U.S. patent application number 16/276520 was filed with the patent office on 2019-08-08 for recombinant listeria vaccine strains and methods of producing the same.
This patent application is currently assigned to ADVAXIS, INC.. The applicant listed for this patent is ADVAXIS, INC.. Invention is credited to Robert Petit, Anu Wallecha.
Application Number | 20190240303 16/276520 |
Document ID | / |
Family ID | 54333010 |
Filed Date | 2019-08-08 |
View All Diagrams
United States Patent
Application |
20190240303 |
Kind Code |
A1 |
Wallecha; Anu ; et
al. |
August 8, 2019 |
RECOMBINANT LISTERIA VACCINE STRAINS AND METHODS OF PRODUCING THE
SAME
Abstract
The present invention provides methods of treating, protecting
against and inducing an immune response against a tumor or cancer,
comprising the step of administering to a subject a recombinant
Listeria strain. In one embodiment the present invention relates to
a recombinant Listeria strain, said recombinant Listeria strain
comprising a recombinant nucleic add, said nucleic add comprising a
first open reading frame encoding a recombinant polypeptide
comprising a first N-terminal fragment of an LLO protein fused to a
heterologous antigen or fragment thereof, and wherein said
recombinant nucleic add further comprises a second open reading
frame encoding a mutant PrfA protein.
Inventors: |
Wallecha; Anu; (Yardley,
PA) ; Petit; Robert; (Newtown (Wrightstown),
PA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ADVAXIS, INC. |
PRINCETON |
NJ |
US |
|
|
Assignee: |
ADVAXIS, INC.
PRINCETON
NJ
|
Family ID: |
54333010 |
Appl. No.: |
16/276520 |
Filed: |
February 14, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15306289 |
Oct 24, 2016 |
10258679 |
|
|
PCT/US2015/025690 |
Apr 14, 2015 |
|
|
|
16276520 |
|
|
|
|
61983732 |
Apr 24, 2014 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 14/195 20130101;
A61K 2039/572 20130101; A61K 39/12 20130101; A61P 15/00 20180101;
C07K 2319/55 20130101; A61P 1/04 20180101; A61K 39/0011 20130101;
C07K 14/005 20130101; C12N 7/00 20130101; A61K 2039/585 20130101;
C12N 1/36 20130101; A61K 2039/522 20130101; A61K 2039/523 20130101;
C12N 2710/20034 20130101; C12N 2710/20051 20130101; A61P 35/00
20180101; A61P 37/04 20180101 |
International
Class: |
A61K 39/00 20060101
A61K039/00; C07K 14/195 20060101 C07K014/195; C12N 1/36 20060101
C12N001/36; A61K 39/12 20060101 A61K039/12; C07K 14/005 20060101
C07K014/005; C12N 7/00 20060101 C12N007/00 |
Claims
1.-32. (canceled)
33. A method of inducing an immune response against a head and neck
cancer in a human subject, the method comprising administering to
said subject a recombinant Listeria strain comprising an episomal
plasmid comprising a recombinant nucleic acid, said nucleic acid
comprising a first open reading frame encoding a recombinant
polypeptide comprising an N-terminal fragment of a listeriolysin O
(LLO) protein fused to a heterologous antigen, wherein said
recombinant nucleic acid further comprises a second open reading
frame encoding a mutant PrfA protein comprising an amino acid
sequence of SEQ ID NO:34, thereby inducing an immune response
against a head and neck cancer.
34. The method of claim 33, wherein said Listeria comprises a
deletion, inactivation or mutation in the genomic prfA gene.
35. The method of claim 33, wherein said mutant PrfA protein
encoded by said second open reading frame complements a prfA
genomic mutation, deletion or inactivation in said Listeria strain
or restores partial PrfA function in said Listeria strain.
36. The method of claim 33, wherein said mutant PrfA protein is
encoded by SEQ ID NO: 33.
37. The method of claim 33, wherein said heterologous antigen is
Human Papilloma Virus-E7 (HPV-E7) or HPV-E6.
38. The method of claim 37, wherein said heterologous antigen is
Human Papilloma Virus-E7 (HPV-E7).
39. The method of claim 38, wherein said HPV-E7 is from HPV16.
40. The method of claim 37, wherein said heterologous antigen is
Human Papilloma Virus-E6 (HPV-E6).
41. The method of claim 33, wherein the N-terminal fragment of a
LLO protein is a fragment of SEQ ID NO: 3.
42. The method of claim 33, wherein said N-terminal fragment of a
LLO protein is selected from a sequence comprising SEQ ID NO: 2 or
SEQ ID NO: 4.
43. The method of claim 33, wherein the recombinant Listeria strain
is a recombinant Listeria monocytogenes strain, the N-terminal
fragment of a LLO protein is a fragment of SEQ ID NO: 3, and the
heterologous antigen is HPV-E7 from HPV16.
44. The method of claim 33, wherein said administering is
intravenous or oral administering.
45. The method of claim 33, wherein said recombinant Listeria
strain is administered to said human subject at a dose of
1.times.10.sup.7-3.31.times.10.sup.10 organisms.
46. The method of claim 45, wherein said recombinant Listeria
strain is administered to said human subject at a dose of
1.times.10.sup.8.
47. The method of claim 45, wherein said recombinant Listeria
strain is stored in a frozen or lyophilized condition prior to
administering.
48. The method of claim 33, further comprising administering to
said subject an additional therapeutic agent.
49. The method of claim 33, further comprising the step of boosting
said human subject with said recombinant Listeria strain.
50. The method of claim 33, wherein said recombinant Listeria
strain is a recombinant Listeria monocytogenes strain.
51. The method of claim 33, wherein said plasmid comprises a gene
encoding a metabolic enzyme.
52. The method of claim 33, wherein said immune response is a
cytotoxic T cell anti-tumor immune response.
53. The method of claim 33, wherein said method allows protecting a
subject against a head and neck cancer.
54. The method of claim 33, wherein said method allows treating a
subject against a head and neck cancer.
Description
FIELD OF INVENTION
[0001] The present invention provides methods of treating,
protecting against, and inducing an immune response against a tumor
or cancer, comprising the step of administering to a subject a
recombinant Listeria strain comprising a nucleic acid encoding a
mutant PrfA protein that partially restores PrfA function.
BACKGROUND OF THE INVENTION
[0002] Persistent infection with high-oncogenic risk human
papillomavirus (HR-HPV) types is recognized as a necessary, but not
sufficient, cause of invasive carcinoma of the cervix (ICC) [1-3].
HPVs 16 and 18 are the most prevalent types in malignant lesions,
accounting for over 70% of ICC and over 50% of high-grade precursor
lesions. The HR-HPV E6 and E7 proteins are consistently expressed
in dysplasias and carcinomas, disrupting the cell cycle regulatory
proteins p53 and pRb, respectively. The obligatory expression of E6
and E7 by both dysplastic and invasive malignant lesions, as well
as the viral origin of these proteins, make them excellent targets
for HPV therapeutic vaccines.
[0003] Listeria monocytogenes (Lm) is a food-borne gram-positive
bacterium that can occasionally cause disease in humans, in
particular elderly individuals, newborns, pregnant women and
immunocompromised individuals. In addition to strongly activating
innate immunity and inducing a cytokine response that enhances
antigen-presenting cell (APC) function, Lm has the ability to
replicate in the cytosol of APCs after escaping from the
phagolysosome, mainly through the action of the listeriolysin O
(LLO) protein. This unique intracellular life cycle allows antigens
secreted by Lm to be processed and presented in the context of both
MHC class I and II molecules, resulting in potent cytotoxic
CD8.sup.+ and Th1 CD4.sup.+ T-cell--mediated immune responses. Lm
has been extensively investigated as a vector for cancer
immunotherapy in pre-clinical models. Immunization of mice with
Lm-LLO-E7 induces regression of established tumors expressing E7
and confers long-term protection. The therapeutic efficacy of
Lm-LLO-E7 correlates with its ability to induce E7-specific CTLs
that infiltrate the tumor site, mature dendritic cells, reduce the
number of intratumoral regulatory CD4.sup.+ CD25.sup.+ T cells and
inhibit tumor angiogenesis.
[0004] Lm has also a number of inherent advantages as a vaccine
vector. The bacterium grows very efficiently in vitro without
special requirements and it lacks LPS, which is a major toxicity
factor in gram-negative bacteria, such as Salmonella. Genetically
attenuated Lm vectors also offer additional safety as they can be
readily eliminated with antibiotics, in case of serious adverse
effects and unlike some viral vectors, no integration of genetic
material into the host genome occurs. However, there is always
great concern about the safety of a live bacterial vaccine such as
Lm, especially regarding its mechanism of attenuation.
[0005] The PrfA protein controls the expression of a regulon
comprising essential virulence genes required by Lm to colonize its
vertebrate hosts; hence the prfA mutation strongly impairs PrfA
ability to activate expression of PrfA-dependent virulence genes.
The present invention addresses this concern by providing a prfA
mutant Listeria that carries a mutant prfA (D133V) gene in the
pGG55 plasmid that restores partial PrfA function.
SUMMARY OF THE INVENTION
[0006] In one embodiment, the present invention relates to a
recombinant Listeria strain, said recombinant Listeria strain
comprising a recombinant nucleic acid, said nucleic acid comprising
a first open reading frame encoding a recombinant polypeptide
comprising a first an N-terminal fragment of an LLO protein fused
to a heterologous antigen or fragment thereof, and wherein said
recombinant nucleic acid further comprises a second open reading
frame encoding a mutant PrfA protein.
[0007] In one embodiment, the present invention relates to a
recombinant Listeria strain, said recombinant Listeria strain
comprising a recombinant nucleic acid, said nucleic acid comprising
a first open reading frame encoding a recombinant polypeptide
comprising a first an N-terminal fragment of an LLO protein fused
to a heterologous antigen or fragment thereof, wherein said
recombinant nucleic acid further comprises a second open reading
frame encoding a mutant PrfA protein, and wherein said Listeria
comprises a genomic mutation or deletion in the prfA gene. In
another embodiment, the mutant PrfA protein encoded by said second
open reading frame complements said genomic mutation or deletion in
said Listeria strain's PrfA protein. In another embodiment, the
mutant PrfA protein encoded by said second open reading frame
restores partial PrfA function in said Listeria strain.
[0008] In one embodiment, the present invention relates to a method
for inducing an immune response against a tumor or a cancer in a
subject, the method comprising the step of administering to said
subject a recombinant Listeria strain comprising a recombinant
nucleic acid, said nucleic acid comprising a first open reading
frame encoding a recombinant polypeptide comprising an N-terminal
fragment of an LLO protein fused to a heterologous antigen or
fragment thereof, is, wherein said recombinant nucleic acid further
comprises a second open reading frame encoding a mutant PrfA
protein, thereby inducing an immune response against a tumor or a
cancer. In another embodiment, the recombinant Listeria strain
comprises a genomic mutation or deletion in the prfA gene.
[0009] Other features and advantages of the present invention will
become apparent from the following detailed description examples
and figures. It should be understood, however, that the detailed
description and the specific examples while indicating preferred
embodiments of the invention arc given by way of illustration only,
since various changes and modifications within the spirit and scope
of the invention will become apparent to those skilled in the art
from this detailed description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0010] The subject matter regarded as the invention is particularly
pointed out and distinctly claimed in the concluding portion of the
specification. The invention, however, both as to organization and
method of operation, together with objects, features, and
advantages thereof, may best be understood by reference to the
following detailed description when read with the accompanying
drawings in which:
[0011] FIG. 1. Lm-E7 and Lm-LLO-E7 use different expression systems
to express and secrete E7. Lm-E7 was generated by introducing a
gene cassette into the orfZ domain of the L. monocytogenes genome
(A). The hly promoter drives expression of the hly signal sequence
and the first five amino acids (AA) of LLO followed by HPV-16 E7.
B), Lm-LLO-E7 was generated by transfoiming the prfA-strain XFL-7
with the plasmid pGG-55. pGG-55 has the hly promoter driving
expression of a nonhemolytic fusion of LLO-E7. pGG-55 also contains
the prfA gene to select for retention of the plasmid by XFL-7 in
vivo.
[0012] FIG. 2. Lm-E7 and Lm-LLO-E7 secrete E7. Lm-Gag (lane 1),
Lm-E7 (lane 2), Lm-LLO-NP (lane 3), Lm-LLO-E7 (lane 4), XFL-7 (lane
5), and 10403S (lane 6) were grown overnight at 37.degree. C. in
Luria-Bertoni broth. Equivalent numbers of bacteria, as determined
by OD at 600 nm absorbance, were pelleted and 18 ml of each
supernatant was TCA precipitated. E7 expression was analyzed by
Western blot. The blot was probed with an anti-E7 mAb, followed by
IIRP-conjugated anti-mouse (Amersham), then developed using ECL
detection reagents.
[0013] FIG. 3. Tumor immunotherapeutic efficacy of LLO-E7 fusions.
Tumor size in millimeters in mice is shown at 7, 14, 21, 28 and 56
days post tumor-inoculation. Naive mice: open-circles; Lm-LLO-E7:
filled circles; Lm-E7: squares; Lm-Gag: open diamonds; and
Lm-LLO-NP: filled triangles.
[0014] FIG. 4. Splenocytes from Lm-LLO-E7-immunized mice
proliferate when exposed to TC-1 cells. C57BL/6 mice were immunized
and boosted with Lm-LLO-E7, Lm-E7, or control rLm strains.
Splenocytes were harvested 6 days after the boost and plated with
irradiated TC-1 cells at the ratios shown. The cells were pulsed
with .sup.3H thymidine and harvested. Cpm is defined as
(experimental cpm)-(no-TC-1 control).
[0015] FIG. 5. A. Induction of E7-specific IFN-gamma-secreting
CD8.sup.+ T cells in the spleens and the numbers penetrating the
tumors, in mice administered TC-1 tumor cells and subsequently
administered Lm-E7, Lm-LLO-E7, Lm-ActA-E7, or no vaccine (naive).
B. Induction and penetration of E7 specific CD8.sup.+ cells in the
spleens and tumors of the mice described for (A).
[0016] FIG. 6. Listeria constructs containing PEST regions induce a
higher percentage of E7-specific lymphocytes within the tumor. A.
representative data from 1 experiment. B. average and SE of data
from all 3 experiments.
[0017] FIG. 7A. Effect of passaging on bacterial load (virulence)
of recombinant Listeria vaccine vectors. Top panel. Lm-Gag. Bottom
panel. Lm-LLO-E7. FIG. 7B. Effect of passaging on bacterial load of
recombinant Lm-E7 in the spleen. Average CFU of live bacteria per
milliliter of spleen homogenate from four mice is depicted.
[0018] FIG. 8 shows induction of antigen-specific CD8.sup.+ T-cells
for HIV-Gag and LLO after administration of passaged Lm-Gag versus
unpassaged Lm-Gag. Mice were immunized with 10.sup.3 (A, B, E, F)
or 10.sup.5 (C, D, G, H) CFU passaged Listeria vaccine vectors, and
antigen-specific T-cells were analyzed. B, D, F, H: unpassaged
Listeria vaccine vectors. A-D immune response to MHC class I
HIV-Gag peptide. E-H: immune response to an LLO peptide. I:
splenocytes from mice immunized with 10.sup.5 CFU passaged Lm-Gag
stimulated with a control peptide from HPV E7.
[0019] FIG. 9A shows plasmid isolation throughout LB stability
study. FIG. 9B shows plasmid isolation throughout TB stability
study. FIG. 9C shows quantitation of TB stability study.
[0020] FIG. 10 shows numbers of viable bacteria chloramphenicol
(CAP)-resistant and CAP-sensitive colony-forming units (CFU) from
bacteria grown in LB. Dark bars: CAP.sup.+; white bars: CAP.sup.-.
The two dark bars and two white bars for each time point represent
duplicate samples.
[0021] FIG. 11 shows numbers of viable bacteria CAP-resistant and
CAP-sensitive CFU from bacteria grown in TB. Dark bars: CAP.sup.+;
white bars: CAP. The two dark bars and two white bars for each time
point represent duplicate samples.
[0022] FIG. 12. Actual chromatograms showing the region of the
D133V mutation (arrows). The mixture ratio is shown in
parentheses.
[0023] FIG. 13. Representation of the location of the ADV451, 452
and 453 primers and the segment of the prfA gene amplified in the
reaction.
[0024] FIG. 14. Specificity of the PCR reaction using primers
ADV451 and ADV453.
[0025] FIG. 15. Specificity of the PCR reaction using primers
ADV452 and ADV453.
[0026] FIG. 16. Sensitivity of the PCR reaction to detect the
wild-type prfA sequence using the primer ADV452 and 1 ng as the
initial amount of DNA.
[0027] FIG. 17. Sensitivity of the PCR reaction to detect the
wild-type prfA sequence using the primer ADV452 and 5 ng as the
initial amount of DNA.
[0028] FIG. 18. Average density of the bands from the PCR depicted
in FIG. 16.
[0029] FIG. 19. Average density of the bands from the PCR depicted
in FIG. 17.
[0030] FIG. 20. Validation of the PCR reaction to detect the
wild-type prfA sequence using the primer ADV452.
[0031] FIG. 21. Average density of the bands from the PCR depicted
in FIG. 16.
[0032] FIG. 22. Analysis of the D133V prfA mutation in the
Lm-LLO-E7. A, Original image used for densitometry; B, Image was
digitally enhanced to facilitate the visualization of the low
density bands.
[0033] It will be appreciated that for simplicity and clarity of
illustration, elements shown in the figures have not necessarily
been drawn to scale. For example, the dimensions of some of the
elements may be exaggerated relative to other elements for clarity.
Further, where considered appropriate, reference numerals may be
repeated among the figures to indicate corresponding or analogous
elements.
DETAILED DESCRIPTION OF THE INVENTION
[0034] The present invention provides, in one embodiment, a
recombinant Listeria strain, said recombinant Listeria strain
comprising a recombinant nucleic acid, said nucleic acid comprising
a first open reading frame encoding a recombinant polypeptide
comprising a first an N-terminal fragment of an LLO protein fused
to a heterologous antigen or fragment thereof, wherein said
recombinant nucleic acid further comprises a second open reading
frame encoding a mutant PrfA protein, and wherein said Listeria
comprises a genomic mutation or deletion in the prfA gene. In
another embodiment, the mutant PrfA protein encoded by said second
open reading frame complements said genomic mutation or deletion in
said Listeria strain's prfA gene. In another embodiment, the mutant
PrfA protein encoded by said second open reading frame restores
partial PrfA function in said Listeria strain. In one embodiment,
the mutant PrfA protein encoded by said second open reading frame
comprises a point mutation in position 133. In another embodiment,
the mutation on residue 133 of the PrfA amino acid sequence is from
amino acid D or Asp or Aspartate (or Aspartic acid) to amino acid V
or Val or Valine.
[0035] The present invention further provides immunogenic
compositions comprising a recombinant Listeria strain provided
herein and methods of using the same, including methods of
treating, protecting against, and inducing an immune response
against a disease, where in some embodiments, the disease is a
tumor or cancer.
[0036] The present invention also provides methods for inducing an
anti-disease cytotoxic T-cell (CTL) response in a subject and
treating disorders, and symptoms associated with said disease
comprising administering a recombinant Listeria strain provided
herein, wherein in some embodiments the disease is a tumor or a
cancer.
[0037] In another embodiment, a recombinant Listeria provided
herein is an attenuated Listeria. "Attenuation" and "attenuated"
may encompass a bacterium, virus, parasite, infectious organism,
prion, tumor cell, gene in the infectious organism, and the like,
that is modified to reduce toxicity to a host. The host can be a
human or animal host, or an organ, tissue, or cell. The bacterium,
to give a non-limiting example, can be attenuated to reduce binding
to a host cell, to reduce spread from one host cell to another host
cell, to reduce extracellular growth, or to reduce intracellular
growth in a host cell. Attenuation can be assessed by measuring,
e.g., an indicum or indicia of toxicity, the LD.sub.50, the rate of
clearance from an organ, or the competitive index (see, e.g.,
Auerbuch, et al. (2001) Infect Immunity 69:5953-5957). Generally,
an attenuation results an increase in the LD.sub.50 and/or an
increase in the rate of clearance by at least 25%; more generally
by at least 50%; most generally by at least 100% (2-fold); normally
by at least 5-fold; more normally by at least 10-fold; most
normally by at least 50-fold; often by at least 100-fold; more
often by at least 500-fold; and most often by at least 1000-fold;
usually by at least 5000-fold; more usually by at least
10,000-fold; and most usually by at least 50,000-fold; and most
often by at least 100,000-fold.
[0038] It will be well appreciated by a skilled artisan that the
term "Attenuated gene" may encompass a gene that mediates toxicity,
pathology, or virulence, to a host, growth within the host, or
survival within the host, where the gene is mutated in a way that
mitigates, reduces, or eliminates the toxicity, pathology, or
virulence. The reduction or elimination can be assessed by
comparing the virulence or toxicity mediated by the mutated gene
with that mediated by the non-mutated (or parent) gene. "Mutated
gene" encompasses deletions, point mutations, and frameshift
mutations in regulatory regions of the gene, coding regions of the
gene, non-coding regions of the gene, or any combination
thereof.
[0039] In one embodiment, provided herein is a method for inducing
an immune response against a tumor or a cancer in a subject, the
method comprising the step of administering to said subject a
composition comprising a recombinant Listeria strain provided
herein, thereby inducing an immune response against a tumor or a
cancer.
[0040] In one embodiment, the present invention provides a method
of treating a tumor or cancer in a subject, comprising the step of
administering to the subject a composition comprising a recombinant
Listeria strain provided herein. In another embodiment, the present
invention provides a method of protecting a subject against a tumor
or cancer, comprising the step of administering to the subject the
recombinant Listeria strain provided herein. In another embodiment,
the recombinant Listeria strain expresses the recombinant
polypeptide. In another embodiment, the recombinant Listeria strain
comprises a plasmid that encodes the recombinant polypeptide. In
another embodiment, the recombinant Listeria strain comprises a
genomic mutation or deletion in the prfA gene.
[0041] In one embodiment, the methods provided herein further
comprise the step of boosting a subject with a composition
comprising a recombinant Listeria strain of the present invention.
In another embodiment, the method further comprises the step of
boosting the subject with an immunogenic composition comprising a
heterologous antigen or fragment thereof provided herein. In
another embodiment, the method further comprises the step of
boosting the subject with an immunogenic composition that directs a
cell of the subject to express the heterologous antigen. In another
embodiment, the cell is a tumor cell. In another embodiment, the
cell is an antigen-presenting cell. In another embodiment, the
method further comprises the step of boosting the subject with a
vaccine comprising a recombinant Listeria strain of the present
invention.
[0042] In one embodiment, the fragment thereof in the context of
LLO proteins and ActA proteins provided herein refer to a peptide
or polypeptide comprising an amino acid sequence of at least 5
contiguous amino acid residues of the LLO or ActA proteins. In
another embodiment, the term refers to a peptide or polypeptide
comprising an amino acid sequence of at least of at least 10
contiguous amino acid residues, at least 15 contiguous amino acid
residues, at least 20 contiguous amino acid residues, at least 25
contiguous amino acid residues, at least 40 contiguous amino acid
residues, at least 50 contiguous amino acid residues, at least 60
contiguous amino residues, at least 70 contiguous amino acid
residues, at least 80 contiguous amino acid residues, at least 90
contiguous amino acid residues, at least 100 contiguous amino acid
residues, at least 125 contiguous amino acid residues, at least 150
contiguous amino acid residues, at least 175 contiguous amino acid
residues, at least 200 contiguous amino acid residues, at least 250
contiguous amino acid residues of the amino acid sequence, at least
300 contiguous amino acid residues, at least 350 contiguous amino
acid residues of, at least 400 contiguous amino acid residues, or
at least 450 contiguous amino acid residues of an LLO or ActA
protein or polypeptide.
[0043] In another embodiment, a "fragment" is a functional fragment
that comprises a biological activity (e.g. to elicit an immune
response against a heterologous antigen expressed by a tumor cell,
either when administered alone or when administered in the context
of a fusion protein as further described herein. In another
embodiment, the fragment is functional in a non-fused form.
[0044] The present invention, in certain embodiments, provides
codon optimization of a nucleic acid heterologous to Listeria, or
of a nucleic acid endogenous to Listeria. The optimal codons
utilized by L. monocytogenes for each amino acid are shown US
Patent Publication 2007/0207170, which is hereby incorporated by
reference herein. A nucleic acid is codon-optimized if at least one
codon in the nucleic acid is replaced with a codon that is more
frequently used by L. monocytogenes for that amino acid than the
codon in the original sequence.
[0045] An N-terminal LLO protein fragment and heterologous antigen
provided herein are, in one embodiment, fused directly to one
another. In another embodiment, the genes encoding the N-terminal
LLO protein fragment and the heterologous antigen are fused
directly to one another. In another embodiment, the N-terminal LLO
protein fragment and the heterologous antigen are attached via a
linker peptide. In another embodiment, the N-terminal LLO protein
fragment and the heterologous antigen are attached via a
heterologous peptide. In another embodiment, the N-terminal LLO
protein fragment is N-terminal to the heterologous antigen. In
another embodiment, the N-terminal LLO protein fragment is the
N-terminal-most portion of the fusion protein. Each possibility
represents a separate embodiment of the present invention.
[0046] As provided herein, recombinant Listeria strains expressing
LLO-antigen fusions induce anti-tumor immunity (Example 1), elicit
antigen-specific T cell proliferation (Example 2), generate
antigen-specific, and tumor-infiltrating T cells (Example 3).
[0047] In another embodiment, the present invention provides a
method of treating a tumor or cancer in a subject, comprising the
step of administering to the subject a recombinant Listeria strain,
the recombinant Listeria strain comprising a recombinant
polypeptide comprising an N-terminal fragment of an LLO protein and
an HPV E7 antigen, whereby the recombinant Listeria strain induces
an immune response against the E7 antigen, thereby treating a tumor
or cancer in a subject. In another embodiment, the recombinant
Listeria strain expresses the recombinant polypeptide. In another
embodiment, the recombinant Listeria strain comprises a plasmid
that encodes the recombinant polypeptide. Each possibility
represents a separate embodiment of the present invention.
[0048] In one embodiment, the terms "recombinant polypeptide" and
"fusion protein" are used interchangeably herein.
[0049] In another embodiment, the present invention provides a
method of protecting a subject against a tumor or cancer,
comprising the step of administering to the subject a recombinant
Listeria strain, the recombinant Listeria strain comprising a
recombinant polypeptide comprising an N-terminal fragment of an LLO
protein and an HPV E7 antigen, whereby the recombinant Listeria
strain induces an immune response against the E7 antigen, thereby
protecting a subject against a tumor or cancer. In another
embodiment, the recombinant Listeria strain expresses the
recombinant polypeptide. In another embodiment, the recombinant
Listeria strain comprises a plasmid that encodes the recombinant
polypeptide. Each possibility represents a separate embodiment of
the present invention.
[0050] In another embodiment, the present invention provides a
method for inducing an immune response against a tumor or cancer in
a subject, comprising the step of administering to the subject a
recombinant Listeria strain, the recombinant Listeria strain
comprising a recombinant polypeptide comprising an N-terminal
fragment of an LLO protein and an HPV E7 antigen, thereby inducing
an immune response against a tumor or cancer in a subject. In
another embodiment, the recombinant Listeria strain expresses the
recombinant polypeptide. In another embodiment, the recombinant
Listeria strain comprises a plasmid that encodes the recombinant
polypeptide. Each possibility represents a separate embodiment of
the present invention.
[0051] In another embodiment, the present invention provides a
method of treating a tumor or cancer in a subject, comprising the
step of administering to the subject a recombinant Listeria strain,
the recombinant Listeria strain comprising a recombinant
polypeptide comprising an N-terminal fragment of an ActA protein
and heterologous antigen, whereby the recombinant Listeria strain
induces an immune response against the heterologous antigen,
thereby treating a tumor or cancer in a subject. In another
embodiment, the recombinant Listeria strain expresses the
recombinant polypeptide. In another embodiment, the recombinant
Listeria strain comprises a plasmid that encodes the recombinant
polypeptide. Each possibility represents a separate embodiment of
the present invention.
[0052] In another embodiment, the present invention provides a
method of protecting a subject against a tumor or cancer,
comprising the step of administering to the subject a recombinant
Listeria strain, the recombinant Listeria strain comprising a
recombinant polypeptide comprising an N-terminal fragment of an
ActA protein and a heterologous antigen, whereby the recombinant
Listeria strain induces an immune response against the heterologous
antigen, thereby protecting a subject against a tumor or cancer. In
another embodiment, the recombinant Listeria strain expresses the
recombinant polypeptide. In another embodiment, the recombinant
Listeria strain comprises a plasmid that encodes the recombinant
polypeptide. Each possibility represents a separate embodiment of
the present invention.
[0053] In another embodiment, the present invention provides a
method for inducing an immune response against a tumor or cancer in
a subject, comprising the step of administering to the subject a
recombinant Listeria strain, the recombinant Listeria strain
comprising a recombinant polypeptide comprising an N-terminal
fragment of an heterologous protein and a heterologous antigen,
thereby inducing an immune response against a tumor or cancer in a
subject. In another embodiment, the recombinant Listeria strain
expresses the recombinant polypeptide. In another embodiment, the
recombinant Listeria strain comprises a plasmid that encodes the
recombinant polypeptide. Each possibility represents a separate
embodiment of the present invention.
[0054] The N-terminal ActA protein fragment and the heterologous
antigen are, in another embodiment, fused directly to one another.
In another embodiment, the genes encoding the N-terminal ActA
protein fragment and heterologous antigen are fused directly to one
another. In another embodiment, the N-terminal ActA protein
fragment and heterologous antigen are attached via a linker
peptide. In another embodiment, the N-terminal ActA protein
fragment and heterologous antigen arc attached via a heterologous
peptide. In another embodiment, the N-terminal ActA protein
fragment is N-terminal to the heterologous antigen. In another
embodiment, the N-terminal ActA protein fragment is the
N-terminal-most portion of the fusion protein. Each possibility
represents a separate embodiment of the present invention.
[0055] In another embodiment, the present invention provides a
method of inducing an immune response against a tumor or cancer in
a subject, comprising the step of administering to the subject a
recombinant Listeria strain, the recombinant Listeria strain
comprising a recombinant polypeptide comprising a PEST amino acid
sequence-containing peptide and a heterologous antigen, whereby the
recombinant Listeria strain induces an immune response against the
heterologous antigen, thereby treating a tumor or cancer in a
subject. In another embodiment, the recombinant Listeria strain
expresses the recombinant polypeptide. In another embodiment, the
recombinant Listeria strain comprises a plasmid that encodes the
recombinant polypeptide. In another embodiment, the method protects
a subject against a tumor or cancer. In another embodiment, the
method treats a tumor or cancer in said subject.
[0056] The PEST amino acid sequence-containing peptide and
heterologous antigen are, in another embodiment, fused directly to
one another. In another embodiment, the genes encoding the PEST
amino acid sequence-containing peptide and heterologous antigen are
fused directly to one another. In another embodiment, the PEST
amino acid sequence-containing peptide and heterologous antigen are
attached via a linker peptide. In another embodiment, the PEST
amino acid sequence-containing peptide and heterologous antigen are
attached via a heterologous peptide. In another embodiment, the
PEST amino acid sequence-containing peptide is N-terminal to the
heterologous antigen. In another embodiment, the PEST amino acid
sequence-containing peptide is the N-terminal-most portion of the
fusion protein. Each possibility represents a separate embodiment
of the present invention.
[0057] In another embodiment, the present invention provides a
method for vaccinating a subject against an HPV, comprising the
step of administering to the subject a prfA mutant recombinant
Listeria strain provided herein, wherein the Listeria expresses an
HPV antigen and wherein the Listeria comprises a plasmid that
expresses a mutant PrfA protein. In another embodiment, the
recombinant Listeria strain expresses a recombinant polypeptide
comprising said HPV antigen. In another embodiment, the recombinant
Listeria strain comprises a plasmid that encodes the recombinant
polypeptide. Each possibility represents a separate embodiment of
the invention.
[0058] In one embodiment, provided herein is a method of increasing
a ratio of T effector cells to regulatory T cells (Tregs) in the
spleen and tumor microenvironments of a subject, comprising
administering the immunogenic composition provided herein. In
another embodiment, increasing a ratio of T effector cells to
regulatory T cells (Tregs) in the spleen and tumor
microenvironments in a subject allows for a more profound
anti-tumor response in the subject.
[0059] In one embodiment, a mutant PrfA protein provided herein
comprises a D133V amino acid mutation. In another embodiment, the
mutant PrfA protein consists of a D133V amino acid mutation. In
another embodiment, a nucleic acid comprising an open reading frame
encoding a mutant PrfA protein provided herein is in a plasmid in
said recombinant Listeria. In another embodiment, the plasmid
comprising a nucleic acid encoding a mutant PrfA protein provided
herein is an integrative plasmid. In another embodiment, the
plasmid comprising a nucleic acid encoding a mutant PrfA protein
provided herein is an episomal or extrachromosomal plasmid.
[0060] In one embodiment, a prfA mutant recombinant Listeria
provided herein comprises a partial deletion in or a complete
deletion of the chromosomal prfA gene. In another embodiment, the
prfA mutant Listeria comprises a loss-of-function mutation in the
prfA gene.
[0061] In one embodiment, a mutant PrfA protein provided herein
complements a genomic deletion, inactivation or mutation in the
prfA gene in a recombinant Listeria. In another embodiment, a
mutant PrfA protein provided herein complements a genomic deletion,
inactivation or mutation in the prjA gene in the recombinant
Listeria provided herein. In another embodiment, a mutant PrfA
protein provided herein restores partial prfA function in a
recombinant Listeria comprising a genomic deletion, inactivation or
mutation of the prfA gene. In another embodiment, a mutant PrfA
protein provided herein restores a loss-of PrfA function mutation
in a recombinant Listeria.
[0062] In one embodiment, a wild-type PrfA protein is encoded by
the following wild-type nucleic acid sequence set forth in SEQ ID
NO: 31.
TABLE-US-00001 (SEQ ID NO: 31) 1 atgaacgctc aagcagaaga attcaaaaaa
tatttagaaa ctaacgggat aaaaccaaaa 61 caatttcata aaaaagaact
tatttttaac caatgggatc cacaagaata ttgtattttt 121 ctatatgatg
gtatcacaaa gctcacgagt attagcgaga acgggaccat catgaattta 181
caatactaca aaggggcttt cgttataatg tctggcttta ttgatacaga aacatcggtt
241 ggctattata atttagaagt cattagcgag caggctaccg catacgttat
caaaataaac 301 gaactaaaag aactactgag caaaaatctt acgcactttt
tctatgtttt ccaaacccta 361 caaaaacaag tttcatacag cctagctaaa
tttaatgatt tttcgattaa cgggaagctt 421 ggctctattt gcggtcaact
tttaatcctg acctatgtgt atggtaaaga aactcctgat 481 ggcatcaaga
ttacactgga taatttaaca atgcaggagt taggatattc aagtggcatc 541
gcacatagct cagctgttag cagaattatt tccaaattaa agcaagagaa agttatcgtg
601 tataaaaatt catgctttta tgtacaaaat cttgattatc tcaaaagata
tgcccctaaa 661 ttagatgaat ggttttattt agcatgtcct gctacttggg
gaaaattaaa ttaa
[0063] In one embodiment, a wild-type PrfA protein comprises an
amino acid sequence set forth in SEQ ID NO: 32.
TABLE-US-00002 (SEQ ID NO: 32) M N A Q A E E F K K Y L E T N G I K
P K Q F H K K E L I F N Q W D P Q E Y C I F L Y D G I T K L T S I S
E N G T I M N L Q Y Y K G A F V I M S G F I D T E T S V G Y Y N L E
V I S E Q A T A Y V I K I N E L K E L L S K N L T H F F Y V F Q T L
Q K Q V S Y S L A K F N D F S I N G K L G S I C G Q L L I L T Y V Y
G K E T P D G I K I T L D N L T M Q E L G Y S S G I A H S S A V S R
I I S K L K Q E K V I V Y K N S C F Y V Q N L D Y L K R Y A P K L D
E W F Y L A C P A T W G K L N.
[0064] In one embodiment, a nucleic acid sequence encoding a mutant
prfA sequence is set forth in SEQ ID NO: 33.
TABLE-US-00003 (SEQ ID NO: 33) 1 atgaacgctc aagcagaaga attcaaaaaa
tatttagaaa ctaacgggat aaaaccaaaa 61 caatttcata aaaaagaact
tatttttaac caatgggatc cacaagaata ttgtattttt 121 ctatatgatg
gtatcacaaa gctcacgagt attagcgaga acgggaccat catgaattta 181
caatactaca aaggggcttt cgttataatg tctggcttta ttgatacaga aacatcggtt
241 ggctattata atttagaagt cattagcgag caggctaccg catacgttat
caaaataaac 301 gaactaaaag aactactgag caaaaatctt acgcactttt
tctatgtttt ccaaacccta 361 caaaaacaag tttcatacag cctagctaaa
tttaatgttt tttcgattaa cgggaagctt 421 ggctctattt gcggtcaact
tttaatcctg acctatgtgt atggtaaaga aactcctgat 481 ggcatcaaga
ttacactgga taatttaaca atgcaggagt taggatattc aagtggcatc 541
gcacatagct cagctgttag cagaattatt tccaaattaa agcaagagaa agttatcgtg
601 tataaaaatt catgctttta tgtacaaaat cgtgattatc tcaaaagata
tgcccctaaa 661 ttagatgaat ggttttattt agcatgtcct gctacttggg
gaaaattaaa ttaa
[0065] In one embodiment, a mutant PrfA protein provided herein
comprises an amino acid sequence set forth in SEQ ID NO: 34. [0066]
MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLY
DGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNL
EVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSL
AKFNVFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTM
QELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNRDY
LKRYAPKLDEWFYLACPATWGKLN(SEQIDNO: 34),Inanother embodiment, SEQ ID
NO: 34 represents a mutant PrfA protein comprising a D133V
mutation. In another embodiment, a mutant PrfA protein is
homologous to SEQ ID NO: 34 and comprises a D133V mutation. In
another embodiment, a mutant PrfA protein is at least 90%
homologous with SEQ ID NO: 34 and comprises a D133V mutation. In
another embodiment, a mutant PrfA protein is at least 85%
homologous with SEQ ID NO: 34, and comprises a D133V mutation.
[0067] In another embodiment, the subject is at risk for developing
an HPV-mediated carcinogenesis (e.g. a cervical, head and neck or
anal cancer). In another embodiment, the subject is
HPV-positive.
[0068] In another embodiment, the subject exhibits cervical
intraepithelial neoplasia. In another embodiment, the subject
exhibits a squamous intraepithelial lesion. In another embodiment,
the subject exhibits a dysplasia in the cervix.
[0069] The HPV that is the target of methods of the present
invention is, in another embodiment, an HPV 16. In another
embodiment, the HPV is an HPV-18. In another embodiment, the HPV is
selected from HPV-16 and HPV-18. In another embodiment, the HPV is
an HPV-31. In another embodiment, the HPV is an HPV-35. In another
embodiment, the HPV is an HPV-39. In another embodiment, the HPV is
an HPV-45. In another embodiment, the HPV is an HPV-51. In another
embodiment, the HPV is an HPV-52. In another embodiment, the HPV is
an HPV-58. In another embodiment, the HPV is a high-risk HPV type.
In another embodiment, the HPV is a mucosal HPV type. Each
possibility represents a separate embodiment of the present
invention.
[0070] In another embodiment, the present invention provides a
method of vaccinating a subject against an antigen of interest, the
method comprising the step of intravenously administering to the
subject an immunogenic composition, comprising a fusion of an
immunogenic peptide to the antigen of interest, wherein the
immunogenic peptide is selected from (a) an N-terminal fragment of
an LLO protein; (b) an ActA protein or N-terminal fragment thereof;
and (c) a PEST amino acid sequence-containing peptide, thereby
vaccinating a subject against an antigen of interest.
[0071] In another embodiment, the present invention provides a
method of vaccinating a subject against an antigen of interest, the
method comprising the step of administering intravenously to the
subject a recombinant Listeria strain comprising a recombinant
polypeptide, the recombinant polypeptide comprising an immunogenic
peptide fused to the antigen of interest, wherein the immunogenic
peptide is selected from (a) an N-terminal fragment of an LLO
protein; (b) an ActA protein or N-terminal fragment thereof; and
(c) a PEST amino acid sequence-containing peptide, thereby
vaccinating a subject against an antigen of interest.
[0072] In another embodiment, the present invention provides a
method of inducing a CTL response in a subject against an antigen
of interest, the method comprising the step of administering to the
subject a recombinant Listeria strain comprising or expressing the
antigen of interest, thereby inducing a CTL response in a subject
against an antigen of interest. In another embodiment, the step of
administering is intravenous or oral administration. Each
possibility represents a separate embodiment of the present
invention.
[0073] As provided herein, recombinant Listeria strains expressing
LLO-antigen fusions induce anti-tumor immunity (Example 1), elicit
antigen-specific T cell proliferation (Example 2), generate
antigen-specific, and tumor-infiltrating T cells (Example 3). Thus,
vaccines of the present invention are efficacious at inducing
immune responses against HPV antigens E7 and E6.
[0074] In another embodiment, the present invention provides a
method for inducing a regression of a cancer in a subject,
comprising the step of administering to the subject a composition
comprising a recombinant Listeria strain provided herein.
[0075] In another embodiment, the present invention provides a
method for reducing an incidence of relapse of a cancer in a
subject, comprising the step of administering to the subject a
composition comprising a recombinant Listeria strain provided
herein.
[0076] In another embodiment, the present invention provides a
method for suppressing a formation of a tumor in a subject,
comprising the step of administering to the subject a composition
comprising recombinant Listeria strain provided herein.
[0077] In another embodiment, the present invention provides a
method for inducing a remission of a cancer in a subject,
comprising the step of administering to the subject a composition
comprising a recombinant Listeria strain provided herein.
[0078] In another embodiment, the present invention provides a
method for impeding a growth of a tumor in a subject, comprising
the step of administering to the subject a composition comprising a
recombinant Listeria strain provided herein.
[0079] In another embodiment, the present invention provides a
method for reducing a size of a tumor in a subject, comprising the
step of administering to the subject a composition comprising a
recombinant Listeria strain provided herein.
[0080] In one embodiment, a disease is an infectious disease, an
autoimmune disease, a respiratory disease, a pre-cancerous
condition or a cancer.
[0081] It will be well appreciated by the skilled artisan that the
term "pre-cancerous condition" may encompass dysplasias,
preneoplastic nodules; macroregenerative nodules (MRN); low-grade
dysplastic nodules (LG-DN); high-grade dysplastic nodules
(HG-DN);
[0082] biliary epithelial dysplasia; foci of altered hepatocytes
(FAH); nodules of altered hepatocytes (NAH); chromosomal
imbalances; aberrant activation of telomerase; re-expression of the
catalytic subunit of telomerase; expression of endothelial cell
markers such as CD31, CD34, and BNH9 (see, e.g., Terracciano and
Tomillo (2003) Pathologica 95:71-82; Su and Bannasch (2003)
Toxicol. Pathol. 31:126-133; Rocken and Carl-McGrath (2001) Dig.
Dis. 19:269-278; Kotoula, et al. (2002) Liver 22:57-69; Frachon, et
al. (2001) J. Hepatol. 34:850-857; Shimonishi, et al. (2000) J.
Hepatobiliary Pancreat. Surg. 7:542-550; Nakanuma, et al. (2003) J.
Hepatobiliary Pancreat. Surg. 10:265-281). Methods for diagnosing
cancer and dysplasia are disclosed (see, e.g., Riegler (1996) Semin
Gastrointest. Dis. 7:74-87; Benvegnu, et al. (1992) Liver 12:80-83;
Giannini, et al. (1987) Hepatogastroenterol. 34:95-97; Anthony
(1976) Cancer Res. 36:2579-2583).
[0083] In one embodiment, an infectious disease is one caused by,
but not limited to, any one of the following pathogens:
BCG/Tuberculosis, Malaria, Plasmodium falciparum, plasmodium
malariae, plasmodium vivax, Rotavirus, Cholera, Diptheria-Tetanus,
Pertussis, Haemophilus influenzae, Hepatitis B, Human papilloma
virus, Influenza seasonal), Influenza A (H1N1) Pandemic, Measles
and Rubella, Mumps, Meningococcus A+C, Oral Polio Vaccines, mono,
bi and trivalent, Pneumococcal, Rabies, Tetanus Toxoid, Yellow
Fever, Bacillus anthracis (anthrax), Clostridium botulinum toxin
(botulism), Yersinia pestis (plague), Variola major (smallpox) and
other related pox viruses, Francisella tularensis (tularemia),
Viral hemorrhagic fevers, Arenaviruses (LCM, Junin virus, Machupo
virus, Guanarito virus, Lassa Fever), Bunyaviruses (Hantaviruses,
Rift Valley Fever), Flaviruses (Dengue), Filoviruses (Ebola ,
Marburg), Burkholderia pseudomallei, Coxiella burnetii (Q fever),
Brucella species (brucellosis), Burkholderia mallei (glanders),
Chlamydia psittaci (Psittacosis), Ricin toxin (from Ricinus
communis), Epsilon toxin of Clostridium perfringens,
[0084] Staphylococcus enterotoxin B, Typhus fever (Rickettsia
prowazekii), other Rickettsias, Food- and Waterborne Pathogens,
Bacteria (Diarrheagenic E.coli, Pathogenic Vibrios, Shigella
species, Salmonella BCG/, Campylobacter jejuni, Yersinia
enterocolitica), Viruses (Caliciviruses, Hepatitis A, West Nile
Virus, LaCrosse, California encephalitis, VEE, EEE, WEE, Japanese
Encephalitis Virus, Kyasanur Forest Virus, Nipah virus,
hantaviruses, Tickborne hemorrhagic fever viruses, Chikungunya
virus, Crimean-Congo Hemorrhagic fever virus, Tickborne
encephalitis viruses, Hepatitis B virus, Hepatitis C virus, Herpes
Simplex vim s (HSV), Human immunodeficiency vims (HIV), Human
papillomavirus (HPV)), Protozoa (Cryptosporidium parvum, Cyclospora
cayatanensis, Giardia lamblia, Entamoeba histolytica, Toxoplasma),
Fungi (Microsporidia), Yellow fever, Tuberculosis, including
drug-resistant TB, Rabies, Prions, Severe acute respiratory
syndrome associated coronavirus (SARS-CoV), Coccidioides posadasii,
Coccidioides immitis, Bacterial vaginosis, Chlamydia trachomatis,
Cytomegalovirus, Granuloma inguinale, Hemophilus ducreyi, Neisseria
gonorrhea, Treponema pallidum, Trichomonas vaginalis, or any other
infectious disease known in the art that is not listed herein.
[0085] In another embodiment, the infectious disease is a livestock
infectious disease. In another embodiment, livestock diseases can
be transmitted to man and are called "zoonotic diseases." In
another embodiment, these diseases include, but are not limited to,
Foot and mouth disease, West Nile Virus, rabies, canine parvovirus,
feline leukemia virus, equine influenza virus, infectious bovine
rhinotracheitis (IBR), pseudorabies, classical swine fever (CSF),
IBR, caused by bovine herpesvirus type 1 (BHV-1) infection of
cattle, and pseudorabies (Aujeszky's disease) in pigs,
toxoplasmosis, anthrax, vesicular stomatitis virus, rhodococcus
equi, Tularemia, Plague (Yersinia pestis), trichomonas.
[0086] In another embodiment, the disease provided herein is a
respiratory or inflammatory disease. In another embodiment, the
respiratory or inflammatory disease is chronic obstructive
pulmonary disease (COPD). In another embodiment, the disease is
asthma.
[0087] In one embodiment, live attenuated Listeria strains are
capable of alleviating asthma symptoms without co-administration of
other therapeutic agents, such as anti-inflammatory agents or
bronchodilators. In another embodiment, the methods provided herein
further comprise the step of co-administering to a subject a live
attenuated Listeria strain and one or more therapeutic agents. In
another embodiment, the therapeutic agent is an anti-asthmatic
agent. In another embodiment, the agent is an anti-inflammatory
agent, a non-steroidal anti-inflammatory agent, an antibiotic, an
antichlolinerginc agent, a bronchodilator, a corticosteroid, a
short-acting beta-agonist, a long-acting beta-agonist, combination
inhalers, an antihistamine, or combinations thereof.
[0088] In one embodiment, a disease is a cancer or a tumor. In one
embodiment, the tumor is cancerous. In another embodiment, the
cancer is breast cancer. In another embodiment, the cancer is a
cervical cancer. In another embodiment, the cancer is a Hcr2
containing cancer. In another embodiment, the cancer is a melanoma.
In another embodiment, the cancer is pancreatic cancer. In another
embodiment, the cancer is ovarian cancer. In another embodiment,
the cancer is gastric cancer. In another embodiment, the cancer is
a carcinomatous lesion of the pancreas. In another embodiment, the
cancer is pulmonary adenocarcinoma. In another embodiment, it is a
glioblastoma multiforme. In another embodiment, the cancer is
colorectal adenocarcinoma. In another embodiment, the cancer is
pulmonary squamous adenocarcinoma. In another embodiment, the
cancer is gastric adenocarcinoma. In another embodiment, the cancer
is an ovarian surface epithelial neoplasm (e.g. a benign,
proliferative or malignant variety thereof). In another embodiment,
the cancer is an oral squamous cell carcinoma. In another
embodiment, the cancer is non-small-cell lung carcinoma. In another
embodiment, the cancer is an endometrial carcinoma. In another
embodiment, the cancer is a bladder cancer. In another embodiment,
the cancer is a head and neck cancer. In another embodiment, the
cancer is a prostate carcinoma. In another embodiment, the cancer
is oropharyngeal cancer. In another embodiment, the cancer is lung
cancer. In another embodiment, the cancer is anal cancer. In
another embodiment, the cancer is colorectal cancer. In another
embodiment, the cancer is esophageal cancer. The cervical tumor
targeted by methods of the present invention is, in another
embodiment, a squamous cell carcinoma. In another embodiment, the
cervical tumor is an adenocarcinoma. In another embodiment, the
cervical tumor is an adenosquamous carcinoma. In another
embodiment, the cervical tumor is a small cell carcinoma. In
another embodiment, the cervical tumor is any other type of
cervical tumor known in the art.
[0089] A cervical tumor targeted by methods of the present
invention is, in one embodiment, a squamous cell carcinoma. In
another embodiment, the cervical tumor is an adenocarcinoma. In
another embodiment, the cervical tumor is an adenosquamous
carcinoma. In another embodiment, the cervical tumor is a small
cell carcinoma. In another embodiment, the cervical tumor is any
other type of cervical tumor known in the art. Each possibility
represents a separate embodiment of the present invention.
[0090] In one embodiment, the terms "tumor antigen" "antigenic
polypeptide," or "foreign antigen" arc used interchangeably herein
and include tumor antigens, tumor-associated antigens, angiogenic
antigens, or infectious disease antigens. In another embodiment, an
antigen provided herein is a self-antigen that is present in the
host but the host does not elicit an immune response against it
because of immunologic tolerance.
[0091] In one embodiment, the antigen is Human Papilloma Virus-E7
(HPV-E7) antigen, which in one embodiment, is from HPV16 (in one
embodiment, GenBank Accession No. AAD33253) and in another
embodiment, from HPV18 (in one embodiment, GenBank Accession No.
P06788). In another embodiment, the antigenic polypeptide is
IIPV-E6, which in one embodiment, is from HPV16 (in one embodiment,
GenBank Accession No. AAD33252, AAM51854, AAM51853, or AAB67615)
and in another embodiment, from HPV18 (in one embodiment, GenBank
Accession No. P06463). In another embodiment, the antigenic
polypeptide is a Her/2-neu antigen. In another embodiment, the
antigenic polypeptide is Prostate Specific Antigen (PSA) (in one
embodiment, GenBank Accession No. CAD30844, CAD54617, AAA58802, or
NP_001639). In another embodiment, the antigenic polypeptide is
Stratum Corneum Chymotryptic Enzyme (SCCE) antigen (in one
embodiment, GenBank Accession No. AAK69652, AAK69624, AAG33360,
AAF01139, or AAC37551). In another embodiment, the antigenic
polypeptide is Wilms tumor antigen 1, which in another embodiment
is WT-1 Telomerase (GenBank Accession. No. P49952, P22561,
NP_659032, CAC39220.2, or EAW68222.1). In another embodiment, the
antigenic polypeptide is hTERT or Telomerase (GenBank Accession.
No. NM003219 (variant 1), NM198255 (variant 2), NM 198253 (variant
3), or NM 198254 (variant 4). In another embodiment, the antigenic
polypeptide is Proteinase 3 (in one embodiment, GenBank Accession
No. M29142, M75154, M96839, X55668, NM 00277, M96628 or X56606). In
another embodiment, the antigenic polypeptide is Tyrosinase Related
Protein 2 (TRP2) (in one embodiment, GenBank Accession No.
NP_001913, ABI73976, AAP33051, or Q95119). In another embodiment,
the antigenic polypeptide is High Molecular Weight Melanoma
Associated Antigen (HMW-MAA) (in one embodiment, GenBank Accession
No. NP_001888, AAI28111, or AAQ62842). In another embodiment, the
antigenic polypeptide is Testisin (in one embodiment, GenBank
Accession No. AAF79020, AAF79019, AAG02255, AAK29360, AAD41588, or
NP_659206). In another embodiment, the antigenic polypeptide is
NY-ESO-1 antigen (in one embodiment, GenBank Accession No.
CAA05908, P78358, AAB49693, or NP_640343). In another embodiment,
the antigenic polypeptide is PSCA (in one embodiment, GenBank
Accession No. AAH65183, NP_005663, NP_082492, 043653, or CAB97347).
In another embodiment, the antigenic polypeptide is Interleukin
(IL) 13 Receptor alpha (in one embodiment, GenBank Accession No.
NP_000631, NP_001551, NP_032382, NP_598751, NP_001003075, or
NP_999506). In another embodiment, the antigenic polypeptide is
Carbonic anhydrase IX (CAIX) (in one embodiment, GenBank Accession
No. CAI13455, CAI10985, EAW58359, NP 001207, NP 647466, or NP
001101426). In another embodiment, the antigenic polypeptide is
carcinoembryonic antigen (CEA) (in one embodiment, GenBank
Accession No. AAA66186, CAA79884, CAA66955, AAA51966, AAD15250, or
AAA51970.). In another embodiment, the antigenic polypeptide is
MAGE-A (in one embodiment, GenBank Accession No. NP_786885,
NP_786884, NP_005352, NP_004979, NP_005358, or NP_005353). In
another embodiment, the antigenic polypeptide is survivin (in one
embodiment, GenBank Accession No. AAC51660, AAY15202, ABF60110,
NP_001003019, or NP_001082350). In another embodiment, the
antigenic polypeptide is GP100 (in one embodiment, GenBank
Accession No. AAC60634, YP_655861, or AAB31176). In another
embodiment, the antigenic polypeptide is any other antigenic
polypeptide known in the art. In another embodiment, the antigenic
peptide of the compositions and methods of the present invention
comprise an immunogenic portion of the antigenic polypeptide. Each
possibility represents a separate embodiment of the present
invention.
[0092] In another embodiment, the antigen is telomerase (TERT). In
another embodiment, the antigen is LMP-1. In another embodiment,
the antigen is p53. In another embodiment, the antigen is
mesothelin. In another embodiment, the antigen is EGFRVIII. In
another embodiment, the antigen is carboxic anhydrase IX (CAIX). In
another embodiment, the antigen is PSMA. In another embodiment, the
antigen is HMW-MAA. In another embodiment, the antigen is HIV-1
Gag. In another embodiment, the antigen is Tyrosinase related
protein 2. In another embodiment, the antigen is selected from
Her-2, HIV-1 Gag, LMP-1, p53, PSMA, carcinoembryonic antigen (CEA),
LMP-1,kallikrein-related peptidase 3 (KLK3), KLK9, Muc, Tyrosinase
related protein 2, Muc1, FAP, IL-13R alpha 2, PSA
(prostate-specific antigen), gp-100, heat-shock protein 70
(HSP-70), beta-HCG, EGFR-III, Granulocyte colony-stimulating factor
(G-CSF), Angiogenin, Angiopoietin-E Del-1, Fibroblast growth
factors: acidic (aFGF) or basic (bFGF), Follistatin, Granulocyte
colony-stimulating factor (G-CSF), Hepatocyte growth factor
(HGF)/scatter factor (SF), Interleukin-8 (IL-8), Leptin, Midkine,
Placental growth factor, Platelet-derived endothelial cell growth
factor (PD-ECGF), Platelet-derived growth factor-BB (PDGF-BB),
Pleiotrophin (PTN), Progranulin, Proliferin, Transforming growth
factor-alpha (TGF-alpha), Transforming growth factor-beta
(TGF-beta), Tumor necrosis factor-alpha (TNF-alpha), Vascular
endothelial growth factor (VEGF)/vascular permeability factor
(VPF), VEGFR, VEGFR2 (KDR/FLK-1) or a fragment thereof, ELK-1 or an
epitope thereof, ELK-E1 , FLK-E2, ELK-11, endoglin or a fragment
thereof, Neuropilin 1 (NRP-1), Angiopoietin 1 (Ang1), Tie2,
Platelet-derived growth factor (PDGF), Platelet-derived growth
factor receptor (PDGFR), Transforming growth factor-beta
(TGF-.beta.), endoglin, TGF-.beta. receptors, monocyte chemotactic
protein-1 (MCP-1), VE-cadhcrin, CD31, ephrin, ICAM-1, V-CAM-1,
VAP-1, E-scicctin, plasminogen activators, plasminogen activator
inhibitor-1, Nitric oxide synthase (NOS), COX-2, AC133, or Id1/Id3,
Angiopoietin 3, Angiopoietin 4, Angiopoietin 6, CD105, EDG, HHT1,
ORW, ORW1 or a TGFbeta co-receptor, or a combination thereof. In
another embodiment, the antigen is a chimeric Her2/neu antigen as
disclosed in US Patent Application Publication No. 2011/0142791,
which is incorporated by reference herein in its entirety. The use
of fragments of antigens provided herein is also encompassed by the
present invention.
[0093] In another embodiment, the tumor antigen provided herein is
a tumor-associated antigen, which in one embodiment, is one of the
following tumor antigens: a MAGE (Melanoma-Associated Antigen E)
protein, e.g. MAGE 1, MAGE 2, MAGE 3, MAGE 4, a tyrosinase; a
mutant ras protein; a mutant p53 protein; p97 melanoma antigen, a
ras peptide or p53 peptide associated with advanced cancers; the
HPV 16/18 antigens associated with cervical cancers, KLH antigen
associated with breast carcinoma, CEA (carcinoembryonic antigen)
associated with colorectal cancer, a MART1 antigen associated with
melanoma, or the PSA antigen associated with prostate cancer. In
another embodiment, the antigen for the compositions and methods
provided herein are melanoma-associated antigens, which in one
embodiment are TRP-2, MAGE-1, MAGE-3, gp-100, tyrosinase, HSP-70,
beta-HCG, or a combination thereof. It is to be understood that a
skilled artisan would be able to use any heterologous antigen not
mentioned herein but known in the art for use in the methods and
compositions provided herein. It is also to be understood that the
present invention provides, but is not limited by, an attenuated
Listeria comprising a nucleic acid that encodes at least one of the
antigens disclosed herein. The present invention encompasses
nucleic acids encoding mutants, muteins, splice variants,
fragments, truncated variants, soluble variants, extracellular
domains, intracellular domains, mature sequences, and the like, of
the disclosed antigens. Provided are nucleic acids encoding
epitopes, oligo- and polypeptides of these antigens. Also provided
are codon optimized embodiments, that is, optimized for expression
in Listeria. The cited references, GenBank Acc. Nos., and the
nucleic acids, peptides, and polypeptides disclosed herein, are all
incorporated herein by reference in their entirety. In another
embodiment, the selected nucleic acid sequence can encode a full
length or a truncated gene, a fusion or tagged gene, and can be a
cDNA, a genomic DNA, or a DNA fragment, preferably, a cDNA. It can
be mutated or otherwise modified as desired. These modifications
include codon optimizations to optimize codon usage in the selected
host cell or bacteria, i.e. Listeria. The selected sequence can
also encode a secreted, cytoplasmic, nuclear, membrane bound or
cell surface polypeptide.
[0094] In one embodiment, vascular endothelial growth factor (VEGF)
is an important signaling protein involved in both vasculogenesis
(the formation of the embryonic circulatory system) and
angiogenesis (the growth of blood vessels from pre-existing
vasculature). In one embodiment, VEGF activity is restricted mainly
to cells of the vascular endothelium, although it does have effects
on a limited number of other cell types (e.g. stimulation
monocyte/macrophage migration). In vitro, VEGF has been shown to
stimulate endothelial cell mitogenesis and cell migration. VEGF
also enhances microvascular permeability and is sometimes referred
to as vascular permeability factor.
[0095] In one embodiment, all of the members of the VEGF family
stimulate cellular responses by binding to tyrosine kinase
receptors (the VEGFRs) on the cell surface, causing them to
dimerize and become activated through transphosphorylation. The
VEGF receptors have an extracellular portion consisting of 7
immunoglobulin-like domains, a single transmembrane spanning region
and an intracellular portion containing a split tyrosine-kinase
domain.
[0096] In one embodiment, VEGF-A is a VEGFR-2 (KDR/Flk-1) ligand as
well as a VEGFR-1 (Flt-1) ligand. In one embodiment, VEGFR-
mediates almost all of the known cellular responses to VEGF. The
function of VEGFR-1 is less well defined, although it is thought to
modulate VEGFR-2 signaling, in one embodiment, via sequestration of
VEGF from VEGFR-2 binding, which in one embodiment, is particularly
important during vasculogenesis in the embryo. In one embodiment,
VEGF-C and VEGF-D are ligands of the VEGFR-3 receptor, which in one
embodiment, mediates lymphangiogenesis.
[0097] In one embodiment, the antigen of the present invention is a
VEGF receptor or a fragment thereof, which in one embodiment, is a
VEGFR-2 and, in another embodiment, a VEGFR-1, and, in another
embodiment, VEGFR-3.
[0098] In one embodiment, vascular Endothelial Growth Factor
Receptor 2 (VEGFR2) is highly expressed on activated endothelial
cells (ECs) and participates in the formation of new blood vessels.
In one embodiment, VEGFR2 binds all 5 isoforms of VEGF. In one
embodiment, signaling of VEGF through VEGFR2 on ECs induces
proliferation, migration, and eventual differentiation. In one
embodiment, the mouse homologue of VEGFR2 is the fetal liver kinase
gene-1 (Flk-1), which is a strong therapeutic target, and has
important roles in tumor growth, invasion, and metastasis. In one
embodiment, VEGFR2 is also referred to as kinase insert domain
receptor (a type III receptor tyrosine kinase) (KDR), cluster of
differentiation 309 (CD309), FLK1, Ly73, Krd-1, VEGFR, VEGFR-2, or
6130401C07.
[0099] In other embodiments, the antigen is derived from a fungal
pathogen, bacteria, parasite, helminth, or viruses. In other
embodiments, the antigen is selected from tetanus toxoid,
hemagglutinin molecules from influenza virus, diphtheria toxoid,
HIV gp120, HIV gag protein, IgA protease, insulin peptide B,
Spongospora subterranea antigen, vibriose antigens, Salmonella
antigens, pneumococcus antigens, respiratory syncytial virus
antigens, Haemophilus influenza outer membrane proteins,
Helicobacter pylori urease, Neisseria meningitidis pilins, N.
[0100] gonorrhoeae pilins, the melanoma-associated antigens (TRP-2,
MAGE-1, MAGE-3, gp-100, tyrosinase, MART-1, HSP-70, beta-HCG),
human papilloma virus antigens E1 and E2 from type HPV-16, -18,
-31, -33, -35 or -45 human papilloma viruses, the tumor antigens
CEA, the ras protein, mutated or otherwise, the p53 protein,
mutated or otherwise, Muc1, or pSA.
[0101] In other embodiments, the antigen is associated with one of
the following diseases; cholera, diphtheria, Haemophilus, hepatitis
A, hepatitis B, influenza, measles, meningitis, mumps, pertussis,
small pox, pneumococcal pneumonia, polio, rabies, rubella, tetanus,
tuberculosis, typhoid, Varicella-zoster, whooping cough3 yellow
fever, the immunogens and antigens from Addison's disease,
allergies, anaphylaxis, Bruton's syndrome, cancer, including solid
and blood borne tumors, eczema, Hashimoto's thyroiditis,
polymyositis, dermatomyositis, type 1 diabetes mellitus, acquired
immune deficiency syndrome, transplant rejection, such as kidney,
heart, pancreas, lung, bone, and liver transplants, Graves'
disease, polyendocrine autoimmune disease, hepatitis, microscopic
polyarteritis, polyarteritis nodosa, pemphigus, primary biliary
cirrhosis, pernicious anemia, coeliac disease, antibody-mediated
nephritis, glomerulonephritis, rheumatic diseases, systemic lupus
erthematosus, rheumatoid arthritis, seronegative
spondylarthritides, rhinitis, sjogren's syndrome, systemic
sclerosis, sclerosing cholangitis, Wegener's granulomatosis,
dermatitis herpetiformis, psoriasis, vitiligo, multiple sclerosis,
encephalomyelitis, Guillain-Barre syndrome, myasthenia gravis,
Lambert-Eaton syndrome, sclera, episclera, uveitis, chronic
mucocutaneous candidiasis, urticaria, transient
hypogammaglobulinemia of infancy, myeloma, X-linked hyper IgM
syndrome, Wiskott-Aldrich syndrome, ataxia telangiectasia,
autoimmune hemolytic anemia, autoimmune thrombocytopenia,
autoimmune neutropenia, Waldenstrom's macroglobulinemia,
amyloidosis, chronic lymphocytic leukemia, non-Hodgkin's lymphoma,
malarial circumsporozite protein, microbial antigens, viral
antigens, autoantigens, and lesteriosis.
[0102] In another embodiment, an HPV E6 antigen is utilized instead
of or in addition to an E7 antigen in a method of the present
invention for treating, protecting against, or inducing an immune
response against a cervical cancer.
[0103] In another embodiment, an ActA protein fragment is utilized
instead of or in addition to an LLO fragment in a method of the
present invention for treating, protecting against, or inducing an
immune response against a cervical cancer.
[0104] In another embodiment, a PEST amino acid sequence-containing
protein fragment is utilized instead of or in addition to an LLO
fragment in a method of the present invention for treating,
protecting against, or inducing an immune response against a
cervical cancer.
[0105] In another embodiment, the present invention provides a
method for inducing an anti-E7 cytotoxic T cell (CTL) response in a
subject, comprising the step of administering to the subject a
recombinant Listeria strain, the recombinant Listeria strain
comprising a recombinant polypeptide comprising an N-terminal
fragment of an LLO protein and an HPV E7 antigen, thereby inducing
an anti-E7 CTL response in a subject. In another embodiment, the
recombinant Listeria strain comprises a plasmid that encodes the
recombinant polypeptide. In another embodiment, the method further
comprises the step of boosting the subject with a recombinant
Listeria strain of the present invention. In another embodiment,
the method further comprises the step of boosting the subject with
an immunogenic composition comprising an E7 antigen. In another
embodiment, the method further comprises the step of boosting the
subject with an immunogenic composition that directs a cell of the
subject to express an E7 antigen. In another embodiment, the CTL
response is capable of therapeutic efficacy against an HPV-mediated
disease, disorder, or symptom. In another embodiment, the CTL
response is capable of prophylactic efficacy against an
HPV-mediated disease, disorder, or symptom. Each possibility
represents a separate embodiment of the present invention.
[0106] In another embodiment, the present invention provides a
method of treating or ameliorating an HPV-mediated disease,
disorder, or symptom in a subject, comprising the step of
administering to the subject a recombinant Listeria strain, the
recombinant Listeria strain comprising a recombinant polypeptide
comprising an N-terminal fragment of an LLO protein and an HPV E7
antigen, whereby the recombinant Listeria strain induces an immune
response against the E7 antigen, thereby treating or ameliorating
an HPV-mediated disease, disorder, or symptom in a subject. In
another embodiment, the subject is a human subject. In another
embodiment, the subject is a non-human mammal. In another
embodiment, the subject is any other type of subject known in the
art. Each possibility represents a separate embodiment of the
present invention.
[0107] In another embodiment, the HPV-mediated disease, disorder,
or symptom is genital warts. In another embodiment, the
HPV-mediated disease, disorder, or symptom is non-genital warts. In
another embodiment, the HPV-mediated disease, disorder, or symptom
is a respiratory papilloma. In another embodiment, the HPV-mediated
disease, disorder, or symptom is any other HPV-mediated disease,
disorder, or symptom known in the art. Each possibility represents
a separate embodiment of the present invention.
[0108] The antigen of methods and compositions of the present
invention is, in another embodiment, an HPV E7 protein. In another
embodiment, the antigen is an HPV E6 protein.
[0109] In another embodiment, the antigen is any other HPV protein
known in the art. Each possibility represents a separate embodiment
of the present invention.
[0110] "E7 antigen" refers, in another embodiment, to an E7
protein. In another embodiment, the term refers to an E7 fragment.
In another embodiment, the term refers to an E7 peptide. In another
embodiment, the term refers to any other type of E7 antigen known
in the art. Each possibility represents a separate embodiment of
the present invention.
[0111] The E7 protein of methods and compositions of the present
invention is, in another embodiment, an HPV 16 E7 protein. In
another embodiment, the E7 protein is an HPV-18 E7 protein. In
another embodiment, the E7 protein is an HPV-31 E7 protein. In
another embodiment, the E7 protein is an HPV-35 E7 protein. In
another embodiment, the E7 protein is an HPV-39 E7 protein. In
another embodiment, the E7 protein is an HPV-45 E7 protein. In
another embodiment, the E7 protein is an HPV-51 E7 protein. In
another embodiment, the E7 protein is an HPV-52 E7 protein. In
another embodiment, the E7 protein is an HPV-58 E7 protein. In
another embodiment, the E7 protein is an E7 protein of a high-risk
HPV type. In another embodiment, the E7 protein is an E7 protein of
a mucosal HPV type. Each possibility represents a separate
embodiment of the present invention.
[0112] "E6 antigen" refers, in another embodiment, to an E6
protein. In another embodiment, the term refers to an E6 fragment.
In another embodiment, the term refers to an E6 peptide. In another
embodiment, the term refers to any other type of E6 antigen known
in the art. Each possibility represents a separate embodiment of
the present invention.
[0113] The E6 protein of methods and compositions of the present
invention is, in another embodiment, an HPV 16 E6 protein. In
another embodiment, the E6 protein is an HPV-18 E6 protein. In
another embodiment, the E6 protein is an HPV-31 E6 protein. In
another embodiment, the E6 protein is an HPV-35 E6 protein. In
another embodiment, the E6 protein is an HPV-39 E6 protein. In
another embodiment, the E6 protein is an HPV-45 E6 protein. In
another embodiment, the E6 protein is an HPV-51 E6 protein. In
another embodiment, the E6 protein is an HPV-52 E6 protein. In
another embodiment, the E6 protein is an HPV-58 E6 protein. In
another embodiment, the E6 protein is an E6 protein of a high-risk
HPV type. In another embodiment, the E6 protein is an E6 protein of
a mucosal HPV type. Each possibility represents a separate
embodiment of the present invention.
[0114] In one embodiment, combinations of the E6 and E7 antigens
are contemplated to fall within the scope of a "heterologous
antigen" provided herein.
[0115] The immune response induced by methods and compositions of
the present invention is, in another embodiment, a T cell response.
In another embodiment, the immune response comprises a cytotoxic T
cell response. In another embodiment, the immune response comprises
a T cell response. In another embodiment, the response is a
CD8.sup.+ T cell response. In another embodiment, the response
comprises a CD8.sup.+ T cell response. Each possibility represents
a separate embodiment of the present invention.
[0116] The N-terminal LLO protein fragment of methods and
compositions of the present invention comprises, in another
embodiment, SEQ ID No: 2. In another embodiment, the fragment
comprises an LLO signal peptide. In another embodiment, the
fragment comprises SEQ ID No: 2. In another embodiment, the
fragment consists approximately of SEQ ID No: 2. In another
embodiment, the fragment consists essentially of SEQ ID No: 2. In
another embodiment, the fragment corresponds to SEQ ID No: 2. In
another embodiment, the fragment is homologous to SEQ ID No: 2. In
another embodiment, the fragment is homologous to a fragment of SEQ
ID No: 2. The .DELTA.LLO used in some of the Examples was 416 AA
long (exclusive of the signal sequence), as 88 residues from the
amino terminus which is inclusive of the activation domain
containing cysteine 484 were truncated. It will be clear to those
skilled in the art that any .DELTA.LLO without the activation
domain, and in particular without cysteine 484, are suitable for
methods and compositions of the present invention. In another
embodiment, fusion of an E7 and/or E6 antigen to any .DELTA.LLO,
including a PEST amino acid AA sequence, SEQ ID NO: 1, enhances
cell mediated and anti-tumor immunity of the antigen. Each
possibility represents a separate embodiment of the present
invention.
[0117] The LLO protein utilized to construct vaccines of the
present invention has, in another embodiment, the sequence: [0118]
MKKIMLVFITT NSLPIAQQTEAKDASAFNKENSTSSMAPPASPPASPKTPIEKKHADE
IDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQ
VVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNA
TKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAV
NNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVN
AENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSF
KAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIK
NNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNK
SKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTT
LYPKYSNKVDNPIE (GenBank Accession No. P13128; SEQ ID NO: 3; nucleic
acid sequence is set forth in GenBank Accession No. X15127). The
first 25 AA of the proprotein corresponding to this sequence are
the signal sequence and are cleaved from LLO when it is secreted by
the bacterium. Thus, in this embodiment, the full length active LLO
protein is 504 residues long. In another embodiment, a full length
LLO protein has an amino acid sequence of any full length wild-type
LLO protein known in the art. In another embodiment, SEQ ID NO: 3
is used as the source of the LLO fragment incorporated in a vaccine
of the present invention. Each possibility represents a separate
embodiment of the present invention.
[0119] In another embodiment, the N-terminal fragment of an LLO
protein utilized in compositions and methods of the present
invention has the sequence:
TABLE-US-00004 (SEQ ID NO: 2)
MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSVAPPASPPASPK
TPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIV
VEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRD
SLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYSNV
SAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVIS
FKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGR
QVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGG
SAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVI
KNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYD.
[0120] In another embodiment, the LLO fragment has the
sequence:
TABLE-US-00005 (SEQ ID NO: 4)
MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSVAPPASPPASPK
TPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIV
VEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRD
SLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYSNV
SAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVIS
FKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGR
QVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGG
SAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVI
KNNSEYIETTSKAYTD.
[0121] In one embodiment, "Listeriolysin O protein," or "LLO
protein," refer to a wild-type LLO protein unless stated to be a
fragment of the same. In another embodiment, "truncated LLO" or
".DELTA.LLO" refers to a fragment of LLO that comprises the PEST
amino acid domain. In another embodiment, the terms refer to an LLO
fragment that comprises a PEST sequence.
[0122] In another embodiment, the terms refer to an LLO fragment
that comprises a putative PEST sequence.
[0123] In another embodiment, the terms refer to an LLO fragment
that does not contain the activation domain at the carboxy terminus
and does not include cysteine 484. In another embodiment, the terms
refer to an LLO fragment that is not hemolytic. In another
embodiment, the LLO fragment is rendered non-hemolytic by deletion
or mutation of the activation domain. In another embodiment, the
LLO fragment is rendered non-hemolytic by deletion or mutation of
cysteine 484. In another embodiment, the LLO fragment is rendered
non-hemolytic by deletion or mutation at another location. Each
possibility represents a separate embodiment of the present
invention.
[0124] In another embodiment, the LLO fragment consists of about
the first 441 AA of a wild-type LLO protein. In another embodiment,
the LLO fragment consists of about the first 420 AA of LLO. In
another embodiment, the LLO fragment is a non-hemolytic form of the
LLO protein.
[0125] In another embodiment, the LLO fragment contains residues of
a homologous LLO protein that correspond to one of the above AA
ranges. The residue numbers need not, in another embodiment,
correspond exactly with the residue numbers enumerated above; e.g.
if the homologous LLO protein has an insertion or deletion,
relative to an LLO protein utilized herein, then the residue
numbers can be adjusted accordingly.
[0126] In another embodiment, the LLO fragment is any other LLO
fragment known in the art. Each possibility represents a separate
embodiment of the present invention.
[0127] In another embodiment, the recombinant polypeptide of
methods of the present invention is expressed by the recombinant
Listeria strain. In another embodiment, the expression is mediated
by a nucleotide molecule carried by the recombinant Listeria
strain.
[0128] In another embodiment, the recombinant Listeria strain
expresses the recombinant polypeptide by means of a plasmid that
encodes the recombinant polypeptide. In another embodiment, the
plasmid comprises a gene encoding a bacterial transcription factor.
In another embodiment, the plasmid encodes a Listeria transcription
factor. In another embodiment, the transcription factor is PrfA. In
another embodiment, the PrfA is a mutant PrfA. In another
embodiment, the PrfA contains a D133V amino acid mutation. In
another embodiment, the transcription factor is any other
transcription factor known in the art. In another embodiment, the
mutant PrfA encoded by said plasmid complements a genomic prfA
mutation, deletion or inactivation in said Listeria. In another
embodiment, the mutant PrfA encoded by said plasmid restores
partial PrfA function in said Listeria having a genomic prfA
mutation, deletion or inactivation. Each possibility represents a
separate embodiment of the present invention.
[0129] In another embodiment, a plasmid comprised by a recombinant
Listeria provided herein comprises an open reading frame encoding a
metabolic enzyme. In another embodiment, the plasmid comprises a
third open reading frame encoding a metabolic enzyme. In another
embodiment, the metabolic enzyme is a bacterial metabolic enzyme.
In another embodiment, the metabolic enzyme is a Listerial
metabolic enzyme. In another embodiment, the metabolic enzyme is an
amino acid metabolism enzyme. In another embodiment, the amino acid
metabolism gene is involved in a cell wall synthesis pathway. In
another embodiment, the metabolic enzyme is the product of a
D-amino acid aminotransferase gene (dat). In another embodiment,
the metabolic enzyme is the product of an alanine racemase gene
(dal). In another embodiment, the metabolic enzyme is any other
metabolic enzyme known in the art. In another embodiment, the
plasmid carries an open reading frame encoding a dal protein. In
another embodiment, the plasmid carries an open reading frame
encoding a dat protein. In another embodiment, the plasmid carries
an open reading frame encoding a dal and dat protein. In another
embodiment, when the plasmid carries an open reading frame encoding
a dal and/or dat protein, it is to complement a dal/dat mutation in
a recombinant Listeria strain. Hence, dal/dat recombinant Listerias
are also envisioned for use in the present invention. In another
embodiment, the recombinant Listeria provided herein comprises a
dal/dat mutation in addition to any other mutation further
described herein. Each possibility represents a separate embodiment
of the present invention.
[0130] In another embodiment, a Listeria strain provided herein is
deficient in an AA metabolism enzyme. In another embodiment, the
Listeria strain is deficient in a D-glutamic acid synthase gene. In
another embodiment, the Listeria strain is deficient in the dat
gene. In another embodiment, the Listeria strain is deficient in
the dal gene. In another embodiment, the Listeria strain is
deficient in the dga gene. In another embodiment, the Listeria
strain is deficient in a gene involved in the synthesis of
diaminopimelic acid (DAP). In another embodiment, the Listeria
strain is deficient in a gene involved in the synthesis of Cysteine
synthase A (CysK). In another embodiment, the gene is vitamin-B12
independent methionine synthase. In another embodiment, the gene is
trpA. In another embodiment, the gene is trpB. In another
embodiment, the gene is trpE. In another embodiment, the gene is
asnB. In another embodiment, the gene is gltD. In another
embodiment, the gene is gltB. In another embodiment, the gene is
leuA. In another embodiment, the gene is argG. In another
embodiment, the gene is thrC. In another embodiment, the Listeria
strain is deficient in one or more of the genes described
hereinabove.
[0131] In another embodiment, a Listeria strain provided herein is
deficient in a synthase gene. In another embodiment, the gene is an
AA synthesis gene. In another embodiment, the gene is folP. In
another embodiment, the gene is dihydrouridine synthase family
protein. In another embodiment, the gene is ispD. In another
embodiment, the gene is ispF. In another embodiment, the gene is
phosphoenolpyruvate synthase. In another embodiment, the gene is
hisF. In another embodiment, the gene is hisH. In another
embodiment, the gene is fil1. In another embodiment, the gene is
ribosomal large subunit pseudouridine synthase. In another
embodiment, the gene is ispD. In another embodiment, the gene is
bifunctional GMP synthase/glutamine amidotransferase protein. In
another embodiment, the gene is cobS. In another embodiment, the
gene is cobB. In another embodiment, the gene is cbiD. In another
embodiment, the gene is uroporphyrin-III
C-methyltransferase/uroporphyrinogen-III synthase. In another
embodiment, the gene is cobQ. In another embodiment, the gene is
uppS.
[0132] In another embodiment, the gene is truB. In another
embodiment, the gene is dxs. In another embodiment, the gene is
mvaS. In another embodiment, the gene is dapA. In another
embodiment, the gene is ispG. In another embodiment, the gene is
folC. In another embodiment, the gene is citrate synthase. In
another embodiment, the gene is argJ. In another embodiment, the
gene is 3-deoxy-7-phosphoheptulonate synthase. In another
embodiment, the gene is indole-3-glycerol-phosphate synthase. In
another embodiment, the gene is anthranilate synthase/glutamine
amidotransferase component. In another embodiment, the gene is
menB. In another embodiment, the gene is menaquinone-specific
isochorismate synthase. In another embodiment, the gene is
phosphoribosylformylglycinamidine synthase I or II. In another
embodiment, the gene is
phosphoribosylaminoimidazole-succinocarboxamide synthase. In
another embodiment, the gene is carB. In another embodiment, the
gene is carA. In another embodiment, the gene is thyA. In another
embodiment, the gene is mgsA. In another embodiment, the gene is
aroB. In another embodiment, the gene is hepB. In another
embodiment, the gene is rluB. In another embodiment, the gene is
ilvB. In another embodiment, the gene is ilvN. In another
embodiment, the gene is alsS. In another embodiment, the gene is
fabF. In another embodiment, the gene is fabH. In another
embodiment, the gene is pseudouridine synthase. In another
embodiment, the gene is pyrG. In another embodiment, the gene is
truA. In another embodiment, the gene is pabB. In another
embodiment, the gene is an atp synthase gene (e.g. atpC, atpD-2,
aptG, atpA-2, etc).
[0133] In another embodiment, the gene is phoP. In another
embodiment, the gene is aroA. In another embodiment, the gene is
aroC. In another embodiment, the gene is aroD. In another
embodiment, the gene is plcB.
[0134] In another embodiment, a Listeria strain provided herein is
deficient in a peptide transporter. In another embodiment, the gene
is ABC transporter/ATP-binding/permease protein. In another
embodiment, the gene is oligopeptide ABC
transporter/oligopeptide-binding protein. In another embodiment,
the gene is oligopeptide ABC transporter/permease protein. In
another embodiment, the gene is zinc ABC transporter/zinc-binding
protein. In another embodiment, the gene is sugar ABC transporter.
In another embodiment, the gene is phosphate transporter. In
another embodiment, the gene is ZIP zinc transporter. In another
embodiment, the gene is drug resistance transporter of the
EmrBlQacA family. In another embodiment, the gene is sulfate
transporter. In another embodiment, the gene is proton-dependent
oligopeptide transporter. In another embodiment, the gene is
magnesium transporter. In another embodiment, the gene is
formate/nitrite transporter. In another embodiment, the gene is
spermidine/putrescine ABC transporter. In another embodiment, the
gene is Na/Pi-cotransporter. In another embodiment, the gene is
sugar phosphate transporter. In another embodiment, the gene is
glutamine ABC transporter. In another embodiment, the gene is major
facilitator family transporter. In another embodiment, the gene is
glycine betaine/L-proline ABC transporter. In another embodiment,
the gene is molybdenum ABC transporter. In another embodiment, the
gene is techoic acid ABC transporter. In another embodiment, the
gene is cobalt ABC transporter. In another embodiment, the gene is
ammonium transporter. In another embodiment, the gene is amino acid
ABC transporter. In another embodiment, the gene is cell division
ABC transporter. In another embodiment, the gene is manganese ABC
transporter. In another embodiment, the gene is iron compound ABC
transporter. In another embodiment, the gene is
maltose/maltodextrin ABC transporter. In another embodiment, the
gene is drug resistance transporter of the Bcr/CflA family. In
another embodiment, the gene is a subunit of one of the above
proteins.
[0135] In one embodiment, provided herein is a nucleic acid
molecule that is used to transform the Listeria in order to arrive
at a recombinant Listeria. In another embodiment, the nucleic acid
provided herein used to transform Listeria lacks a virulence gene.
In another embodiment, the nucleic acid molecule is integrated into
the Listeria genome and carries a non-functional virulence gene. In
another embodiment, the virulence gene is mutated in the
recombinant Listeria. In yet another embodiment, the nucleic acid
molecule is used to inactivate the endogenous gene present in the
Listeria genome. In yet another embodiment, the virulence gene is
an actA gene, an inlA gene, and in1B gene, an inlC gene, inlJ gene,
a plbC gene, a bsh gene, or a prfA gene. It is to be understood by
a skilled artisan, that the virulence gene can be any gene known in
the art to be associated with virulence in the recombinant
Listeria.
[0136] In one embodiment, a live attenuated Listeria provided
herein is a recombinant
[0137] Listeria. In another embodiment, a recombinant Listeria
provided herein comprises a mutation of a genomic internalin C
(inlC) gene. In another embodiment, the recombinant Listeria
comprises a mutation or a deletion of a genomic actA gene and a
genomic internalin C gene. In one embodiment, translocation of
Listeria to adjacent cells is inhibited by the deletion of the actA
gene and/or the inlC gene, which are involved in the process,
thereby resulting in unexpectedly high levels of attenuation with
increased immunogenicity and utility as a strain backbone. Each
possibility represents a separate embodiment of the present
invention.
[0138] It will be appreciated by a skilled artisan that the term
"attenuation," may encompass a diminution in the ability of the
bacterium to cause disease in an animal. In other words, for
example the pathogenic characteristics of the attenuated Listeria
strain have been lessened compared with wild-type Listeria,
although the attenuated Listeria is capable of growth and
maintenance in culture. Using as an example the intravenous
inoculation of Balb/c mice with an attenuated Listeria, the lethal
dose at which 50% of inoculated animals survive (LD.sub.50) is
preferably increased above the LD.sub.50 of wild-type Listeria by
at least about 10-fold, more preferably by at least about 100-fold,
more preferably at least about 1,000 fold, even more preferably at
least about 10,000 fold, and most preferably at least about
100,000-fold. An attenuated strain of Listeria is thus one which
does not kill an animal to which it is administered, or is one
which kills the animal only when the number of bacteria
administered is vastly greater than the number of wild type
non-attenuated bacteria which would be required to kill the same
animal. An attenuated bacterium should also be construed to mean
one which is incapable of replication in the general environment
because the nutrient required for its growth is not present
therein. Thus, the bacterium is limited to replication in a
controlled environment wherein the required nutrient is provided.
The attenuated strains of the present invention arc therefore
environmentally safe in that they arc incapable of uncontrolled
replication.
[0139] In yet another embodiment, a Listeria strain provided herein
is an inlA mutant, an in1B mutant, an inlC mutant, an inlJ mutant,
prfA mutant, actA mutant, a dal/dat mutant, a prfA mutant, a plcB
deletion mutant, or a double mutant lacking both plcA and plcB. In
another embodiment, the Listeria comprises a deletion or mutation
of these genes individually or in combination. In another
embodiment, the Listeria provided herein lack each one of genes. In
another embodiment, the Listeria provided herein lack at least one
and up to ten of any gene provided herein, including the actA,
prfA, and dal/dat genes. In another embodiment, the prfA mutant is
a D133V PrfA mutant.
[0140] In one embodiment, the metabolic gene, the virulence gene,
etc. is lacking in a chromosome of the Listeria strain. In another
embodiment, the metabolic gene, virulence gene, etc. is lacking in
the chromosome and in any episomal genetic element of the Listeria
strain. In another embodiment, the metabolic gene, virulence gene,
etc. is lacking in the genome of the virulence strain. In one
embodiment, the virulence gene is mutated in the chromosome. In
another embodiment, the virulence gene is deleted from the
chromosome. In another embodiment, the metabolic gene, the
virulence gene, etc. is mutated in a chromosome of the Listeria
strain. In another embodiment, the metabolic gene, virulence gene,
etc. is mutated in the chromosome and in any episomal genetic
element of the Listeria strain. In another embodiment, the
metabolic gene, virulence gene, etc. is mutated in the genome of
the virulence strain. Tn another embodiment, the virulence gene is
deleted from the chromosome. Each possibility represents a separate
embodiment of the present invention.
[0141] In one embodiment, a recombinant Listeria strain provided
herein is attenuated. In another embodiment, the recombinant
Listeria lacks the actA virulence gene. In another embodiment, the
recombinant Listeria lacks the prfA virulence gene. In another
embodiment, the recombinant Listeria lacks the inlB gene. In
another embodiment, the recombinant Listeria lacks both, the actA
and inlB genes. In another embodiment, the recombinant Listeria
strain provided herein comprises an inactivating mutation of the
endogenous actA gene. In another embodiment, the recombinant
Listeria strain provided herein comprises an inactivating mutation
of the endogenous inlB gene. In another embodiment, the recombinant
Listeria strain provided herein comprises an inactivating mutation
of the endogenous inlC gene. In another embodiment, the recombinant
Listeria strain provided herein comprises an inactivating mutation
of the endogenous actA and inlB genes. In another embodiment, the
recombinant Listeria strain provided herein comprises an
inactivating mutation of the endogenous actA and inlC genes. In
another embodiment, the recombinant Listeria strain provided herein
comprises an inactivating mutation of the endogenous actA, inlB,
and inlC genes. In another embodiment, the recombinant Listeria
strain provided herein comprises an inactivating mutation of the
endogenous actA, inlB, and inlC genes. In another embodiment, the
recombinant Listeria strain provided herein comprises an
inactivating mutation of the endogenous actA, inlB, and inlC genes.
In another embodiment, the recombinant Listeria strain provided
herein comprises an inactivating mutation in any single gene or
combination of the following genes: actA, dat, inlB, inlC, prfA,
plcA, plcB.
[0142] It will be appreciated by a skilled artisan that the term
"mutation" and grammatical equivalents thereof, include any type of
mutation or modification to the sequence (nucleic acid or amino
acid sequence), and includes a deletion mutation, a truncation, an
inactivation, a disruption, or a translocation. These types of
mutations are readily known in the art.
[0143] In one embodiment, in order to select for auxotrophic
bacteria comprising a plasmid encoding a metabolic enzyme or a
complementing gene provided herein, transformed auxotrophic
bacteria are grown on a media that will select for expression of
the amino acid metabolism gene or the complementing gene. In
another embodiment, a bacteria auxotrophic for D-glutamic acid
synthesis is transformed with a plasmid comprising a gene for
D-glutamic acid synthesis, and the auxotrophic bacteria will grow
in the absence of D-glutamic acid, whereas auxotrophic bacteria
that have not been transformed with the plasmid, or are not
expressing the plasmid encoding a protein for D-glutamic acid
synthesis, will not grow. In another embodiment, a bacterium
auxotrophic for D-alanine synthesis will grow in the absence of
D-alanine when transformed and expressing the plasmid of the
present invention if the plasmid comprises an isolated nucleic acid
encoding an amino acid metabolism enzyme for D-alanine synthesis.
Such methods for making appropriate media comprising or lacking
necessary growth factors, supplements, amino acids, vitamins,
antibiotics, and the like are well known in the art, and are
available commercially (Becton-Dickinson, Franklin Lakes,
N.J.).
[0144] In another embodiment, once the auxotrophic bacteria
comprising the plasmid of the present invention have been selected
on appropriate media, the bacteria are propagated in the presence
of a selective pressure. Such propagation comprises growing the
bacteria in media without the auxotrophic factor. The presence of
the plasmid expressing an amino acid metabolism enzyme in the
auxotrophic bacteria ensures that the plasmid will replicate along
with the bacteria, thus continually selecting for bacteria
harboring the plasmid. The skilled artisan, when equipped with the
present disclosure and methods herein will be readily able to
scale-up the production of the Listeria vaccine vector by adjusting
the volume of the media in which the auxotrophic bacteria
comprising the plasmid are growing.
[0145] The skilled artisan will appreciate that, in another
embodiment, other auxotroph strains and complementation systems are
adopted for the use with this invention.
[0146] In one embodiment, a recombinant Listeria strain provided
herein expresses a recombinant polypeptide. In another embodiment,
a recombinant Listeria strain comprises a plasmid that encodes a
recombinant polypeptide. In another embodiment, a recombinant
nucleic acid provided herein is in a plasmid in the recombinant
Listeria strain provided herein. In another embodiment, the plasmid
is an episomal plasmid that does not integrate into the recombinant
Listeria strain's chromosome. In another embodiment, the plasmid is
an integrative plasmid that integrates into the Listeria strain's
chromosome. In another embodiment, the plasmid is a multicopy
plasmid. In another embodiment, the recombinant Listeria strain is
administered to the human subject at a dose of
1.times.10.sup.9-3.31.times.10.sup.10 CFU. In another embodiment,
the dose is 5-500.times.10.sup.8 CFU. In another embodiment, the
dose is 7-500.times.10.sup.8 CFU. In another embodiment, the dose
is 10-500.times.10.sup.8 CFU. In another embodiment, the dose is
20-500.times.10.sup.8 CFU. In another embodiment, the dose is
30-500.times.10.sup.8 CFU. In another embodiment, the dose is
50-500.times.10.sup.8 CFU. In another embodiment, the dose is
70-500.times.10.sup.8 CFU. In another embodiment, the dose is
100-500.times.10.sup.8 CFU. In another embodiment, the dose is
150-500.times.10.sup.8 CFU. In another embodiment, the dose is
5-300.times.10.sup.8 CFU. In another embodiment, the dose is
5-200.times.10.sup.8 CFU. In another embodiment, the dose is
5-150.times.10.sup.8 CFU. In another embodiment, the dose is
5-100.times.10.sup.8 CFU. In another embodiment, the dose is
5-70.times.10.sup.8 CFU. In another embodiment, the dose is
5-50.times.10.sup.8 CFU. In another embodiment, the dose is
5-30.times.10.sup.8 CFU. In another embodiment, the dose is
5-20.times.10.sup.8 CFU. In another embodiment, the dose is
1-30.times.10.sup.9 CFU. In another embodiment, the dose is
1-20.times.10.sup.9 CFU. In another embodiment, the dose is
2-30.times.10.sup.9 CFU. In another embodiment, the dose is
1-10.times.10.sup.9 CM. In another embodiment, the dose is
2-10.times.10.sup.9 CFU. In another embodiment, the dose is
3-10.times.10.sup.9 CFU. In another embodiment, the dose is
2-7.times.10.sup.9 CFU. In another embodiment, the dose is
2-5.times.10.sup.9 CFU. In another embodiment, the dose is
3-5.times.10.sup.9 CFU.
[0147] In another embodiment, the dose is 1.times.10.sup.7
organisms. In another embodiment, the dose is 1.times.10.sup.8
organisms. In another embodiment, the dose is 1.times.10.sup.9
organisms. In another embodiment, the dose is 1.5.times.10.sup.9
organisms. In another embodiment, the dose is 2.times.10.sup.9
organisms. In another embodiment, the dose is 3.times.10.sup.9
organisms. In another embodiment, the dose is 4.times.10.sup.9
organisms. In another embodiment, the dose is 5.times.10.sup.9
organisms. In another embodiment, the dose is 6.times.10.sup.9
organisms. In another embodiment, the dose is 7.times.10.sup.9
organisms. In another embodiment, the dose is 8.times.10.sup.9
organisms. In another embodiment, the dose is 10.times.10.sup.9
organisms. In another embodiment, the dose is 1.5.times.10.sup.10
organisms. In another embodiment, the dose is 2.times.10.sup.10
organisms. In another embodiment, the dose is 2.5.times.10.sup.10
organisms. In another embodiment, the dose is 3.times.10.sup.10
organisms. In another embodiment, the dose is 3.3.times.10.sup.10
organisms. In another embodiment, the dose is 4.times.10.sup.10
organisms. In another embodiment, the dose is 5.times.10.sup.10
organisms. Each dose and range of doses represents a separate
embodiment of the present invention.
[0148] In one embodiment, repeat administrations (doses) of
compositions of this invention may be undertaken immediately
following the first course of treatment or after an interval of
days, weeks or months to achieve tumor regression. In another
embodiment, repeat doses may be undertaken immediately following
the first course of treatment or after an interval of days, weeks
or months to achieve suppression of tumor growth. Assessment may be
determined by any of the techniques known in the art, including
diagnostic methods such as imaging techniques, analysis of serum
tumor markers, biopsy, or the presence, absence or amelioration of
tumor associated symptoms.
[0149] It will be appreciated by the skilled artisan that the term
"Boosting" may encompass administering an immunogenic composition
or recombinant Listeria strain dose to a subject. In another
embodiment, of methods of the present invention, 2 boosts (or a
total of 3 inoculations) are administered. In another embodiment, 3
boosts are administered. In another embodiment, 4 boosts are
administered. In another embodiment, 5 boosts are administered. In
another embodiment, 6 boosts are administered. In another
embodiment, more than 6 boosts are administered. Each possibility
represents a separate embodiment of the present invention.
[0150] In one embodiment, a method of present invention further
comprises the step of boosting the human subject with a recombinant
Listeria strain of the present invention. In another embodiment,
the recombinant Listeria strain used in the booster inoculation is
the same as the strain used in the initial "priming" inoculation.
In another embodiment, the booster strain is different from the
priming strain. In another embodiment, the same doses are used in
the priming and boosting inoculations. In another embodiment, a
larger dose is used in the booster. In another embodiment, a
smaller dose is used in the booster. In another embodiment, the
methods of the present invention further comprise the step of
administering to the subject a booster vaccination. In one
embodiment, the booster vaccination follows a single priming
vaccination. Tn another embodiment, a single booster vaccination is
administered after the priming vaccinations. In another embodiment,
two booster vaccinations are administered after the priming
vaccinations. In another embodiment, three booster vaccinations are
administered after the priming vaccinations. In one embodiment, the
period between a prime and a boost strain is experimentally
determined by the skilled artisan. In another embodiment, the
period between a prime and a boost strain is from 1 day and up to 1
week, in another embodiment it is up to 2 weeks, in another
embodiment, it is up to 3 weeks, in another embodiment, it is up to
4 weeks, in another embodiment, it is up to 5 weeks, in another
embodiment it is up to 6-8 weeks, in yet another embodiment, the
boost strain is administered up to 8-12 weeks after the prime
strain. Each possibility represents a separate embodiment of the
present invention.
[0151] In another embodiment, a method of present invention further
comprises the step of inoculating the human subject with an
immunogenic composition comprising the E7 antigen. In another
embodiment, the immunogenic composition comprises a recombinant E7
protein or fragment thereof. In another embodiment, the immunogenic
composition comprises a nucleotide molecule expressing a
recombinant E7 protein or fragment thereof. In another embodiment,
the non-Listerial inoculation is administered after the Listerial
inoculation. In another embodiment, the non-Listerial inoculation
is administered before the Listerial inoculation. Each possibility
represents a separate embodiment of the present invention.
[0152] The recombinant Listeria strain of methods and compositions
of the present invention is, in another embodiment, a recombinant
Listeria monocytogenes strain. In another embodiment, the Listeria
strain is a recombinant Listeria seeligeri strain. In another
embodiment, the Listeria strain is a recombinant Listeria grayi
strain. In another embodiment, the Listeria strain is a recombinant
Listeria ivanovii strain. In another embodiment, the Listeria
strain is a recombinant Listeria murrayi strain. In another
embodiment, the Listeria strain is a recombinant Listeria
welshimeri strain. In another embodiment, the Listeria strain is a
recombinant strain of any other Listeria species known in the art.
Each possibility represents a separate embodiment of the present
invention.
[0153] The present invention provides a number of Listerial species
and strains for making or engineering an attenuated Listeria of the
present invention. In one embodiment, the Listeria strain is L.
monocytogenes 10403S wild type (see Bishop and Hinrichs (1987) J.
Immunol. 139: 2005-2009; Lauer, et al. (2002) J. Bact. 184:
4177-4186.) In another embodiment, the Listeria strain is L.
monocytogenes DP-L4056 (phage cured) (see Lauer, et al. (2002) J.
Bact. 184: 4177-4186). In another embodiment, the Listeria strain
is L. monocytogenes DP-L4027, which is phage cured and deleted in
the lily gene (see Lauer, et al. (2002) J. Bact. 184: 4177-4186;
Jones and Portnoy (1994) Infect. Immunity 65: 5608-5613.). In
another embodiment, the Listeria strain is L. monocytogenes
DP-L4029, which is phage cured, deleted in ActA (see Lauer, et al.
(2002) J. Bact. 184: 4177-4186; Skoble, et al. (2000) J. Cell Biol.
150: 527-538). In another embodiment, the Listeria strain is L.
monocytogenes DP-L4042 (delta PEST) (see Brockstedt, et al. (2004)
Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting
information). In another embodiment, the Listeria strain is L.
monocytogenes DP-L4097 (LLO-S44A) (see Brockstedt, et al. (2004)
Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting
information). In another embodiment, the Listeria strain is L.
monocytogenes DP-L4364 (delta 1p1A; lipoate protein ligase) (see
Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101:
13832-13837; supporting information). In another embodiment, the
Listeria strain is L. monocytogenes DP-L4405 (delta in1A) (see
Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101:
13832-13837; supporting information). In another embodiment, the
Listeria strain is L. monocytogenes DP-L4406 (delta in1B) (see
Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101:
13832-13837; supporting information). In another embodiment, the
Listeria strain is L. monocytogenes CS-L0001 (delta ActA-delta
in1B) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA
101: 13832-13837; supporting information). In another embodiment,
the Listeria strain is L. monocytogenes CS-L0002 (delta ActA-delta
1p1A) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA
101: 13832-13837; supporting information). In another embodiment,
the Listeria strain is L. monocytogenes CS-L0003 (L461T-delta 1p1A)
(see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101:
13832-13837; supporting information). In another embodiment, the
Listeria strain is L. monocytogenes DP-L4038 (delta ActA-LLO L461T)
(see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101:
13832-13837; supporting information). In another embodiment, the
Listeria strain is L. monocytogenes DP-L4384 (S44A-LLO L461T) (see
Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101:
13832-13837; supporting information). In another embodiment, the
Listeria strain is L. monocytogenes. Mutation in lipoate protein
(see O'Riordan, et al. (2003) Science 302: 462-464). In another
embodiment, the Listeria strain is L. monocytogenes DP-L4017
(10403S hly (L461T), having a point mutation in hemolysin gene (see
U.S. Provisional Pat. Appl. Ser. No. 60/490,089 filed Jul. 24,
2003). In another embodiment, the Listeria strain is L.
monocytogenes EGD (see GenBank Acc. No. AL591824). In another
embodiment, the Listeria strain is L. monocytogenes EGD-e (see
GenBank Acc. No. NC_003210. ATCC Acc. No. BAA-679). In another
embodiment, the Listeria strain is L. monocytogenes DP-L4029
deleted in uvrAB (see U.S. Provisional Pat. Appl. Ser. No.
60/541,515 filed Feb. 2, 2004; US Provisional Pat. Appl. Ser. No.
60/490,080 filed Jul. 24, 2003). In another embodiment, the
Listeria strain is L. monocytogenes ActA-/in1B--double mutant (see
ATCC Acc. No. PTA-5562). In another embodiment, the Listeria strain
is L. monocytogenes 1p1A mutant or hly mutant (see U.S. Pat.
Applic. No. 20040013690 of Portnoy, et. al). In another embodiment,
the Listeria strain is L. monocytogenes DAL/DAT double mutant. (see
U.S. Pat. Applic. No. 20050048081 of Frankel and Portnoy. The
present invention encompasses reagents and methods that comprise
the above Listerial strains, as well as these strains that are
modified, e.g., by a plasmid and/or by genomic integration, to
contain a nucleic acid encoding one of, or any combination of, the
following genes: hly (LLO; listeriolysin); iap (p60); in1A; in1B;
in1C; dal (alanine racemase); dat (D-amino acid aminotransferase);
p1cA; p1cB; actA; or any nucleic acid that mediates growth, spread,
breakdown of a single walled vesicle, breakdown of a double walled
vesicle, binding to a host cell, uptake by a host cell. The present
invention is not to be limited by the particular strains disclosed
above.
[0154] In another embodiment, a recombinant Listeria strain of the
present invention has been passaged through an animal host. In
another embodiment, the passaging maximizes efficacy of the strain
as a vaccine vector. In another embodiment, the passaging
stabilizes the immunogenicity of the Listeria strain. In another
embodiment, the passaging stabilizes the virulence of the Listeria
strain. In another embodiment, the passaging increases the
immunogenicity of the Listeria strain. In another embodiment, the
passaging increases the virulence of the Listeria strain. In
another embodiment, the passaging removes unstable sub-strains of
the Listeria strain. In another embodiment, the passaging reduces
the prevalence of unstable sub-strains of the Listeria strain. In
another embodiment, the Listeria strain contains a genomic
insertion of the gene encoding the antigen-containing recombinant
peptide. In another embodiment, the Listeria strain carries a
plasmid comprising the gene encoding the antigen-containing
recombinant peptide. In another embodiment, the passaging is
performed as described herein (e.g. in Example 12). In another
embodiment, the passaging is performed by any other method known in
the art. Each possibility represents a separate embodiment of the
present invention.
[0155] In another embodiment, the recombinant Listeria strain
utilized in methods of the present invention has been stored in a
frozen cell bank. In another embodiment, the recombinant Listeria
strain has been stored in a lyophilized condition. Each possibility
represents a separate embodiment of the present invention.
[0156] In another embodiment, the cell bank of methods and
compositions of the present invention is a master cell hank. In
another embodiment, the cell bank is a working cell bank.
[0157] In another embodiment, the cell bank is Good Manufacturing
Practice (GMP) cell bank. In another embodiment, the cell bank is
intended for production of clinical-grade material. In another
embodiment, the cell bank conforms to regulatory practices for
human use. In another embodiment, the cell bank is any other type
of cell bank known in the art. Each possibility represents a
separate embodiment of the present invention.
[0158] "Good Manufacturing Practices" are defined, in another
embodiment, by (21 CFR 210-211) of the United States Code of
Federal Regulations. In another embodiment, "Good Manufacturing
Practices" are defined by other standards for production of
clinical-grade material or for human consumption; e.g. standards of
a country other than the United States. Each possibility represents
a separate embodiment of the present invention.
[0159] In another embodiment, a recombinant Listeria strain
utilized in methods of the present invention is from a batch of
vaccine doses.
[0160] In another embodiment, a recombinant Listeria strain
utilized in methods of the present invention is from a frozen or
lyophilized stock produced by methods provided in U.S. Pat. Ser.
No. 8,114,414, which is incorporated by reference herein.
[0161] In another embodiment, a peptide of the present invention is
a fusion peptide. In another embodiment, "fusion peptide" refers to
a peptide or polypeptide comprising 2 or more proteins linked
together by peptide bonds or other chemical bonds. In another
embodiment, the proteins are linked together directly by a peptide
or other chemical bond. In another embodiment, the proteins are
linked together with 1 or more AA (e.g. a "spacer") between the 2
or more proteins. Each possibility represents a separate embodiment
of the present invention.
[0162] In another embodiment, a vaccine of the present invention
further comprises an adjuvant. The adjuvant utilized in methods and
compositions of the present invention is, in another embodiment, a
granulocyte/macrophage colony-stimulating factor (GM-CSF) protein.
In another embodiment, the adjuvant comprises a GM-CSF protein. In
another embodiment, the adjuvant is a nucleotide molecule encoding
GM-CSF. In another embodiment, the adjuvant comprises a nucleotide
molecule encoding GM-CSF. In another embodiment, the adjuvant is
saponin QS21. In another embodiment, the adjuvant comprises saponin
QS21. In another embodiment, the adjuvant is monophosphoryl lipid
A. In another embodiment, the adjuvant comprises monophosphoryl
lipid A. In another embodiment, the adjuvant is SBAS2. In another
embodiment, the adjuvant comprises SBAS2. In another embodiment,
the adjuvant is an unmethylated CpG-containing oligonucleotide. In
another embodiment, the adjuvant comprises an unmethylated
CpG-containing oligonucleotide. In another embodiment, the adjuvant
is an immune-stimulating cytokine. In another embodiment, the
adjuvant comprises an immune-stimulating cytokine. In another
embodiment, the adjuvant is a nucleotide molecule encoding an
immune-stimulating cytokine. In another embodiment, the adjuvant
comprises a nucleotide molecule encoding an immune-stimulating
cytokine. In another embodiment, the adjuvant is or comprises a
quill glycoside. In another embodiment, the adjuvant is or
comprises a bacterial mitogen. In another embodiment, the adjuvant
is or comprises a bacterial toxin. In another embodiment, the
adjuvant is or comprises any other adjuvant known in the art. Each
possibility represents a separate embodiment of the present
invention.
[0163] In another embodiment, a nucleotide of the present invention
is operably linked to a promoter/regulatory sequence that drives
expression of the encoded peptide in the Listeria strain.
Promoter/regulatory sequences useful for driving constitutive
expression of a gene are well known in the art and include, but are
not limited to, for example, the P.sub.hlyA, P.sub.ActA, and p60
promoters of Listeria, the Streptococcus bac promoter, the
Streptomyces griseus sgiA promoter, and the B. thuringiensis phaZ
promoter. In another embodiment, inducible and tissue specific
expression of the nucleic acid encoding a peptide of the present
invention is accomplished by placing the nucleic acid encoding the
peptide under the control of an inducible or tissue specific
promoter/regulatory sequence. Examples of tissue specific or
inducible promoter/regulatory sequences which are useful for his
purpose include, but are not limited to the MMTV LTR inducible
promoter, and the SV40 late enhancer/promoter. In another
embodiment, a promoter that is induced in response to inducing
agents such as metals, glucocorticoids, and the like, is utilized.
Thus, it will be appreciated that the invention includes the use of
any promoter/regulatory sequence, which is either known or unknown,
and which is capable of driving expression of the desired protein
operably linked thereto.
[0164] An N-terminal fragment of an ActA protein utilized in
methods and compositions of the present invention has, in another
embodiment, the sequence set forth in SEQ ID NO: 5.
MRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAR
EVSSRDIKELEKSNKVRNTNKADLIAMLKEKAEKGPNINNNNSEQTENAAINEEASG
ADRPAIQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLTYPDKPTKVNKKKVAKES
VADASESDLDSSMQSADESSPQPLKANQQPFFPKVFKKIKDAGKWVRDKIDENPEVK
KAIVDKSAGLIDQLLTKKKSEEVNASDFPPPPTDEELRLALPETPMLLGFNAPATSEPS
SFEFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTEDELEIIRETASSLDS SF
TRGDLASLRNAINRHSQNFSDFPPIPTEEELNGRGGRP. In another embodiment, the
ActA fragment comprises the sequence set forth in SEQ ID NO: 5. In
another embodiment, the ActA fragment is any other ActA fragment
known in the art. Each possibility represents a separate embodiment
of the present invention.
[0165] In another embodiment, the recombinant nucleotide encoding a
fragment of an ActA protein comprises the sequence set forth in SEQ
ID NO: 6: [0166]
Atgcgtgcgatgatggtggttttcattactgccaattgcattacgattaaccccgacataatatttgcagcga-
cagatagcgaagattcta
gtctaaacacagatgaatgggaagaagaaaaaacagaagagcaaccaagcgaggtaaatacgggaccaagata-
cgaaactgcacg
tgaagtaagttcacgtgatattaaagaactagaaaaatcgaataaagtgagaaatacgaacaaagcagaccta-
atagcaatgttgaaag aaaaagc agaaaaaggtccaaatatcaataataacaacagtgaac
aaactgagaatgcggctataaatgaagaggcttcaggagccg
accgaccagctatacaagtggagcgtcgtcatccaggattgccatcggatagcgcagcggaaattaaaaaaag-
aaggaaagccatag
catcatcggatagtgagcttgaaagccttacttatccggataaaccaacaaaagtaaataagaaaaaagtggc-
gaaagagtcagttgcg
gatgcttctgaaagtgacttagattctagcatgcagtcagcagatgagtcttcaccacaacctttaaaagcaa-
accaacaaccatttttccc
taaagtatttaaaaaaataaaagatgcggggaaatgggtacgtgataaaatcgacgaaaatcctgaagtaaag-
aaagcgattgttgata
aaagtgcagggttaattgaccaattattaaccaaaaagaaaagtgaagaggtaaatgcttcggacttcccgcc-
accacctacggatgaa
gagttaagacttgctttgccagagacaccaatgcttcttggttttaatgctcctgctacatcagaaccgagct-
cattcgaatttccaccacca
cctacggatgaagagttaagacttgctagccagagacgccaatgcttatggattaatgctcctgctacatcgg-
aaccgagctcgttcga
ataccaccgcctccaacagaagatgaactagaaatcatccgggaaacagcatcctcgctagattctagattac-
aagaggggatttagct
agtttgagaaatgctattaatcgccatagtcaaaatttctctgatttcccaccaatcccaacagaagaagagt-
tgaacgggagaggcggt agacca. In another embodiment, the recombinant
nucleotide has the sequence set forth in SEQ ID NO: 6. In another
embodiment, the recombinant nucleotide comprises any other sequence
that encodes a fragment of an ActA protein. Each possibility
represents a separate embodiment of the present invention.
[0167] In another embodiment of the methods and compositions of the
present invention, a PEST amino acid AA sequence is fused to the E7
or E6 antigen. As provided herein, recombinant Listeria strains
expressing PEST amino acid sequence-antigen fusions induce
anti-tumor immunity (Example 3) and generate antigen-specific,
tumor-infiltrating T cells (Example 4). Further, enhanced cell
mediated immunity was demonstrated for fusion proteins comprising
an antigen and LLO containing the PEST amino acid AA sequence
TABLE-US-00006 (SEQ ID NO: 1) KENSISSMAPPASPPASPKTPIEKKHADEIDK.
[0168] Thus, fusion of an antigen to other LM PEST amino acid
sequences and PEST amino acid sequences derived from other
prokaryotic organisms will also enhance immunogenicity of the
antigen. The PEST amino acid AA sequence has, in another
embodiment, a sequence selected from SEQ ID NO: 7-12. In another
embodiment, the PEST amino acid sequence is a PEST amino acid
sequence from the LM ActA protein. In another embodiment, the PEST
amino acid sequence is KTEEQPSEVNTGPR (SEQ ID NO: 7),
KASVTDTSEGDLDSSMQSADESTPQPLK (SEQ ID NO: 8), KNEEVNASDFPPPPTDEELR
(SEQ ID NO: 9), or RGGIPTSEEFSSLNSGDFTDDENSETTEEEIDR (SEQ ID NO:
10). In another embodiment, the PEST amino acid sequence is from
Streptolysin O protein of Streptococcus sp. In another embodiment,
the PEST amino acid sequence is from Streptococcus pyogenes
Streptolysin O, e.g. KQNTASTETTTTNEQPK (SEQ ID NO: 11) at AA 35-51.
In another embodiment, the PEST amino acid sequence is from
Streptococcus equisimilis Streptolysin O, e.g. KQNTANTETTTTNEQPK
(SEQ ID NO: 12) at AA 38-54. In another embodiment, the PEST amino
acid sequence is another PEST amino acid AA sequence derived from a
prokaryotic organism. In another embodiment, the PEST amino acid
sequence is any other PEST amino acid sequence known in the art.
Each possibility represents a separate embodiment of the present
invention.
[0169] PEST amino acid sequences of other prokaryotic organism can
be identified in accordance with methods such as described by, for
example Rechsteiner and Rogers (1996, Trends Biochem. Sci.
21:267-271) for LM. Alternatively, PEST amino acid AA sequences
from other prokaryotic organisms can also be identified based by
this method. Other prokaryotic organisms wherein PEST amino acid AA
sequences would be expected to include, but are not limited to,
other Listeria species. In another embodiment, the PEST amino acid
sequence is embedded within the antigenic protein. Thus, in another
embodiment, "fusion" refers to an antigenic protein comprising both
the antigen and either i) an N-terminal LEO protein (tLEO), ii) an
N-terminal ActA protein or iii) a PEST amino acid sequence either
linked at one end of the antigen or embedded within the
antigen.
[0170] In another embodiment, a PEST amino acid sequence is
identified using any other method or algorithm known in the art,
e.g the CaSPredictor (Garay-Malpartida H M, Occhiucci J M, Alves J,
Belizario J E. Bioinformatics. 2005 June; 21 Suppl 1:i169-76). In
another embodiment, the following method is used:
[0171] A PEST index is calculated for each 30-35 AA stretch by
assigning a value of 1 to the amino acids Ser, Thr, Pro, Glu, Asp,
Asn, or Gln. The coefficient value (CV) for each of the PEST
residue is 1 and for each of the other AA (non-PEST) is 0.
[0172] Each method for identifying a PEST amino acid sequence
represents a separate embodiment of the present invention.
[0173] In another embodiment, the LLO protein, ActA protein, or
fragment thereof of the present invention need not be that which is
set forth exactly in the sequences set forth herein, hut rather
other alterations, modifications, or changes can be made that
retain the functional characteristics of an LLO or ActA protein
fused to an antigen as set forth elsewhere herein. In another
embodiment, the present invention utilizes an analog of an LLO
protein, ActA protein, or fragment thereof. Analogs differ, in
another embodiment, from naturally occurring proteins or peptides
by conservative AA sequence differences or by modifications which
do not affect sequence, or by both.
[0174] In another embodiment, either a whole E7 protein or a
fragment thereof is fused to a LLO protein, ActA protein, or PEST
amino acid sequence-containing peptide to generate a recombinant
peptide of methods of the present invention. The E7 protein that is
utilized (either whole or as the source of the fragments) has, in
another embodiment, the sequence
[0175] MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHY
NIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP (SEQ ID No: 13). In
another embodiment, the E7 protein is a homologue of SEQ ID No: 13.
In another embodiment, the E7 protein is a variant of SEQ ID No:
13. In another embodiment, the E7 protein is an isomer of SEQ ID
No: 13. In another embodiment, the E7 protein is a fragment of SEQ
ID No: 13. In another embodiment, the E7 protein is a fragment of a
homologue of SEQ ID No: 13. In another embodiment, the E7 protein
is a fragment of a variant of SEQ ID No: 13. In another embodiment,
the E7 protein is a fragment of an isomer of SEQ ID No: 13. Each
possibility represents a separate embodiment of the present
invention.
[0176] In another embodiment, the sequence of the E7 protein
is:
[0177] MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARR
AEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ (SEQ ID No:
14). In another embodiment, the E6 protein is a homologue of SEQ ID
No: 14. In another embodiment, the E6 protein is a variant of SEQ
ID No: 14. In another embodiment, the E6 protein is an isomer of
SEQ ID No: 14. In another embodiment, the E6 protein is a fragment
of SEQ ID No: 14. In another embodiment, the E6 protein is a
fragment of a homologue of SEQ ID No: 14. In another embodiment,
the E6 protein is a fragment of a variant of SEQ ID No: 14. In
another embodiment, the E6 protein is a fragment of an isomer of
SEQ ID No: 14. Each possibility represents a separate embodiment of
the present invention.
[0178] In another embodiment, the E7 protein has a sequence set
forth in one of the following GenBank entries: M24215, NC_004500,
V01116, X62843, or M14119. In another embodiment, the E7 protein is
a homologue of a sequence from one of the above GenBank entries. In
another embodiment, the E7 protein is a variant of a sequence from
one of the above GenBank entries. In another embodiment, the E7
protein is an isomer of a sequence from one of the above GenBank
entries. In another embodiment, the E7 protein is a fragment of a
sequence from one of the above GenBank entries. In another
embodiment, the E7 protein is a fragment of a homologue of a
sequence from one of the above GenBank entries. In another
embodiment, the E7 protein is a fragment of a variant of a sequence
from one of the above GenBank entries. In another embodiment, the
E7 protein is a fragment of an isomer of a sequence from one of the
above GenBank entries. Each possibility represents a separate
embodiment of the present invention.
[0179] In another embodiment, either a whole E6 protein or a
fragment thereof is fused to a LLO protein, ActA protein, or PEST
amino acid sequence-containing peptide to generate a recombinant
peptide of methods of the present invention. The E6 protein that is
utilized (either whole or as the source of the fragments) has, in
another embodiment, the sequence
[0180] MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFA
FRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCI
NCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL (SEQ ID No: 15). In
another embodiment, the E6 protein is a homologue of SEQ ID No: 15.
In another embodiment, the E6 protein is a variant of SEQ ID No:
15. In another embodiment, the E6 protein is an isomer of SEQ ID
No: 15. In another embodiment, the E6 protein is a fragment of SEQ
ID No: 15. In another embodiment, the E6 protein is a fragment of a
homologue of SEQ ID No: 15. In another embodiment, the E6 protein
is a fragment of a variant of SEQ ID No: 15. In another embodiment,
the E6 protein is a fragment of an isomer of SEQ ID No: 15.
[0181] Each possibility represents a separate embodiment of the
present invention.
[0182] In another embodiment, the sequence of the E6 protein
is:
[0183] MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFV
VYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPL
NPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV (SEQ ID No: 16). In
another embodiment, the E6 protein is a homologue of SEQ ID No: 16.
In another embodiment, the E6 protein is a variant of SEQ ID No:
16. In another embodiment, the E6 protein is an isomer of SEQ ID
No: 16. In another embodiment, the E6 protein is a fragment of SEQ
ID No: 16. In another embodiment, the E6 protein is a fragment of a
homologue of SEQ ID No: 16. In another embodiment, the E6 protein
is a fragment of a variant of SEQ ID No: 16. In another embodiment,
the E6 protein is a fragment of an isomer of SEQ ID No: 16. Each
possibility represents a separate embodiment of the present
invention.
[0184] In another embodiment, the E6 protein has a sequence set
forth in one of the following GenBank entries: M24215, M14119,
NC_004500, V01116, X62843, or M14119. In another embodiment, the E6
protein is a homologue of a sequence from one of the above GenBank
entries. In another embodiment, the E6 protein is a variant of a
sequence from one of the above GenBank entries. In another
embodiment, the E6 protein is an isomer of a sequence from one of
the above GenBank entries. In another embodiment, the E6 protein is
a fragment of a sequence from one of the above GenBank entries. In
another embodiment, the E6 protein is a fragment of a homologue of
a sequence from one of the above GenBank entries. In another
embodiment, the E6 protein is a fragment of a variant of a sequence
from one of the above GenBank entries. In another embodiment, the
E6 protein is a fragment of an isomer of a sequence from one of the
above GenBank entries. Each possibility represents a separate
embodiment of the present invention.
[0185] In another embodiment, "homology" refers to identity to an
LLO sequence (e.g. to one of SEQ ID No: 2-4) of greater than 60%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 2-4 of greater than 64%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 68%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 72%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 75%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 78%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 80%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 82%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 83%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 85%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 87%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 88%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 90%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 92%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 93%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 95%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 96%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 97%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of greater than 98%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 2-4 of greater than 99%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 2-4 of 100%. Each
possibility represents a separate embodiment of the present
invention.
[0186] In another embodiment, "homology" refers to identity to an
E7 sequence (e.g. to one of SEQ ID No: 13-14) of greater than 60%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 62%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 64%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 68%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 72%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 75%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 78%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 80%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 82%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 83%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 85%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 87%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 88%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 90%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 92%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 93%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 95%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 96%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 97%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of greater than 98%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 13-14 of greater than 99%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 13-14 of 100%. Each possibility represents a separate
embodiment of the present invention.
[0187] In another embodiment, "homology" refers to identity to an
E6 sequence (e.g. to one of SEQ ID No: 15-16) of greater than 60%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 64%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 68%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 72%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 75%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 78%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 80%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 82%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 83%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 85%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 87%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 88%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 90%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 92%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 93%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 95%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 96%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 97%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of greater than 98%.
In another embodiment, "homology" refers to identity to one of SEQ
ID No: 15-16 of greater than 99%. In another embodiment, "homology"
refers to identity to one of SEQ ID No: 15-16 of 100%. Each
possibility represents a separate embodiment of the present
invention.
[0188] In another embodiment, "homology" refers to identity to a
PEST amino acid sequence (e.g. to one of SEQ ID No: 1, and 7-12) or
to an ActA sequence (e.g. to one of SEQ ID No: 5-6) of greater than
60%. In another embodiment, "homology" refers to identity to one of
SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 60%. In
another embodiment, "homology" refers to identity to one of SEQ ID
No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 64%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 68%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 72%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 75%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 78%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 80%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 82%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 83%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 85%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 87%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ Ill No: 5-6 of greater than 88%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 90%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 92%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 93%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 95%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 96%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 97%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 98%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of greater than 99%. In another
embodiment, "homology" refers to identity to one of SEQ ID No: 1,
and 7-12 or SEQ ID No: 5-6 of 100%. Each possibility represents a
separate embodiment of the present invention.
[0189] Protein and/or peptide homology for any AA sequence listed
herein is determined, in one embodiment, by methods well described
in the art, including immunoblot analysis, or via computer
algorithm analysis of AA sequences, utilizing any of a number of
software packages available, via established methods. Some of these
packages include the FASTA, BLAST, MPsrch or Scanps packages, and
employ, in other embodiments, the use of the Smith and Waterman
algorithms, and/or global/local or BLOCKS alignments for analysis,
for example. Each method of determining homology represents a
separate embodiment of the present invention.
[0190] In another embodiment, the LLO protein, ActA protein, or
fragment thereof is attached to the antigen by chemical
conjugation. In another embodiment, glutaraldehyde is used for the
conjugation. In another embodiment, the conjugation is performed
using any suitable method known in the art. Each possibility
represents another embodiment of the present invention.
[0191] In another embodiment, fusion proteins of the present
invention are prepared by any suitable method, including, for
example, cloning and restriction of appropriate sequences or direct
chemical synthesis by methods discussed below. In another
embodiment, subsequences are cloned and the appropriate
subsequences cleaved using appropriate restriction enzymes. The
fragments are then ligated, in another embodiment, to produce the
desired DNA sequence. In another embodiment, DNA encoding the
fusion protein is produced using DNA amplification methods, for
example polymerase chain reaction (PCR). First, the segments of the
native DNA on either side of the new terminus are amplified
separately. The 5' end of the one amplified sequence encodes the
peptide linker, while the 3' end of the other amplified sequence
also encodes the peptide linker. Since the 5' end of the first
fragment is complementary to the 3' end of the second fragment, the
two fragments (after partial purification, e.g. on LMP agarose) can
be used as an overlapping template in a third PCR reaction. The
amplified sequence will contain codons, the segment on the carboxy
side of the opening site (now forming the amino sequence), the
linker, and the sequence on the amino side of the opening site (now
forming the carboxyl sequence). The insert is then ligated into a
plasmid.
[0192] In another embodiment, the LLO protein, ActA protein, or
fragment thereof and the antigen, or fragment thereof are
conjugated by a means known to those of skill in the art. In
another embodiment, the antigen, or fragment thereof is conjugated,
either directly or through a linker (spacer), to the ActA protein
or LLO protein. In another embodiment, the chimeric molecule is
recombinantly expressed as a single-chain fusion protein.
[0193] In another embodiment, a fusion peptide of the present
invention is synthesized using standard chemical peptide synthesis
techniques. Tn another embodiment, the chimeric molecule is
synthesized as a single contiguous polypeptide. In another
embodiment, the LLO protein, ActA protein, or fragment thereof; and
the antigen, or fragment thereof are synthesized separately, then
fused by condensation of the amino terminus of one molecule with
the carboxyl terminus of the other molecule, thereby forming a
peptide bond. In another embodiment, the ActA protein or LLO
protein and antigen are each condensed with one end of a peptide
spacer molecule, thereby forming a contiguous fusion protein.
[0194] In another embodiment, the peptides and proteins of the
present invention are prepared by solid-phase peptide synthesis
(SPPS) as described by Stewart et al. in Solid Phase Peptide
Synthesis, 2nd Edition, 1984, Pierce Chemical Company, Rockford,
Ill.; or as described by Bodanszky and Bodanszky (The Practice of
Peptide Synthesis, 1984, Springer-Verlag, New York). In another
embodiment, a suitably protected AA residue is attached through its
carboxyl group to a derivatized, insoluble polymeric support, such
as cross-linked polystyrene or polyamide resin. "Suitably
protected" refers to the presence of protecting groups on both the
alpha-amino group of the amino acid, and on any side chain
functional groups. Side chain protecting groups are generally
stable to the solvents, reagents and reaction conditions used
throughout the synthesis, and are removable under conditions which
will not affect the final peptide product. Stepwise synthesis of
the oligopeptide is carried out by the removal of the N-protecting
group from the initial AA, and couple thereto of the carboxyl end
of the next AA in the sequence of the desired peptide. This AA is
also suitably protected. The carboxyl of the incoming AA can be
activated to react with the N-terminus of the support-bound AA by
formation into a reactive group such as formation into a
carbodiimide, a symmetric acid anhydride or an "active ester" group
such as hydroxybenzotriazole or pentafluorophenly esters. The
pharmaceutical compositions containing vaccines and compositions of
the present invention are, in another embodiment, administered to a
subject by any method known to a person skilled in the art, such as
parenterally, paracancerally, transmucosally, transdermally,
intramuscularly, intravenously, intra-dermally, subcutaneously,
intra-peritonealy, intra-ventricularly, intra-cranially,
intra-vaginally or intra-tumorally.
[0195] In another embodiment of the methods and compositions
provided herein, the vaccines or compositions are administered
orally, and are thus formulated in a form suitable for oral
administration, i.e. as a solid or a liquid preparation. Suitable
solid oral formulations include tablets, capsules, pills, granules,
pellets and the like. Suitable liquid oral formulations include
solutions, suspensions, dispersions, emulsions, oils and the like.
In another embodiment of the present invention, the active
ingredient is formulated in a capsule. In accordance with this
embodiment, the compositions of the present invention comprise, in
addition to the active compound and the inert carrier or diluent, a
hard gelating capsule.
[0196] In another embodiment, the vaccines or compositions are
administered by intravenous, intra-arterial, or intra-muscular
injection of a liquid preparation. Suitable liquid formulations
include solutions, suspensions, dispersions, emulsions, oils and
the like. In one embodiment, the pharmaceutical compositions are
administered intravenously and are thus formulated in a form
suitable for intravenous administration. In another embodiment, the
pharmaceutical compositions are administered intra-arterially and
are thus formulated in a form suitable for intra-arterial
administration. In another embodiment, the pharmaceutical
compositions are administered intra-muscularly and are thus
formulated in a form suitable for intra-muscular
administration.
[0197] It will be appreciated by a skilled artisan that the term
"treating" may encompass both therapeutic treatment and
prophylactic or preventative measures, wherein the object is to
prevent or lessen the targeted pathologic condition or disorder as
described herein. Thus, in one embodiment, treating may include
directly affecting or curing, suppressing, inhibiting, preventing,
reducing the severity of, delaying the onset of, reducing symptoms
associated with the disease, disorder or condition, or a
combination thereof. Thus, in one embodiment, "treating" may
encompass inter alia delaying progression, expediting remission,
inducing remission, augmenting remission, speeding recovery,
increasing efficacy of or decreasing resistance to alternative
therapeutics, or a combination thereof. In one embodiment,
"preventing" or "impeding" may encompass, inter alia, delaying the
onset of symptoms, preventing relapse to a disease, decreasing the
number or frequency of relapse episodes, increasing latency between
symptomatic episodes, or a combination thereof. In one embodiment,
"suppressing" or "inhibiting", may encompass, inter alia, reducing
the severity of symptoms, reducing the severity of an acute
episode, reducing the number of symptoms, reducing the incidence of
disease-related symptoms, reducing the latency of symptoms,
ameliorating symptoms, reducing secondary symptoms, reducing
secondary infections, prolonging patient survival, or a combination
thereof.
[0198] In one embodiment, symptoms are primary, while in another
embodiment, symptoms are secondary. In one embodiment, "primary"
refers to a symptom that is a direct result of a particular disease
or disorder, while in one embodiment, "secondary" refers to a
symptom that is derived from or consequent to a primary cause. In
one embodiment, the compounds for use in the present invention
treat primary or secondary symptoms or secondary complications. In
another embodiment, "symptoms" may be any manifestation of a
disease or pathological condition.
[0199] In another embodiment, the present invention provides a kit
comprising vaccine of the present invention, an applicator, and
instructional material that describes use of the methods of the
invention. Although model kits are described below, the contents of
other useful kits will be apparent to the skilled artisan in light
of the present disclosure. Each of these kits represents a separate
embodiment of the present invention.
[0200] In one embodiment, the singular forms of words such as "a,"
"an," and "the," include their corresponding plural references
unless the context clearly dictates otherwise.
[0201] Throughout this application, various embodiments of this
invention may be presented in a range format. It should be
understood that the description in range format is merely for
convenience and brevity and should not be construed as an
inflexible limitation on the scope of the invention. Accordingly,
the description of a range should be considered to have
specifically disclosed all the possible sub ranges as well as
individual numerical values within that range. For example,
description of a range such as from 1 to 6 should be considered to
have specifically disclosed sub ranges such as from 1 to 3, from 1
to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as
well as individual numbers within that range, for example, 1, 2, 3,
4, 5, and 6. This applies regardless of the breadth of the
range.
[0202] Whenever a numerical range is indicated herein, it is meant
to include any cited numeral (fractional or integral) within the
indicated range. The phrases "ranging/ranges between" a first
indicate number and a second indicate number and "ranging/ranges
from" a first indicate number "to" a second indicate number are
used herein interchangeably and are meant to include the first and
second indicated numbers and all the fractional and integral
numerals there between.
[0203] It will he appreciated by a skilled artisan that the term
"about" when used to modify a numerically defined parameter may
encompass variation of the parameter in quantitative terms plus or
minus 5%, or in another embodiment plus or minus 10%, or in another
embodiment plus or minus 15%, or in another embodiment plus or
minus 20% of stated numerical value for that parameter.
[0204] It is to be understood by the skilled artisan that the term
"subject" can encompass a mammal including an adult human or a
human child, teenager or adolescent in need of therapy for, or
susceptible to, a condition or its sequelae, and also may include
non-human mammals such as dogs, cats, pigs, cows, sheep, goats,
horses, rats, and mice. It will also be appreciated that the term
may encompass livestock. The term "subject" does not exclude an
individual that is normal in all respects.
[0205] It will be appreciated by the skilled artisan that the term
"mammal" for purposes of treatment refers to any animal classified
as a mammal, including, but not limited to, humans, domestic and
farm animals, and zoo, sports, or pet animals, such as canines,
including dogs, and horses, cats, cattle, pigs, sheep, etc.
[0206] In the following examples, numerous specific details are set
forth in order to provide a thorough understanding of the
invention. However, it will be understood by those skilled in the
art that the present invention may be practiced without these
specific details. In other instances, well-known methods,
procedures, and components have not been described in detail so as
not to obscure the present invention. Thus these examples should in
no way be construed, as limiting the broad scope of the
invention.
Experimental Details Section
Example 1: LLO-Antigen Fusions Induce Anti-Tumor Immunity
Materials and Experimental Methods (EXAMPLES 1-2)
Cell Lines
[0207] The C57BL/6 syngeneic TC-1 tumor was immortalized with
HPV-16 E6 and E7 and transformed with the c-Ha-ras oncogene. TC-1,
provided by T. C. Wu (Johns Hopkins University School of Medicine,
Baltimore, MD) is a highly tumorigenic lung epithelial cell
expressing low levels of with HPV-16 E6 and E7 and transformed with
the c-Ha-ras oncogene. TC-1 was grown in RPMI 1640, 10% FCS, 2 mM
L-glutamine, 100 U/ml penicillin, 100 .mu.g/ml streptomycin, 100
.mu.M nonessential amino acids, 1 mM sodium pyruvate, 50 micromolar
(mcM) 2-ME, 400 microgram (mcg)/ml G418, and 10% National
Collection Type Culture-109 medium at 37.degree. with 10% CO.sub.2.
C3 is a mouse embryo cell from C57BL/6 mice immortalized with the
complete genome of HPV 16 and transformed with pEJ-ras. EL-4/E7 is
the thymoma EL-4 retrovirally transduced with E7.
L. monocytogenes Strains and Propagation
[0208] Listeria strains used were Lm-LLO-E7 (hly-E7 fusion gene in
an episomal expression system; FIG. 1A), Lm-E7 (single-copy E7 gene
cassette integrated into Listeria genome),
[0209] Lm-LLO-NP ("DP-L2028"; hly-NP fusion gene in an episomal
expression system), and Lm-Gag ("ZY-18"; single-copy HIV-1 Gag gene
cassette integrated into the chromosome). E7 was amplified by PCR
using the primers 5'-GGCTCGAGCATGGAGATACACC-3' (SEQ ID No: 17; Xhol
site is underlined) and 5'-GGGGACTAGTTTATGGTTTCTGAGAACA-3' (SEQ ID
No: 18; SpeI site is underlined) and ligated into pCR2.1
(Invitrogen, San Diego, Calif.). E7 was excised from pCR2.1 by
XhoI/Spel digestion and ligated into pGG-55. The hly-E7 fusion gene
and the pluripotential transcription factor prfA were cloned into
pAM401, a multicopy shuttle plasmid (Wirth R et al, J Bacteriol,
165: 831, 1986), generating pGG-55. The hly promoter drives the
expression of the first 441 AA of the hly gene product, (lacking
the hemolytic C-terminus, referred to below as ".DELTA.LLO," and
having the sequence set forth in SEQ ID No: 25), which is joined by
the XhoI site to the E7 gene, yielding a hly-E7 fusion gene that is
transcribed and secreted as LLO-E7. Transformation of a prfA
negative strain of Listeria, XFL-7 (provided by Dr. Hao Shen,
University of Pennsylvania), with pGG-55 selected for the retention
of the plasmid in vivo (FIGS. 1A-B). The hly promoter and gene
fragment were generated using primers
5'-GGGGGCTAGCCCTCCTTTGATTAGTATATTC-3' (SEQ ID No: 19; NheI site is
underlined) and 5'-CTCCCTCGAGATCATAATTTACTTCATC-3' (SEQ ID No: 20;
XhoI site is underlined). The prfA gene was PCR amplified using
primers
5'-GACTACAAGGACGATGACCGACAAGTGATAACCCGGGATCTAAATAAATCCGTTT-3' (SEQ
ID No: 27; XbaIsite is underlined) and
5'-CCCGTCGACCAGCTCTTCTTGGTGAAG-3' (SEQ ID No: 21; Sall site is
underlined). Lm-E7 was generated by introducing an expression
cassette containing the hly promoter and signal sequence driving
the expression and secretion of E7 into the orfZ domain of the LM
genome. E7 was amplified by PCR using the primers
5'-GCGGATCCCATGGAGATACACCTAC-3' (SEQ ID No: 22; BamHI site is
underlined) and 5'-GCTCTAGATTATGGTTTCTGAG-3' (SEQ ID No: 23; XbaI
site is underlined). E7 was then ligated into the pZY-21 shuttle
vector. LM strain 10403S was transformed with the resulting
plasmid, pZY-21-E7, which includes an expression cassette inserted
in the middle of a 1.6-kb sequence that corresponds to the orfX, Y,
Z domain of the LM genome. The homology domain allows for insertion
of the E7 gene cassette into the orfZ domain by homologous
recombination. Clones were screened for integration of the E7 gene
cassette into the orfZ domain. Bacteria were grown in brain heart
infusion medium with (Lm-LLO-E7 and Lm-LLO-NP) or without (Lm-E7
and ZY-18) chloramphenicol (20 .mu.g/ml). Bacteria were frozen in
aliquots at -80.degree. C. Expression was verified by Western
blotting (FIG. 2).
Western Blotting
[0210] Listeria strains were grown in Luria-Bertoni medium at
37.degree. C. and were harvested at the same optical density
measured at 600 nm. The supernatants were TCA precipitated and
resuspended in 1.times. sample buffer supplemented with 0.1 N NaOH.
Identical amounts of each cell pellet or each TCA-precipitated
supernatant were loaded on 4-20% Tris-glycine SDS-PAGE gels (NOVEX,
San Diego, Calif.). The gels were transferred to polyvinylidene
difluoride and probed with an anti-E7 monoclonal antibody (mAb)
(Zymed Laboratories, South San Francisco, Calif.), then incubated
with HRP-conjugated anti-mouse secondary Ab (Amersham Pharmacia
Biotech, Little Chalfont, U.K.), developed with Amersham ECL
detection reagents, and exposed to Hyperfilm (Amersham Pharmacia
Biotech).
Measurement of Tumor Growth
[0211] Tumors were measured every other day with calipers spanning
the shortest and longest surface diameters. The mean of these two
measurements was plotted as the mean tumor diameter in millimeters
against various time points. Mice were sacrificed when the tumor
diameter reached 20 mm Tumor measurements for each time point are
shown only for surviving mice.
Effects of Listeria Recombinants on Established Tumor Growth
[0212] Six- to 8-wk-old C57BL/6 mice (Charles River) received
2.times.10.sup.5 TC-1 cells s.c. on the left flank. One week
following tumor inoculation, the tumors had reached a palpable size
of 4-5 mm in diameter. Groups of eight mice were then treated with
0.1 LD.sub.50 i.p. Lm-LLO-E7 (10.sup.7 CFU), Lm- E7 (10.sup.6 CFU),
Lm-LLO-NP (10.sup.7 CFU), or Lm-Gag (5.times.10.sup.5 CFU) on days
7 and 14.
.sup.51Cr Release Assay
[0213] C57BL/6 mice, 6-8 wk old, were immunized i.p. with
0.1LD.sub.50 Lm-LLO-E7, Lm-E7, Lm-LLO-NP, or Lm-Gag. Ten days
post-immunization, spleens were harvested. Splenocytes were
established in culture with irradiated TC-1 cells (100:1,
splenocytes:TC-1) as feeder cells; stimulated in vitro for 5 days,
then used in a standard .sup.51Cr release assay, using the
following targets: EL-4, EL-4/E7, or EL-4 pulsed with E7 H-2b
peptide (RAHYNIVTF). E:T cell ratios, performed in triplicate, were
80:1, 40:1, 20:1, 10:1, 5:1, and 2.5:1. Following a 4-h incubation
at 37.degree. C., cells were pelleted, and 50 .mu.l supernatant was
removed from each well. Samples were assayed with a Wallac 1450
scintillation counter (Gaithersburg, Md.). The percent specific
lysis was determined as [(experimental counts per minute
(cpm)-spontaneous cpm)/(total cpm-spontaneous cpm)].times.100.
TC-1-Specific Proliferation
[0214] C57BL/6 mice were immunized with 0.1 LD.sub.50 and boosted
by i.p. injection 20 days later with 1 LD.sub.50 Lm-LLO-E7, Lm-E7,
Lm-LLO-NP, or Lm-Gag. Six days after boosting, spleens were
harvested from immunized and naive mice. Splenocytes were
established in culture at 5.times.10.sup.5/well in flat-bottom
96-well plates with 2.5.times.10.sup.4, 1.25.times.10.sup.4,
6.times.10.sup.3, or 3.times.10.sup.3 irradiated TC-1 cells/well as
a source of E7 Ag, or without TC-1 cells or with 10 .mu.g/ml Con A.
Cells were pulsed 45 h later with 0.5 .mu.Ci
[.sup.3H]thymidine/well. Plates were harvested 18 h later using a
Tomtec harvester 96 (Orange, Conn.), and proliferation was assessed
with a Wallac 1450 scintillation counter. The change in cpm was
calculated as experimental cpm-no Ag cpm.
Flow Cytometric Analysis
[0215] C57BL/6 mice were immunized intravenously (i.v.) with 0.1
LD.sub.50 Lm-LLO-E7 or Lm-E7 and boosted 30 days later. Three-color
flow cytometry for CD8 (53-6.7, PE conjugated), CD62 ligand (CD62L;
MEL-14, APC conjugated), and E7 H-2Db tetramer was performed using
a FACSCalibur.RTM. flow cytometer with CellQuest.RTM. software
(Becton Dickinson, Mountain View, Calif.). Splenocytes harvested 5
days after the boost were stained at room temperature (rt) with
H-2Db tetramers loaded with the E7 peptide (RAHYNIVTF) or a control
(HIV-Gag) peptide. Tetramers were used at a 1/200 dilution and were
provided by Dr. Larry R. Pease (Mayo Clinic, Rochester, Minn.) and
by the NIAID Tetramer Core Facility and the NIH AIDS Research and
Reference Reagent Program. Tetramer.sup.+, CD8.sup.+, CD62L.sup.low
cells were analyzed.
B16F0-Ova Experiment
[0216] 24 C57BL/6 mice were inoculated with 5.times.10.sup.5
B16F0-Ova cells. On days 3, 10 and 17, groups of 8 mice were
immunized with 0.1 LD.sub.50 Lm-OVA (10.sup.6 cfu), Lm-LLO-OVA
(10.sup.8 cfu) and eight animals were left untreated.
Statistics
[0217] For comparisons of tumor diameters, mean and SD of tumor
size for each group were determined, and statistical significance
was determined by Student's t test. p.ltoreq.0.05 was considered
significant.
Results
[0218] Lm-E7 and Lm-LLO-E7 were compared for their abilities to
impact on TC-1 growth. Subcutaneous tumors were established on the
left flank of C57BL/6 mice. Seven days later tumors had reached a
palpable size (4-5 mm). Mice were vaccinated on days 7 and 14 with
0.1 LD.sub.50 Lm-E7, Lm-LLO-E7, or, as controls, Lm-Gag and
Lm-LLO-NP. Lm-LLO-E7 induced complete regression of 75% of
established TC-1 tumors, while tumor growth was controlled in the
other 2 mice in the group (FIG. 3). By contrast, immunization with
Lm-E7 and Lm-Gag did not induce tumor regression. This experiment
was repeated multiple times, always with very similar results. In
addition, similar results were achieved for Lm-LLO-E7 under
different immunization protocols. In another experiment, a single
immunization was able to cure mice of established 5 mm TC-1
tumors.
[0219] In other experiments, similar results were obtained with 2
other E7-expressing tumor cell lines: C3 and EL-4/E7. To confirm
the efficacy of vaccination with Lm-LLO-E7, animals that had
eliminated their tumors were re-challenged with TC-1 or EL-4/E7
tumor cells on day 60 or day 40, respectively. Animals immunized
with Lm-LLO-E7 remained tumor free until termination of the
experiment (day 124 in the case of TC-1 and day 54 for
EL-4/E7).
[0220] Thus, expression of an antigen as a fusion protein with
.DELTA.LLO enhances the immunogenicity of the antigen.
Example 2: Lm-LLO-E7 Treatment Elicits TC-1 Specific Splenocyte
Proliferation
[0221] To measure induction of T cells by Lm-E7 with Lm-LLO-E7,
TC-1-specific proliferative responses, a measure of
antigen-specific immunocompetence, were measured in immunized mice.
Splenocytes from Lm-LLO-E7-immunized mice proliferated when exposed
to irradiated TC-1 cells as a source of E7, at splenocyte: TC-1
ratios of 20:1, 40:1, 80:1, and 160:1 (FIG. 4). Conversely,
splenocytes from Lm-E7 and rLm control-immunized mice exhibited
only background levels of proliferation.
Example 3: Fusion of E7 to LLO, ActA, or a Pest Amino Acid Sequence
Enhances E7-Specific Immunity and Generates Tumor-Infiltrating
E7-Specific CDS.sup.+ Cells
Materials and Experimental Methods
[0222] 500 mcl (microliter) of MATRIGEL.RTM., comprising 100 mcl of
2.times.10.sup.5 TC-1 tumor cells in phosphate buffered saline
(PBS) plus 400 mcl of MATRIGEL.RTM. (BD Biosciences, Franklin
Lakes, N.J.) were implanted subcutaneously on the left flank of 12
C57BL/6 mice (n=3). Mice were immunized intraperitoneally on day 7,
14 and 21, and spleens and tumors were harvested on day 28. Tumor
MATRIGELs were removed from the mice and incubated at 4.degree. C.
overnight in tubes containing 2 milliliters (ml) of RP 10 medium on
ice. Tumors were minced with forceps, cut into 2 mm blocks, and
incubated at 37.degree. C. for 1 hour with 3 ml of enzyme mixture
(0.2 mg/ml collagenase-P, 1 mg/ml DNAse-1 in PBS). The tissue
suspension was filtered through nylon mesh and washed with 5% fetal
bovine serum +0.05% of NaN.sub.3 in PBS for tetramer and IFN-gamma
staining.
[0223] Splenocytes and tumor cells were incubated with 1 micromole
(mcm) E7 peptide for 5 hours in the presence of brefeldin A at
10.sup.7 cells/ml. Cells were washed twice and incubated in 50 mcl
of anti-mouse Fc receptor supernatant (2.4 G2) for 1 hour or
overnight at 4.degree. C. Cells were stained for surface molecules
CD8 and CD62L, permeabilized, fixed using the permeabilization kit
Golgi-stop.RTM. or Golgi-Plug.RTM. (Pharmingen, San Diego, Calif.),
and stained for IFN-gamma. 500,000 events were acquired using
two-laser flow cytometer FACSCalibur and analyzed using Cellquest
Software (Becton Dickinson, Franklin Lakes, N.J.). Percentages of
IFN-gamma secreting cells within the activated (CD62L.sup.low)
CD8.sup.+ T cells were calculated.
[0224] For tetramer staining, H-2D.sup.b tetramer was loaded with
phycoerythrin (PE)-conjugated E7 peptide (RAHYNIVTF, SEQ ID NO:
24), stained at rt for 1 hour, and stained with
anti-allophycocyanin (APC) conjugated MEL-14 (CD62L) and
FITC-conjugated CD8.sup.+ at 4.degree. C. for 30 min. Cells were
analyzed comparing tetramer.sup.+CD8.sup.+ CD62L.sup.low cells in
the spleen and in the tumor.
Results
[0225] To analyze the ability of Lm-ActA-E7 to enhance antigen
specific immunity, mice were implanted with TC-1 tumor cells and
immunized with either Lm-LLO-E7 (1.times.10.sup.7 CFU), Lm-E7
(1.times.10.sup.6 CFU), or Lm-ActA-E7 (2.times.10.sup.8 CFU), or
were untreated (naive). Tumors of mice from the Lm-LLO-E7 and
Lm-ActA-E7 groups contained a higher percentage of
IFN-gamma-secreting CD8.sup.+ T cells (FIG. 5A) and
tetramer-specific CD8.sup.+ cells (FIG. 5B) than in Lm-E7 or naive
mice.
[0226] In another experiment, tumor-bearing mice were administered
Lm-LLO-E7, Lm-PEST-E7, Lm-APEST-E7, or Lm-E7epi, and levels of
E7-specific lymphocytes within the tumor were measured. Mice were
treated on days 7 and 14 with 0.1 LD.sub.50 of the 4 vaccines.
[0227] Tumors were harvested on day 21 and stained with antibodies
to CD62L, CD8, and with the E7/Db tetramer. An increased percentage
of tetramer-positive lymphocytes within the tumor were seen in mice
vaccinated with Lm-LLO-E7 and Lm-PEST-E7 (FIG. 6A). This result was
reproducible over three experiments (FIG. 6B).
[0228] Thus, Lm-LLO-E7, Lm-ActA-E7, and Lm-PEST-E7 are each
efficacious at induction of tumor-infiltrating CD8.sup.+ T cells
and tumor regression.
[0229] Example 4: Passaging of Listeria Vaccine Vectors Through
Mice Elicits Increased Immune Responses to Heterologous and
Endogenous Antigens
Materials and Experimental Methods
Bacterial Strains
[0230] L. monocytogenes strain 10403S, serotype 1 (ATCC, Manassas,
Va.) was the wild type organism used in these studies and the
parental strain of the constructs described below. Strain 10403S
has an LD.sub.50 of approximately 5.times.10.sup.4 CFU when
injected intraperitoneally into BALB/c mice. "Lm-Gag" is a
recombinant LM strain containing a copy of the HIV-1 strain HXB
(subtype B laboratory strain with a syncytia-forming phenotype) gag
gene stably integrated into the Listerial chromosome using a
modified shuttle vector pKSV7. Gag protein was expressed and
secreted by the strain, as determined by Western blot. All strains
were grown in brain-heart infusion (BHI) broth or agar plates
(Difco Labs, Detroit, Mich).
Bacterial Culture
[0231] Bacteria from a single clone expressing the passenger
antigen and/or fusion protein were selected and cultured in BHI
broth overnight. Aliquots of this culture were frozen at
-70.degree. C. with no additives. From this stock, cultures were
grown to 0.1-0.2 O.D. at 600 nm, and aliquots were again frozen at
-70.degree. C. with no additives. To prepare cloned bacterial
pools, the above procedure was used, but after each passage a
number of bacterial clones were selected and checked for expression
of the target antigen, as described herein. Clones in which
expression of the foreign antigen was confirmed were used for the
next passage.
Passage of Bacteria in Mice
[0232] 6-8 week old female BALB/c (H-2d) mice were purchased from
Jackson Laboratories (Bar Harbor, Me) and were maintained in a
pathogen-free microisolator environment. The titer of viable
bacteria in an aliquot of stock culture, stored frozen at
-70.degree. C., was determined by plating on BHI agar plates on
thawing and prior to use. In all, 5.times.10.sup.5 bacteria were
injected intravenously into BALB/c mice. After 3 days, spleens were
harvested, homogenized, and serial dilutions of the spleen
homogenate were incubated in BHI broth overnight and plated on BHI
agar plates. For further passage, aliquots were again grown to
0.1-0.2 O.D., frozen at -70.degree. C., and bacterial titer was
again determined by serial dilution. After the initial passage
(passage 0), this sequence was repeated for a total of 4 times.
Intracellular Cytokine Stain for IFN-Gamma
[0233] Lymphocytes were cultured for 5 hours in complete RPM1-10
medium supplemented with 50 U/ml human recombinant IL-2 and 1
microliter/ml Brefeldin A (Golgistop.TM.; PharMingen, San Diego,
Calif.) in the presence or absence of either the cytotoxic T-cell
(CTL) epitope for HIV-GAG (AMQMLKETI; SEQ ID No: 25), Listeria LLO
(GYKDGNEYI; SEQ ID No: 26) or the HPV virus gene E7 (RAHYNIVTF)
(SEQ ID No: 24), at a concentration of 1 micromole. Cells were
first surface-stained, then washed and subjected to intracellular
cytokine stain using the Cytofix/Cytoperm kit in accordance with
the manufacturer's recommendations (PharMingen, San Diego, Calif.).
For intracellular IFN-gamma stain, FITC-conjugated rat anti-mouse
IFN-gamma monoclonal antibody (clone XMG 1.2) and its isotype
control Ab (rat IgG1; both from PharMingen) was used. In all,
10.sup.6 cells were stained in PBS containing 1% Bovine Serum
Albumin and 0.02% sodium azide (FACS Buffer) for 30 minutes at
4.degree. C. followed by 3 washes in FACS buffer. Sample data were
acquired on either a FACScan.TM. flowcytometer or FACSCalibur.TM.
instrument (Becton Dickinson, San Jose, Calif.). Three-color flow
cytometry for CD8 (PERCP conjugated, rat anti-mouse, clone 53-6.7
Pharmingen, San Diego, Calif.), CD62L (APC conjugated, rat
anti-mouse, clone MEL-14), and intracellular IFN-gamma was
performed using a FACSCalibur.TM. flow cytometer, and data were
further analyzed with CELLQuest software (Becton Dickinson,
Mountain View, Calif.). Cells were gated on CD8 high and
CD62L.sup.low before they were analyzed for CD8.sup.+ and
intracellular IFN-gamma staining.
Results
Passaging in Mice Increases the Virulence of Recombinant Listeria
Monocytogenes
[0234] Three different constructs were used to determine the impact
of passaging on recombinant Listeria vaccine vectors. Two of these
constructs carry a genomic insertion of the passenger antigen: the
first comprises the HIV gag gene (Lm-Gag), and the second comprises
the HPV E7 gene (Lm-E7). The third (Lm-LLO-E7) comprises a plasmid
with the fusion gene for the passenger antigen (IIPV E7) fused with
a truncated version of LLO and a gene encoding prfA, the positive
regulatory factor that controls Listeria virulence factors. This
plasmid was used to complement a prfA negative mutant so that in a
live host, selection pressures would favor conservation of the
plasmid, because without it the bacterium is avirulent. All 3
constructs had been propagated extensively in vitro for many
bacterial generations.
[0235] Passaging the bacteria resulted in an increase in bacterial
virulence, as measured by numbers of surviving bacteria in the
spleen, with each of the first 2 passages. For Lm-Gag and
Lm-LLO-E7, virulence increased with each passage up to passage 2
(FIG. 7A). The plasmid-containing construct, Lm-LLO-E7,
demonstrated the most dramatic increase in virulence. Prior to
passage, the initial immunizing dose of Lm-LLO-E7 had to be
increased to 10.sup.7 bacteria and the spleen had to be harvested
on day 2 in order to recover bacteria (whereas an initial dose of
10.sup.5 bacteria for Lm-Gag was harvested on day 3). After the
initial passage, the standard dosage of Lm-LLO-E7 was sufficient to
allow harvesting on day 3. For Lm-E7, virulence increased by 1.5
orders of magnitude over unpassaged bacteria (FIG. 7B).
[0236] Thus, passage through mice increases the virulence of
Listeria vaccine strains
Passaging Increases the Ability of L. monocytogenes to Induce
CD8.sup.+ T Cells
[0237] Next, the effect of passaging on induction of
antigen-specific CD8.sup.+ T cells was determined by intracellular
cytokine staining with immunodominant peptides specific for
MHC-class I using HIV-Gag peptide AMQMLKETI (SEQ ID No: 25) and LLO
91-99 (GYKDGNEYI; SEQ ID No: 26). Injection of 10.sup.3 CFU
passaged bacteria (Lm-Gag) into mice elicited significant numbers
of HIV-Gag-specific CD8.sup.+ T cells, while the same dose of
non-passaged Lm-Gag induced no detectable Gag-specific CD8.sup.+ T
cells. Even increasing the dose of unpassaged bacteria 100-fold did
not compensate for their relative avirulence; in fact, no
detectable Gag-specific CD8.sup.+ T cells were elicited even at the
higher dose. The same dose increase with passaged bacteria
increased Gag-specific T cell induction by 50% (FIG. 8). The same
pattern of induction of antigen-specific CD8.sup.+ T cells was
observed with LLO-specific CD8.sup.+ T cells, showing that these
results were not caused by the properties of the passenger antigen,
since they were observed with LLO, an endogenous Listeria
antigen.
[0238] Thus, passage through mice increases the immunogenicity of
Listeria vaccine strains
Example 5: A PrfA-Containing Plasmid is Stable in an Lm Strain with
a Prfa Deletion in the Absence of Antibiotics
Materials and Experimental Methods
Bacteria
[0239] L. monocytogenes strain XFL7 contains a 300 base pair
deletion in the prfA gene XFL7 carries pGG55 which partially
restores virulence and confers CAP resistance, and is described in
United States Patent Application Publication No. 200500118184.
Development of Protocol for Plasmid Extraction from Listeria
[0240] 1 mL of Listeria monocytogenes Lm-LLO-E7 research working
cell bank vial was inoculated into 27 mL BH1 medium containing 34
.mu.g/mL CAP and grown for 24 hours at 37.degree. C. and 200
rpm.
[0241] Seven 2.5 mL samples of the culture were pcllctcd (15000 rpm
for 5 minutes), and pellets were incubated at 37.degree. C. with 50
.mu.l lysozyme solution for varying amounts of time, from 0-60
minutes.
[0242] Lysozyme solution:
[0243] 29 .mu.l 1 M dibasic Potassium Phosphate
[0244] 21 .mu.l 1 M monobasic Potassium Phosphate
[0245] 500 .mu.l 40% Sucrose (filter sterilized through 0.45/.mu.m
filter)
[0246] 450 .mu.l water
[0247] 60 .mu.l lysozyme (50 mg/mL)
[0248] After incubation with the lysozyme, the suspensions were
centrifuged as before and the supernatants discarded. Each pellet
was then subjected to plasmid extraction by a modified version of
the QIAprep Spin Miniprep Kit.RTM. (Qiagen, Germantown, Md.)
protocol. The changes to the protocol were as follows: [0249] 1.
The volumes of buffers P1, P2 and N3 were all increased threefold
to allow complete lysis of the increased biomass. [0250] 2. 2 mg/mL
of lysozyme was added to the resuspended cells before the addition
of P2.
[0251] The lysis solution was then incubated at 37.degree. C. for
15 minutes before neutralization. [0252] 3. The plasmid DNA was
resuspended in 30 .mu.L rather than 50 .mu.L to increase the
concentration.
[0253] In other experiments, the cells were incubated for 15 min in
P1 buffer +Lysozyme, then incubated with P2 (lysis buffer) and P3
(neutraliztion buffer) at room temperature.
[0254] Equal volumes of the isolated plasmid DNA from each
subculture were run on an 0.8% agarose gel stained with ethidium
bromide and visualized for any signs of structural or segregation
instability.
[0255] The results showed that plasmid extraction from L.
monocytogenes Lm-LLO-E7 increases in efficiency with increasing
incubation time with lysozyme, up to an optimum level at
approximately 50 minutes incubation.
[0256] These results provide an effective method for plasmid
extraction from Listeria vaccine strains.
Replica Plating
[0257] Dilutions of the original culture were plated onto plates
containing LB or TB agar in the absence or presence of 34 .mu.g/mL
CAP. The differences between the counts on selective and
non-selective agar were used to determine whether there was any
gross segregational instability of the plasmid.
Results
[0258] The genetic stability (i.e. the extent to which the plasmid
is retained by or remains stably associated with the bacteria in
the absence of selection pressure; e.g. antibiotic selection
pressure) of the pGG55 plasmid in L. monocytogenes strain XFL7 in
the absence of antibiotic was assessed by serial sub-culture in
both Luria-Bertani media (LB: 5 g/L NaCl, 10 g/ml soy peptone, 5
g/L yeast extract) and Terrific Broth media (TB: 10 g/L glucose,
11.8 g/L soy peptone, 23.6 g/L yeast extract, 2.2 g/L
KH.sub.2PO.sub.4, 9.4 g/L K.sub.2HPO.sub.4), in duplicate cultures.
50 mL of fresh media in a 250 mL baffled shake flask was inoculated
with a fixed number of cells (1 ODmL), which was then subcultured
at 24 hour intervals. Cultures were incubated in an orbital shaker
at 37.degree. C. and 200 rpm. At each subculture the OD.sub.600 was
measured and used to calculate the cell doubling time (or
generation) elapsed, until 30 generations were reached in LB and 42
in TB. A known number of cells (15 OD mL) at each subculture stage
(approximately every 4 generations) were pelleted by
centrifugation, and the plasmid DNA was extracted using the Qiagen
QIAprep Spin Miniprep.RTM. protocol described above. After
purification, plasmid DNA was subjected to agarose gel
electrophoresis, followed by ethidium bromide staining. While the
amount of plasmid in the preps varied slightly between samples, the
overall trend was a constant amount of plasmid with respect to the
generational number of the bacteria (FIGS. 9A-B). Thus, pGG55
exhibited stability in strain XFL7, even in the absence of
antibiotic.
[0259] Plasmid stability was also monitored during the stability
study by replica plating on agar plates at each stage of the
subculture. Consistent with the results from the agarose gel
electrophoresis, there was no overall change in the number of
plasmid-containing cells throughout the study in either LB or TB
liquid culture (FIGS. 10 and 11, respectively).
[0260] These findings demonstrate that prfA-encoding plasmids
exhibit stability in the absence of antibiotic in Listeria strains
containing mutations in prfA.
Materials And Methods (Examples 6-10)
[0261] PCR reagents:
[0262] The primers used for amplification of the prfA gene and
discrimination of the D133V mutation are shown in Table 1. Stock
solutions of the primers ADV451, 452 and 453 were prepared by
diluting the primers in TE buffer to 400 .mu.M. An aliquot of the
stock solution was further diluted to 20 .mu.M in water (PCR grade)
to prepare a working solution. Primers were stored at -20.degree.
C. The reagents used in the PCR are shown in Table 2.
TABLE-US-00007 TABLE 1 Primers ADV451, 452 and 453. Primer
Orientation Sequence (5' .fwdarw. 3') Specificity ADV451 Forward
CCTAGCTAAATTTAATGT D133V (SEQ ID NO: 28) mutation ADV452 Forward
CCTAGCTAAATTTAATGA Wild-type (SEQ ID NO: 29) sequence ADV453
Reverse TAATTTTCCCCAAGTAGCAGG Shared (SEQ ID NO: 30) sequence
TABLE-US-00008 TABLE 2 PCR reagents. Description Provider Catalog
number 1 0.2 ml thin-walled PCR tubes: GeneAmp Applied N801-0612
autoclaved reaction tube with cap Biosystems 2 Water (PCR reagent)
Sigma W1754 3 Taq DNA Polymerase with 10x reaction buffer Sigma
D1806 containing 15 mM MgCl.sub.2 4 Set of deoxynucleotides
(dNTPs), 10 mM each Sigma D7295 5 Primers ADV451, ADV452 and ADV453
Invitrogen 6 Template DNA, midipreparations of pGG55 plasmids 7
Thermal cycler PTC200 (48 wells block) MJ Research
Plasmid DNA Preparation
[0263] pGG55 plasmids with (pGG55 D133V) and without (pGG55 WT) the
prfA mutation were extracted and purified by midipreparations
either from E. coli or Listeria monocytogenes using the
PurcLink.TM. HiPurc Plasmid Midiprep Kit (lnvitrogen, K2100-05),
according to the manufacturer's instructions. For plasmid
purification from Listeria, bacterial strains carrying the pGG55
D133V or WT plasmids were streak plated from frozen stocks in BHI
agar plates supplemented with chloramphenicol (25 .mu.g/ml). A
single colony from each strain was grown in 5 ml of selective
medium (BHI broth with 25 .mu.g/ml of chloramphenicol) for 6 hours
with vigorous shaking at 37.degree. C. and subinoculated 1:500 in
100 ml of selective medium for overnight growth under similar
conditions. Bacteria from the overnight culture were harvested by
centrifugation at 4,000.times.g for 10 minutes and resuspended
buffer R3 (resuspension buffer) containing 2 mg/ml of lysozyme
(Sigma, L7001). The bacteria suspension was incubated for at least
1 hour at 37.degree. C. before proceeding to the regular protocol.
Concentration and purity of the eluted plasmids were measured in a
spectrophotometer at 260 nm and 280 nm. To prepare the template
DNAs, the pGG55 D133V and WT plasmids were resuspended in water to
a final concentration of 1 ng/.mu.l from the midiprep stock
solution. For the pGG55 WT plasmid, serial 10-fold dilutions from
the 1 ng/.mu.l solution were prepared, corresponding to dilutions
from 10.sup.-1 to 10.sup.-7.
[0264] prfA specific PCR protocol to test clinical grade
material
[0265] The reaction mixture contained 1.times.PCR buffer, 1.5 mM
MgCl.sub.2, 0.8 mM dNTPs, 0.4 .mu.M of each primer, 0.05 U/.mu.l of
Taq DNA polymerase and 0.04 ng/.mu.l of the pGG55 D133V template
plasmid. For each test, 10 tubes were required and the key
components in each tube in a 25 .mu.l reaction are shown in the
Table 3. For the PCR reaction, a master mix was prepared with
enough reagents for 11 reactions as shown in Table 4, and 24 .mu.l
of this PCR mix was added to each tube. Subsequently, a total of 1
.mu.l of the serially diluted pGG55 WT plasmid was added to the
corresponding tubes: 1 ng in tube 3; 100 pg in tube 4; 10 pg in
tube 5; 1 pg in tube 6; 100 fg in tube 7; 10 fg in tube 8; 1 fg in
tube 9; 0.1 fg in tube 10. This serial dilution was used to
calibrate a standard curve to determine the method sensitivity.
Additionally, 0.5 .mu.l of water and 0.5 .mu.l of primer ADV451 (20
.mu.M stock) were added in tube 1, and 1 .mu.l of water added in
tube 2, completing 25 .mu.l of final volume. The quantities of each
reagent per tube for a 25 .mu.l reaction are shown in Table 5. The
PCR cycling conditions used in the reaction are shown in Table
6.
[0266] After conclusion of the PCR reaction, 5 .mu.l of gel-loading
buffer (6.times., with bromophenol blue) was added to each sample
and 10 .mu.l were analyzed by electrophoresis in 1.2% agarose gel
in TBE buffer. The gel dimensions were 7 cm.times.7 cm.times.1 cm
with a 15 sample wells (1 mm.times.2 mm) comb. The gel was run at
100 V for -30 minutes, until the bromophenol blue dye reached the
middle of the gel. The gel was stained in ethidium bromide (0.5
.mu.g/ml) for 20 minutes, destaining in water for 10 minutes. The
gel is visualized by illumination with UV light and photographed.
The image was analyzed using a band densitometry software (Quantity
One version 4.5.1, BioRad).
TABLE-US-00009 TABLE 3 Set of individual PCR reactions to validate
the method to detect the presence of wild-type prfA sequence in
Lm-LLO-E7 samples. Expected Tube Primer A Primer B Template DNA
Function result 1 ADV451 ADV453 1 ng of pGG55 Positive control for
Positive (D133V) the ADV451 reaction 2 ADV452 ADV453 1 ng of pGG55
Negative control for Negative (D133V) the ADV452 reaction
(specificity) 3 ADV452 ADV453 1 ng of pGG55 Positive control for
Positive (wild-type) + 1 ng the ADV452 reaction of pGG55 (D133V) 4
ADV452 ADV453 100 pg of pGG55 Test the sensitivity of Positive
(wild-type) + 1 ng the reaction of pGG55 (D133V) 5 ADV452 ADV453 10
pg of pGG55 Test the sensitivity of Positive (wild-type) + 1 ng the
reaction of pGG55 (D133V) 6 ADV452 ADV453 1 pg of pGG55 Test the
sensitivity of Positive (wild-type) + 1 ng the reaction of pGG55
(D133V) 7 ADV452 ADV453 100 fg of pGG55 Test the sensitivity of
Positive (wild-type) + 1 ng the reaction pGG55 (D133V) 8 ADV452
ADV453 10 fg of pGG55 Test the sensitivity of Positive (wild-type)
+ the reaction pGG55 (D133V) 9 ADV452 ADV453 1 fg of pGG55 Test the
sensitivity of Weakly (wild-type) + the reaction positive pGG55
(D133V) 10 ADV452 ADV453 0.1 fg of pGG55 Test the sensitivity of To
be (wild-type) + the reaction determined pGG55 (D133V)
TABLE-US-00010 TABLE 4 Master PCR mix preparation. Reagent Quantity
(.mu.l) Water 206.25 Taq DNA Polymerase 10.times. reaction buffer
27.5 containing 15 mM MgCl.sub.2 Deoxynucleotides (dNTPs) 10 mM
each 5.5 Primers ADV452 (20 .mu.M in water) 5.5 Primers ADV453 (20
.mu.M in water) 5.5 pGG55 D133V (Lm-LLO-E7) plasmid (1 ng/.mu.l) 11
Taq DNA Polymerase (5 U/.mu.l) 2.75 Total 264
TABLE-US-00011 TABLE 5 PCR protocol for validation of the method to
detect the presence of wild-type prfA sequence using primers
ADV451, 452 and 453. Reagent PCR Water 18.75 .mu.l PCR Buffer 10x +
MgCl.sub.2 15 mM 2.5 .mu.l Deoxynucleotides mix (dATP, dCTP, dGTP
0.5 .mu.l and dTTP) 10 mM each Primer ADV452 (20 .mu.M) 0.5 .mu.l
Primer ADV453 (20 .mu.M) 0.5 .mu.l Taq DNA polymerase (5 U/.mu.l)
0.25 .mu.l Template DNA (1 ng/.mu.l) pGG55 D133V 1 .mu.l Template
DNA pGG55 WT (tubes 3 to 10).sup.a 1 .mu.l Final volume per
tube.sup.b 25 .mu.l .sup.apGG55 WT (1 ng in tube 3; 100 pg in tube
4; 10 pg in tube 5; 1 pg in tube 6; 100 fg in tube 7; 10 fg in tube
8; 1 fg in tube 9; 0.1 fg in tube 10). .sup.bIn tube 1, add 0.5
.mu.l of water and 0.5 .mu.l of primer ADV451 (20 .mu.M stock); in
tube 2 add 1 .mu.l of water.
TABLE-US-00012 TABLE 6 PCR cycling conditions to detect the
presence of wild-type prfA sequence using primers ADV451, 452 and
453. Step Temperature Time Number of cycles 1. 94.degree. C. 2
minutes and 1 30 seconds 2. 94.degree. C. 30 seconds 1 3.
53.degree. C. 30 seconds 1 4. 72.degree. C. 30 seconds 1 5. Repeat
steps 2 to 4 12 6. 94.degree. C. 30 seconds 1 7. 50.degree. C. 30
seconds 1 8. 72.degree. C. 30 seconds 1 9. Repeat steps 6 to 8 23
10. 72.degree. C. 10 minutes 1
Sequencing:
[0267] Sequencing of the plasmids was done using the dideoxy
sequencing method. The plasmids pGG55 D133V and pGG55 WT were mixed
at different ratios (1:1, 1:10, 1;100, 1:1,000 and 1:10,000). The
total amount of plasmid in the mixture was kept constant (500
.mu.g) and the plasmid containing the wild-type sequence was
10-fold serially diluted in relation to the D133V plasmid to
determine the sensitivity of the method.
Results
Example 6: Sequencing is not a Sensitive Method to Detect The
Reversion of the D133V Mutation
[0268] To estimate the sensitivity of sequencing in detecting the
wild-type prfA sequence, the pGG55 D133V and WT plasmids were mixed
at the different ratios and sequenced. The results are shown in
FIG. 12 and reveal that sequencing has a high specificity in
discriminating the prfA D133V mutation (FIG. 12). On the other
hand, the sensitivity is low and the maximum dilution of wild-type
prfA pGG55 plasmid with a detectable peak in the sequence was 1 in
10 (FIG. 12). In conclusion, although sequencing is very specific,
the sensitivity of the method is low and not appropriate to screen
for the presence of rare events such as revertants of the prfA
D133V mutation in Lm-LLO-E7 samples.
[0269] Example 7: Development of a Highly Specific and Sensitive
PCR Method to Detect Reversion of the D133V Mutation
[0270] Given the low sensitivity of sequencing to detect rare
events, it became imperative to develop a more sensitive method
with similar specificity to detect reversion of the D133V mutation
to wild-type. To achieve this goal, we designed a PCR-based method
that specifically amplifies the wild-type sequence and is sensitive
enough to detect at least 1 wild-type copy of prfA in 10,000,000
copies of the D133V mutated sequence. We designed 3 primers for
this method: ADV451, ADV452 and ADV453 (Table 1). Both ADV451 and
ADV452 are forward primers and differ in the last nucleotide at the
3' position to discriminate the A.fwdarw.T (D133V) mutation at
position 398 of the prfA gene. The ADV453 primer is the reverse
primer located approximately 300 by downstream the annealing site
of the ADV451 and ADV452 primers (FIG. 13). The expected PCR band
obtained with the primers ADV451 or ADV452 and ADV453 is 326 bp.
Under stringent conditions, the ADV451 primer should only amplify
the pGG55 D133V plasmid, whereas the ADV452 would be specific to
the wild-type prfA sequence.
Example 8: Specificity of the PCR Method
[0271] The reaction using the primer ADV451 was very specific and
amplified the mutated D133V prfA sequence (lanes 1 to 3), but not
the wild-type sequence (lanes 4 to 6). However, a very faint hand
can be detected in lane 4, when 5 ng of template DNA was used, but
not with 1 ng (FIG. 14).
[0272] As shown in FIG. 15, the reaction with the ADV452 primer
only amplified the wild-type prfA sequence (lanes 4, 5 and 6), and
no bands were detected when the pGG55 carrying the D133V prfA
mutation was used as a template (lanes 1, 2 and 3), even when using
5 ng of plasmid in the reaction (FIG. 16). In conclusion, the PCR
reactions with primers ADV451 and ADV452 are very specific and able
to discriminate the AT (D133V) mutation at position 398 of the prfA
gene in the pGG55 plasmid. Based on these results, we selected the
amount of 1 ng as the standard amount of template DNA to be used in
the reaction.
Example 9: Sensitivity of the PCR Method
[0273] The sensitivity of the reaction was tested using 1 ng of
template DNA. For the plasmid carrying the wild-type pifA sequence,
decreasing amounts of DNA (corresponding to 10-fold dilutions from
10.sup.1 to 10.sup.-7), were also included in the reaction to
estimate the sensitivity. In these reactions only the primers
ADV452 and ADV453 were used. In a PCR reaction with 30 cycles (10
cycles with annealing temperature of 53.degree. C. and an
additional 20 cycles with annealing temperature of 50.degree. C.),
the sensitivity of the method was 1 in 100,000 (data not shown). As
shown in FIG. 5, increasing the number of PCR cycles to 37 improved
the visual sensitivity of the method to 10.sup.-6 for the detection
of D133V revertants, without significantly compromising the
specificity. A clear band was visible at the 10.sup.-6 dilution,
corresponding to a detection level of 1 copy of the wild-type
sequence in a million of the D133V mutant, when 1 ng of plasmid was
used as the initial amount of DNA. Only a very weak band can be
visualized in lanes 1 and 9 after longer exposure, reassuring the
robust specificity of the method. On the other hand, when starting
with 5 ng of DNA, a band could be easily detected at the 10.sup.-7
dilution, increasing the sensitivity of the PCR. However, a similar
band in intensity could also be detected with the pGG55 D133V
plasmid, indicating the specificity limit of the method (FIG. 17).
This band observed with the pGG55 D133V plasmid is likely due to
non-specific amplification of the D133V mutation with primer ADV452
that can significantly accumulate with the increased number of
cycles. These results indicate that the sensitivity limit for this
method, without significantly compromising the specificity, is
situated between 1 to 1,000,000 and 1 to 10,000,000.
Example 10: Recombinant Listeria Expressing a Fusion Protein of LLO
to E7 (Lm-LLO-E7)
[0274] This strain is approx. 4 -5 logs more attenuated than the
wild-type parent strain 10403S and secretes the fusion protein
tLLO-E7. This immunotherapy is based on the backbone XFL7, which is
derived from 10403S by the irreversible deletion in the virulence
gene transcription activator prfA. PrfA regulates the transcription
of several virulence genes such as Listeriolysin O (LLO), ActA,
PlcA (phospholipase A), PlcB (phospholipase B) etc that arc
required for in vivo intracellular growth and survival of L.
monocytogenes. The plasmid pGG55 is retained by the Lm-LLO-E7 in
vitro by means of selection with `chloramphenicol`. However for in
vivo retention of the plasmid by Lm-LLO-E7, it carries a copy of
mutated prfA (D133V), which has been demonstrated to be less active
than wild-type PrfA in DNA binding and activating the transcription
of virulence genes. We have observed that complementation with
mutated prfA resulted in approx. 40 fold reduction in the amount of
secreted LLO from Lm-LLO-E7 when compared to wild-type strain
10403S. This implicates that the strain Lm-LLO-E7 likely exhibits a
reduced expression of the virulence genes that are regulated by
PrfA such as actA, inlA, inlB, inlC, plcB etc. In Lm-LLO-E7, the
complementation with mutated copy of prfA likely causes a reduction
in the expression of different virulence genes that are regulated
by PrfA resulting in overall attenuation of approx. 4-5 logs.
[0275] While certain features of the invention have been
illustrated and described herein, many modifications,
substitutions, changes, and equivalents will now occur to those of
ordinary skill in the art. It is, therefore, to be understood that
the appended claims are intended to cover all such modifications
and changes as fall within the true spirit of the invention.
Sequence CWU 1
1
36132PRTListeria monocytogenes 1Lys Glu Asn Ser Ile Ser Ser Met Ala
Pro Pro Ala Ser Pro Pro Ala1 5 10 15Ser Pro Lys Thr Pro Ile Glu Lys
Lys His Ala Asp Glu Ile Asp Lys 20 25 302441PRTListeria
monocytogenes 2Met Lys Lys Ile Met Leu Val Phe Ile Thr Leu Ile Leu
Val Ser Leu1 5 10 15Pro Ile Ala Gln Gln Thr Glu Ala Lys Asp Ala Ser
Ala Phe Asn Lys 20 25 30Glu Asn Ser Ile Ser Ser Val Ala Pro Pro Ala
Ser Pro Pro Ala Ser 35 40 45Pro Lys Thr Pro Ile Glu Lys Lys His Ala
Asp Glu Ile Asp Lys Tyr 50 55 60Ile Gln Gly Leu Asp Tyr Asn Lys Asn
Asn Val Leu Val Tyr His Gly65 70 75 80Asp Ala Val Thr Asn Val Pro
Pro Arg Lys Gly Tyr Lys Asp Gly Asn 85 90 95Glu Tyr Ile Val Val Glu
Lys Lys Lys Lys Ser Ile Asn Gln Asn Asn 100 105 110Ala Asp Ile Gln
Val Val Asn Ala Ile Ser Ser Leu Thr Tyr Pro Gly 115 120 125Ala Leu
Val Lys Ala Asn Ser Glu Leu Val Glu Asn Gln Pro Asp Val 130 135
140Leu Pro Val Lys Arg Asp Ser Leu Thr Leu Ser Ile Asp Leu Pro
Gly145 150 155 160Met Thr Asn Gln Asp Asn Lys Ile Val Val Lys Asn
Ala Thr Lys Ser 165 170 175Asn Val Asn Asn Ala Val Asn Thr Leu Val
Glu Arg Trp Asn Glu Lys 180 185 190Tyr Ala Gln Ala Tyr Ser Asn Val
Ser Ala Lys Ile Asp Tyr Asp Asp 195 200 205Glu Met Ala Tyr Ser Glu
Ser Gln Leu Ile Ala Lys Phe Gly Thr Ala 210 215 220Phe Lys Ala Val
Asn Asn Ser Leu Asn Val Asn Phe Gly Ala Ile Ser225 230 235 240Glu
Gly Lys Met Gln Glu Glu Val Ile Ser Phe Lys Gln Ile Tyr Tyr 245 250
255Asn Val Asn Val Asn Glu Pro Thr Arg Pro Ser Arg Phe Phe Gly Lys
260 265 270Ala Val Thr Lys Glu Gln Leu Gln Ala Leu Gly Val Asn Ala
Glu Asn 275 280 285Pro Pro Ala Tyr Ile Ser Ser Val Ala Tyr Gly Arg
Gln Val Tyr Leu 290 295 300Lys Leu Ser Thr Asn Ser His Ser Thr Lys
Val Lys Ala Ala Phe Asp305 310 315 320Ala Ala Val Ser Gly Lys Ser
Val Ser Gly Asp Val Glu Leu Thr Asn 325 330 335Ile Ile Lys Asn Ser
Ser Phe Lys Ala Val Ile Tyr Gly Gly Ser Ala 340 345 350Lys Asp Glu
Val Gln Ile Ile Asp Gly Asn Leu Gly Asp Leu Arg Asp 355 360 365Ile
Leu Lys Lys Gly Ala Thr Phe Asn Arg Glu Thr Pro Gly Val Pro 370 375
380Ile Ala Tyr Thr Thr Asn Phe Leu Lys Asp Asn Glu Leu Ala Val
Ile385 390 395 400Lys Asn Asn Ser Glu Tyr Ile Glu Thr Thr Ser Lys
Ala Tyr Thr Asp 405 410 415Gly Lys Ile Asn Ile Asp His Ser Gly Gly
Tyr Val Ala Gln Phe Asn 420 425 430Ile Ser Trp Asp Glu Val Asn Tyr
Asp 435 4403529PRTListeria monocytogenes 3Met Lys Lys Ile Met Leu
Val Phe Ile Thr Leu Ile Leu Val Ser Leu1 5 10 15Pro Ile Ala Gln Gln
Thr Glu Ala Lys Asp Ala Ser Ala Phe Asn Lys 20 25 30Glu Asn Ser Ile
Ser Ser Met Ala Pro Pro Ala Ser Pro Pro Ala Ser 35 40 45Pro Lys Thr
Pro Ile Glu Lys Lys His Ala Asp Glu Ile Asp Lys Tyr 50 55 60Ile Gln
Gly Leu Asp Tyr Asn Lys Asn Asn Val Leu Val Tyr His Gly65 70 75
80Asp Ala Val Thr Asn Val Pro Pro Arg Lys Gly Tyr Lys Asp Gly Asn
85 90 95Glu Tyr Ile Val Val Glu Lys Lys Lys Lys Ser Ile Asn Gln Asn
Asn 100 105 110Ala Asp Ile Gln Val Val Asn Ala Ile Ser Ser Leu Thr
Tyr Pro Gly 115 120 125Ala Leu Val Lys Ala Asn Ser Glu Leu Val Glu
Asn Gln Pro Asp Val 130 135 140Leu Pro Val Lys Arg Asp Ser Leu Thr
Leu Ser Ile Asp Leu Pro Gly145 150 155 160Met Thr Asn Gln Asp Asn
Lys Ile Val Val Lys Asn Ala Thr Lys Ser 165 170 175Asn Val Asn Asn
Ala Val Asn Thr Leu Val Glu Arg Trp Asn Glu Lys 180 185 190Tyr Ala
Gln Ala Tyr Pro Asn Val Ser Ala Lys Ile Asp Tyr Asp Asp 195 200
205Glu Met Ala Tyr Ser Glu Ser Gln Leu Ile Ala Lys Phe Gly Thr Ala
210 215 220Phe Lys Ala Val Asn Asn Ser Leu Asn Val Asn Phe Gly Ala
Ile Ser225 230 235 240Glu Gly Lys Met Gln Glu Glu Val Ile Ser Phe
Lys Gln Ile Tyr Tyr 245 250 255Asn Val Asn Val Asn Glu Pro Thr Arg
Pro Ser Arg Phe Phe Gly Lys 260 265 270Ala Val Thr Lys Glu Gln Leu
Gln Ala Leu Gly Val Asn Ala Glu Asn 275 280 285Pro Pro Ala Tyr Ile
Ser Ser Val Ala Tyr Gly Arg Gln Val Tyr Leu 290 295 300Lys Leu Ser
Thr Asn Ser His Ser Thr Lys Val Lys Ala Ala Phe Asp305 310 315
320Ala Ala Val Ser Gly Lys Ser Val Ser Gly Asp Val Glu Leu Thr Asn
325 330 335Ile Ile Lys Asn Ser Ser Phe Lys Ala Val Ile Tyr Gly Gly
Ser Ala 340 345 350Lys Asp Glu Val Gln Ile Ile Asp Gly Asn Leu Gly
Asp Leu Arg Asp 355 360 365Ile Leu Lys Lys Gly Ala Thr Phe Asn Arg
Glu Thr Pro Gly Val Pro 370 375 380Ile Ala Tyr Thr Thr Asn Phe Leu
Lys Asp Asn Glu Leu Ala Val Ile385 390 395 400Lys Asn Asn Ser Glu
Tyr Ile Glu Thr Thr Ser Lys Ala Tyr Thr Asp 405 410 415Gly Lys Ile
Asn Ile Asp His Ser Gly Gly Tyr Val Ala Gln Phe Asn 420 425 430Ile
Ser Trp Asp Glu Val Asn Tyr Asp Pro Glu Gly Asn Glu Ile Val 435 440
445Gln His Lys Asn Trp Ser Glu Asn Asn Lys Ser Lys Leu Ala His Phe
450 455 460Thr Ser Ser Ile Tyr Leu Pro Gly Asn Ala Arg Asn Ile Asn
Val Tyr465 470 475 480Ala Lys Glu Cys Thr Gly Leu Ala Trp Glu Trp
Trp Arg Thr Val Ile 485 490 495Asp Asp Arg Asn Leu Pro Leu Val Lys
Asn Arg Asn Ile Ser Ile Trp 500 505 510Gly Thr Thr Leu Tyr Pro Lys
Tyr Ser Asn Lys Val Asp Asn Pro Ile 515 520 525Glu4416PRTListeria
monocytogenes 4Met Lys Lys Ile Met Leu Val Phe Ile Thr Leu Ile Leu
Val Ser Leu1 5 10 15Pro Ile Ala Gln Gln Thr Glu Ala Lys Asp Ala Ser
Ala Phe Asn Lys 20 25 30Glu Asn Ser Ile Ser Ser Val Ala Pro Pro Ala
Ser Pro Pro Ala Ser 35 40 45Pro Lys Thr Pro Ile Glu Lys Lys His Ala
Asp Glu Ile Asp Lys Tyr 50 55 60Ile Gln Gly Leu Asp Tyr Asn Lys Asn
Asn Val Leu Val Tyr His Gly65 70 75 80Asp Ala Val Thr Asn Val Pro
Pro Arg Lys Gly Tyr Lys Asp Gly Asn 85 90 95Glu Tyr Ile Val Val Glu
Lys Lys Lys Lys Ser Ile Asn Gln Asn Asn 100 105 110Ala Asp Ile Gln
Val Val Asn Ala Ile Ser Ser Leu Thr Tyr Pro Gly 115 120 125Ala Leu
Val Lys Ala Asn Ser Glu Leu Val Glu Asn Gln Pro Asp Val 130 135
140Leu Pro Val Lys Arg Asp Ser Leu Thr Leu Ser Ile Asp Leu Pro
Gly145 150 155 160Met Thr Asn Gln Asp Asn Lys Ile Val Val Lys Asn
Ala Thr Lys Ser 165 170 175Asn Val Asn Asn Ala Val Asn Thr Leu Val
Glu Arg Trp Asn Glu Lys 180 185 190Tyr Ala Gln Ala Tyr Ser Asn Val
Ser Ala Lys Ile Asp Tyr Asp Asp 195 200 205Glu Met Ala Tyr Ser Glu
Ser Gln Leu Ile Ala Lys Phe Gly Thr Ala 210 215 220Phe Lys Ala Val
Asn Asn Ser Leu Asn Val Asn Phe Gly Ala Ile Ser225 230 235 240Glu
Gly Lys Met Gln Glu Glu Val Ile Ser Phe Lys Gln Ile Tyr Tyr 245 250
255Asn Val Asn Val Asn Glu Pro Thr Arg Pro Ser Arg Phe Phe Gly Lys
260 265 270Ala Val Thr Lys Glu Gln Leu Gln Ala Leu Gly Val Asn Ala
Glu Asn 275 280 285Pro Pro Ala Tyr Ile Ser Ser Val Ala Tyr Gly Arg
Gln Val Tyr Leu 290 295 300Lys Leu Ser Thr Asn Ser His Ser Thr Lys
Val Lys Ala Ala Phe Asp305 310 315 320Ala Ala Val Ser Gly Lys Ser
Val Ser Gly Asp Val Glu Leu Thr Asn 325 330 335Ile Ile Lys Asn Ser
Ser Phe Lys Ala Val Ile Tyr Gly Gly Ser Ala 340 345 350Lys Asp Glu
Val Gln Ile Ile Asp Gly Asn Leu Gly Asp Leu Arg Asp 355 360 365Ile
Leu Lys Lys Gly Ala Thr Phe Asn Arg Glu Thr Pro Gly Val Pro 370 375
380Ile Ala Tyr Thr Thr Asn Phe Leu Lys Asp Asn Glu Leu Ala Val
Ile385 390 395 400Lys Asn Asn Ser Glu Tyr Ile Glu Thr Thr Ser Lys
Ala Tyr Thr Asp 405 410 4155390PRTListeria monocytogenes 5Met Arg
Ala Met Met Val Val Phe Ile Thr Ala Asn Cys Ile Thr Ile1 5 10 15Asn
Pro Asp Ile Ile Phe Ala Ala Thr Asp Ser Glu Asp Ser Ser Leu 20 25
30Asn Thr Asp Glu Trp Glu Glu Glu Lys Thr Glu Glu Gln Pro Ser Glu
35 40 45Val Asn Thr Gly Pro Arg Tyr Glu Thr Ala Arg Glu Val Ser Ser
Arg 50 55 60Asp Ile Lys Glu Leu Glu Lys Ser Asn Lys Val Arg Asn Thr
Asn Lys65 70 75 80Ala Asp Leu Ile Ala Met Leu Lys Glu Lys Ala Glu
Lys Gly Pro Asn 85 90 95Ile Asn Asn Asn Asn Ser Glu Gln Thr Glu Asn
Ala Ala Ile Asn Glu 100 105 110Glu Ala Ser Gly Ala Asp Arg Pro Ala
Ile Gln Val Glu Arg Arg His 115 120 125Pro Gly Leu Pro Ser Asp Ser
Ala Ala Glu Ile Lys Lys Arg Arg Lys 130 135 140Ala Ile Ala Ser Ser
Asp Ser Glu Leu Glu Ser Leu Thr Tyr Pro Asp145 150 155 160Lys Pro
Thr Lys Val Asn Lys Lys Lys Val Ala Lys Glu Ser Val Ala 165 170
175Asp Ala Ser Glu Ser Asp Leu Asp Ser Ser Met Gln Ser Ala Asp Glu
180 185 190Ser Ser Pro Gln Pro Leu Lys Ala Asn Gln Gln Pro Phe Phe
Pro Lys 195 200 205Val Phe Lys Lys Ile Lys Asp Ala Gly Lys Trp Val
Arg Asp Lys Ile 210 215 220Asp Glu Asn Pro Glu Val Lys Lys Ala Ile
Val Asp Lys Ser Ala Gly225 230 235 240Leu Ile Asp Gln Leu Leu Thr
Lys Lys Lys Ser Glu Glu Val Asn Ala 245 250 255Ser Asp Phe Pro Pro
Pro Pro Thr Asp Glu Glu Leu Arg Leu Ala Leu 260 265 270Pro Glu Thr
Pro Met Leu Leu Gly Phe Asn Ala Pro Ala Thr Ser Glu 275 280 285Pro
Ser Ser Phe Glu Phe Pro Pro Pro Pro Thr Asp Glu Glu Leu Arg 290 295
300Leu Ala Leu Pro Glu Thr Pro Met Leu Leu Gly Phe Asn Ala Pro
Ala305 310 315 320Thr Ser Glu Pro Ser Ser Phe Glu Phe Pro Pro Pro
Pro Thr Glu Asp 325 330 335Glu Leu Glu Ile Ile Arg Glu Thr Ala Ser
Ser Leu Asp Ser Ser Phe 340 345 350Thr Arg Gly Asp Leu Ala Ser Leu
Arg Asn Ala Ile Asn Arg His Ser 355 360 365Gln Asn Phe Ser Asp Phe
Pro Pro Ile Pro Thr Glu Glu Glu Leu Asn 370 375 380Gly Arg Gly Gly
Arg Pro385 39061170DNAListeria monocytogenes 6atgcgtgcga tgatggtggt
tttcattact gccaattgca ttacgattaa ccccgacata 60atatttgcag cgacagatag
cgaagattct agtctaaaca cagatgaatg ggaagaagaa 120aaaacagaag
agcaaccaag cgaggtaaat acgggaccaa gatacgaaac tgcacgtgaa
180gtaagttcac gtgatattaa agaactagaa aaatcgaata aagtgagaaa
tacgaacaaa 240gcagacctaa tagcaatgtt gaaagaaaaa gcagaaaaag
gtccaaatat caataataac 300aacagtgaac aaactgagaa tgcggctata
aatgaagagg cttcaggagc cgaccgacca 360gctatacaag tggagcgtcg
tcatccagga ttgccatcgg atagcgcagc ggaaattaaa 420aaaagaagga
aagccatagc atcatcggat agtgagcttg aaagccttac ttatccggat
480aaaccaacaa aagtaaataa gaaaaaagtg gcgaaagagt cagttgcgga
tgcttctgaa 540agtgacttag attctagcat gcagtcagca gatgagtctt
caccacaacc tttaaaagca 600aaccaacaac catttttccc taaagtattt
aaaaaaataa aagatgcggg gaaatgggta 660cgtgataaaa tcgacgaaaa
tcctgaagta aagaaagcga ttgttgataa aagtgcaggg 720ttaattgacc
aattattaac caaaaagaaa agtgaagagg taaatgcttc ggacttcccg
780ccaccaccta cggatgaaga gttaagactt gctttgccag agacaccaat
gcttcttggt 840tttaatgctc ctgctacatc agaaccgagc tcattcgaat
ttccaccacc acctacggat 900gaagagttaa gacttgcttt gccagagacg
ccaatgcttc ttggttttaa tgctcctgct 960acatcggaac cgagctcgtt
cgaatttcca ccgcctccaa cagaagatga actagaaatc 1020atccgggaaa
cagcatcctc gctagattct agttttacaa gaggggattt agctagtttg
1080agaaatgcta ttaatcgcca tagtcaaaat ttctctgatt tcccaccaat
cccaacagaa 1140gaagagttga acgggagagg cggtagacca 1170714PRTListeria
monocytogenes 7Lys Thr Glu Glu Gln Pro Ser Glu Val Asn Thr Gly Pro
Arg1 5 10828PRTListeria monocytogenes 8Lys Ala Ser Val Thr Asp Thr
Ser Glu Gly Asp Leu Asp Ser Ser Met1 5 10 15Gln Ser Ala Asp Glu Ser
Thr Pro Gln Pro Leu Lys 20 25920PRTListeria monocytogenes 9Lys Asn
Glu Glu Val Asn Ala Ser Asp Phe Pro Pro Pro Pro Thr Asp1 5 10 15Glu
Glu Leu Arg 201033PRTListeria monocytogenes 10Arg Gly Gly Ile Pro
Thr Ser Glu Glu Phe Ser Ser Leu Asn Ser Gly1 5 10 15Asp Phe Thr Asp
Asp Glu Asn Ser Glu Thr Thr Glu Glu Glu Ile Asp 20 25
30Arg1117PRTStreptococcus sp. G148 11Lys Gln Asn Thr Ala Ser Thr
Glu Thr Thr Thr Thr Asn Glu Gln Pro1 5 10 15Lys1217PRTStreptococcus
equisimilis 12Lys Gln Asn Thr Ala Asn Thr Glu Thr Thr Thr Thr Asn
Glu Gln Pro1 5 10 15Lys1398PRTHuman papillomavirus type 16 13Met
His Gly Asp Thr Pro Thr Leu His Glu Tyr Met Leu Asp Leu Gln1 5 10
15Pro Glu Thr Thr Asp Leu Tyr Cys Tyr Glu Gln Leu Asn Asp Ser Ser
20 25 30Glu Glu Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln Ala Glu Pro
Asp 35 40 45Arg Ala His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp
Ser Thr 50 55 60Leu Arg Leu Cys Val Gln Ser Thr His Val Asp Ile Arg
Thr Leu Glu65 70 75 80Asp Leu Leu Met Gly Thr Leu Gly Ile Val Cys
Pro Ile Cys Ser Gln 85 90 95Lys Pro14105PRTHuman papillomavirus
type 16 14Met His Gly Pro Lys Ala Thr Leu Gln Asp Ile Val Leu His
Leu Glu1 5 10 15Pro Gln Asn Glu Ile Pro Val Asp Leu Leu Cys His Glu
Gln Leu Ser 20 25 30Asp Ser Glu Glu Glu Asn Asp Glu Ile Asp Gly Val
Asn His Gln His 35 40 45Leu Pro Ala Arg Arg Ala Glu Pro Gln Arg His
Thr Met Leu Cys Met 50 55 60Cys Cys Lys Cys Glu Ala Arg Ile Glu Leu
Val Val Glu Ser Ser Ala65 70 75 80Asp Asp Leu Arg Ala Phe Gln Gln
Leu Phe Leu Asn Thr Leu Ser Phe 85 90 95Val Cys Pro Trp Cys Ala Ser
Gln Gln 100 10515158PRTHuman papillomavirus type 16 15Met His Gln
Lys Arg Thr Ala Met Phe Gln Asp Pro Gln Glu Arg Pro1 5 10 15Arg Lys
Leu Pro Gln Leu Cys Thr Glu Leu Gln Thr Thr Ile His Asp 20 25 30Ile
Ile Leu Glu Cys Val Tyr Cys Lys Gln Gln Leu Leu Arg Arg Glu 35 40
45Val Tyr Asp Phe Ala Phe Arg Asp Leu Cys Ile Val Tyr Arg Asp Gly
50 55 60Asn Pro Tyr Ala Val Cys
Asp Lys Cys Leu Lys Phe Tyr Ser Lys Ile65 70 75 80Ser Glu Tyr Arg
His Tyr Cys Tyr Ser Leu Tyr Gly Thr Thr Leu Glu 85 90 95Gln Gln Tyr
Asn Lys Pro Leu Cys Asp Leu Leu Ile Arg Cys Ile Asn 100 105 110Cys
Gln Lys Pro Leu Cys Pro Glu Glu Lys Gln Arg His Leu Asp Lys 115 120
125Lys Gln Arg Phe His Asn Ile Arg Gly Arg Trp Thr Gly Arg Cys Met
130 135 140Ser Cys Cys Arg Ser Ser Arg Thr Arg Arg Glu Thr Gln
Leu145 150 15516158PRTHuman papillomavirus type 16 16Met Ala Arg
Phe Glu Asp Pro Thr Arg Arg Pro Tyr Lys Leu Pro Asp1 5 10 15Leu Cys
Thr Glu Leu Asn Thr Ser Leu Gln Asp Ile Glu Ile Thr Cys 20 25 30Val
Tyr Cys Lys Thr Val Leu Glu Leu Thr Glu Val Phe Glu Phe Ala 35 40
45Phe Lys Asp Leu Phe Val Val Tyr Arg Asp Ser Ile Pro His Ala Ala
50 55 60Cys His Lys Cys Ile Asp Phe Tyr Ser Arg Ile Arg Glu Leu Arg
His65 70 75 80Tyr Ser Asp Ser Val Tyr Gly Asp Thr Leu Glu Lys Leu
Thr Asn Thr 85 90 95Gly Leu Tyr Asn Leu Leu Ile Arg Cys Leu Arg Cys
Gln Lys Pro Leu 100 105 110Asn Pro Ala Glu Lys Leu Arg His Leu Asn
Glu Lys Arg Arg Phe His 115 120 125Asn Ile Ala Gly His Tyr Arg Gly
Gln Cys His Ser Cys Cys Asn Arg 130 135 140Ala Arg Gln Glu Arg Leu
Gln Arg Arg Arg Glu Thr Gln Val145 150 1551722DNAArtificial
SequencePrimer 17ggctcgagca tggagataca cc 221828DNAArtificial
SequencePrimer 18ggggactagt ttatggtttc tgagaaca 281931DNAArtificial
SequencePrimer 19gggggctagc cctcctttga ttagtatatt c
312028DNAArtificial SequencePrimer 20ctccctcgag atcataattt acttcatc
282127DNAArtificial SequencePrimer 21cccgtcgacc agctcttctt ggtgaag
272225DNAArtificial SequencePrimer 22gcggatccca tggagataca cctac
252322DNAArtificial SequencePrimer 23gctctagatt atggtttctg ag
22249PRTHuman papillomavirus type 16 24Arg Ala His Tyr Asn Ile Val
Thr Phe1 5259PRTHuman immunodeficiency virus 25Ala Met Gln Met Leu
Lys Glu Thr Ile1 5269PRTListeria monocytogenes 26Gly Tyr Lys Asp
Gly Asn Glu Tyr Ile1 52755DNAArtificial SequencePrimer 27gactacaagg
acgatgaccg acaagtgata acccgggatc taaataaatc cgttt
552818DNAArtificial SequenceADV451 forward primer for amplification
of prfA gene and discernment of D133V mutation 28cctagctaaa
tttaatgt 182918DNAArtificial SequenceADV452 forward primer for
amplification of prfA gene 29cctagctaaa tttaatga
183021DNAArtificial SequenceADV453 reverse primer for amplification
of prfA gene 30taattttccc caagtagcag g 2131714DNAListeria
monocytogenes 31atgaacgctc aagcagaaga attcaaaaaa tatttagaaa
ctaacgggat aaaaccaaaa 60caatttcata aaaaagaact tatttttaac caatgggatc
cacaagaata ttgtattttt 120ctatatgatg gtatcacaaa gctcacgagt
attagcgaga acgggaccat catgaattta 180caatactaca aaggggcttt
cgttataatg tctggcttta ttgatacaga aacatcggtt 240ggctattata
atttagaagt cattagcgag caggctaccg catacgttat caaaataaac
300gaactaaaag aactactgag caaaaatctt acgcactttt tctatgtttt
ccaaacccta 360caaaaacaag tttcatacag cctagctaaa tttaatgatt
tttcgattaa cgggaagctt 420ggctctattt gcggtcaact tttaatcctg
acctatgtgt atggtaaaga aactcctgat 480ggcatcaaga ttacactgga
taatttaaca atgcaggagt taggatattc aagtggcatc 540gcacatagct
cagctgttag cagaattatt tccaaattaa agcaagagaa agttatcgtg
600tataaaaatt catgctttta tgtacaaaat cttgattatc tcaaaagata
tgcccctaaa 660ttagatgaat ggttttattt agcatgtcct gctacttggg
gaaaattaaa ttaa 71432237PRTListeria monocytogenes 32Met Asn Ala Gln
Ala Glu Glu Phe Lys Lys Tyr Leu Glu Thr Asn Gly1 5 10 15Ile Lys Pro
Lys Gln Phe His Lys Lys Glu Leu Ile Phe Asn Gln Trp 20 25 30Asp Pro
Gln Glu Tyr Cys Ile Phe Leu Tyr Asp Gly Ile Thr Lys Leu 35 40 45Thr
Ser Ile Ser Glu Asn Gly Thr Ile Met Asn Leu Gln Tyr Tyr Lys 50 55
60Gly Ala Phe Val Ile Met Ser Gly Phe Ile Asp Thr Glu Thr Ser Val65
70 75 80Gly Tyr Tyr Asn Leu Glu Val Ile Ser Glu Gln Ala Thr Ala Tyr
Val 85 90 95Ile Lys Ile Asn Glu Leu Lys Glu Leu Leu Ser Lys Asn Leu
Thr His 100 105 110Phe Phe Tyr Val Phe Gln Thr Leu Gln Lys Gln Val
Ser Tyr Ser Leu 115 120 125Ala Lys Phe Asn Asp Phe Ser Ile Asn Gly
Lys Leu Gly Ser Ile Cys 130 135 140Gly Gln Leu Leu Ile Leu Thr Tyr
Val Tyr Gly Lys Glu Thr Pro Asp145 150 155 160Gly Ile Lys Ile Thr
Leu Asp Asn Leu Thr Met Gln Glu Leu Gly Tyr 165 170 175Ser Ser Gly
Ile Ala His Ser Ser Ala Val Ser Arg Ile Ile Ser Lys 180 185 190Leu
Lys Gln Glu Lys Val Ile Val Tyr Lys Asn Ser Cys Phe Tyr Val 195 200
205Gln Asn Leu Asp Tyr Leu Lys Arg Tyr Ala Pro Lys Leu Asp Glu Trp
210 215 220Phe Tyr Leu Ala Cys Pro Ala Thr Trp Gly Lys Leu Asn225
230 23533714DNAListeria monocytogenes 33atgaacgctc aagcagaaga
attcaaaaaa tatttagaaa ctaacgggat aaaaccaaaa 60caatttcata aaaaagaact
tatttttaac caatgggatc cacaagaata ttgtattttt 120ctatatgatg
gtatcacaaa gctcacgagt attagcgaga acgggaccat catgaattta
180caatactaca aaggggcttt cgttataatg tctggcttta ttgatacaga
aacatcggtt 240ggctattata atttagaagt cattagcgag caggctaccg
catacgttat caaaataaac 300gaactaaaag aactactgag caaaaatctt
acgcactttt tctatgtttt ccaaacccta 360caaaaacaag tttcatacag
cctagctaaa tttaatgttt tttcgattaa cgggaagctt 420ggctctattt
gcggtcaact tttaatcctg acctatgtgt atggtaaaga aactcctgat
480ggcatcaaga ttacactgga taatttaaca atgcaggagt taggatattc
aagtggcatc 540gcacatagct cagctgttag cagaattatt tccaaattaa
agcaagagaa agttatcgtg 600tataaaaatt catgctttta tgtacaaaat
cgtgattatc tcaaaagata tgcccctaaa 660ttagatgaat ggttttattt
agcatgtcct gctacttggg gaaaattaaa ttaa 71434237PRTListeria
monocytogenes 34Met Asn Ala Gln Ala Glu Glu Phe Lys Lys Tyr Leu Glu
Thr Asn Gly1 5 10 15Ile Lys Pro Lys Gln Phe His Lys Lys Glu Leu Ile
Phe Asn Gln Trp 20 25 30Asp Pro Gln Glu Tyr Cys Ile Phe Leu Tyr Asp
Gly Ile Thr Lys Leu 35 40 45Thr Ser Ile Ser Glu Asn Gly Thr Ile Met
Asn Leu Gln Tyr Tyr Lys 50 55 60Gly Ala Phe Val Ile Met Ser Gly Phe
Ile Asp Thr Glu Thr Ser Val65 70 75 80Gly Tyr Tyr Asn Leu Glu Val
Ile Ser Glu Gln Ala Thr Ala Tyr Val 85 90 95Ile Lys Ile Asn Glu Leu
Lys Glu Leu Leu Ser Lys Asn Leu Thr His 100 105 110Phe Phe Tyr Val
Phe Gln Thr Leu Gln Lys Gln Val Ser Tyr Ser Leu 115 120 125Ala Lys
Phe Asn Val Phe Ser Ile Asn Gly Lys Leu Gly Ser Ile Cys 130 135
140Gly Gln Leu Leu Ile Leu Thr Tyr Val Tyr Gly Lys Glu Thr Pro
Asp145 150 155 160Gly Ile Lys Ile Thr Leu Asp Asn Leu Thr Met Gln
Glu Leu Gly Tyr 165 170 175Ser Ser Gly Ile Ala His Ser Ser Ala Val
Ser Arg Ile Ile Ser Lys 180 185 190Leu Lys Gln Glu Lys Val Ile Val
Tyr Lys Asn Ser Cys Phe Tyr Val 195 200 205Gln Asn Arg Asp Tyr Leu
Lys Arg Tyr Ala Pro Lys Leu Asp Glu Trp 210 215 220Phe Tyr Leu Ala
Cys Pro Ala Thr Trp Gly Lys Leu Asn225 230 23535364DNAArtificial
SequenceLovaxin_C_pGG55 35ccaaacccta caaaaacaag tttcatacag
cctagctaaa tttaatgttt tttcgattaa 60cgggaagctt ggctctattt gcggtcaact
tttaatcctg acctatgtgt atggtaaaga 120aactcctgat ggcatcaaga
ttacactgga taatttaaca atgcaggagt taggatattc 180aagtggcatc
gcacatagct cagctgttag cagaattatt tccaaattaa agcaagagaa
240agttatcgtg tataaaaatt catgctttta tgtacaaaat cgtgattatc
tcaaaagata 300tgcccctaaa ttagatgaat ggttttattt agcatgtcct
gctacttggg gaaaattaaa 360ttaa 36436364DNAListeria monocytogenes
36ccaaacccta caaaaacaag tttcatacag cctagctaaa tttaatgatt tttcgattaa
60cgggaagctt ggctctattt gcggtcaact tttaatcctg acctatgtgt atggtaaaga
120aactcctgat ggcatcaaga ttacactgga taatttaaca atgcaggagt
taggatattc 180aagtggcatc gcacatagct cagctgttag cagaattatt
tccaaattaa agcaagagaa 240agttatcgtg tataaaaatt catgctttta
tgtacaaaat cttgattatc tcaaaagata 300tgcccctaaa ttagatgaat
ggttttattt agcatgtcct gctacttggg gaaaattaaa 360ttaa 364
* * * * *