy chains in humans can be any of
the IgG1, IgG2, IgG3 and IgG4 subclasses.
[0039] Each chain, i.e. immunoglobulin molecule, has a variable
domain. The variable domain of immunoglobulin molecules is
subdivided into hypervariable (HV) and framework (FR) regions. HV
regions have a high ratio of different amino acids in a given
position, relative to the most common amino acid in that position.
The hypervariability regions are referred to as complementarity
determining regions (CDR). Immunoglobulin molecules have three
complementarity determining regions (CDR1, CDR2 and CDR3). Four
framework regions, with much less variable amino acids sequences,
separate the CDR regions. The CDR regions can direct binding to the
antigen, such as a V.gamma.9V.delta.2 T cell receptor (see for
example FIG. 1, wherein the framework regions and CDR regions are
indicated of the selected VHHs). The framework regions form a
beta-sheet structure which serves as a scaffold to position the CDR
regions to contact the antigen.
[0040] Llama antibodies consist of two heavy chains (see FIG. 9B).
Each of the heavy chains is an immunoglobulin molecule with a
single variable domain. Such an antibody is referred to as a single
chain antibody, i.e. it comprises one type of chain. Such an
antibody can also be referred to as a heavy chain only
antibody.
[0041] A single domain antibody is an immunoglobulin molecule
containing a single monomeric variable domain (see FIG. 9C). Single
domain antibodies thus contain a single CDR1, a single CDR2 and a
single CDR3. A single domain antibody can be derived from a single
chain antibody (or heavy chain only antibody). Like a whole
antibody, a single domain antibody is able to bind selectively to a
specific antigen. Single domain antibodies may contain only the
variable domain of an immunoglobulin chain having CDR1, CDR2 and
CDR3 and framework regions, such antibodies can also be referred to
as VHHs or nanobodies. With a molecular weight of only about 12-15
kDa, nanobodies are much smaller than common antibodies (150-160
kDa) which are composed of two heavy chains and two light chains.
CDR1, CDR2 and CDR3 sequences may be exchanged between species. For
example, from a llama immunoglobulin molecule, CDR sequences may be
selected and exchanged with CDR sequences in a human immunoglobulin
molecule, to obtain a human immunoglobulin molecule having the
specificity that is derived from the llama CDR sequences. This may
be advantageous as a human sequence may be less immunogenic to
humans as compared to the original llama framework sequence. Such
an exchange of CDR sequences is known as humanization. Hence, the
immunoglobulin molecules, single chain antibodies and single domain
antibodies according to the invention may have human derived
immunoglobulin sequences or llama derived immunoglobulin sequences
and have the CDR1, CDR2 and CDR3 sequences replaced with the CDR
sequences according to the invention in order to provide for human
V.gamma.9V.delta.2 T cell receptor binding. For example, a single
chain human antibody may comprise a sequence corresponding to the
human heavy chain sequence but has been mutated, e.g. having the
CH1 domain deleted, such that a llama-like single chain antibody is
formed (see e.g. FIG. 9B), and has the CDR regions of said human
heavy chain sequence replaced by the CDR sequences according to the
invention. A human immunoglobulin, a human single chain antibody or
a human single domain antibody hence refers to the origin of
framework and/or constant regions and not to the origin of the
CDR1, CDR2 and CDR3 regions of the invention.
[0042] As described in the example section, human
V.gamma.9V.delta.2 T cell receptor binding immunoglobulin molecules
were selected by using a strategy involving immunizing Llama glamas
with human donor-derived V.gamma.9V.delta.2 T cells and phage
display. The VHH sequences that were selected were sequenced and
are listed in table 3 and depicted in FIG. 1. The CDR1, CDR2 and
CDR3 regions of the selected VHHs are listed below in table 1. Each
of the CDRs is also listed in table 3 with the corresponding SEQ ID
NO.
TABLE-US-00001 TABLE 1 Of the 20 VHHs that were selected the CDR1,
CDR2 and CDR3 sequences are 20 listed. The Ref. CDR1 and CDR2 are
listed above (corresponding to SEQ ID NO. 31 and SEQ ID NO. 32
respectively), and the sequence identify (%) of each CDR1 and CDR2
region with the respective Ref. CDR1 and CDR2 is listed as well.
CDR1 % CDR2 % CDR3 Nr Ref GRTFSNYAMG AISWSGGSTYYADSVKG 1 5D7
GRTFSRYTMG 80 AISWSGGRTNFAGSVKG 71 DWLPVPGRESYDY 2 5E3 GRTFSSYAMG
90 AISWSGGTTYYADSVKG 94 SLDCSGPGCHTAEYDY 3 6H1 GRTFSEYAMG 90
AISWTGSKTYYADSVKG 82 SSDCSGPGCHTEEYDY 4 5G3 GRTFSSYAMG 90
AVSWSGGSTYYADSVKG 94 SQDCSGPGCYTNEYDS 5 5C1 GSIFSNYAMA 70
AVSWSGGRTYYADSVKG 88 SLSCSGPGCSLEEYDY 6 5D3 GRPFSNYAMG 90
VISWSGGSTYYADSVKG 94 QFSGASTVVAGTALDYDY 7 6E3 GRPFSNYGMG 90
GISWSGGSTDYADSVKG 88 VFSGAETAYYPSDDYDY 8 6H4 GRPFSNYGMG 90
GISWSGGSTDYADSVKG 88 VFSGAETAYYPSDDYDY 9 6C1 GRPFSNYGMG 90
GISWSGGSTDYADSVKG 94 VFSGAETAYYPSDDYDY 10 6H3 GRPFSNYGMG 90
GITWSGGSTHYADLVKG 76 VFSGAETAYYPSTEYDY 11 6G3 GRPFNNYGMG 70
GISWSGGSTYYADSVKG 94 VFSGAETAQYPSYDYDY 12 6F6 GRPFSNYAMG 90
AVTWSGGSTYYADSVKG 88 QFNGAENIVPATTTPTSYDY 13 5C8 GRPFSNYAMG 90
AISWSGGSTSYADSVKG 94 QFSGADYGFGRLGIRGYEYDY 14 5E7 GRPFSNYAMG 90
AISWSGGSTSYADSVKG 94 QFSGADYGFGRLGIQGYEYDY 15 5F5 GRTFSNYAMG 100
AISWSGGSTYYADSVKG 100 MFSGSESQLVVVITNLYEYDY 16 6A1 GRTFSNYAMG 100
TISWSGGSTYYADSVKG 94 AFSGSDYANTKKEVEYDY 17 5D7 GRTFSNYAMG 100
AISWSGGMTDHADSVKG 82 AFAGDIPYGSSWYGDPTTYDY 18 5B11 GRTSSTFSMA 50
AINWSGGSTRYADSVSD 76 RRGGIYYSTQNDYDY 19 6C4 VRTFSDYRMG 70
TISWSGGLTYYADSVKG 94 GGGYAGGTYYHPEE 20 6E4 GFTFDDYCIA 40
CITTSDGSTYYADSVKG 76 YFGYGCYGGAQDYRAMDY
[0043] The immunoglobulins that were selected by the inventors to
bind the human V.gamma.9V.delta.2 T cell receptor surprisingly had
a substantial sequence identity with regard to CDR1 and CDR2.
Without being bound by theory, such CDR1 and CDR2 sequences
substantially contribute to the binding of the V.gamma.9V.delta.2 T
cell receptor. More variability was found for the CDR3 region,
which, without being bound by theory, may implicate the CDR3
sequence in the functionality of the immunoglobulin molecule, i.e.
type of modulation such as blocking activation of
V.gamma.9V.delta.2 T cells, inducing activation of
V.gamma.9V.delta.2 T cells or neither blocking activation nor
inducing activation of V.gamma.9V.delta.2 T cells. Hence, the
immunoglobulin molecule comprises a CDR1 region and a CDR2 region,
wherein the CDR1 region comprises an amino acid sequence with at
least 40% sequence identity with the amino acid sequence of SEQ ID
NO. 31 GRTFSNYAMG, and wherein the CDR2 region comprises an amino
acid sequence with at least 60% sequence identity with the amino
acid sequence of SEQ ID NO. 32 AISWSGGSTYYADSVKG. Preferably the
CDR2 region comprises an amino acid sequence with at least 70%
sequence identity with the amino acid sequence of SEQ ID NO.
32.
[0044] Preferably, the immunoglobulin molecule is a single chain
antibody. As said, the immunoglobulins are derived from llama.
Llamas produce antibodies with a single heavy chain that dimerizes
via disulphide bridges, i.e. a llama antibody has two single
variable domains from two chains (see FIG. 9B).
[0045] In one embodiment, the CDR2 region comprises an amino acid
sequence with at least 60% sequence identity with SEQ ID NO. 32
AISWSGGSTYYADSVKG, wherein the said amino acid sequence has a T at
position 9, an A at position 12, and a V at position 15. When the
sequences of the selected CDR2 regions are compared, the amino
acids at these positions do not show variation. Hence, without
being bound by theory, these positions appear to be of importance
to binding the V.gamma.9V.delta.2 T cell receptor. It is understood
that the position referred to relates to the position in the
reference sequence and does not refer to the position in the
immunoglobulin molecule as a whole. Hence, the CDR2 region has
identical amino acids to SEQ ID NO. 32 at the specified
position.
[0046] As described in the example section, the CDR1, CDR2 and CDR3
regions were selected from llama antibodies. Hence, a single chain
antibody according to the invention may comprise immunoglobulin
molecule sequences that are derived from the llama. It is
understood that in such a llama single chain antibody, the original
CDR sequences are replaced by replacement CDR sequences, e.g. such
as listed in table 1, to arrive at a llama single chain having the
specificity of the replacement CDR sequences. Similarly, the same
may be done with a human heavy chain sequences. The human single
chain antibody than having the specificity being governed by the
replacement CDR sequences. Transferring CDR1, CDR2 and CDR3 regions
to other frameworks, e.g. to other species such as human frameworks
is well known in the art.
[0047] In one embodiment, the single chain antibody is a single
domain antibody. Single chain antibodies comprise framework
regions. Hence, a human single domain antibody may have human
framework regions, e.g. derived from either a human heavy and/or
human light chain sequence and CDR1, CDR2 and CDR3sequences
according to the invention. A llama single domain antibody has
llama framework regions.
[0048] In one embodiment, one or more of the framework regions are
selected from the group of amino acid sequences of SEQ ID NO.
67-70. These framework regions are the framework regions from one
of the VHH clones that was isolated. As can be observed, the
framework regions from the 20 isolated clones do not vary
substantially.
[0049] In one embodiment, the immunoglobulin molecule, the single
chain antibody or the single domain antibody comprises a CDR3
region, wherein the CDR3 region comprises an amino acid sequence
selected from the group consisting of amino acid sequences SEQ ID
NO. 3, 6, 9, 11, 14, 17, 20, 22, 25, 27, 29, 30, 33, 35, 37, 40,
43, and 46. These CDR3 regions combined with the CDR1 and CDR2
sequences provided for binding and function, as discussed
below.
[0050] In one embodiment, the immunoglobulin molecule, the single
chain antibody or the single domain antibody has the combinations
of the amino acid sequences of the CDR1, CDR2 and CDR3 regions from
the antibodies such as listed in table 1. In one embodiment, the
immunoglobulin molecule, the single chain antibody or the single
domain antibody comprises an amino acid sequence selected from the
group of amino acid sequences consisting of SEQ ID NO. 47-66.
[0051] In one embodiment, an immunoglobulin molecule according to
the invention as disclosed above is provided for use in a medical
treatment. It is understood that a human V.gamma.9V.delta.2 T cell
receptor binding immunoglobulin molecule when it binds a human
V.gamma.9V.delta.2 T cell in vivo, e.g. in a medical treatment,
that it may not be desirable that the immunoglobulin molecule is a
fully functional immunoglobulin molecule as upon binding to human
V.gamma.9V.delta.2 T cells it may trigger an immune response
directed against the human V.gamma.9V.delta.2 T cells. Hence, in
such a scenario, immunoglobulin molecules that do not have
functional constant regions, i.e. inactivated or deleted, are
preferred such as e.g. in nanobodies and VHHs. This may be in
particular useful when the action of the human V.gamma.9V.delta.2 T
cells is required in vivo.
[0052] In one embodiment, a nucleotide sequence is provided that
encodes an immunoglobulin molecule according to the invention. The
sequences as disclosed herein relate to amino acid sequences.
Hence, the skilled person is well capable of providing for a
nucleotide sequence encoding an amino acid sequence, as it only
requires to use a codon table to convert amino acid sequence into
nucleotide sequence. Such nucleotide sequence may be used to
operably link it to promoter sequences, polyA signals etc., to
provide for a genetic construct with which the antibody may be
expressed. Such a genetic construct comprising the nucleotide
sequence may be comprised in a host cell.
[0053] In one embodiment, a method is provided for preparing an
immunoglobulin molecule according to the invention comprising:
[0054] culturing a host cell according to the invention comprising
a nucleotide sequence that encodes an immunoglobulin molecule
according to the invention; [0055] allowing the host cell to
express the immunoglobulin; [0056] obtaining the
immunoglobulin.
[0057] Furthermore, the invention also provides for a human
V.gamma.9V.delta.2 T cell receptor binding immunoglobulin molecule,
wherein the immunoglobulin molecule is an immunoglobulin molecule
that blocks activation of human V.gamma.9V.delta.2 T cells.
Blocking activation of human V.gamma.9V.delta.2 T cells is
advantageous in conditions and/or treatments wherein activation of
human V.gamma.9V.delta.2 T cells is undesirable. V.gamma.9V.delta.2
T cells can be strongly and specifically activated by small
nonpeptidic phosphorylated intermediates, referred to as
phosphoantigens (pAg) from the mammalian mevalonate pathway or the
microbial deoxyxylulose-phosphate pathways. Phosphoantigens can
then be specifically recognized (resulting in activation) by
V.gamma.9V.delta.2 T cell through interaction between pAg and
membrane bound butyrophilin3A1/CD277 molecules. V.gamma.9V.delta.2
T cell receptor binding immunoglobulin molecules, as shown in the
examples, can block phosphoantigen induced activation of
V.gamma.9V.delta.2 T cells.
[0058] Preferably, the human V.gamma.9V.delta.2 T cell receptor
binding immunoglobulin molecule, wherein the immunoglobulin
molecule is an immunoglobulin molecule that blocks activation of
human V.gamma.9V.delta.2 T cells, is a human V.gamma.9V.delta.2 T
cell receptor binding immunoglobulin molecule, comprising a CDR1
region and a CDR 2 region, wherein the CDR1 region comprises an
amino acid sequence with at least 40% sequence identity with the
amino acid sequence of SEQ ID NO. 31 GRTFSNYAMG; and wherein the
CDR2 region comprises an amino acid sequence with at least 60%
sequence identity with the amino acid sequence of SEQ ID NO. 32
AISWSGGSTYYADSVKG; and wherein preferably the immunoglobulin
molecule is a single chain antibody. In one embodiment, the CDR2
region of said immunoglobulin molecule comprises an amino acid
sequence with at least 60% sequence identity with SEQ ID NO. 2
AISWSGGSTYYADSVKG, wherein the said amino acid sequence has a T at
position 9, an A at position 12, and a V at position 15. In a
further embodiment, the immunoglobulin molecule is a single domain
antibody, preferably wherein the single domain antibody is derived
from a llama single chain antibody or a human single chain
antibody. In a further embodiment, the immunoglobulin molecule is a
single chain antibody or a single domain antibody. In further
embodiments, the immunoglobulin molecule or the single chain
antibody or the single domain antibody, comprises one or more of
the framework regions selected from the group of amino acid
sequences of SEQ ID NO. 67-70.
[0059] In one embodiment, the said human V.gamma.9V.delta.2 T cell
receptor binding immunoglobulin molecule that blocks activation of
human V.gamma.9V.delta.2 T cells is for use in a medical treatment.
In a further embodiment, said immunoglobulin molecule is for use in
a medical treatment, wherein the medical treatment comprising the
use of inhibitors of the mevalonate pathway or wherein the medical
treatment comprises the treatment of cancer. In another further
embodiment said immunoglobulin molecule is for use in a medical
treatment wherein the medical treatment comprises the treatment of
an infectious disease.
[0060] Inhibitors of the mevalonate pathway that act downstream of
pAg production, that include commonly clinically prescribed
aminobisphosphonates such as pamidronate, alendronate, risedronate,
ibandronate and zoledronate. Another class of compounds includes
alkylamines such as isobutylamine, isoamylamine, and n-butylamine.
Such compounds can be used for the treatment of Paget's disease,
osteoporosis, hypercalcemia, and prevention of skeletal events in
case of malignant bone metastases. This results in the
intracellular accumulation of the endogenous pAg
isopentenyl-pyrophosphate (IPP) and the subsequent selective
activation and expansion of V.gamma.9V.delta.2 T cells.
Aminobisphosphonate administration is frequently accompanied by an
acute febrile response due to this selective activation of
V.gamma.9V.delta.2 T cells. This acute phase response has a peak
onset of 1 day and a median duration of 3 days and mostly consists
of fever, chills, flushes, acute musculoskeletal symptoms, pain,
generalized discomfort and local complaints involving the back,
neck, chest or shoulders, nausea, vomiting, and diarrhea. Hence, in
a medical treatment, said human V.gamma.9V.delta.2 T cell receptor
binding immunoglobulin molecules that block activation of human
V.gamma.9V.delta.2 T cells can prevent the acute phase response
induced by e.g. aminobisphosphonate administration in patients with
Paget's disease, osteoporosis, bone metastases, and hypercalcemia.
Furthermore, such immunoglobulin molecules may also be advantageous
in the medical treatment of excessive activation of
V.gamma.9V.delta.2 T cells in vivo, which can occur for example
during an infection where V.gamma.9V.delta.2 T cells are
overstimulated or chronically stimulated or in certain cancerous
conditions where chronic overactivity of the mevalonate pathway in
tumour cells can result in V.gamma.9V.delta.2 T cell exhaustion.
Such (over)stimulation can be measured in patients for example by
measuring an increase in V.gamma.9B.delta.2 T cells as compared to
baseline levels, or by measuring supranormal levels of
V.gamma.9V.delta.2 T cells, e.g. more than 5% of the T cells are
V.gamma.9V.delta.2 T cells, combined with an upregulation of
surface markers such as CD69 (early activation marker) or CD25
(late activation marker) on V.gamma.9V.delta.2 T cells. It is
understood that due to migration of the V.gamma.9V.delta.2 T cells
out of the blood to tissues, measuring supranormal levels of
V.gamma.9V.delta.2 T cells is not a requirement. On the other hand,
in chronic overstimulation, V.gamma.9V.delta.2 T cells may be less
well activated, and that can be a sign of overstimulation as well.
Cytokine production (IFN-gamma, TNF-alpha) and cytotoxic granule
content can also be measured intracellularly by flow cytometry.
[0061] In a preferred embodiment, the said human V.gamma.9V.delta.2
T cell receptor binding immunoglobulin molecule that blocks
activation of human V.gamma.9V.delta.2 T cells, is an
immunoglobulin molecule comprising a CDR3 region, wherein the CDR3
region comprises an amino acid sequence selected from the group
consisting of amino acid sequences SEQ ID NO. 27 and 30.
[0062] In one embodiment, the said human V.gamma.9V.delta.2 T cell
receptor binding immunoglobulin molecule that blocks activation of
human V.gamma.9V.delta.2 T cells, is used for blocking activation
of human V.gamma.9V.delta.2 T cells. According to this embodiment,
said immunoglobulin molecule (which includes the single chain
antibody or single domain antibody), is used in assays, e.g. such
as described in the examples, to block activation.
[0063] The invention also provides an immunoglobulin molecule that
activates human V.gamma.9V.delta.2 T cells, that is a human
V.gamma.9V.delta.2 T cell receptor binding immunoglobulin molecule,
comprising a CDR1 region and a CDR2 region, wherein the CDR1 region
comprises an amino acid sequence with at least 40% sequence
identity with the amino acid sequence of SEQ ID NO. 31 GRTFSNYAMG;
and wherein the CDR2 region comprises an amino acid sequence with
at least 60% sequence identity with the amino acid sequence of SEQ
ID NO. 32 AISWSGGSTYYADSVKG; and wherein preferably the
immunoglobulin molecule is a single chain antibody. In one
embodiment, the CDR2 region comprises an amino acid sequence with
at least 60% sequence identity with SEQ ID NO. 2 AISWSGGSTYYADSVKG,
wherein the said amino acid sequence has a T at position 9, an A at
position 12, and a V at position 15. In a further embodiment, the
immunoglobulin molecule is a single domain antibody, preferably
wherein the single domain antibody is a llama single chain antibody
or a human single chain antibody. In a further embodiment, the
single chain antibody is a single domain antibody. In further
embodiments, the immunoglobulin molecule or the single chain
antibody or the single domain antibody, comprises one or more of
the framework regions selected from the group of amino acid
sequences of SEQ ID NO. 67-70.
[0064] Preferably, said immunoglobulin molecules that activate
human V.gamma.9V.delta.2 T cells comprises a CDR3 region, wherein
the CDR3 region comprises an amino acid sequence selected from the
group consisting of amino acid sequences SEQ ID NO. 6, 9, 11, 14,
17, 20, 22, 25, 29, 33, 35, and 46.
[0065] Current strategies that aim to exploit V.gamma.9V.delta.2 T
cells depend on their systemic activation (e.g. by
aminobisphosphonates or synthetic phosphoantigens such as BrHPP) or
on e.g. adoptive transfer of V.gamma.9V.delta.2 T cells. These
approaches have been shown to be well tolerated by patients and
signs of antitumor activity have been documented. However, results
are not consistent enough to allow widespread clinical application.
Described strategies result in systemic activation of
V.gamma.9V.delta.2 T cells, but do not result in the specific
recruitment of these cells to the tumour, where they are supposed
to exert their antitumor effect. The said immunoglobulin molecule
that activates human V.gamma.9V.delta.2 T cells and that are
preferably linked to an agent can be used to activate
V.gamma.9V.delta.2 T cells in a clinical setting.
[0066] Preferably, said immunoglobulin molecule that activates
human V.gamma.9V.delta.2 T cells are linked to an agent. Said agent
is preferably an agent that can bind to a target, e.g. a cancer
cell or an infected cell, e.g. infected with a virus, or a non-host
cell, e.g. bacteria. Preferably said agent is an immunoglobulin
molecule. More preferably, said immunoglobulin molecule is a single
chain antibody or a single domain antibody. By linking to an agent,
the agent can recruit and activate the human V.gamma.9V.delta.2 T
cells at the site where the action of the human V.gamma.9V.delta.2
T cells is required, in contrast to systemic activation. For
example, said immunoglobulin molecule that activates human
V.gamma.9V.delta.2 T cells can be linked to a tumour-specific
antibody, an antiviral antibody, or an antibacterial antibody. Such
a tumour specific antibody can be any antibody. Such an
immunoglobulin molecule linked to another antibody can be referred
to as a bispecific antibody. A bispecific antibody may also consist
of a first immunoglobulin molecule comprising the CDR1, CDR2 and
CDR3 regions according to the invention, which is a chain such as
comprised in a single chain antibody, wherein the first
immunoglobulin chain is paired with a second immunoglobulin
molecule which is also a chain such as being comprised in a single
chain antibody wherein the second immunoglobulin binds to the
target. A bispecific antibody is thus formed that has two chains
(similar to as depicted in FIG. 9B), each chain having a different
single binding domain wherein one binding domain comprises CDR1,
CDR2 and CDR3 in accordance with the invention and the other
binding domain binds to the targets. Said immunoglobulin molecule
that activates human V.gamma.9V.delta.2 T cells and linked to an
agent can also be a bispecific antibody that comprises two single
domain antibodies, the first single domain antibody comprising the
CDR1, CDR2 and CDR3 regions according to the invention, wherein the
first single domain antibody is linked to a second single domain
antibody wherein the second single domain antibody binds to the
target.
[0067] Hence, in one embodiment, said immunoglobulin molecule that
activates human V.gamma.9V.delta.2 T cells, and which is preferably
linked to an agent is for use in a medical treatment. Preferably
the medical treatment is a treatment of cancer or of an
infection.
[0068] In a further embodiment, the use is provided said
immunoglobulin molecule that activates human V.gamma.9V.delta.2 T
cells for activating human V.gamma.9B.delta.2 T cells. Such use is
for instance useful in assays such as described in the
examples.
[0069] In a further embodiment, said immunoglobulin molecule that
activates human V.gamma.9V.delta.2 T cells comprises a label. These
immunoglobulin molecules are in particular useful for flow
cytometry of cells expressing human V.gamma.9V.delta.2 T cell
receptor. The immunoglobulin molecule may comprise a tag, e.g. a
myc tag as described in the examples or an his-tag or a fluorescent
protein sequence, or it may be coupled to a suitable imaging dye.
Furthermore, when coupled to e.g. magnetic beads, these
immunoglobulin molecules can be used for the isolation and
purification of these cells from cell suspensions including those
from peripheral blood. As these immunoglobulins that activate human
V.gamma.9V.delta.2 T cells, these immunoglobulin molecules are in
particular useful for selecting these cells while at the same time
activating and expanding the cell population. Hence, the use is
further provided of these immunoglobulin molecules for labelling
and/or for selecting, and for activating human V.gamma.9V.delta.2 T
cells.
[0070] In a further aspect of the invention, an immunoglobulin
molecule is provided wherein the immunoglobulin molecule is an
immunoglobulin molecule that does not block activation of human
V.gamma.9V.delta.2 T cells; and does not activate human
V.gamma.9V.delta.2 T cells and wherein it is a human
V.gamma.9V.delta.2 T cell receptor binding immunoglobulin molecule,
comprising a CDR1 region and a CDR2 region, wherein the CDR1 region
comprises an amino acid sequence with at least 40% sequence
identity with the amino acid sequence of SEQ ID NO. 31 GRTFSNYAMG;
and wherein the CDR2 region comprises an amino acid sequence with
at least 60% sequence identity with the amino acid sequence of SEQ
ID NO. 32 AISWSGGSTYYADSVKG; and wherein preferably the
immunoglobulin molecule is a single chain antibody. In one
embodiment, the CDR2 region comprises an amino acid sequence with
at least 60% sequence identity with SEQ ID NO. 2 AISWSGGSTYYADSVKG,
wherein the said amino acid sequence has a T at position 9, an A at
position 12, and a V at position 15. In a further embodiment, the
immunoglobulin molecule is a single domain antibody, preferably
wherein the single domain antibody is a llama single chain antibody
or a human single chain antibody. In a further embodiment, the
single chain antibody is a single domain antibody. In further
embodiments, the immunoglobulin molecule or the single chain
antibody or the single domain antibody, comprises one or more of
the framework regions selected from the group of amino acid
sequences of SEQ ID NO. 67-70.
[0071] In one embodiment, said immunoglobulin molecule, wherein the
immunoglobulin molecule is an immunoglobulin molecule that does not
block activation of nor activates human V.gamma.9V.delta.2 T cells,
comprises a CDR3 region wherein the CDR3 region comprises an amino
acid sequence selected from the group consisting of SEQ ID NO. 3,
37, 40 and 43.
[0072] In a further embodiment, said immunoglobulin molecule,
wherein the immunoglobulin molecule is an immunoglobulin molecule
that does not block activation of human V.gamma.9V.delta.2 T cells,
comprises a label.
[0073] These immunoglobulin molecules are in particular useful for
flow cytometric or immunohistochemical detection of cells
expressing human V.gamma.9V.delta.2 T cell receptor. The
immunoglobulin molecule may comprise a tag, e.g. a myc tag as
described in the examples or an his-tag or a fluorescent protein
sequence, or it may be coupled to a suitable imaging dye.
Furthermore, when coupled to e.g. magnetic beads, these
immunoglobulin molecules can be used for the isolation and
purification of these cells from cell suspensions including those
from peripheral blood. These V.gamma.9V.delta.2 T cell receptor
binding immunoglobulin molecules can be developed as research tools
for detection in immunohistochemistry, flow-cytometry, imaging, and
for magnetic purification from cell suspensions. As these do not
have an effect on the human V.gamma.9V.delta.2 T cells, these
immunoglobulin molecules are in particular useful for selecting
these cells for further uses. Hence, the use is further provided of
these immunoglobulin molecules for labelling or for selecting human
V.gamma.9V.delta.2 T cells.
[0074] In another aspect of the invention, an immunoglobulin
molecule is provided wherein the immunoglobulin molecule is an
immunoglobulin comprising a CDR1 region and a CDR2 region, wherein
the CDR1 region comprises an amino acid sequence with at least 40%
sequence identity with the amino acid sequence of SEQ ID NO. 31
GRTFSNYAMG; and wherein the CDR2 region comprises an amino acid
sequence with at least 60% sequence identity with the amino acid
sequence of SEQ ID NO. 32 AISWSGGSTYYADSVKG; and wherein preferably
the immunoglobulin molecule is a single chain antibody. In one
embodiment, the CDR2 region comprises an amino acid sequence with
at least 60% sequence identity with SEQ ID NO. 2 AISWSGGSTYYADSVKG,
wherein the said amino add sequence has a T at position 9, an A at
position 12, and a V at position 15. In a further embodiment, the
immunoglobulin molecule is a single domain antibody, preferably
wherein the single domain antibody is a llama single chain antibody
or a human single chain antibody. In a further embodiment, the
single chain antibody is a single domain antibody. In further
embodiments, the immunoglobulin molecule or the single chain
antibody or the single domain antibody, comprises one or more of
the framework regions selected from the group of amino acid
sequences of SEQ ID NO. 67-70. In a further embodiment of this
aspect of the invention, the immunoglobulin molecule, the single
chain antibody or the single domain antibody comprises a CDR3
region, wherein the CDR3 region comprises an amino acid sequence
selected from the group consisting of amino add sequences SEQ ID
NO. 3, 6, 9, 11, 14, 17, 20, 22, 25, 27, 29, 30, 33, 35, 37, 40,
43, and 46.
[0075] In another aspect of the invention an immunoglobulin
molecule is provided, wherein the immunoglobulin molecule comprises
a CDR3 region, wherein the CDR3 region comprises an amino acid
sequence selected from the group consisting of amino add sequences
SEQ ID NO. 3, 6, 9, 11, 14, 17, 20, 22, 25, 27, 29, 30, 33, 35, 37,
40, 43, and 46.
EXAMPLES
[0076] Generation of Donor-Derived V.gamma.9V.delta.2 T Cells
[0077] Healthy donor-derived (human) V.gamma.9V.delta.2 T cells
were generated and cultured as described (Schneiders F L, et al.
Clin Immunol 2012; 142:194-200).
[0078] Generation of Jurkat V.gamma.9V.delta.2 T Cell Lines and
Jurma V.gamma.9V.delta.2 T Cell Lines
[0079] Jurkat and JurMa cell lines expressing V.gamma.9V.delta.2
TCR were synthesized according to methodologies described
previously (Scholten K B, et al. Clin Immunol 2006; 119:135-45). In
brief, protein sequences of clone G9 V.gamma.9- and V.delta.2-chain
(Allison T J et al. Nature 2001; 411:820-4), Davodeau F et al. Eur
J Immunol 1993; 23:804-8) separated by a picoma virus derived 2A
sequence was codon modified for optimal protein production and
synthesized by GeneART (Life technologies) and subsequently cloned
to LZRS. After transfection to the Phoenix-A packaging cell line,
retroviral supernatants were collected to transduce Jurkat or Jurma
cells.
[0080] Selection of Anti-V.gamma.9V.delta.2 TCR VHH
[0081] 2 Llama glamas were immunized four times each with
1.times.10.sup.8 human donor-derived V.gamma.9V.delta.2 T cells in
sterile PBS over a period of six weeks. Phage libraries were
constructed from extracted RNA isolated from llama PBMCs as
described (Roovers R C et al. Cancer Immunol Immunother. 2007;
56:303-17) and ligated into phagemid vector pUR8100.
V.gamma.9V.delta.2 T cell receptor (TCR) specific VHH were
generated by two rounds of phage display selections. In round 1,
phages from both libraries were incubated for 2 hours at 4.degree.
C. with Jurkat cells transduced to stably express
V.gamma.9V.delta.2 TCR (Jurkat V.gamma.9V.delta.2). After
incubation, cells were washed and phages were eluted with 100 mM
HCl. After 7 minutes incubation at 4.degree. C., unbound phages
were removed and neutralized with Tris-HCl after which they were
infected to E. coli. After recovery of selected phages, second
round phages were first counter selected 2.times. for 1 hour at
4.degree. C. to Jurkat cells after which unbound phages were
incubated for 1 hour with Jurkat V.gamma.9V.delta.2. Phages were
eluted and infected to E. coli as described for first round
selections. Bacteria were plated on LB/2% glucose/ampicillin plates
to generate single bacterial colonies coding eluted VHH DNA.
[0082] Production and Purification of VHH
[0083] VHH DNA from individual clones were digested with
Sfi1/BstEII and cloned into plasmid pMEK219, a derivative from
pHen1 (Hoogenboom et al. Nucleic Acids Res 1991) with addition of a
HC-V cassette to enable Sfi1/BstEII cloning, add a C-terminal
myc-and 6.times.HIS-tag deletion of the genIII sequence.
pMEK219-VHH was transformed to TG1 bacteria. An overnight culture
was used to inoculate 2.times.TY medium plus 0,1% glucose and 100
ug/ml ampicillin. When OD.sub.600 reached 0.5, IPTG was added to a
final concentration of 1 mM. Protein production was allowed for 2-5
hours. Growth of all cultures was performed at 37.degree. C. with
shaking at 200-220 rpm. Protein production was stopped by spinning
cultures for 15 minutes at 4.degree. C. The bacterial pellet was
suspended in PBS and frozen for at least 1 hour. Bacterial
suspension was thawed, slightly shaken for 1 hour at 4.degree. C.
and spun at 4500 rpm for 30 minutes. Supernatant was incubated with
washed Talon resin (Clontech, 1290 Terra Bella Ave. Mountain View,
Calif., USA) for 1 hour at room temperature. Talon resin was washed
3.times. with PBS and 1.times. with 15 mM imidazole/PBS pH7 and
eluted with 150 mM imidazole/PBS pH7. The eluted fraction was
dialysed 2.times. against PBS. Purified VHH was checked by
coomassie stained protein gel for purity.
[0084] Binding of VHH to Donor-Derived V.gamma.9V.delta.2 T cells
or Jurkat V.gamma.9B.delta.2 T cells.
[0085] 5*10.sup.4 donor-derived V.gamma.9V.delta.2 T cells were
washed with FACS buffer. All incubations were performed in FACS
buffer for 30 minutes at 4.degree. C. Cells were incubated with 25
.mu.l 500 nM VHH. After washing, cells were incubated with 10 .mu.l
1:500 anti-myc tag antibody clone 4A6 (Merck Millipore, 290 Cocord
Road Billerica, Mass., USA). After washing, cells were incubated
with 10 .mu.l 1:200 goat-anti-mouse F(ab)2 APC (Beckman Coulter,
Fullerton, Calif., USA) for 30 minutes at 4.degree. C. After a
final washing step, VHH binding to cells was measured by
flowcytometry (FACSCalibur, BD Biosciences).
[0086] Activation of Donor-Derived V.gamma.9V.delta.2 T Cells by
VHH
[0087] Flat bottom 96-well cell culture plates (Costar) were coated
overnight with 50 .mu.l 4 ug/ml mouse-anti-myc clone 9E10 (made in
house) at 4.degree. C. Wells were washed with PBS and blocked with
200 .mu.l 4% BSA/PBS at room temperature for 30 minutes. Block was
discarded and wells were incubated with 30 .mu.l 500 nM VHH in PBS
for 2 hours at room temperature. Wells were washed and
1.times.10.sup.4 V.gamma.9V.delta.2 T in 200 .mu.l IMDM+
(Schneiders F L, et al. Clin Immunol 2012; 142:194-200) were added
per well and incubated overnight at 37.degree. C. in a CO.sub.2
incubator with humidified atmosphere in the presence of golgiplug
(1:500) (BD Biosciences) for intracellular cytokine retention.
Flowcytometry was then used to determine CD25, IFN-.gamma. and
Granzyme B expression (as described; Schneiders F L, et al. Clin
Immunol 2012; 142:194-200 (CD25-PE (clone M-A251, #555432),
IFN-.gamma. APC (clone B27 #554702) both available from BD
Pharmingen. Granzyme B PE (clone GB-12 #M2289) available from
Sanquin, Amsterdam, The Netherlands).
[0088] Neutralization of Donor-Derived V.gamma.9B.delta.2 T Cells
by VHH
[0089] HeLa cells were incubated with indicated amounts of
aminobisphosphonates (NBP; ABP Pamidronaat-DiNatrium, Pharmachemie,
Haarlem, The Netherlands) for 2 hours at 37.degree. C. in a
CO.sub.2 incubator with humidified atmosphere. Cells were then
washed and seeded at 5*10.sup.4 in 100 .mu.l IMDM+ per well in a
flat bottom 96-well cell culture plate (Costar) and allowed to
adhere for 2 hours at 37.degree. C. in a CO.sub.2 incubator with
humidified atmosphere. Cells were washed with PBS and cultured in
100 .mu.l IMDM+. Donor-derived V.gamma.9V.delta.2 T cells were
incubated with the indicated VHH concentration for 1 hour at
4.degree. C. 75*10.sup.3 VHH-incubated V.gamma.9V.delta.2 T cells
were added to NBP-treated HeLa cell coated wells and incubated at
37.degree. C. in a CO.sub.2 incubator with humidified atmosphere.
Cells were harvested with trypsin to a 96-wells round bottom plate,
Golgiplug (1:500, BD Biosciences) was added for intracellular
cytokine retention. Flowcytometry was used to determine CD25,
IFN-.gamma. and Granzyme B expression (as described; Schneiders F
L, et al. Clin Immunol 2012; 142:194-200)
[0090] VHH Chain Specificity
[0091] A donor-derived V.gamma.9V.delta.2 T cell line was stained
with mouse-anti-human V.delta.2-FITC and mouse-anti-human
V.gamma.9-PE (both BD Biosciences) and sorted with FACS Aria (BD
Biosciences) for the populations: single V.delta.2 positive
.gamma..delta. T-cells, single V.gamma.9 positive .gamma..delta. T
cells, V.gamma.9V.delta.2 double positive .gamma..delta. T-cells
and V.gamma.9V.delta.2 double negative .gamma..delta. T-cells.
Sorted cells were cultured in the same way as the donor-derived
V.gamma.9V.delta.2 T cell lines. For determining VHH specificity,
10.sup.4 cells of the resulting purified sorted cell lines were
stained with VHH similar to the methodology as described for
binding of VHH to donor-derived V.gamma.9V.delta.2 T cells with the
adjustment that 10 .mu.l 1:80 goat-anti-mouse-F(ab)2 RPE (#R0480
from Dako, Glostrup, Denmark) was used for anti-myc antibody
detection.
[0092] Results
[0093] The selected VHHs were tested for specificity as described
above, and all 20 VHHs (see table 2) showed binding to
V.gamma.9V.delta.2 T cell receptor expressing Jurkat cells as well
as primary V.gamma.9V.delta.2 T cells, whereas they did not bind to
Jurkat cells not expressing the V.gamma.9V.delta.2 T cell
receptor.
[0094] Immunoglobulin Molecules That Block Phosphoantigen Induced
Activation
[0095] Clones 6F6 and 5E7 were characterized as nanobodies that
block phosphoantigen-induced stimulation of V.gamma.9V.delta.2 T
cells. Both clones 6F6 and 5E7 are nanobodies that bind to the
V.delta.2 chain of the V.gamma.9V.delta.2 T cell receptor. GrB,
CD25 and IFN-gamma expression were similar to unstimulated
controls, whereas the positive control showed relative high
expression levels (see FIG. 2). In a dose response curve, upon
exposure to phosphoantigen, dose dependent neutralization of
phosphoantigen induced V.gamma.9V.delta.2 T cell activation was
shown (see FIG. 3). It was further shown that the VHH 5E7 nanobody
inhibits V.gamma.9V.delta.2 T cell activation by
aminobisphosphonates (ABP) in a dose dependent manner, i.e. a
higher dose of 5E7 results in a relative stronger reduction of CD25
and CD107a expression, and a relative stronger reduction of
interferon-.gamma. and TNF-.alpha. production as well. The 5E7
nanobody was also shown to inhibit spontaneous lysis of Daudi cells
by V.gamma.9V.delta.2 T cells in a dose dependent manner, whereas a
control nanobody did not show any significant effect. In the same
assay, the nitrogen-containing bisphosphonate pamidronate was used
to activate V.gamma.9V.delta.2 T cells resulting in an enhanced
lysis of Daudi cells. Again, the 5E7 nanobody reduced the lysis of
the Daudi cells in a dose dependent manner. This indicates that any
undesired activation of V.gamma.9V.delta.2 T cells may be reduced
by using a nanobody that blocks V.gamma.9V.delta.2 T cell
activation. Such a antibody that blocks V.gamma.9V.delta.2 T cell
activation may be an antibody that binds to the V.delta.2 chain of
the V.gamma.9V.delta.2 T cell receptor.
[0096] Immunoglobulin Molecules That Induce Activation
[0097] Various VHHs were shown to activate V.gamma.9V.delta.2 T
cells as shown by an increase in CD25 expression and an increase in
IFN-gamma expression (see FIG. 4). Furthermore, such VHHs showed a
typical dose response as an increasing dose of VHHs resulted in an
increasing CD25 expression as well (see FIG. 5, right panel). Such
a VHH was also coupled to an immunoglobulin molecule and the effect
on apoptosis of tumour cells studied (see FIG. 6). The bispecific
VHH (anticancer cell binding and V.gamma.9V.delta.2 T cell binding
and activation) showed potent activity towards killing of tumour
cells. A bispecific VHH was made by coupling of
anti-V.gamma.9V.delta.2 nanobody 6H4 to a nanobody against a tumor.
As bispecific controls, an anti-V.gamma.9V.delta.2 nanobody was
coupled to a control nanobody, and an anti-tumor nanobody was
coupled to a control nanobody. At the highest dose tested (10 nM),
the controls only induced about 22% lysis of tumor cells. The
bispecific VHH (or nanobody) binding both V.gamma.9V.delta.2 T
cells and tumor cells induced about 85% lysis of the tumor cells
mediated by the V.gamma.9V.delta.2 T cells. In a dose response
curve, the percentage of lysis by the V.gamma.9V.delta.2 T cells
decreased with a lower dose (1 nM, about 80%, 100 pM about 78%, 10
pM about 50%, 1 pM about 23% and 0 about 24%). In a control
experiment without (bispecific) nanobodies only using
bisphosphonates, about 80% of tumor cell lysis was observed. These
results show that tumor-specific lysis by V.gamma.9V.delta.2 T
cells can be enhanced by using bispecific VHHs (or nanobodies) ,
wherein both the tumor and V.gamma.9V.delta.2 T cells are targeted,
and wherein the specific tumor targeting of V.gamma.9V.delta.2 T
cells induces activation of V.gamma.9V.delta.2 T cells as well.
[0098] Immunoglobulin Molecules That Do Not Induce Activation and
Do Not Block Phosphoantigen Activation
[0099] Several VHHs (5D7, 5C7, 5B11 and 6C4) showed no activation
of human V.gamma.9V.delta.2 T cells, nor did it have an effect on
blocking phosphoantigen human V.gamma.9V.delta.2 T cell activation
(FIG. 8 and FIG. 5, left panel). Such VHHs are useful for example
in FACS sorting (see FIG. 7).
[0100] Magnetic Bead Separation
[0101] An anti-V.delta.2 (e.g. 6H4) or V.gamma.9 nanobody (e.g.
6H1) was biotinylated and mixed with PBMCs. The cells were washed
to remove unbound nanobody. Magnetic beads with streptavidin (such
as available from Miltenyi Biotec) were added to the mixture and
cells bound to the beads, via the biotinylated nanobody, separated
from unbound cells using a magnetic separating column. PBMCs were
FACS analysed with regard to V.gamma.9 and V.delta.2 expression.
Excellent purification was obtained with both anti-V.delta.2 and
V.gamma.9 nanobodies. For example, with nanobody 6H4 4.5% of the
PBMCs expressed both chains, after magnetic bead separation, 97.4%
of the cells were positive for both V.gamma.9 and V.delta.2 chains.
The fraction of cells that did not bind to the magnetic beads were
negative for both V.gamma.9 and V.delta.2 chains (0%).
TABLE-US-00002 TABLE 2 Binding of VHHs to .gamma. T-cells
expressing V.gamma.9V 2 or not expressing V.gamma.9V 2 or
expressing a single V.gamma.9 or V 2 chain. Nr Ref V 2+ V.gamma.9+
V.gamma.9V 2+ V.gamma.9V 2- 1 5C7 +/- - +/- - 2 5E3 - ++ ++ - 3 6H1
- ++ ++ - 4 5G3 - ++ ++ - 5 5C1 +/- ++ ++ - 6 5D3 ++ - ++ - 7 6E3
++ - ++ - 8 6H4 ++ - ++ - 9 6C1 ++ - ++ - 10 6H3 ++ +/- ++ - 11 6G3
++ - ++ - 12 6F6 ++ - ++ - 13 5C8 ++ - ++ - 14 5E7 ++ - ++ - 15 5F5
++ - ++ - 16 6A1 ++ - ++ - 17 5D7 ++ - ++ - 18 5B11 - - + - 19 6C4
+/- ++ ++ - 20 6E4 ++ - ++ -
TABLE-US-00003 TABLE 3 Sequences. (B = binding, not activating, not
phosphoantigen activation (PA) blocking; A = activating; PA =
blocks PA activation) SEQ ID. code Description Sequence 1 5C7 CDR1
B GRTFSRYTMG 2 5C7 CDR2 B AISWSGGRTNFAGSVKG 3 5C7 CDR3 B
DWLPVPGRESYDY 4 5E3 CDR1 A GRTFSSYAMG 5 5E3 CDR2 A
AISWSGGTTYYADSVKG 6 5E3 CDR3 A SLDCSGPGCHTAEYDY 7 6H1 CDR1 A
GRTFSEYAMG 8 6H1 CDR2 A AISWTGSKTYYADSVKG 9 6H1 CDR3 A
SSDCSGPGCHTEEYDY 4 5G3 CDR1 A GRTFSSYAMG 10 5G3 CDR2 A
AVSWSGGSTYYADSVKG 11 5G3 CDR3 A SQDCSGPGCYTNEYDS 12 5C1 CDR1 A
GSIFSNYAMA 13 5C1 CDR2 A AVSWSGGRTYYADSVKG 14 5C1 CDR3 A
SLSCSGPGCSLEEYDY 15 5D3 CDR1 A GRPFSNYAMG 16 5D3 CDR2 A
VISWSGGSTYYADSVKG 17 5D3 CDR3 A QFSGASTVVAGTALDYDY 18 6E3 CDR1 A
GRPFSNYGMG 19 6E3 CDR2 A GISWSGGSTDYADSVKG 20 6E3 CDR3 A
VFSGAETAYYPSDDYDY 18 6H4 CDR1 A GRPFSNYGMG 19 6H4 CDR2 A
GISWSGGSTDYADSVKG 20 6H4 CDR3 A VFSGAETAYYPSDDYDY 18 6C1 CDR1 A
GRPFSNYGMG 19 6C1 CDR2 A GISWSGGSTDYADSVKG 20 6C1 CDR3 A
VFSGAETAYYPSDDYDY 18 6H3 CDR1 A GRPFSNYGMG 21 6H3 CDR2 A
GITWSGGSTHYADLVKG 22 6H3 CDR3 A VFSGAETAYYPSTEYDY 23 6G3 CDR1 A
GRPFNNYGMG 24 6G3 CDR2 A GISWSGGSTYYADSVKG 25 6G3 CDR3 A
VFSGAETAQYPSYDYDY 15 6F6 CDR1 PA GRPFSNYAMG 26 6F6 CDR2 PA
AVTWSGGSTYYADSVKG 27 6F6 CDR3 PA QFNGAENIVPATTTPTSYDY 15 5C8 CDR1 A
GRPFSNYAMG 28 5C8 CDR2 A AISWSGGSTSYADSVKG 29 5C8 CDR3 A
QFSGADYGFGRLGIRGYEYDY 15 5E7 CDR1 PA GRPFSNYAMG 28 5E7 CDR2 PA
AISWSGGSTSYADSVKG 30 537 CDR3 PA QFSGADYGFGRLGIQGYEYDY 31 5F5 CDR1
A GRTFSNYAMG 32 5F5 CDR2 A AISWSGGSTYYADSVKG 33 5F5 CDR3 A
MFSGSESQLVVVITNLYEYDY 31 6A1 CDR1 A GRTFSNYAMG 34 6A1 CDR2 A
TISWSGGSTYYADSVKG 35 6A1 CDR3 A AFSGSDYANTKKEVEYDY 31 5D7 CDR1 B
GRTFSNYAMG 36 5D7 CDR2 B AISWSGGMTDHADSVKG 37 5D7 CDR3 B
AFAGDIPYGSSWYGDPTTYDY 38 5B11 CDR1 B GRTSSTFSMA 39 5B11 CDR2 B
AINWSGGSTRYADSVSD 40 5B11 CDR3 B RRGGIYYSTQNDYDY 41 6C4 CDR1 B
VRTFSDYRMG 42 6C4 CDR2 B TISWSGGLTYYADSVKG 43 6C4 CDR3 B
GGGYAGGTYYHPEE 44 6E4 CDR1 A GFTFDDYCIA 45 634 CDR2 A
CITTSDGSTYYADSVKG 46 6E4 CDR3 A YFGYGCYGGAQDYRAMDY 47 5C7 VHH
EVQLVESGGGLVQAGDSLRLSCAASGRTFSRYTMGWF
RQAPGKEREFVAAISWSGGRTNFAGSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAADWLPVPGRESYDY WGQGTQVTVSS 48 5E3 VHH
EVQLVESGGGLVQAGGSLRLSCTASGRTFSSYAMGWF
RQAPGKEREFVAAISWSGGTTYYADSVKGRFTISRDN
AKNTVSLQMNSLKPEDTAVYFCAASLDCSGPGCHTAE YDYWGQGTQVTVSS 49 6H1 VHH
EVQLVESGGGLVQAGGSLRLSCAATGRTFSEYAMGWF
RQAPGKEREFAAAISWTGSKTYYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAASSDCSGPGCHTEE YDYWGQGTQVTVSS 50 5G3 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWF
RQAPGKEREFVAAVSWSGGSTYYADSVKGRFTISRDN
ARNTVYLQMNSLNPEDTAVYYCAASQDCSGPGCYTNE YDSWGQGTQVTVSS 51 5C1 VHH
EVQLVESGGGLVQPGGSLRLSCAASGSIFSNYAMAWF
RQAPEKERDFLAAVSWSGGRTYYADSVKGRFTISRDN
AKNTVNLQMNSLKPEDTAVYYCAASLSCSGPGCSLEE YDYWGQGTQVTVSS 52 5D3 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYAMGWF
RQAPGKEREFVTVISWSGGSTYYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAQFSGASTVVAGTA LDYDYWGQGTRVTVSS 53 6E3 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGMGWF
RQAPGKKREFVAGISWSGGSTDYADSVKGRLTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAVFSGAETAYYPSD DYDYWGQGTQVTVSS 54 6H9 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGMGWF
RQAPGKKREFVAGISWSGGSTDYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAVFSGAETAYYPSD DYDYWGQGTQVTVSS 55 6C1 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGMGWF
RQAPGKKRESVAGISWSGGSTDYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAVFSGAETAYYPSD DYDYWGQGTQVTVSS 56 6H3 VHH
EVQLVESGGGLVQAGGSLRLSCAVSGRPFSNYGMGWF
RQAPGKEREFVAGITWSGGSTHYADLVKGRFTISRDN
AKNTVHLQMNSLKPEDTAVYYCAAVFSGAETAYYPST EYDYWGQGTQVTVSS 57 6G3 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRPFNNYGMGWF
RQAPGKEREFVAGISWSGGSTYYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAVFSGAETAQYPSY DYDYWGQGTQVTVSS 58 6F6 VHH
EVQLVESGGGLVQAGGSLRLSCVASGRPFSNYAMGWF
RQAPGKEREFVAAVTWSGGSTYYADSVKGRFAISRDN
AKNTVYLQMNSLKPEDTAVYYCAAQFNGAENIVPATT TPTSYDYWGQGTQVTVSS 59 5C8 VHH
EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYAMGWF
RQAPGKEREFVAAISWSGGSTSYADSVKGRFTISRDN
AKNTVYLQMNSPKPEDTAIYYCAAQFSGADYGFGRLG IRGYEYDYWGQGTQVTVSS 60 5E7
VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYAMGWF
RQAPGKEREFVAAISWSGGSTSYADSVKGRFTISRDN
AENTVYLQMNSPKPEDTAIYYCAAQFSGADYGFGRLG IQGYEYDYWGQGTQVTVSS 61 5F5
VHH EVQLVESGGGLVQAGGSLRLSCAASGRTFSNYAMGWF
RQAPGKEREFVAAISWSGGSTYYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAMFSGSESQLVVVI TNLYEYDYWGQGTQVTVSS 62 6A1
VHH EVQLVESGGGLVQAGGSLRLSCAASGRTFSNYAMGWF
RQAPGKEREFVATISWSGGSTYYADSVKGRFTISRDN
AKNTVYLQMNSLKPEDTAVYYCAAAFSGSDYANTKKE VEYDYWGQGTQVTVSS 63 5D7 VHH
1EVQLVESGGGLVQAGGSLRLSCIASGRTFSNYAMGW
FRQAPGKEREFVAAISWSGGMTDHADSVKGRFTISRD
NAKNTVYLQMNSLKPEDTAVYYCAAAFAGDIPYGSSW YGDPTTYDYWGQGTQVTVSS 64 B11
VHH EVQLVESGGGLVQAGGSLRLSCAASGRTSSTFSMAWF
RQAPRKEREFVAAINWSGGSTRYADSVSDRFAISRDN
AKNTVYLQMNNLKPEDTAVYYCAARRGGIYYSTQNDY DYWGQGTQVTVSS 65 6C4 VHH
3EVQLVESGGGLVQAGGSLRLSCAVSVRTFSDYRMGW
FRQAPGKEREFVSTISWSGGLTYYADSVKGRFTISRD
NSKNTLYLQMNSLKPEDTAVYYCAAGGGYAGGTYYHP EEWGQGTQVTVSS 66 6E4 VHH
EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYCIAWF
RQAPGKEREPVSCITTSDGSTYYADSVKGRFTISSDN
AKNTVYLQMNRLKPEDTAVYYCAAYFGYGCYGGAQDY RAMDYWGKGTLVTVSS 67 5C7 FRW1
EVQLVESGGGLVQAGDSLRLSCAAS 68 5C7 FRW2 WFRQAPGKEREFVA 69 5C7 FRW3
RFTISRDNAKNTVYLQMNSLKPEDTAVYYCAA 70 5C7 FRW4 WGQGTQVTVSS 71 Human
TCR MLSLLHASTLAVLGALCVYGAGHLEQPQISSTKTLSK V
TARLECVVSGITISATSVYWYRERPGEVIQFLVSISY gamma
DGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQD 9
IATYYCALWEAQQELGKKIKVFGPGTKLIITDKQLDA chain
DVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIK
IHWEEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEK
SLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDP
KDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFA IITCCLLRRTAFCCNGEKS 72 Human
TCR MQRISSLIHLSLFWAGVMSAIELVPEHQTVPVSIGVP V
ATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDI delta
YGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYC 2
ACDTLGMGGEYTDKLIFGKGTRVTVEPRSQPHTKPSV chain
FVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPA
IVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHST
DFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTE
KVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
Sequence CWU 1
1
72110PRTLlama glama 1Gly Arg Thr Phe Ser Arg Tyr Thr Met Gly1 5
10217PRTLlama glama 2Ala Ile Ser Trp Ser Gly Gly Arg Thr Asn Phe
Ala Gly Ser Val Lys1 5 10 15Gly313PRTLlama glama 3Asp Trp Leu Pro
Val Pro Gly Arg Glu Ser Tyr Asp Tyr1 5 10410PRTLlama glama 4Gly Arg
Thr Phe Ser Ser Tyr Ala Met Gly1 5 10517PRTLlama glama 5Ala Ile Ser
Trp Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10
15Gly616PRTLlama glama 6Ser Leu Asp Cys Ser Gly Pro Gly Cys His Thr
Ala Glu Tyr Asp Tyr1 5 10 15710PRTLlama glama 7Gly Arg Thr Phe Ser
Glu Tyr Ala Met Gly1 5 10817PRTLlama glama 8Ala Ile Ser Trp Thr Gly
Ser Lys Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly916PRTLlama
glama 9Ser Ser Asp Cys Ser Gly Pro Gly Cys His Thr Glu Glu Tyr Asp
Tyr1 5 10 151017PRTLlama glama 10Ala Val Ser Trp Ser Gly Gly Ser
Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly1116PRTLlama glama 11Ser
Gln Asp Cys Ser Gly Pro Gly Cys Tyr Thr Asn Glu Tyr Asp Ser1 5 10
151210PRTLlama glama 12Gly Ser Ile Phe Ser Asn Tyr Ala Met Ala1 5
101317PRTLlama glama 13Ala Val Ser Trp Ser Gly Gly Arg Thr Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly1416PRTLlama glama 14Ser Leu Ser Cys
Ser Gly Pro Gly Cys Ser Leu Glu Glu Tyr Asp Tyr1 5 10
151510PRTLlama glama 15Gly Arg Pro Phe Ser Asn Tyr Ala Met Gly1 5
101617PRTLlama glama 16Val Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly1718PRTLlama glama 17Gln Phe Ser Gly
Ala Ser Thr Val Val Ala Gly Thr Ala Leu Asp Tyr1 5 10 15Asp
Tyr1810PRTLlama glama 18Gly Arg Pro Phe Ser Asn Tyr Gly Met Gly1 5
101917PRTLlama glama 19Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr
Ala Asp Ser Val Lys1 5 10 15Gly2017PRTLlama gama 20Val Phe Ser Gly
Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp Tyr Asp1 5 10
15Tyr2117PRTLlama gama 21Gly Ile Thr Trp Ser Gly Gly Ser Thr His
Tyr Ala Asp Leu Val Lys1 5 10 15Gly2217PRTLlama gama 22Val Phe Ser
Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Thr Glu Tyr Asp1 5 10
15Tyr2310PRTLlama gama 23Gly Arg Pro Phe Asn Asn Tyr Gly Met Gly1 5
102417PRTLlama gama 24Gly Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly2517PRTLlama gama 25Val Phe Ser Gly
Ala Glu Thr Ala Gln Tyr Pro Ser Tyr Asp Tyr Asp1 5 10
15Tyr2617PRTLlama gama 26Ala Val Thr Trp Ser Gly Gly Ser Thr Tyr
Tyr Ala Asp Ser Val Lys1 5 10 15Gly2720PRTLlama gama 27Gln Phe Asn
Gly Ala Glu Asn Ile Val Pro Ala Thr Thr Thr Pro Thr1 5 10 15Ser Tyr
Asp Tyr 202817PRTLlama gama 28Ala Ile Ser Trp Ser Gly Gly Ser Thr
Ser Tyr Ala Asp Ser Val Lys1 5 10 15Gly2921PRTLlama gama 29Gln Phe
Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile Arg Gly1 5 10 15Tyr
Glu Tyr Asp Tyr 203021PRTLlama gama 30Gln Phe Ser Gly Ala Asp Tyr
Gly Phe Gly Arg Leu Gly Ile Gln Gly1 5 10 15Tyr Glu Tyr Asp Tyr
203110PRTLlama gama 31Gly Arg Thr Phe Ser Asn Tyr Ala Met Gly1 5
103217PRTLlama gama 32Ala Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly3321PRTLlama gama 33Met Phe Ser Gly
Ser Glu Ser Gln Leu Val Val Val Ile Thr Asn Leu1 5 10 15Tyr Glu Tyr
Asp Tyr 203417PRTLlama gama 34Thr Ile Ser Trp Ser Gly Gly Ser Thr
Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly3518PRTLlama gama 35Ala Phe
Ser Gly Ser Asp Tyr Ala Asn Thr Lys Lys Glu Val Glu Tyr1 5 10 15Asp
Tyr3617PRTLlama gama 36Ala Ile Ser Trp Ser Gly Gly Met Thr Asp His
Ala Asp Ser Val Lys1 5 10 15Gly3721PRTLlama gama 37Ala Phe Ala Gly
Asp Ile Pro Tyr Gly Ser Ser Trp Tyr Gly Asp Pro1 5 10 15Thr Thr Tyr
Asp Tyr 203810PRTLlama gama 38Gly Arg Thr Ser Ser Thr Phe Ser Met
Ala1 5 103917PRTLlama gama 39Ala Ile Asn Trp Ser Gly Gly Ser Thr
Arg Tyr Ala Asp Ser Val Ser1 5 10 15Asp4015PRTLlama gama 40Arg Arg
Gly Gly Ile Tyr Tyr Ser Thr Gln Asn Asp Tyr Asp Tyr1 5 10
154110PRTLlama gama 41Val Arg Thr Phe Ser Asp Tyr Arg Met Gly1 5
104217PRTLlama gama 42Thr Ile Ser Trp Ser Gly Gly Leu Thr Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15Gly4314PRTLlama gama 43Gly Gly Gly Tyr
Ala Gly Gly Thr Tyr Tyr His Pro Glu Glu1 5 104410PRTLlama gama
44Gly Phe Thr Phe Asp Asp Tyr Cys Ile Ala1 5 104517PRTLlama gama
45Cys Ile Thr Thr Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1
5 10 15Gly4618PRTLlama gama 46Tyr Phe Gly Tyr Gly Cys Tyr Gly Gly
Ala Gln Asp Tyr Arg Ala Met1 5 10 15Asp Tyr47122PRTLlama gama 47Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Arg Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Arg Thr Asn Phe Ala Gly
Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp Trp Leu Pro Val Pro Gly Arg
Glu Ser Tyr Asp Tyr Trp 100 105 110Gly Gln Gly Thr Gln Val Thr Val
Ser Ser 115 12048125PRTLlama gama 48Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Thr
Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp
Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Ser65 70 75 80Leu Gln
Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys 85 90 95Ala
Ala Ser Leu Asp Cys Ser Gly Pro Gly Cys His Thr Ala Glu Tyr 100 105
110Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12549125PRTLlama gama 49Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Thr Gly
Arg Thr Phe Ser Glu Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Ala 35 40 45Ala Ala Ile Ser Trp Thr Gly Ser
Lys Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Ser
Asp Cys Ser Gly Pro Gly Cys His Thr Glu Glu Tyr 100 105 110Asp Tyr
Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12550125PRTLlama gama 50Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Val Ser Trp Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Arg Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Asn Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Gln
Asp Cys Ser Gly Pro Gly Cys Tyr Thr Asn Glu Tyr 100 105 110Asp Ser
Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12551125PRTLlama gama 51Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Ser Ile Phe Ser Asn Tyr 20 25 30Ala Met Ala Trp Phe Arg Gln Ala Pro
Glu Lys Glu Arg Asp Phe Leu 35 40 45Ala Ala Val Ser Trp Ser Gly Gly
Arg Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Asn65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Leu
Ser Cys Ser Gly Pro Gly Cys Ser Leu Glu Glu Tyr 100 105 110Asp Tyr
Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12552127PRTLlama gama 52Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40 45Thr Val Ile Ser Trp Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gln Phe
Ser Gly Ala Ser Thr Val Val Ala Gly Thr Ala Leu 100 105 110Asp Tyr
Asp Tyr Trp Gly Gln Gly Thr Arg Val Thr Val Ser Ser 115 120
12553126PRTLlama gama 53Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Lys Arg Glu Phe Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly
Ser Thr Asp Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Leu Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe
Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp 100 105 110Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12554126PRTLlama gama 54Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Lys Arg Glu Phe Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly
Ser Thr Asp Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe
Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp 100 105 110Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12555126PRTLlama gama 55Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Lys Arg Glu Ser Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly
Ser Thr Asp Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe
Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp 100 105 110Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12556126PRTLlama gama 56Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Val Ser Gly
Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Gly Ile Thr Trp Ser Gly Gly
Ser Thr His Tyr Ala Asp Leu Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val His65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe
Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Thr Glu 100 105 110Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12557126PRTLlama gama 57Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Pro Phe Asn Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe
Ser Gly Ala Glu Thr Ala Gln Tyr Pro Ser Tyr Asp 100 105 110Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120
12558129PRTLlama gama 58Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Val Ala Ser Gly
Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Val Thr Trp Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Ala Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gln Phe
Asn Gly Ala Glu Asn Ile Val Pro Ala Thr Thr Thr 100 105 110Pro Thr
Ser Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser 115 120
125Ser59130PRTLlama gama 59Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly
Gly Ser Thr Ser Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn
Ser Pro Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Gln Phe Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile
100 105 110Arg Gly Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val
Thr Val 115 120 125Ser Ser 13060130PRTLlama gama 60Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala
Ala Ile Ser Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Glu Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser Pro Lys Pro Glu Asp Thr Ala Ile Tyr Tyr
Cys 85 90 95Ala Ala Gln Phe Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu
Gly Ile 100 105 110Gln Gly Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val 115 120 125Ser Ser 13061130PRTLlama gama 61Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Asn Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Ala Ala Met Phe Ser Gly Ser Glu Ser Gln Leu
Val Val Val Ile Thr 100 105 110Asn Leu Tyr Glu Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val 115 120 125Ser Ser 13062127PRTLlama
gama 62Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly
Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser
Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Thr Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr
Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala
Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ala Phe Ser Gly Ser Asp
Tyr Ala Asn Thr Lys Lys Glu Val 100 105 110Glu Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12563130PRTLlama gama
63Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ile Ala Ser Gly Arg Thr Phe Ser Asn
Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Met Thr Asp His Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ala Phe Ala Gly Asp Ile Pro
Tyr Gly Ser Ser Trp Tyr Gly 100 105 110Asp Pro Thr Thr Tyr Asp Tyr
Trp Gly Gln Gly Thr Gln Val Thr Val 115 120 125Ser Ser
13064124PRTLlama gama 64Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Ser Ser Thr Phe 20 25 30Ser Met Ala Trp Phe Arg Gln Ala Pro
Arg Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Ser Gly Gly
Ser Thr Arg Tyr Ala Asp Ser Val 50 55 60Ser Asp Arg Phe Ala Ile Ser
Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Asn
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Arg Arg
Gly Gly Ile Tyr Tyr Ser Thr Gln Asn Asp Tyr Asp 100 105 110Tyr Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 12065123PRTLlama gama
65Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala Val Ser Val Arg Thr Phe Ser Asp
Tyr 20 25 30Arg Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ser Thr Ile Ser Trp Ser Gly Gly Leu Thr Tyr Tyr Ala
Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gly Gly Gly Tyr Ala Gly Gly
Thr Tyr Tyr His Pro Glu Glu 100 105 110Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser 115 12066127PRTLlama gama 66Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr 20 25 30Cys Ile Ala Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Pro Val 35 40 45Ser Cys Ile
Thr Thr Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly
Arg Phe Thr Ile Ser Ser Asp Asn Ala Lys Asn Thr Val Tyr65 70 75
80Leu Gln Met Asn Arg Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Tyr Phe Gly Tyr Gly Cys Tyr Gly Gly Ala Gln Asp Tyr
Arg 100 105 110Ala Met Asp Tyr Trp Gly Lys Gly Thr Leu Val Thr Val
Ser Ser 115 120 1256725PRTLlama glama 67Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser 20 256814PRTLlama gama 68Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val Ala1 5 106932PRTLlama gama 69Arg Phe Thr
Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln1 5 10 15Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala 20 25
307011PRTLlama gama 70Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser1
5 1071315PRTHomo Sapiens 71Met Leu Ser Leu Leu His Ala Ser Thr Leu
Ala Val Leu Gly Ala Leu1 5 10 15Cys Val Tyr Gly Ala Gly His Leu Glu
Gln Pro Gln Ile Ser Ser Thr 20 25 30Lys Thr Leu Ser Lys Thr Ala Arg
Leu Glu Cys Val Val Ser Gly Ile 35 40 45Thr Ile Ser Ala Thr Ser Val
Tyr Trp Tyr Arg Glu Arg Pro Gly Glu 50 55 60Val Ile Gln Phe Leu Val
Ser Ile Ser Tyr Asp Gly Thr Val Arg Lys65 70 75 80Glu Ser Gly Ile
Pro Ser Gly Lys Phe Glu Val Asp Arg Ile Pro Glu 85 90 95Thr Ser Thr
Ser Thr Leu Thr Ile His Asn Val Glu Lys Gln Asp Ile 100 105 110Ala
Thr Tyr Tyr Cys Ala Leu Trp Glu Ala Gln Gln Glu Leu Gly Lys 115 120
125Lys Ile Lys Val Phe Gly Pro Gly Thr Lys Leu Ile Ile Thr Asp Lys
130 135 140Gln Leu Asp Ala Asp Val Ser Pro Lys Pro Thr Ile Phe Leu
Pro Ser145 150 155 160Ile Ala Glu Thr Lys Leu Gln Lys Ala Gly Thr
Tyr Leu Cys Leu Leu 165 170 175Glu Lys Phe Phe Pro Asp Val Ile Lys
Ile His Trp Glu Glu Lys Lys 180 185 190Ser Asn Thr Ile Leu Gly Ser
Gln Glu Gly Asn Thr Met Lys Thr Asn 195 200 205Asp Thr Tyr Met Lys
Phe Ser Trp Leu Thr Val Pro Glu Lys Ser Leu 210 215 220Asp Lys Glu
His Arg Cys Ile Val Arg His Glu Asn Asn Lys Asn Gly225 230 235
240Val Asp Gln Glu Ile Ile Phe Pro Pro Ile Lys Thr Asp Val Ile Thr
245 250 255Met Asp Pro Lys Asp Asn Cys Ser Lys Asp Ala Asn Asp Thr
Leu Leu 260 265 270Leu Gln Leu Thr Asn Thr Ser Ala Tyr Tyr Met Tyr
Leu Leu Leu Leu 275 280 285Leu Lys Ser Val Val Tyr Phe Ala Ile Ile
Thr Cys Cys Leu Leu Arg 290 295 300Arg Thr Ala Phe Cys Cys Asn Gly
Glu Lys Ser305 310 31572292PRTHomo Sapiens 72Met Gln Arg Ile Ser
Ser Leu Ile His Leu Ser Leu Phe Trp Ala Gly1 5 10 15Val Met Ser Ala
Ile Glu Leu Val Pro Glu His Gln Thr Val Pro Val 20 25 30Ser Ile Gly
Val Pro Ala Thr Leu Arg Cys Ser Met Lys Gly Glu Ala 35 40 45Ile Gly
Asn Tyr Tyr Ile Asn Trp Tyr Arg Lys Thr Gln Gly Asn Thr 50 55 60Met
Thr Phe Ile Tyr Arg Glu Lys Asp Ile Tyr Gly Pro Gly Phe Lys65 70 75
80Asp Asn Phe Gln Gly Asp Ile Asp Ile Ala Lys Asn Leu Ala Val Leu
85 90 95Lys Ile Leu Ala Pro Ser Glu Arg Asp Glu Gly Ser Tyr Tyr Cys
Ala 100 105 110Cys Asp Thr Leu Gly Met Gly Gly Glu Tyr Thr Asp Lys
Leu Ile Phe 115 120 125Gly Lys Gly Thr Arg Val Thr Val Glu Pro Arg
Ser Gln Pro His Thr 130 135 140Lys Pro Ser Val Phe Val Met Lys Asn
Gly Thr Asn Val Ala Cys Leu145 150 155 160Val Lys Glu Phe Tyr Pro
Lys Asp Ile Arg Ile Asn Leu Val Ser Ser 165 170 175Lys Lys Ile Thr
Glu Phe Asp Pro Ala Ile Val Ile Ser Pro Ser Gly 180 185 190Lys Tyr
Asn Ala Val Lys Leu Gly Lys Tyr Glu Asp Ser Asn Ser Val 195 200
205Thr Cys Ser Val Gln His Asp Asn Lys Thr Val His Ser Thr Asp Phe
210 215 220Glu Val Lys Thr Asp Ser Thr Asp His Val Lys Pro Lys Glu
Thr Glu225 230 235 240Asn Thr Lys Gln Pro Ser Lys Ser Cys His Lys
Pro Lys Ala Ile Val 245 250 255His Thr Glu Lys Val Asn Met Met Ser
Leu Thr Val Leu Gly Leu Arg 260 265 270Met Leu Phe Ala Lys Thr Val
Ala Val Asn Phe Leu Leu Thr Ala Lys 275 280 285Leu Phe Phe Leu
290
* * * * *