U.S. patent application number 16/092298 was filed with the patent office on 2019-05-16 for fgf21 c-terminal peptide optimization.
The applicant listed for this patent is Archita S. AGRAWAL, Richard D. DIMARCHI, Alexei KHARITONENKOV, Pengyun LI. Invention is credited to Archita S. AGRAWAL, Richard D. DIMARCHI, Alexei KHARITONENKOV, Pengyun LI.
Application Number | 20190142963 16/092298 |
Document ID | / |
Family ID | 59285313 |
Filed Date | 2019-05-16 |
View All Diagrams
United States Patent
Application |
20190142963 |
Kind Code |
A1 |
DIMARCHI; Richard D. ; et
al. |
May 16, 2019 |
FGF21 C-TERMINAL PEPTIDE OPTIMIZATION
Abstract
Disclosed herein are modified C-terminal fragments of FGF21
optimized for binding to Klotho .beta. or antagonizing FGF21
activity. FGF21 peptides modified to comprise modifications to the
C-terminal amino acid sequence are disclosed that have enhanced
activity at the FGF21 receptor. Additionally, conjugates formed
between the optimized FGF21 peptide fragments and insulin like
peptides or nuclear hormone receptor ligands are provided.
Inventors: |
DIMARCHI; Richard D.;
(Carmel, IN) ; KHARITONENKOV; Alexei; (Zionsville,
IN) ; LI; Pengyun; (Bloomington, IN) ;
AGRAWAL; Archita S.; (Bloomington, IN) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
DIMARCHI; Richard D.
KHARITONENKOV; Alexei
LI; Pengyun
AGRAWAL; Archita S. |
Carmel
Zionsville
Bloomington
Bloomington |
IN
IN
IN
IN |
US
US
US
US |
|
|
Family ID: |
59285313 |
Appl. No.: |
16/092298 |
Filed: |
April 14, 2017 |
PCT Filed: |
April 14, 2017 |
PCT NO: |
PCT/US2017/027600 |
371 Date: |
October 9, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62323003 |
Apr 15, 2016 |
|
|
|
Current U.S.
Class: |
514/6.9 |
Current CPC
Class: |
A61K 38/03 20130101;
A61K 38/28 20130101; A61P 3/04 20180101; C07K 14/50 20130101; A61K
47/65 20170801; A61K 47/66 20170801; A61P 3/10 20180101; A61K
38/1796 20130101; A61K 38/26 20130101 |
International
Class: |
A61K 47/66 20060101
A61K047/66; A61K 38/26 20060101 A61K038/26; A61K 38/03 20060101
A61K038/03; A61K 38/28 20060101 A61K038/28; A61P 3/04 20060101
A61P003/04; A61P 3/10 20060101 A61P003/10; A61K 38/17 20060101
A61K038/17; A61K 47/65 20060101 A61K047/65 |
Claims
1. A peptide exhibiting antagonist activity against FGF21 binding
to Klotho .beta., said peptide comprising an amino acid sequence of
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5SX.sub.7DPX.sub.10X.sub.11X.sub.12VX.s-
ub.14GX.sub.16X.sub.17X.sub.18X.sub.19RSPSX.sub.24X.sub.25X.sub.26
(SEQ ID NO: 235), wherein X.sub.1 is Pro or absent; X.sub.2 is Pro
or Leu; X.sub.3 is Asp or Glu; X.sub.4 is Val or Thr; X.sub.5 is
Gly, Asp, Phe, Leu or Ser; X.sub.7 is Ser or Met; X.sub.10 is Leu
or Phe; X.sub.11 is Ser or Gly; X.sub.12 is Met or Leu; X.sub.14 is
absent or Thr; X.sub.16 is Pro, Leu, Arg, Glu, or Gly; X.sub.17 is
Ser or Glu; X.sub.18 is Gln or Ala; X.sub.19 is Gly or Val;
X.sub.24 is Tyr or Phe; X.sub.25 is Ala or Glu; and X.sub.26 is
Ala.
2. The peptide of claim 1 wherein said peptide comprises a sequence
selected from the group consisting of I) LETDSMDPFGLVTGLEAVRSPSFEA
(SEQ ID NO: 188), PPDVGSSDPLSMVGPSQGRSPSYAA (SEQ ID NO: 191),
PPDVGSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 180),
PLETDSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 179),
PDVGSMDPFGLVTGLEAVRSPSYAA (SEQ ID NO: 234) PPDVGSMDPF GLVGR SQGRS
PSFEA (SEQ ID NO: 237), PPDVF SMDPF GLVGP SQGRS PSFEA (SEQ ID NO:
238), PPDVL SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 239), PPDVS SMDPF
GLVGP SQGRS PSFEA (SEQ ID NO: 240), and PPDVG SSDPF GLVGP SQGRS
PSFEA (SEQ ID NO: 241), or II) a peptide that differs from SEQ ID
NO: 188, SEQ ID NO: 191, SEQ ID NO: 180, SEQ ID NO: 179, SEQ ID NO:
234, SEQ ID NO: 237, SEQ ID NO: 238, SEQ ID NO: 239, SEQ ID NO: 240
or SEQ ID NO: 241 by one to two amino acid substitutions selected
from positions 1, 2, 5, 7, 11, 14, 15, 16, 17, 18 and 19.
3. The peptide of claim 2 wherein said peptide is fused to the
carboxy terminus of a polypeptide selected from the group
consisting of SEQ ID NO: 194, SEQ ID NO: 195 and SEQ ID NO: 196 or
a peptide that differs from SEQ ID NO: 194, SEQ ID NO: 195 or SEQ
ID NO: 196 by 1 to 3 amino acid substitutions.
4. (canceled)
5. A modified FGF21 peptide wherein said modified peptide differs
from SEQ ID NO: 173 by a substitution of the C-terminal amino acid
with alanine; and one or more of the following modifications: i)
one or more substitutions selected from the group consisting of
G161L, G161F, G161S, S163M, L166F, S167G, M168L, P171R, Y179F, and
A180E (based on the numbering of the mature FGF21 peptide of SEQ ID
NO: 173); or ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K; or iii)
substitution of the native amino acid at position 167 and/or 175
with the corresponding D-isomer of said native amino acid; or iv)
substitution of the C-terminal 25 amino acids of SEQ ID NO: 173
with the 25 amino acid sequence of SEQ ID NO: 188; or v) any
combination of i) and ii), or any combination of i), ii) and iii),
or any combination of ii) and iv).
6-7. (canceled)
8. The modified FGF21 peptide of claim 5 wherein said modified
peptide differs from SEQ ID NO: 173 by each of the following
substitutions: S163M, L166F, S167G and M168L, or said modified
peptide differs from SEQ ID NO: 173 by each of the following
substitutions: S163M, L166F, S167G, M168L, Y179F, and A180E.
9. (canceled)
10. The modified FGF21 peptide of claim 8 further comprising the
substitution of P171R.
11. The modified FGF21 peptide of claim 5 wherein the peptide
consists of a peptide selected from the group consisting of i) SEQ
ID NO: 192, SEQ ID NO: 193, SEQ ID NO: 247, SEQ ID NO: 248, SEQ ID
NO: 249, SEQ ID NO: 250, SEQ ID NO: 251 and SEQ ID NO:252 or ii)
SEQ ID NO: 192, SEQ ID NO: 206, SEQ ID NO: 207, SEQ ID NO: 208 and
SEQ ID NO: 209, or iii) a modified sequence of SEQ ID NO: 192, SEQ
ID NO: 206, SEQ ID NO: 207, SEQ ID NO: 208 and SEQ ID NO: 209,
wherein SEQ ID NO: 192, SEQ ID NO: 206, SEQ ID NO: 207, SEQ ID NO:
208 or SEQ ID NO: 209 are modified to comprise one or more
substitutions selected from the group consisting of A31C, G43C,
L98D, L100K, N121D, and D127K.
12-14. (canceled)
15. A pharmaceutical composition comprising a modified FGF21
peptide of claim 5 and a pharmaceutically acceptable carrier,
diluent, or excipient.
16. A method of reducing weight gain or inducing weight loss in a
patient in need thereof, comprising administering to said patient
in need thereof a pharmaceutical composition of claim 15 in an
amount effective to reduce weight gain or induce weight loss.
17. A method of treating diabetes, comprising administering to a
patient in need thereof a pharmaceutical composition of claim 15 in
an amount effective to lower blood glucose levels.
18. A peptide conjugate comprising the general formula: Q-L-Y
wherein Q is a bioactive peptide selected from the group consisting
of an insulin peptide, a glucagon peptide, FGF1, FGF2, and a
nuclear hormone; Y is a peptide comprising a sequence selected from
the group consisting of LETDSMDPFGLVTGLEAVRSPSFEA (SEQ ID NO: 188),
PPDVGSSDPLSMVGPSQGRSPSYAA (SEQ ID NO: 191),
PPDVGSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 180),
PLETDSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 179),
PDVGSMDPFGLVTGLEAVRSPSYAA (SEQ ID NO: 234) PPDVG SMDPF GLVGR SQGRS
PSFEA (SEQ ID NO: 237), PPDVF SMDPF GLVGP SQGRS PSFEA (SEQ ID NO:
238), PPDVL SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 239), PPDVS SMDPF
GLVGP SQGRS PSFEA (SEQ ID NO: 240), and PPDVG SSDPF GLVGP SQGRS
PSFEA (SEQ ID NO: 241); and L is a linking group or a bond.
19. The conjugate of claim 18 wherein i) Q is a glucagon peptide
comprising a sequence from the group consisting of
HX.sub.1QGTFTSDKSKYLDX.sub.2RAAQDFVQWLMDT (SEQ ID NO: 202),
TABLE-US-00010 (SEQ ID NO: 197)
X.sub.3AQGTFTSDKSKYLDERAAQDFVQWLLEGGPSSGAPPPS, (SEQ ID NO: 198)
X.sub.4AQGTFTSDKSKYLDERAAQDFVQWLLEGGPSSGAPPPS, (SEQ ID NO: 199)
X.sub.5AQGTFTSDKSKYLDERAAQDFVQWLLEGGPSSGAPPPS, (SEQ ID NO: 200)
X.sub.6AQGTFTSDKSKYLDERAAQDFVQWLLDAGPSSGAPPPS and (SEQ ID NO: 201)
X.sub.7AQGTFTSDKSKYLDERAAQDFVQWLLEAGPSSGAPPPS,
wherein X.sub.1 and X.sub.2 are both Aib; X.sub.3 is Acetyl D-Tyr;
X.sub.4 is Acetyl D-His; X.sub.5 is Acetyl D-thio Ala, and X.sub.6
and X.sub.7 are both acetyl-D-Tyr, or ii) Q is selected from the
group consisting of estradiol and derivatives thereof, estrone and
derivatives thereof, testosterone and derivatives thereof, and
cortisol and derivatives thereof; or iii) Q is a compound having
the general structure ##STR00056## wherein R.sub.15 is
C.sub.1-C.sub.4 alkyl, --CH.sub.2(pyridazinone),
--CH.sub.2(OH)(phenyl)F, --CH(OH)CH.sub.3, halo or H; R.sub.20 is
halo, CH.sub.3 or H; R.sub.21 is halo, CH.sub.3 or H; R.sub.22 is
H, OH, halo, --CH.sub.2(OH)(C.sub.6 aryl)F, or C.sub.1-C.sub.4
alkyl; and R.sub.23 is --CH.sub.2CH(NH.sub.2)COOH, --OCH.sub.2COOH,
--NHC(O)COOH, --CH.sub.2COOH --NHC(O)CH.sub.2COOH,
--CH.sub.2CH.sub.2COOH, or --OCH.sub.2PO.sub.3.sup.2-, or iv) Q is
a compound having the general structure ##STR00057## wherein
R.sub.15 is C.sub.1-C.sub.4 alkyl, --CH(OH)CH.sub.3, I or H
R.sub.20 is I, Br, CH.sub.3 or H; R.sub.21 is I, Br, CH.sub.3 or H;
R.sub.22 is H, OH, I, or C.sub.1-C.sub.4 alkyl; and R.sub.23 is
--CH.sub.2CH(NH.sub.2)COOH, --OCH.sub.2COOH, --NHC(O)COOH,
--CH.sub.2COOH, --NHC(O)CH.sub.2COOH, --CH.sub.2CH.sub.2COOH, or
--OCH.sub.2PO.sub.3.sup.2-, or v) Q is a compound of the general
structure of Formula I: ##STR00058## wherein R.sub.20, R.sub.21 and
R.sub.22 are independently selected from the group consisting of H,
OH, halo and C.sub.1-C.sub.4 alkyl; and R.sub.15 is halo or H, or
vi) Q is selected from the group consisting of thyroxine T4
(3,5,3',5'-tetra-iodothyronine), and 3,5,3'-triiodo L-thyronine; or
vii) Q is a ligand that activates the peroxisome
proliferator-activated receptors (PPAR) when in an unbound
state.
20-25. (canceled)
26. The conjugate of claim 18 wherein (Q) is an insulin peptide
comprising an A chain and a B chain wherein i) said A chain
comprises a sequence
GIVX.sub.4X.sub.5CCX.sub.8X.sub.9X.sub.10CX.sub.12LX.sub.14X.sub-
.15LX.sub.17X.sub.18YCX.sub.21-R.sub.53 (SEQ ID NO: 19), and said B
chain comprises a sequence
R.sub.62-X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGX.sub.41X.sub-
.42GFX.sub.45 (SEQ ID NO: 20), wherein X.sub.4 is glutamic acid or
aspartic acid; X.sub.5 is glutamine or glutamic acid X.sub.8 is
histidine, threonine or phenylalanine; X.sub.9 is serine, arginine,
lysine, ornithine or alanine; X.sub.10 is isoleucine or serine;
X.sub.12 is serine or aspartic acid; X.sub.14 is tyrosine,
arginine, lysine, ornithine or alanine; X.sub.15 is glutamine,
glutamic acid, arginine, alanine, lysine, ornithine or leucine;
X.sub.17 is glutamic acid, aspartic acid, asparagine, lysine,
ornithine or glutamine; X.sub.18 is methionine, asparagine,
glutamine, aspartic acid, glutamic acid or threonine; X.sub.21 is
selected from the group consisting of alanine, glycine, serine,
valine, threonine, isoleucine, leucine, glutamine, glutamic acid,
asparagine, aspartic acid, histidine, tryptophan, tyrosine, and
methionine; X.sub.25 is histidine or threonine; X.sub.29 is
selected from the group consisting of alanine, glycine and serine;
X.sub.30 is selected from the group consisting of histidine,
aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
X.sub.33 is selected from the group consisting of aspartic acid and
glutamic acid; X.sub.34 is selected from the group consisting of
alanine and threonine; X.sub.41 is selected from the group
consisting of glutamic acid, aspartic acid or asparagine; X.sub.42
is selected from the group consisting of alanine, ornithine, lysine
and arginine; X.sub.45 is tyrosine or phenylalanine; R.sub.62 is
selected from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ
(SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a tripeptide
glycine-proline-glutamic acid, a tripeptide
valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a
dipeptide asparagine-glutamine, glutamine, glutamic acid and an
N-terminal amine; and R.sub.53 is COOH or CONH.sub.2, or ii) said A
chain comprises the sequence
GIVEQCCX.sub.8X.sub.9ICSLYQLENYCX.sub.21-R.sub.53 (SEQ ID NO: 73)
said B chain comprises the sequence
R.sub.62-X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGX.sub.41X.sub-
.42GFX.sub.45 (SEQ ID NO: 20), wherein X.sub.8 is histidine or
threonine; X.sub.9 is serine, lysine, or alanine; X.sub.21 is
alanine, glycine or asparagine; X.sub.25 is histidine or threonine;
X.sub.29 is selected from the group consisting of alanine, glycine
and serine; X.sub.30 is selected from the group consisting of
histidine, aspartic acid, glutamic acid, homocysteic acid and
cysteic acid; X.sub.33 is selected from the group consisting of
aspartic acid and glutamic acid; X.sub.34 is selected from the
group consisting of alanine and threonine; X.sub.41 is selected
from the group consisting of glutamic acid, aspartic acid or
asparagine; X.sub.42 is selected from the group consisting of
alanine, ornithine, lysine and arginine; X.sub.45 is tyrosine or
phenylalanine; R.sub.62 is selected from the group consisting of
FVNQ (SEQ ID NO: 12), a tripeptide valine-asparagine-glutamine, a
dipeptide asparagine-glutamine, glutamine and an N-terminal amine;
and R.sub.53 is COOH or CONH.sub.2, or iii) said A chain comprises
a sequence GIVDECCX.sub.8X.sub.9SCDLRRLEMX.sub.19CX.sub.21-R.sub.53
(SEQ ID NO: 74) and said B chain comprises a sequence
R.sub.62-X.sub.25LCGAX.sub.30LVDALYLVCGDX.sub.42GFY (SEQ ID NO:
75), wherein X.sub.8 is phenylalanine or histidine; X.sub.9 is
arginine, ornithine or alanine; X.sub.19 is tyrosine,
4-methoxy-phenylalanine or 4-amino-phenylalanine; X.sub.21 is
alanine or asparagine; X.sub.25 is histidine or threonine; X.sub.30
is selected from the group consisting of histidine, aspartic acid,
glutamic acid, homocysteic acid and cysteic acid; X.sub.42 is
selected from the group consisting of alanine ornithine and
arginine; and R.sub.53 is COOH or CONH.sub.2; R.sub.62 is selected
from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID
NO: 12), PGPE (SEQ ID NO: 11), a tripeptide
glycine-proline-glutamic acid, a tripeptide
valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a
dipeptide asparagine-glutamine, glutamine, glutamic acid and an
N-terminal amine; and R.sub.53 is COOH or CONH.sub.2, or iv) said A
chain comprises a sequence
GIVDECCX.sub.8X.sub.9SCDLRRLEMX.sub.19CX.sub.21-R.sub.53 (SEQ ID
NO: 74) and the B chain sequence comprises the sequence
FVKQX.sub.25LCGSHLVEALYLVCGERGFF-R.sub.63 (SEQ ID NO: 147), or
FVNQX.sub.25LCGSHLVEALYLVCGERGFF-R.sub.63 (SEQ ID NO: 148), wherein
X.sub.8 is phenylalanine or histidine; X.sub.9 is arginine,
ornithine or alanine; X.sub.19 is tyrosine, 4-methoxy-phenylalanine
or 4-amino-phenylalanine; X.sub.25 is selected from the group
consisting of histidine and threonine; and R.sub.63 is selected
from the group consisting of YTX.sub.28KT (SEQ ID NO: 149), YTKPT
(SEQ ID NO: 150), YTX.sub.28K (SEQ ID NO: 152), YTKP (SEQ ID NO:
151), YTPK (SEQ ID NO: 70), YTX.sub.28, YT, Y and a bond, wherein
X.sub.28 is proline, aspartic acid or glutamic acid, or v) said A
chain comprises a sequence
GIVDECCX.sub.8X.sub.9SCDLRRLEMX.sub.19CX.sub.21--R.sub.53 (SEQ ID
NO: 74) and the B chain sequence comprises the sequence
FVKQX.sub.25LCGSHLVEALYLVCGERGFFYTEKT (SEQ ID NO: 162),
FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTDKT (SEQ ID NO: 164),
FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 165) or
FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 161) wherein
X.sub.8 is phenylalanine or histidine; X.sub.9 is arginine,
ornithine or alanine; X.sub.19 is tyrosine, 4-methoxy-phenylalanine
or 4-amino-phenylalanine; X.sub.25 is selected from the group
consisting of histidine and threonine; or vi) said A chain
comprises a sequence GIVEQCCTSICSLYQLENYCN-R.sub.53 (SEQ ID NO: 1)
and said B chain comprises a sequence
FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), wherein R.sub.53 is
COOH or CONH.sub.2.
27-31. (canceled)
32. The conjugate of claim 26, wherein L is stable in vivo,
hydrolyzable in vivo, or metastable in vivo.
33. The conjugate of claim 32, wherein L comprises an ether moiety,
or an amide moiety, an ester moiety, an acid-labile moiety, a
reduction-labile moiety, an enzyme-labile moiety, a hydrazone
moiety, a disulfide moiety, or a cathepsin-cleavable moiety.
34. The conjugate of claim 18, further comprising an acyl group or
alkyl group covalently linked to an amino acid side chain of said
conjugate.
35. A pharmaceutical composition comprising a conjugate of claim
18, or pharmaceutically acceptable salt thereof, and a
pharmaceutically acceptable carrier.
36. The peptide of claim 5 for use in treating diabetes.
37. The peptide of claim 5 for use in reducing weight gain or
inducing weight loss in a patient in need thereof.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent
Application No. 62/323,003 filed on Apr. 15, 2016, the disclosure
of which is hereby expressly incorporated by reference in its
entirety.
INCORPORATION BY REFERENCES OF MATERIAL SUBMITTED
ELECTRONICALLY
[0002] Incorporated by reference in its entirety is a
computer-readable nucleotide/amino acid sequence listing submitted
concurrently herewith and identified as follows: 165 kilobytes ACII
(Text) file named "PCTKlotho_ST25.txt," created on Apr. 13,
2017.
BACKGROUND
[0003] Fibroblast growth factor 21 (FGF21) is a recently identified
circulating protein that regulates insulin sensitivity along with
lipid and energy metabolism. FGF21 belongs to a subfamily of
Fibroblast Growth Factors (FGFs) that includes FGF19 (SEQ ID NO:
170), FGF21 (SEQ ID NO: 171), and FGF23 (SEQ ID NO: 172). FGF is
expressed with a 28 amino acid signal peptide that is subsequently
cleaved to produce the mature protein (SEQ ID NO: 173) FGF21 is an
atypical FGF in that it is heparin independent and functions as a
hormone in the regulation of glucose, lipid, and energy
metabolism.
[0004] FGF21 is highly expressed in liver and pancreas and is the
only member of the FGF family to be primarily expressed in liver.
Transgenic mice overexpressing FGF21 exhibit metabolic phenotypes
of slow growth rate, low plasma glucose and triglyceride levels,
and an absence of age-associated type 2 diabetes, islet
hyperplasia, and obesity.
[0005] Pharmacological administration of recombinant FGF21 protein
in obese diabetic rodents markedly improved hyperglycemia, lowered
elevated triglycerides (TGs), and reduced body weight. Similarly,
administration to obese diabetic rhesus monkeys results in
normalized levels of plasma glucose, reduced triglyceride and
cholesterol levels, and improved glucose tolerance and insulin
sensitivity. FGF21 functions to reduce body weight and body fat by
increasing energy expenditure, physical activity, and metabolic
rate. Experimental research (see Gaich et al., Cell Metab. Vol.
18(3):333-40 (September 2013)) provides support for the
pharmacological administration of FGF21 for the treatment of type 2
diabetes, obesity, dyslipidemia, and other metabolic conditions or
disorders in humans.
[0006] At a molecular level, FGF21 interacts with the FGF receptor
only in tissues expressing the cofactor Klotho .beta.. The Klotho
.beta.-dependent tissue specificity is consistent with the
predominant effects of FGF21 occurring in liver and adipose tissue.
The terminal residues of FGF21 are vital for effective biochemical
signaling and their truncation dramatically affects the biochemical
activity of the molecule. While it is evident that the C-termini of
the hormonal FGFs are important for facilitating the interaction
with their respective co-receptor partners for the formation of an
active receptor complex, the detailed molecular requirements for
the association are unknown.
[0007] The beneficial pharmacology observed in preclinical models
indicated that FGF21 and its analogs or mimetics hold promise as
innovative therapeutics for treating metabolic disorders. However,
analogs of FGF21 having greater potency at the FGF receptor is
desirable to enhance the efficacy of FGF21 mediated therapies
SUMMARY
[0008] In accordance with one embodiment of the present disclosure
a method of identifying an optimized FGF21 analog is provided. In
one embodiment the method of identifying an optimized FGF21 analog
is based on analyzing the C-terminal 25 amino acid peptide fragment
of FGF21 (SEQ ID NO: 166) for determining the structure-activity
relationship for protein FGF21. Applicants have found that in terms
of its ability to antagonize FGF21 activity, the peptide of SEQ ID
NO: 166, and derivatives thereof, are also predictive of FGF
receptor activity of the whole FGF protein comprising a derivative
peptide of SEQ ID NO: 166. Accordingly, in one embodiment the
method of identifying an optimized FGF21 analog comprises the steps
of modifying a peptide comprising the sequence
PPDVGSSDPLSMVGPSQGRSPSYAS (SEQ ID NO: 166), analyzing the modified
peptide's ability to bind to Klotho .beta. or antagonize FGF21
activity in an in vitro assay (e.g., the assay of Example 1) and
identifying modified peptides that have an enhanced activity
relative to the native peptide (SEQ ID NO: 166). The identified
modified peptides can then be incorporated into a full length
protein, such as the FGF21 protein or other bioactive proteins,
using standard means such as biosynthesis or semi-synthesis.
[0009] In accordance with one embodiment peptides based on the
C-terminal 25 amino acids of native FGF21 and FGF19 are provided
that have an enhanced ability to bind Klotho .beta. and function as
antagonist of FGF21 activity relative to the native sequence. In
accordance with one embodiment a 25 amino acid peptide selected
from the group consisting of
[0010] LETDSMDPFGLVTGLEAVRSPSFEA (SEQ ID NO: 188),
[0011] PPDVGSSDPLSMVGPSQGRSPSYAA (SEQ ID NO: 191),
[0012] PPDVGSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 180),
[0013] PLETDSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 179),
[0014] PDVGSMDPFGLVTGLEAVRSPSYAA (SEQ ID NO: 234),
[0015] PPDVG SMDPF GLVGR SQGRS PSFEA (SEQ ID NO: 237),
[0016] PPDVF SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 238),
[0017] PPDVL SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 239),
[0018] PPDVS SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 240), and
[0019] PPDVG SSDPF GLVGP SQGRS PSFEA (SEQ ID NO: 241) is provided.
Each of these peptides have been found to be more potent in
antagonizing the native FGF21's in vitro signaling than the
corresponding native FGF21 C-terminal 25 amino acid fragment.
[0020] Substituting any of the novel sequences of SEQ ID NOs: 179,
180, 188, 191, 234, 237, 238, 239, 240 or 241 for the native
C-terminal 25 amino acids of FGF21 produces an FGF analog that has
higher potency at the FGF receptor than native FGF21. Furthermore,
applicants have discovered additional modifications to the native
FGF21 sequence that also enhance the peptide's activity at its
receptor. In accordance with one embodiment an agonist analog of
FGF21 is provided having enhanced potency at the FGF receptor,
where said analog comprises at least one amino acid modification
selected from the group consisting of amino acids positions 159,
160, 162, 164, 165,166, 168, 169, 176, 177, and 179, relative to
SEQ ID NO: 173. In one embodiment the amino acid modification
comprises an amino acid substitution with a non-natural amino acid.
In one embodiment the non-natural amino acid substitution is a
substitution of an amino acid with an amino acid in the D-stereo
configuration, and optionally the corresponding D-stereoisomer of
the native amino acid at that position. In one embodiment an analog
of FGF21 is provided having enhanced potency relative to the native
FGF21 sequence of SEQ ID NO: 167, where said analog comprises 1-6,
1-4, or 1-2 amino acid modifications at amino acid positions
selected from positions 159, 160, 162, 164, 165,166, 168, 169, 176,
177, and 179, relative to SEQ ID NO: 167. In one embodiment an
analog of FGF21 is provided having enhanced potency, where said
analog comprises 1-2 amino acid modifications selected from the
group consisting of amino acids positions 164, 165 and 168,
relative to SEQ ID NO: 167.
[0021] In accordance with one embodiment an FGF21 analog is
provided having enhanced potency at the FGF receptor, wherein the
C-terminal amino acid is substituted with a small aliphatic amino
acid, optionally wherein said small aliphatic amino acid has a
C.sub.1-C.sub.4 side chain. In accordance with one embodiment the
C-terminal amino acid is substituted with an amino acid selected
from the group consisting of glycine, alanine, valine, isoleucine
and leucine. In one embodiment the C-terminal amino acid is
substituted with alanine. In a further embodiment an FGF21 analog
is provided having enhanced potency at the FGF receptor wherein the
C-terminal 25 amino acids of FGF21 are substituted with the native
C-terminal 25 amino acids of FGF19, further modified by
substituting the C-terminal amino acid of the FGF21 analog with
alanine.
[0022] In a further embodiment novel conjugates comprising a
modified C-terminal 25 amino acid peptide of FGF21 are provided. In
one embodiment the conjugate comprises an insulin agonist peptide
or an FGF1 peptide covalently linked to a modified peptide of SEQ
ID NO: 166, wherein the modified peptide differs from SEQ ID NO:
166 by one or more amino acid modifications at positions selected
from the group consisting of 3, 4, 6, 8, 9, 10, 12, 13, 20, 21 and
23 of SEQ ID NO: 166. In one embodiment the conjugate comprises a
modified peptide of SEQ ID NO: 166 wherein the modified peptide
differs from SEQ ID NO: 166 by 1, 2, 3, 4 or 5 amino acid
substitution at amino acid positions selected from the group
consisting of 3, 4, 6, 8, 9, 10, 12, 13, 20, 21 and 23. In one
embodiment the conjugate comprises a modified peptide of SEQ ID NO:
166 wherein the modified peptide differs from SEQ ID NO: 166 by 1
or 2 amino acid substitution at amino acid positions selected from
the group consisting of 8, 9 and 12. In accordance with one
embodiment the conjugate comprises a 25 amino acid peptide selected
from the group consisting of (SEQ ID NO: 188), (SEQ ID NO: 191),
(SEQ ID NO: 180), (SEQ ID NO: 179), (SEQ ID NO: 234), (SEQ ID NO:
237), (SEQ ID NO: 238), (SEQ ID NO: 239), (SEQ ID NO: 240), and
(SEQ ID NO: 241).
[0023] In accordance with one embodiment conjugates of the present
disclosure can be represented by the following formula:
Q-L-Y
[0024] wherein Q is an insulin peptide, a glucagon peptide, FGF1,
FGF2, or nuclear hormone, Y is a peptide comprising the sequence of
SEQ ID NO: 166 or a modified peptide that differs from SEQ ID NO:
166 by 1, 2, 3, 4 or 5 amino acid substitution at amino acid
positions selected from the group consisting of 3, 4, 6, 8, 9, 10,
12, 13, 20, 21 and 23 of SEQ ID NO: 166, and L is a linking group
or a bond. In accordance with one embodiment Y is a 25 amino acid
peptide selected from the group consisting of (SEQ ID NO: 188),
(SEQ ID NO: 191), (SEQ ID NO: 180), (SEQ ID NO: 179), (SEQ ID NO:
234), (SEQ ID NO: 237), (SEQ ID NO: 238), (SEQ ID NO: 239), (SEQ ID
NO: 240), and (SEQ ID NO: 241). In one embodiment Q is an insulin
peptide, or nuclear hormone. The insulin peptide component of the
conjugate can be native insulin or any known insulin analog that
has activity at the insulin receptor including, for example, any
insulin peptide disclosed in published international applications
WO96/34882, WO 2010/080607, WO 2010/080609, WO 2011/159882,
WO/2011/159895 and U.S. Pat. No. 6,630,348, the disclosures of
which are incorporated herein by reference. In embodiments where Q
is an NHR ligand, the ligand is wholly or partly non-peptidic and
acts at a nuclear hormone receptor with an activity in accordance
with any of the teachings set forth herein. In some embodiments the
NHR ligand is an agonist that, in its unbound state, has an EC50 or
IC50 of about 1 mM or less, or 100 .mu.M or less, or 10 .mu.M or
less, or 1 .mu.M or less. In accordance with one embodiment the NHR
ligand component of the conjugate can be a ligand that activates
the thyroid hormone receptor or activates the peroxisome
proliferator-activated receptors (PPAR) when in an unbound
state.
[0025] In other aspects of the present disclosure, methods are
provided for administering a therapeutically effective amount of a
Q-L-Y conjugate or FGF21-based analog described herein for treating
a disease or medical condition in a patient. In some embodiments,
the disease or medical condition is selected from the group
consisting of metabolic syndrome, diabetes, obesity, liver
steatosis, and chronic cardiovascular disease. In one embodiment
the FGF21-based analogs are administered to a patient to treat
metabolic syndrome and lipid abnormalities of the liver, including
for example non-alcoholic steatohepatitis (NASH).
[0026] Also encompassed by the present disclosure are
pharmaceutical compositions comprising the conjugates or
FGF21-based analogs disclosed herein and a pharmaceutically
acceptable carrier. In accordance with one embodiment a
pharmaceutical composition is provided comprising any of the
conjugates or FGF21-based analogs disclosed herein preferably at a
purity level of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98% or 99%, and a pharmaceutically acceptable diluent, carrier or
excipient. Such compositions may contain a conjugate or FGF21-based
analog as disclosed herein at a concentration of at least 0.5
mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7
mg/ml, 8 mg/ml, 9 mg/ml, 10 mg/ml, 11 mg/ml, 12 mg/ml, 13 mg/ml, 14
mg/ml, 15 mg/ml, 16 mg/ml, 17 mg/ml, 18 mg/ml, 19 mg/ml, 20 mg/ml,
21 mg/ml, 22 mg/ml, 23 mg/ml, 24 mg/ml, 25 mg/ml or higher. In one
embodiment the pharmaceutical compositions comprise aqueous
solutions that are sterilized and optionally stored within various
package containers. In other embodiments the pharmaceutical
compositions comprise a lyophilized powder. The pharmaceutical
compositions can be further packaged as part of a kit that includes
a disposable device for administering the composition to a patient.
The containers or kits may be labeled for storage at ambient room
temperature or at refrigerated temperature.
[0027] In accordance with one embodiment an improved method of
regulating blood glucose levels in insulin dependent patients is
provided. The method comprises the steps of administering to a
patient an FGF21-based peptide analog or conjugate as disclosed
herein in an amount therapeutically effective for the control of
diabetes. In accordance with one embodiment a method of reducing
weight or preventing weight gain is provided wherein the method
comprises administering a conjugate or FGF21-based analog as
disclosed herein to a patient in need of such therapy.
BRIEF DESCRIPTION OF THE DRAWINGS
[0028] FIG. 1. is a graph demonstrating C-terminal peptides of
FGF21 (amino acids 153-181) and FGF19 (amino acids 165-194) exhibit
antagonism to FGF21 activity (10 nM stimulation) in 293 HEK hKLB
cells equivalent to a much larger fragment of FGF21 (amino acids
18-181).
[0029] FIG. 2 is a graph comparing the ability of varying lengths
of C-terminal peptides of FGF21 to antagonize to FGF21 activity (10
nM stimulation) in 293 HEK hKLB cells. The results demonstrate a
terminal fragment of greater than 20 amino acids is required for
antagonism of FGF21 activity.
[0030] FIGS. 3A & 3B are graphs demonstrating that the
C-terminal 25 amino acid fragment of FGF21 (FIG. 3A) or FGF19 (FIG.
3B) is sufficient for antagonism of FGF21 activity. Also provided
is the activity of various alanine-mutated peptides of FGF21
157-181 as antagonists to FGF21 activity (FIG. 3A).
[0031] FIG. 4 is a graph presenting data for FGF21 analogs with
alanine mutations at positions 164 and 171 compared to native FGF21
activity. Alanine substitution at position 164 was found to
significantly impact FGF21 activity.
[0032] FIG. 5 provides the Far-UV CD spectra comparing native FGF21
and the Ala164 site-specific analog demonstrating the loss of
antagonism with the Ala164 is not associated with changes in the
secondary structure for the peptide.
[0033] FIG. 6 shows the sequence alignment of the C-termini of
FGF21 and FGF19.
[0034] FIGS. 7A-7C provided data regarding the bioactivity of FGF21
157-181 or FGF19 169-194 alanine scan mutation analogs. FIGS. 7A
& 7B present bar graphs plotting the respective bioactivity of
the FGF21 157-181 or FGF19 169-194 alanine mutation analogs. The
residue positions are denoted with regard to the FGF19 sequence.
FIG. 7A presents the fold change in the potencies of the set of
analogs achieving complete antagonistic response in comparison to
its respective native FGF21 or FGF19 peptide. FIG. 7B presents %
maximal activities of the set of analogs with less than 95% maximal
activity with respect to their native FGF21 or FGF19 peptide. The
vertical dotted line represents the activities of the native
peptides. Surprisingly, a significant difference in bioactivity was
achieved in FGF21 and FGF19 analogs having Ala in the C-terminal
position. FIG. 7C is a graph demonstrating the superior bioactivity
of FGF19 169-194 K194A peptide to antagonize FGF21 activity in
Hep3B cells relative to the native FGF21 18-181, FGF21 157-181 and
FGF19 169-194 sequences, thus confirming the unexpected activity
associated with the K194A substitution.
[0035] FIGS. 8A & 8B. are graphs representing the consequences
of substitutions at the terminal position of the antagonist
peptide. FIG. 8A graphs the data produced from a mutational
analysis at the terminal position of FGF19 169-194 peptide and its
effect on the antagonistic activity, IC-50 values provided in [nM].
K194A [10.5] (squares); K194S [22.3] (circles); K194L [17.3]
(triangles); K194E [87.9] (inverted triangles). FIG. 8B graphs the
data produced from an analysis of the presence or absence of a
lysine substitution at terminal position in FGF21 and FGF19
C-terminal peptides. FGF21 157-181 [0.04] (squares); FGF21 157-181
S181K (circles); FGF19 169-194 [0.05] (triangles); FGF19 169-194
K194A [0.0005] (inverted triangles), IC-50 values in [.mu.M].
[0036] FIGS. 9A & 9B. are graphs demonstrating the
translatability between the effects of alanine substitution seen in
the antagonist peptides and their corresponding full length agonist
analogs. Selected alanine mutations from the antagonist peptides
were incorporated into their corresponding full length FGF21 or
FGF19 protein sequences and tested for their ability to activate
Erk1/2 phosphorylation in 293T HEK hKLB cells. FIG. 9A shows the
activity for FGF21 [4.5, 100] (squares); FGF21 D164A [inactive, 6]
(circles); FGF21 P171A [4.5, 100] (triangles). FIG. 9B shows the
activity for FGF21 [3.3, 100] (squares); FGF19 [147.9, 27]
(circles); FGF19 K194A [8.1, 31] (triangles); FGF21-19 K194A [0.5,
84] (inverted triangles). EC-50 and % maximal activity values are
provided in [nM, %].
[0037] FIGS. 10A & 10 B are graphs demonstrating the FGF21 and
FGF19 peptides are functional in mouse as well as human cells.
FGF21 and FGF19 peptides were acetylated at the N-terminus to help
increase stability for use in vivo. Acetylated FGF21 and FGF19
peptides retain their antagonistic activity at both human (FIG.
10A) and mouse (FIG. 10B) cells that overexpressing human and mouse
Klotho .beta. (KLB), respectively.
[0038] FIGS. 11A & 11B are graphs demonstrating that
modification of FGF21 by replacing the native C-terminal 25 amino
acids with the FGF19 A26 antagonistic peptide significantly
increases agonism at both human (FIG. 11A) and mouse (FIG. 11B)
KLB. This fusion, called 0268-1A, has enhanced potency
(1.82.+-.0.37 & 2.15.+-.0.54) compared to both FGF21
(8.42.+-.4.1 & 3.96.+-.1.51) and FGF19 (65.78.+-.58.19 &
25.67.+-.21.32) in cells that overexpressed both human and mouse
KLB.
[0039] FIG. 12 is a graph demonstrating modification of the
N-Terminus of FGF21 analog 0278-1A by amino acid substitutions
A31C, G43C, L98D, L100K, N121D, and D127K (position numbering based
on the native FGF21 sequence) to generate analog V2-0278-1A,
increases potency relative to 0278-1A. V2-0278-1A displays
.about.2-3.times. higher potency (0.35.+-.0.12 nM) versus 0278
(1.13.+-.0.28) in cells overexpressing human KLB.
[0040] FIGS. 13A-13C provide data relating to the in vivo
administration of the FGF21 analog of SEQ ID NO: 193 (analog 0361)
administered at a dosage of 0.3 mg/kg or 1.0 mg/kg. FIGS. 13A and
13B demonstrate the superior change in body weight obtained with
the FGF21 analog relative to the control and administered native
FGF21, as measured by total body weight (FIG. 13A) or by percent
change in body weight (FIG. 13B). FIG. 13C demonstrates those mice
receiving the FGF21 analog had a greater reduction in total food
intake.
DETAILED DESCRIPTION
Definitions
[0041] In describing and claiming the invention, the following
terminology will be used in accordance with the definitions set
forth below.
[0042] The term "about" as used herein means greater or lesser than
the value or range of values stated by 10 percent, but is not
intended to designate any value or range of values to only this
broader definition. Each value or range of values preceded by the
term "about" is also intended to encompass the embodiment of the
stated absolute value or range of values.
[0043] As used herein the term "amino acid" encompasses any
molecule containing both amino and carboxyl functional groups,
wherein the amino and carboxylate groups are attached to the same
carbon (the alpha carbon). The alpha carbon optionally may have one
or two further organic substituents. For the purposes of the
present disclosure designation of an amino acid without specifying
its stereochemistry is intended to encompass either the L or D form
of the amino acid, or a racemic mixture.
[0044] As used herein the term "hydroxyl acid" refers to amino
acids that have been modified to replace the alpha carbon amino
group with a hydroxyl group.
[0045] As used herein the term "non-coded amino acid" encompasses
any amino acid that is not an L-isomer of any of the following 20
amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met,
Asn, Pro, Gln, Arg, Ser, Thr, Val, Trp, Tyr.
[0046] As used herein a general reference to a peptide is intended
to encompass peptides that have modified amino and carboxy termini.
For example, an amino acid sequence designating the standard amino
acids is intended to encompass standard amino acids at the N- and
C-terminus as well as a corresponding hydroxyl acid or acetylated
amino acid at the N-terminus and/or a corresponding C-terminal
amino acid modified to comprise an amide group in place of the
terminal carboxylic acid.
[0047] As used herein an "acylated" amino acid is an amino acid
comprising an acyl group which is non-native to a
naturally-occurring amino acid, regardless by the means by which it
is produced. Exemplary methods of producing acylated amino acids
and acylated peptides are known in the art and include acylating an
amino acid before inclusion in the peptide or peptide synthesis
followed by chemical acylation of the peptide. In some embodiments,
the acyl group causes the peptide to have one or more of (i) a
prolonged half-life in circulation, (ii) a delayed onset of action,
(iii) an extended duration of action, (iv) an improved resistance
to proteases, such as DPP-IV, and (v) increased potency at the IGF
and/or insulin peptide receptors.
[0048] As used herein, an "alkylated" amino acid is an amino acid
comprising an alkyl group which is non-native to a
naturally-occurring amino acid, regardless of the means by which it
is produced. Exemplary methods of producing alkylated amino acids
and alkylated peptides are known in the art and including
alkylating an amino acid before inclusion in the peptide or peptide
synthesis followed by chemical alkylation of the peptide. Without
being held to any particular theory, it is believed that alkylation
of peptides will achieve similar, if not the same, effects as
acylation of the peptides, e.g., a prolonged half-life in
circulation, a delayed onset of action, an extended duration of
action, an improved resistance to proteases, such as DPP-IV, and
increased potency at the IGF and/or insulin receptors.
[0049] As used herein, the term "pharmaceutically acceptable
carrier" includes any of the standard pharmaceutical carriers, such
as a phosphate buffered saline solution, water, emulsions such as
an oil/water or water/oil emulsion, and various types of wetting
agents. The term also encompasses any of the agents approved by a
regulatory agency of the US Federal government or listed in the US
Pharmacopeia for use in animals, including humans.
[0050] As used herein the term "pharmaceutically acceptable salt"
refers to salts of compounds that retain the biological activity of
the parent compound, and which are not biologically or otherwise
undesirable. Many of the compounds disclosed herein are capable of
forming acid and/or base salts by virtue of the presence of amino
and/or carboxyl groups or groups similar thereto.
[0051] As used herein, the term "hydrophilic moiety" refers to any
compound that is readily water-soluble or readily absorbs water,
and which are tolerated in vivo by mammalian species without toxic
effects (i.e. are biocompatible). Examples of hydrophilic moieties
include polyethylene glycol (PEG), polylactic acid, polyglycolic
acid, a polylactic-polyglycolic acid copolymer, polyvinyl alcohol,
polyvinylpyrrolidone, polymethoxazoline, polyethyloxazoline,
polyhydroxyethyl methacrylate, polyhydroxypropyl methacrylamide,
polymethacrylamide, polydimethylacrylamide, and derivatised
celluloses such as hydroxymethylcellulose or hydroxyethylcellulose
and co-polymers thereof, as well as natural polymers including, for
example, albumin, heparin and dextran.
[0052] As used herein, the term "treating" includes prophylaxis of
the specific disorder or condition, or alleviation of the symptoms
associated with a specific disorder or condition and/or preventing
or eliminating said symptoms. For example, as used herein the term
"treating diabetes" will refer in general to maintaining glucose
blood levels near normal levels and may include increasing or
decreasing blood glucose levels depending on a given situation.
[0053] As used herein an "effective" amount or a "therapeutically
effective amount" of a compound or conjugate refers to a nontoxic
but sufficient amount of the compound or conjugate to provide the
desired effect. The amount that is "effective" will vary from
subject to subject, depending on the age and general condition of
the individual, mode of administration, and the like. Thus, it is
not always possible to specify an exact "effective amount."
However, an appropriate "effective" amount in any individual case
may be determined by one of ordinary skill in the art using routine
experimentation.
[0054] The term, "parenteral" means not through the alimentary
canal but by some other route such as intranasal, inhalation,
subcutaneous, intramuscular, intraspinal, or intravenous.
[0055] Throughout the application, all references to a particular
amino acid position in an insulin analog by letter and number (e.g.
position A5) refer to the amino acid at that position of either the
A chain (e.g. position A5) or the B chain (e.g. position B5) in the
respective native human insulin A chain (SEQ ID NO: 1) or B chain
(SEQ ID NO: 2), or the corresponding amino acid position in any
analogs thereof. For example, a reference herein to "position B28"
absent any further elaboration would mean the corresponding
position B27 of the B chain of an insulin analog in which the first
amino acid of SEQ ID NO: 2 has been deleted. Similarly, amino acids
added to the N-terminus of the native B chain are numbered starting
with B0, followed by numbers of increasing negative value (e.g.,
B-1, B-2 . . . ) as amino acids are added to the N-terminus.
Alternatively, any reference to an amino acid position in the
linking moiety of a single chain analog, is made in reference to
the native C chain of IGF 1 (SEQ ID NO: 17). For example, position
9 of the native C chain (or the "position C9") has an alanine
residue.
[0056] As used herein the term "native insulin peptide" is intended
to designate the 51 amino acid heteroduplex comprising the A chain
of SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, as well as
single-chain insulin analogs that comprise SEQ ID NOS: 1 and 2. The
term "insulin peptide" as used herein, absent further descriptive
language is intended to encompass the 51 amino acid heteroduplex
comprising the A chain of SEQ ID NO: 1 and the B chain of SEQ ID
NO: 2, as well as single-chain insulin analogs thereof (including
for example those disclosed in published international application
WO96/34882 and U.S. Pat. No. 6,630,348, the disclosures of which
are incorporated herein by reference), including heteroduplexes and
single-chain analogs that comprise modified analogs of the native A
chain and/or B chain and derivatives thereof. Such modified analogs
include modification of the amino acid at position A19, B16 or B25
to a 4-amino phenylalanine or one or more amino acid substitutions
at positions selected from A5, A8, A9, A10, A12, A14, A15, A17,
A18, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21,
B22, B23, B26, B27, B28, B29 and B30 or deletions of any or all of
positions B1-4 and B26-30. Insulin peptides as defined herein can
also be analogs derived from a naturally occurring insulin by
insertion or substitution of a non-peptide moiety, e.g. a
retroinverso fragment, or incorporation of non-peptide bonds such
as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond
(e.g. NH substituted with CH.sub.2) or an ester bond (e.g., a
depsipeptide, wherein one or more of the amide (--CONHR--) bonds
are replaced by ester (COOR) bonds).
[0057] As used herein the term "insulin-like peptide" is intended
to designate insulin peptides and related peptides that share the
common structural element of having six cysteine residues that form
the three disulfide cross-links similar to native insulin. Such
related peptides include insulin like growth factors (e.g., IGF I
and IGF II), insulin like peptides (e.g., insulin like peptides 3,
4, 5 and 6) and relaxins (e.g., relaxin-1, 2 and 3).
[0058] As used herein, the term "single-chain insulin analog"
encompasses a group of structurally-related proteins wherein
insulin or IGF A and B chains, or analogs or derivatives thereof,
are covalently linked to one another to form a linear polypeptide
chain. As disclosed herein the single-chain insulin analog
comprises the covalent linkage of the carboxy terminus of the B
chain to the amino terminus of the A chain via a linking
moiety.
[0059] As used herein the term "insulin A chain", absent further
descriptive language is intended to encompass the 21 amino acid
sequence of SEQ ID NO: 1 as well as functional analogs and
derivatives thereof, including insulin analogs known to those
skilled in the art, including modification of the sequence of SEQ
ID NO: 1 by one or more amino acid insertions, deletions or
substitutions at positions selected from A4, A5, A8, A9, A10, A12,
A14, A15, A17, A18, A21.
[0060] As used herein the term "insulin B chain", absent further
descriptive language is intended to encompass the 30 amino acid
sequence of SEQ ID NO: 2, as well as modified functional analogs of
the native B chain, including one or more amino acid insertions,
deletions or substitutions at positions selected from B1, B2, B3,
B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B25, B26, B27,
B28, B29 and B30 or deletions of any or all of positions B1-4 and
B26-30.
[0061] The term "identity" as used herein relates to the similarity
between two or more sequences. Identity is measured by dividing the
number of identical residues by the total number of residues and
multiplying the product by 100 to achieve a percentage. Thus, two
copies of exactly the same sequence have 100% identity, whereas two
sequences that have amino acid deletions, additions, or
substitutions relative to one another have a lower degree of
identity. Those skilled in the art will recognize that several
computer programs, such as those that employ algorithms such as
BLAST (Basic Local Alignment Search Tool, Altschul et al. (1993) J.
Mol. Biol. 215:403-410) are available for determining sequence
identity.
[0062] As used herein, the term "selectivity" of a molecule for a
first receptor relative to a second receptor refers to the
following ratio: EC.sub.50 of the molecule at the second receptor
divided by the EC.sub.50 of the molecule at the first receptor. For
example, a molecule that has an EC.sub.50 of 1 nM at a first
receptor and an EC.sub.50 of 100 nM at a second receptor has
100-fold selectivity for the first receptor relative to the second
receptor.
[0063] As used herein an amino acid "modification" refers to a
substitution of an amino acid, or the derivation of an amino acid
by the addition and/or removal of chemical groups to/from the amino
acid, and includes substitution with any of the 20 amino acids
commonly found in human proteins, as well as atypical or
non-naturally occurring amino acids. Commercial sources of atypical
amino acids include Sigma-Aldrich (Milwaukee, Wis.), ChemPep Inc.
(Miami, Fla.), and Genzyme Pharmaceuticals (Cambridge, Mass.).
Atypical amino acids may be purchased from commercial suppliers,
synthesized de novo, or chemically modified or derivatized from
naturally occurring amino acids.
[0064] As used herein an amino acid "substitution" refers to the
replacement of one amino acid residue by a different amino acid
residue.
[0065] As used herein, the term "conservative amino acid
substitution" is defined herein as exchanges within one of the
following five groups: [0066] I. Small aliphatic, nonpolar or
slightly polar residues: [0067] Ala, Ser, Thr, Pro, Gly; [0068] II.
Polar, negatively charged residues and their amides: [0069] Asp,
Asn, Glu, Gln, cysteic acid and homocysteic acid; [0070] III.
Polar, positively charged residues: [0071] His, Arg, Lys; Ornithine
(Orn) [0072] IV. Large, aliphatic, nonpolar residues: [0073] Met,
Leu, Ile, Val, Cys, Norleucine (Nle), homocysteine [0074] V. Large,
aromatic residues: [0075] Phe, Tyr, Trp, acetyl phenylalanine
[0076] As used herein the general term "polyethylene glycol chain"
or "PEG chain", refers to mixtures of condensation polymers of
ethylene oxide and water, in a branched or straight chain,
represented by the general formula H(OCH.sub.2CH.sub.2).sub.nOH,
wherein n is at least 2. "Polyethylene glycol chain" or "PEG chain"
is used in combination with a numeric suffix to indicate the
approximate average molecular weight thereof. For example,
PEG-5,000 refers to polyethylene glycol chain having a total
molecular weight average of about 5,000 Daltons.
[0077] As used herein the term "pegylated" and like terms refers to
a compound that has been modified from its native state by linking
a polyethylene glycol chain to the compound. A "pegylated
polypeptide" is a polypeptide that has a PEG chain covalently bound
to the polypeptide.
[0078] As used herein a "linker" is a bond, molecule or group of
molecules that binds two separate entities to one another. Linkers
may provide for optimal spacing of the two entities or may further
supply a labile linkage that allows the two entities to be
separated from each other. Labile linkages include photocleavable
groups, acid-labile moieties, base-labile moieties and
enzyme-cleavable groups.
[0079] As used herein a "dimer" is a complex comprising two
subunits covalently bound to one another via a linker. The term
dimer, when used absent any qualifying language, encompasses both
homodimers and heterodimers. A homodimer comprises two identical
subunits, whereas a heterodimer comprises two subunits that differ,
although the two subunits are substantially similar to one
another.
[0080] The term "C.sub.1-C.sub.n alkyl" wherein n can be from 1
through 6, as used herein, represents a branched or linear alkyl
group having from one to the specified number of carbon atoms.
Typical C.sub.1-C.sub.6 alkyl groups include, but are not limited
to, methyl, ethyl, n-propyl, isopropyl, butyl, iso-Butyl,
sec-butyl, tert-butyl, pentyl, hexyl and the like.
[0081] The terms "C.sub.2-C.sub.n alkenyl" wherein n can be from 2
through 6, as used herein, represents an olefinically unsaturated
branched or linear group having from 2 to the specified number of
carbon atoms and at least one double bond. Examples of such groups
include, but are not limited to, 1-propenyl, 2-propenyl
(--CH.sub.2--CH.dbd.CH.sub.2), 1,3-butadienyl,
(--CH.dbd.CHCH.dbd.CH.sub.2), 1-butenyl
(--CH.dbd.CHCH.sub.2CH.sub.3), hexenyl, pentenyl, and the like.
[0082] The term "C.sub.2-C.sub.n alkynyl" wherein n can be from 2
to 6, refers to an unsaturated branched or linear group having from
2 to n carbon atoms and at least one triple bond. Examples of such
groups include, but are not limited to, 1-propynyl, 2-propynyl,
1-butynyl, 2-butynyl, 1-pentynyl, and the like.
[0083] As used herein the term "aryl" refers to a mono- or bicyclic
carbocyclic ring system having one or two aromatic rings including,
but not limited to, phenyl, naphthyl, tetrahydronaphthyl, indanyl,
indenyl, and the like. The size of the aryl ring and the presence
of substituents or linking groups are indicated by designating the
number of carbons present. For example, the term "(C.sub.1-C.sub.3
alkyl)(C.sub.6-C.sub.10 aryl)" refers to a 5 to 10 membered aryl
that is attached to a parent moiety via a one to three membered
alkyl chain.
[0084] The term "heteroaryl" as used herein refers to a mono- or
bi-cyclic ring system containing one or two aromatic rings and
containing at least one nitrogen, oxygen, or sulfur atom in an
aromatic ring. The size of the heteroaryl ring and the presence of
substituents or linking groups are indicated by designating the
number of carbons present. For example, the term "(C.sub.1-C.sub.n
alkyl)(C.sub.5-C.sub.6 heteroaryl)" refers to a 5 or 6 membered
heteroaryl that is attached to a parent moiety via a one to "n"
membered alkyl chain.
[0085] As used herein, the term "halo" refers to one or more
members of the group consisting of fluorine, chlorine, bromine, and
iodine.
[0086] As used herein the term "patient" without further
designation is intended to encompass any warm blooded vertebrate
domesticated animal (including for example, but not limited to
livestock, horses, cats, dogs and other pets) and humans.
[0087] The term "isolated" as used herein means having been removed
from its natural environment. In some embodiments, the analog is
made through recombinant methods and the analog is isolated from
the host cell.
[0088] The term "purified," as used herein relates to the isolation
of a molecule or compound in a form that is substantially free of
contaminants normally associated with the molecule or compound in a
native or natural environment and means having been increased in
purity as a result of being separated from other components of the
original composition. The term "purified polypeptide" is used
herein to describe a polypeptide which has been separated from
other compounds including, but not limited to nucleic acid
molecules, lipids and carbohydrates.
[0089] A "peptidomimetic" refers to a chemical compound having a
structure that is different from the general structure of an
existing peptide, but that functions in a manner similar to the
existing peptide, e.g., by mimicking the biological activity of
that peptide. Peptidomimetics typically comprise
naturally-occurring amino acids and/or unnatural amino acids, but
can also comprise modifications to the peptide backbone. For
example a peptidomimetic may include a sequence of
naturally-occurring amino acids with the insertion or substitution
of a non-peptide moiety, e.g. a retroinverso fragment, or
incorporation of non-peptide bonds such as an azapeptide bond (CO
substituted by NH) or pseudo-peptide bond (e.g. NH substituted with
CH2), or an ester bond (e.g., depsipeptides, wherein one or more of
the amide (--CONHR--) bonds are replaced by ester (COOR) bonds).
Alternatively the peptidomimetic may be devoid of any
naturally-occurring amino acids.
[0090] As used herein the term "FGF21-based analog" or "FGF21
analog" are used interchangeably, and absent further limitation
define an FGF peptide of SEQ ID NO: 173 modified to comprise a
substitution at position 181 with a non-charged amino acid (i.e.,
excluding Asp, Glu, Lys, Arg and His) and optionally selected from
the group consisting of Ala, Val, Gly, Thr, Cys, Pro, Met, Be and
Leu, and optionally one or more of the following modifications:
[0091] i) one or more substitutions at positions selected from the
group consisting of positions 157-161, 163, 166-168, 170-174 and
179-180 (based on the numbering of the mature FGF21 peptide of SEQ
ID NO: 173); or
[0092] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173);
or
[0093] iii) a substitution of the native amino acid at position 167
and/or 175 with the corresponding D-isomer of said native amino
acid;
[0094] iv) substitution of the native C-terminal 25 amino acids of
SEQ ID NO: 173 with the sequence of SEQ ID NO: 188 or
[0095] v) and any combination of i) and ii) or i), ii) and iii) or
a combination of ii) with iii).
[0096] As used herein the term "FGF21-based peptide conjugate"
defines a conjugate comprising a modified peptide of SEQ ID NO: 166
linked to a conjugate moiety, wherein the modified peptide differs
from the peptide of SEQ ID NO: 166 by one or more amino acid
substitutions at positions selected from positions 1, 2, 3, 4, 5,
7, 10, 11, 12, 14, 15, 16, 17, 18, 23, 24 and 25 of SEQ ID NO:
166.
Abbreviations
[0097] Insulin analogs will be abbreviated as follows:
[0098] The insulin A and B chains will be designated generically by
a capital A for the A chain and a capital B for the B chain. When
present, a superscript 0 (e.g., A.sup.0 or B.sup.0) will designate
the base sequence is an insulin sequence (A chain: SEQ ID NO: 1, B
chain SEQ ID NO: 2) and a superscript 1 (e.g., A.sup.1 or B.sup.1)
will designate the base sequence is an IGF-1 sequence (A chain: SEQ
ID NO: 5, B chain SEQ ID NO: 6). Modifications that deviate from
the native insulin and IGF sequence are indicated in parenthesis
following the designation of the A or B chain (e.g.,
[B.sup.1(H5,H10,Y16,L17): A.sup.1(H8,N18,N21)]) with the single
letter amino acid abbreviation indicating the substitution and the
number indicating the position of the substitution in the
respective A or B chain, using native insulin numbering. A colon
between the A and B chain indicates a two chain insulin whereas a
dash will indicate a covalent bond and thus a single chain analog.
In single chain analogs a linking moiety will be included between
the A and B chains and the designation C.sup.1 refers to the native
IGF 1 C peptide, SEQ ID NO: 17. The designation "position C8" in
reference to the linking moiety designates an amino acid located at
the position corresponding to the eighth amino acid of SEQ ID NO:
17.
Embodiments
[0099] The beneficial pharmacology observed in preclinical models
indicate that FGF21 and its analogs or mimetics hold promise as
innovative therapeutics for treating metabolic disorders. However,
analogs of FGF21 having greater potency at the FGF receptor are
needed to enhance the efficacy of FGF21 mediated therapies.
[0100] At a molecular level, FGF21 interacts with the FGF receptor
only in tissues expressing the cofactor Klotho .beta.. The Klotho
.beta.-dependent tissue specificity is consistent with the
predominant effects of FGF21 occurring in liver and adipose tissue.
Accordingly, one approach to enhance the potency of FGF21 analogs
at the FGF21 receptor would be to modify FGF21 to enhance its
interaction with Klotho .beta..
[0101] The C-terminus of FGF21 is believed to play a key role in
binding with Klotho .beta. and applicants have demonstrated that a
peptide comprising the C-terminal 25 amino acids of FGF21 (SEQ ID
NO: 166) can inhibit activity of the native FGF21 peptide at its
receptor. Presumably this antagonism arises from the affinity of
the peptide for Klotho .beta.. In one embodiment, the present
disclosure is directed to peptides, and conjugates comprising such
peptides, that impact the activity of FGF21 at the FGF21 receptor.
More particularly, in one embodiment structural optimization of the
peptide of SEQ ID NO: 166 is performed to enhance the peptide's
interaction with Klotho .beta..
[0102] In one embodiment a derivative of SEQ ID NO: 166 is provided
wherein the derivative comprises a peptide that differs from SEQ ID
NO: 166 by one or more amino acid modifications, wherein said
peptide has enhanced ability to bind to Klotho .beta. and/or
enhanced ability to antagonize FGF21 activity, relative to the
peptide of SEQ ID NO: 166. In one embodiment a peptide is provided
comprising the structure of
PPX.sub.3X.sub.4GX.sub.6SX.sub.8X.sub.9X.sub.10SX.sub.12X.sub.13GPSQGRX.s-
ub.20X.sub.21SX.sub.23AS (SEQ ID NO: 168) wherein X.sub.3, X.sub.4,
X.sub.6, X.sub.8, X.sub.9, X.sub.10, X.sub.12, X.sub.13, X.sub.20,
X.sub.21, and X.sub.23 are independently any amino acid, with the
proviso that the peptide of SEQ ID NO: 168 differs from SEQ ID NO:
166 by at least one amino acid substitution. In one embodiment one
or more of X.sub.3, X.sub.4, X.sub.6, X.sub.8, X.sub.9, X.sub.10,
X.sub.12, X.sub.13, X.sub.20, X.sub.21, and X.sub.23 are amino
acids in the D-stereo configuration, optionally the D-stereoisomer
of the corresponding native amino acid at that position.
[0103] In accordance with one embodiment a peptide derivative of
SEQ ID NO: 166 is provided that differs from SEQ ID NO: 166 by 1,
2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions at any of
amino acid positions 3, 4, 6, 8, 9, 10, 12, 13, 20, 21 and 23 of
SEQ ID NO: 166. In accordance with one embodiment a peptide
derivative of SEQ ID NO: 166 is provided that differs from SEQ ID
NO: 166 by 1, 2, 3, 4, or 5 amino acid substitutions at any of
amino acid positions 3, 4, 6, 8, 9, 10, 12, 13, 20, 21 and 23 of
SEQ ID NO: 166. In accordance with one embodiment a peptide
derivative of SEQ ID NO: 166 is provided that differs from SEQ ID
NO: 166 by 1 or 2 amino acid substitutions at any of amino acid
positions 3, 4, 6, 8, 9, 10, 12, 13, 20, 21 and 23 of SEQ ID NO:
166. In accordance with one embodiment a peptide derivative of SEQ
ID NO: 166 is provided that differs from SEQ ID NO: 166 by 1, 2 or
3 amino acid substitutions at amino acid positions selected from
positions 8, 9 and 12 of SEQ ID NO: 166. In accordance with one
embodiment a peptide derivative of SEQ ID NO: 166 is provided that
differs from SEQ ID NO: 166 by 1 or 2 amino acid substitutions at
amino acid positions selected from positions 8, 9 and 12 of SEQ ID
NO: 166.
[0104] In one embodiment a peptide is provided comprising the
structure of PPDVGSSX.sub.8X.sub.9LSX.sub.12VGPSQGRSPSYAS (SEQ ID
NO: 169) wherein X.sub.8, X.sub.9, and X.sub.12 are independently
any amino acid, with the proviso that the peptide of SEQ ID NO: 169
differs from SEQ ID NO: 166 by at least one amino acid
substitution. In one embodiment one or more of X.sub.8, X.sub.9,
and X.sub.12 are amino acids in the D-stereo configuration,
optionally the D-stereoisomer of the corresponding native amino
acid at that position. In one embodiment X.sub.8 is selected from
the group consisting of Asp and D-Asp; X.sub.9 is selected from the
group consisting of Phe and D-Phe; and X.sub.12 is selected from
the group consisting of Met and D-Met, with the proviso that the
peptide of SEQ ID NO: 169 differs from SEQ ID NO: 166 by at least
one amino acid substitution.
[0105] In one embodiment a peptide is provided comprising the
structure of PPDVGSSX.sub.8X.sub.9LSX.sub.12VGPSQGRSPSYAS (SEQ ID
NO: 169) wherein
[0106] X.sub.8 is selected from the group consisting of D-Asp,
.alpha.-methyl-L-aspartic acid, .alpha.-methyl-D-aspartic acid;
[0107] X.sub.9 is selected from the group consisting of D-Phe,
D-4-t-Bu-phenylalanine (D-4-tBuPhe), D-alpha-methylphenylalanine
(D-alpha-MePhe), D-4-biphenylalanine (D-4-Bip), D-1-naphthylalanine
(D-1-Nal), D-2-naphthylalanine (D-2-Nal), 4-FPhe, 4-ClPhe, 4-BrPhe,
4-IPhe, 4-NO.sub.2Phe, and 3-NO.sub.2Phe; and
[0108] X.sub.12 is selected from the group consisting of D-Met, and
methionine sulfoxide.
[0109] In accordance with one embodiment a peptide antagonist of
Klotho .beta. binding/FGF21 activity is provided wherein the
peptide is a derivative of the C-terminal 25 amino acid sequence of
FGF21. In particular, applicants have discovered that the
C-terminal 25 amino acids of FGF21 has equivalent antagonist
activity for binding to Klotho .beta. as a much larger fragment of
FGF21 (amino acids 18-181). Furthermore, applicants have discovered
that by substituting the C-terminal amino acid of the 25mer peptide
fragment of FGF21, the potency of antagonism of the peptide for
FGF21 binding to Klotho .beta. can be significantly enhanced. In
accordance with one embodiment, a modified C-terminal 25 amino acid
fragment of FGF21 (SEQ ID NO: 177) or a C-terminal 25 amino acid
fragment of FGF19 (SEQ ID NO: 203) is provided wherein the
C-terminal amino acid is substituted with a non-charged amino acid
(e.g., excluding Arg, Lys, Asp, Glu or His). This peptide can be
further modified with 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 additional
amino acid modifications. In one embodiment the C-terminal amino
acid of the FGF21 modified peptide fragment is an aliphatic amino
acid selected from the group consisting of Gly, Ala, Val, Pro, Cys,
Thr, Met, Leu and Be. In one embodiment the C-terminal amino acid
of the FGF21 modified peptide fragment is an aliphatic amino acid
selected from the group consisting of Gly, Ala, Val, Pro, Met, Leu
and Ile. In one embodiment the C-terminal amino acid of the FGF21
modified peptide fragment is an aliphatic amino acid selected from
the group consisting of Gly, Ala, Val, Leu and Ile. In one
embodiment the C-terminal amino acid of the FGF21 modified peptide
fragment is an aliphatic amino acid selected from the group
consisting of Gly, Ala and Val. In one embodiment the C-terminal
amino acid of the FGF21 modified peptide fragment is Ala.
[0110] In accordance with one embodiment peptides based on the
C-terminal 25 amino acids of native FGF21 and FGF19 are provided
that have an enhanced ability to bind Klotho .beta. and can be used
as antagonists of FGF receptor activity. In one embodiment these
peptides comprise a C-terminal 25 amino acid fragment of FGF21 (SEQ
ID NO: 177) that is modified by a substitution at position 25 with
a non-charged amino acid (e.g., excluding Arg, Lys, Asp, Glu or
His), optionally substituted with alanine, and optionally one or
more modifications selected from:
[0111] i) one or more substitutions selected from the group
consisting of G5L, G5F, G5S, S7M, L10F, S11G, M12L, P15R, Y23F, and
A24E (based on the numbering of the FGF21 peptide fragment of SEQ
ID NO: 177); or
[0112] ii) one or more substitution of the native amino acid at
position 11 or 19 (based on the numbering of the FGF21 peptide
fragment of SEQ ID NO: 177) with the corresponding D-isomer of that
amino acid; or
[0113] iii) and any combination of i) and ii).
[0114] In one embodiment a modified C-terminal 25 amino acid
fragment of FGF21 (SEQ ID NO: 177) is provided, wherein the
modified peptide comprises a substitution at position 25 with
alanine, and
[0115] i) one or more substitutions selected from the group
consisting of G5L, G5F, G5S, S7M, L10F, S11G, M12L, P15R, Y23F, and
A24E.
[0116] In one embodiment a modified C-terminal 25 amino acid
fragment of FGF21 (SEQ ID NO: 177) is provided, wherein the
modified peptide comprises a substitution at position 25 with a
non-charged amino acid (e.g., excluding Arg, Lys, Asp, Glu or His),
optionally substituted with alanine, and
[0117] i) one or more substitutions selected from the group
consisting of G5L, G5F, G5S, S7M, L10F, S11G, M12L, P15R, Y23F, and
A24E; and
[0118] ii) a substitution of the native amino acid at position 11
or 19 (based on the numbering of the FGF21 peptide fragment of SEQ
ID NO: 177) with the corresponding D-isomer of that amino acid.
[0119] In one embodiment a modified C-terminal 25 amino acid
fragment of FGF21 (SEQ ID NO: 177) is provided, wherein the
modified peptide comprises a substitution at position 25 with a
non-charged amino acid (e.g., excluding Arg, Lys, Asp, Glu or His),
optionally substituted with alanine, and one or more substitutions
selected from the group consisting of S7M, L10F, S11G, and
M12L.
[0120] In one embodiment a modified C-terminal 25 amino acid
fragment of FGF21 (SEQ ID NO: 177) is provided, wherein the
modified peptide comprises a substitution at position 25 with a
non-charged amino acid (e.g., excluding Arg, Lys, Asp, Glu or His),
optionally substituted with alanine, and 2, 3, 4, 5, 6, 7 or 8
substitutions selected from the group consisting of G5L, G5F, G5S,
S7M, L10F, S11G, M12L, P15R, Y23F, and A24E.
[0121] In one embodiment a modified C-terminal 25 amino acid
fragment of FGF21 (SEQ ID NO: 177) is provided, wherein the
modified peptide comprises a substitution at position 25 with a
non-charged amino acid (e.g., excluding Arg, Lys, Asp, Glu or His),
optionally substituted with alanine, and further substitutions of
S7M, L10F, S11G, M12L, P15R, Y23F, and A24E.
[0122] In accordance with one embodiment peptides based on the
C-terminal 25 amino acids of native FGF21 and FGF19 are provided
that have an enhanced ability to bind Klotho .beta. and can
function as antagonists of FGF receptor activity. In accordance
with one embodiment a 25 amino acid peptide antagonist of FGF21
receptor activity is selected from the group consisting of SEQ ID
NOs: 179, 180, 188, 191, 234, 237, 238, 239, 240 or 241. Each of
these peptides have been found to be more potent in antagonizing
the native FGF21's in vitro signaling than the corresponding native
FGF21 C-terminal 25 amino acid fragment.
[0123] As demonstrated by the data presented in Examples 1 and 2
certain positions of the 25 amino acid C-terminal peptide are
tolerant of amino acid substitutions without substantial impact to
the ability of the peptide to bind Klotho .beta. and/or inhibit
FGF21 activity at the FGF21 receptor. In particular positions 1, 2,
5, 7, 11, 14, 15, 16, 17, 18 and 19 of the C-terminal FGF21
fragment tolerate amino acid substitutions without substantial loss
in their ability to antagonizing the native FGF21's in vitro
signaling. In accordance with one embodiment a derivative of a
peptide comprising SEQ ID NO: 188, SEQ ID NO: 191, SEQ ID NO: 180,
SEQ ID NO: 179 or SEQ ID NO: 234 is provided, wherein the
derivative peptide differs from SEQ ID NO: 188, SEQ ID NO: 191, SEQ
ID NO: 180, SEQ ID NO: 179 or SEQ ID NO: 234 by 1, 2, 3, 4, 5, 6,
7, 8, 9, 10 or 11 amino acid substitutions selected from positions
1, 2, 5, 7, 11, 14, 15, 16, 17, 18 and 19 relative to those
sequences. In one embodiment the derivative peptide differs by 1, 2
or 3 amino acid substitutions selected from positions 1, 2, 5, 7,
11, 14, 15, 16, 17, 18 and 19. In one embodiment the amino acid
substitutions at positions 1, 2, 5, 7, 11, 14, 15, 16, 17, 18 and
19 are conservative amino acid substitutions. In one embodiment a
derivative of a peptide comprising SEQ ID NO: 188, SEQ ID NO: 191,
SEQ ID NO: 180, SEQ ID NO: 179 or SEQ ID NO: 234 is provided,
wherein the derivative peptide differs from SEQ ID NO: 188, SEQ ID
NO: 191, SEQ ID NO: 180, SEQ ID NO: 179 or SEQ ID NO: 234 by 1, 2
or 3 amino acid substitutions selected from positions 1, 2, 5, 14,
15, 16, 17, 18 and 19, optionally wherein the amino acid
substitutions are conservative amino acid substitutions. In one
embodiment a derivative of a peptide comprising SEQ ID NO: 188, SEQ
ID NO: 191, SEQ ID NO: 180, SEQ ID NO: 179 or SEQ ID NO: 234 is
provided, wherein the derivative peptide differs from SEQ ID NO:
188, SEQ ID NO: 191, SEQ ID NO: 180, SEQ ID NO: 179 or SEQ ID NO:
234 by 1, 2 or 3 amino acid substitutions selected from positions
2, 5, 14, 15, 16, 17, 18 and 19, optionally wherein the amino acid
substitutions are conservative amino acid substitutions. In one
embodiment a peptide with antagonist activity against Klotho .beta.
is provided wherein the peptide comprises an amino acid sequence of
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5SX.sub.7DPX.sub.10X.sub.11X.sub.12VX.s-
ub.14GX.sub.16X.sub.17X.sub.18X.sub.19RSPSX.sub.24X.sub.25X.sub.26
(SEQ ID NO: 235),
[0124] wherein
[0125] X.sub.1 is Pro or absent;
[0126] X.sub.2 is Pro or Leu;
[0127] X.sub.3 is Asp or Glu;
[0128] X.sub.4 is Val or Thr;
[0129] X.sub.5 is Gly, Asp, Phe, Leu or Ser;
[0130] X.sub.7 is Ser or Met;
[0131] X.sub.10 is Leu or Phe;
[0132] X.sub.11 is Ser or Gly;
[0133] X.sub.12 is Met or Leu;
[0134] X.sub.14 is absent or Thr;
[0135] X.sub.16 is Pro, Leu, Arg, Glu, or Gly;
[0136] X.sub.17 is Ser or Glu;
[0137] X.sub.18 is Gln or Ala;
[0138] X.sub.19 is Gly or Val;
[0139] X.sub.24 is Tyr or Phe;
[0140] X.sub.25 is Ala or Glu; and
[0141] X.sub.26 is an aliphatic amino acid selected from Gly, Ala,
Val, Leu, Ser, or Ile, optionally comprising up to 5 (i.e., 1, 2,
3, 4 or 5) further amino acid substitutions. Optionally the up to 5
further modification can include additional amino acid
substitutions at any of positions 1-5, 7, 10-12, 14, 16-19 or 24-26
of SEQ ID NO: 235, or at positions 1, 2, 3, 5, 7, 11, 14, 15, 16,
17, 18 and 19 of SEQ ID NO: 235, or optionally the peptide
comprises up to 2 further amino acid substitutions at positions
selected from positions 15 and 23 of SEQ ID NO: 235. In one
embodiment X.sub.1 is absent and X.sub.14 is Thr. In one embodiment
X.sub.16 is Pro, Leu, or Arg. In one embodiment a peptide with
antagonist activity against Klotho .beta. is provided wherein the
peptide comprises an amino acid sequence of
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5SX.sub.7DPX.sub.10X.sub.11X.sub.12VX.s-
ub.14GX.sub.16X.sub.17X.sub.18X.sub.19RSPSX.sub.24X.sub.25A (SEQ ID
NO: 236),
[0142] wherein
[0143] X.sub.1 is Pro or absent;
[0144] X.sub.2 is Pro or Leu;
[0145] X.sub.3 is Asp or Glu;
[0146] X.sub.4 is Val or Thr;
[0147] X.sub.5 is Gly, Asp, Phe, Leu or Ser;
[0148] X.sub.7 is Ser or Met;
[0149] X.sub.10 is Leu or Phe;
[0150] X.sub.11 is Ser or Gly;
[0151] X.sub.12 is Met or Leu;
[0152] X.sub.14 is absent or Thr;
[0153] X.sub.16 is Pro, Leu, or Arg;
[0154] X.sub.17 is Ser or Glu;
[0155] X.sub.18 is Gln or Ala;
[0156] X.sub.19 is Gly or Val;
[0157] X.sub.24 is Tyr or Phe;
[0158] X.sub.25 is Ala or Glu; and
[0159] In accordance with one embodiment a pharmaceutical
composition is provided comprising an FGF peptide fragment
antagonist as disclosed herein and a pharmaceutically acceptable
carrier, diluent, or excipient.
[0160] Each of the 25 amino acid FGF21 C-terminal peptide
fragments, analogs and derivatives disclosed herein can be linked
to the carboxy terminus of a larger peptide to form a contiguous
polypeptide sequence. For example each of the 25 amino acid FGF21
peptide fragments, analogs and derivatives disclosed herein can be
fused to the carboxy terminus of a N-terminal polypeptide fragment
of FGF21 (or analog thereof) including for example a peptide
selected from the group consisting of SEQ ID NO: 194, SEQ ID NO:
195 and SEQ ID NO: 196, or a peptide that differs from SEQ ID NO:
194, SEQ ID NO: 195 and SEQ ID NO: 196 by 1, 2, 3, 4, 5, 6, 7, 8,
or 9 amino acid substitutions, to form a polypeptide having agonist
activity at the FGF21 receptor. In one embodiment the 1, 2, 3, 4,
5, 6, 7, 8, or 9 amino acid substitutions are conservative amino
acid substitutions.
[0161] Substituting the novel sequences of SEQ ID NOs: 179, 180,
234, 188 or 191 for the native C-terminal 25 amino acids of FGF21
or FGF19 produces an FGF analog that has higher potency at the FGF
receptor than native FGF2. Accordingly, one aspect of the present
disclosure is directed to an FGF21 analog comprising the sequence
of
[0162] HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG
[0163] GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
[0164] CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGL
PPALPEPPGILAPQLETDSMDPFGLVTGLEAVRSPSFEA (SEQ ID NO: 192); or
[0165] HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG
[0166] GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
[0167] CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAA (SEQ ID NO: 206); or
[0168] HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG
[0169] GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
[0170] CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVGSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 207); or
[0171] HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG
[0172] GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
[0173] CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGL
PPALPEPPGILAPQPLETDSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 208); or
[0174] HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG
[0175] GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
[0176] CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGL
PPALPEPPGILAPQPDVGSMDPFGLVTGLEAVRSPSYAA (SEQ ID NO: 209). Each of
the peptides of SEQ ID NOs: 192, 206, 207, 208 and 209 can be
further modified to enhance the potency of the FGF21 analog as an
FGF receptor agonist. In one embodiment the peptides of SEQ ID NOs:
192, 206, 207, 208 and 209 are further modified to comprise
[0177] i) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 sequence of SEQ ID NO: 173);
or
[0178] ii) a substitution of the native amino acid at position 167
and/or 175 with the corresponding D-isomer of that amino acid
(based on the numbering of the mature FGF21 sequence of SEQ ID NO:
173); or
[0179] iii) any combination of i) or ii).
[0180] In accordance with one embodiment an FGF21 analog having
enhanced activity at the FGF receptor relative to native FGF (based
on the Erk1/2 phosphorylation in 293T HEK hKLB cell assay of
Example 1) is provided. In one embodiment the FGF21 analog
comprises the sequence of SEQ ID NO: 175 or SEQ ID NO: 176.
[0181] In accordance with one embodiment analogs of FGF21 are
provided wherein the analog has higher potency at the FGF receptor
relative to native FGF (based on the Erk1/2 phosphorylation in 293T
HEK hKLB cell assay of Example 1). In accordance with one
embodiment an FGF21-based analog is provided that differs from the
FGF peptide of SEQ ID NO: 173 by a substitution at position 181
with a non-charged amino acid (i.e., excluding Asp, Glu, Lys, Arg
and His), and optionally an amino acid selected from the group
consisting of Ala, Val, Gly, Thr, Cys, Pro, Met, Ile and Leu, and
optionally one or more of the following modifications:
[0182] i) one or more substitutions selected from the group
consisting of G161L, G161F, G161S, S163M, L166F, S167G, M168L,
P171R, Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173); or
[0183] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173);
or
[0184] iii) a substitution of the native amino acid at position 167
and/or 175 with the corresponding D-isomer of that amino acid
(based on the numbering of the mature FGF21 peptide of SEQ ID NO:
173);
[0185] iv) substitution of the native C-terminal 25 amino acids of
SEQ ID NO: 173 with the sequence of SEQ ID NO: 188 or
[0186] v) any combination of i) and ii), any combination of i), ii)
and iii) or any combination of ii) with iv). Optionally the amino
acid at position 181 is selected from the group consisting of Ala,
Val, Gly, Ile and Leu, or is selected from the group consisting of
Ala, Val, Ile and Leu, or is selected from the group consisting of
Ala and Val.
[0187] In one embodiment the FGF21-based analog peptides comprise a
modified peptide of SEQ ID NO: 204, wherein the modified peptide
comprises one or more modifications selected from:
[0188] i) one or more substitutions selected from the group
consisting of G161L, G161F, G161S, S163M, L166F, S167G, M168L,
P171R, Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173); or
[0189] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173);
or
[0190] iii) a substitution of the native amino acid at position 167
and/or 175 (based on the numbering of the mature FGF21 peptide of
SEQ ID NO: 173) with the corresponding D-isomer of that amino acid;
or
[0191] iv) any combination of i) ii), and iii).
[0192] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0193] i) one or more substitutions selected from the group
consisting of G161L, G161F, G161S, S163M, L166F, S167G, M168L,
P171R, Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173); and
[0194] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173).
[0195] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0196] i) one or more substitutions selected from the group
consisting of G161L, G161F, G161S, S163M, L166F, S167G, M168L,
P171R, Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173); and
[0197] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173);
and
[0198] iii) a substitution of the native amino acid at position 167
and/or 175 (based on the numbering of the mature FGF21 peptide of
SEQ ID NO: 173) with the corresponding D-isomer of that amino
acid.
[0199] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0200] i) one or more substitutions selected from the group
consisting of S163M, L166F, S167G, M168L (based on the numbering of
the mature FGF21 peptide of SEQ ID NO: 173); and
[0201] ii) a substitution of the native amino acid at position 167
and/or 175 (based on the numbering of the mature FGF21 peptide of
SEQ ID NO: 173) with the corresponding D-isomer of that amino
acid.
[0202] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0203] i) one or more substitutions selected from the group
consisting of G161L, G161F, G161S, S163M, L166F, S167G, M168L,
P171R, Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173).
[0204] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0205] i) 2, 3, 4, 5, 6 or 7 substitutions selected from the group
consisting of G161L, G161F, G161S, S163M, L166F, S167G, M168L,
P171R, Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173); and
[0206] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173).
[0207] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0208] i) substitutions of S163M, L166F, S167G, M168L, P171R,
Y179F, and A180E (based on the numbering of the mature FGF21
peptide of SEQ ID NO: 173); and
[0209] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173).
[0210] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0211] i) substitutions of S163M, L166F, S167G, M168L, P171R,
Y179F, and A180E and one of G161L, G161F and G161S (based on the
numbering of the mature FGF21 peptide of SEQ ID NO: 173); and
[0212] ii) one or more substitutions selected from the group
consisting of A31C, G43C, L98D, L100K, N121D, and D127K (based on
the numbering of the mature FGF21 peptide of SEQ ID NO: 173).
[0213] In one embodiment a modified analog of FGF21 comprising the
sequence of SEQ ID NO: 204 is provided, wherein the modified
peptide differs from SEQ ID NO: 204 by comprising
[0214] i) substitutions of S163M, L166F, S167G, M168L, P171R,
Y179F, and A180E and one of G161L, G161F and G161S (based on the
numbering of the mature FGF21 peptide of SEQ ID NO: 173); and
[0215] ii) substitutions of A31C, G43C, L98D, L100K, N121D, and
D127K (based on the numbering of the mature FGF21 peptide of SEQ ID
NO: 173). In accordance with one embodiment an FGF21-based analog
is provided wherein the analog comprises a sequence selected from
the group consisting of SEQ ID NO: 192, SEQ ID NO: 193, SEQ ID NO:
204, SEQ ID NO: 205, SEQ ID NO: 247, SEQ ID NO: 248, SEQ ID NO:
249, SEQ ID NO: 250, SEQ ID NO: 251 and SEQ ID NO: 252. In
accordance with one embodiment an analog of FGF21 is provided
wherein the analog comprises a peptide sequence selected from the
group consisting of SEQ ID NO: 247, SEQ ID NO: 248, SEQ ID NO: 249,
SEQ ID NO: 250, SEQ ID NO: 251 and SEQ ID NO: 252. In accordance
with one embodiment an analog of FGF21 is provided wherein the
analog comprises the sequence of SEQ ID NO: 193 or SEQ ID NO: 205.
In accordance with one embodiment an analog of FGF21 is provided
wherein the analog consists of the sequence of SEQ ID NO: 193. In
accordance with one embodiment an analog of FGF21 is provided
wherein the analog consists of the sequence of SEQ ID NO: 205. In
accordance with one embodiment an analog of FGF21 is provided
wherein the analog consists of the sequence of SEQ ID NO: 248.
[0216] The FGF21 analogs disclosed herein as having high potency at
the FGF receptor can be used for any previous use identified for
native FGF21. This includes but is not limited to the treatment of
a disease or medical condition selected from the group consisting
of metabolic syndrome, diabetes, obesity, liver steatosis,
dyslipidemia, and chronic cardiovascular disease.
[0217] In accordance with one embodiment a pharmaceutical
composition is provided comprising an FGF21 agonist analog as
disclosed herein and a pharmaceutically acceptable carrier,
diluent, or excipient. In accordance with one embodiment the
pharmaceutical composition can be used for reducing weight gain or
inducing weight loss in a patient in need thereof or for reducing
elevated triglycerides, improving hyperglycemia and treating
diabetes.
[0218] In some aspects, the invention provides a pharmaceutical
composition comprising any of the novel FGF21 analogs disclosed
herein, preferably sterile and preferably at a purity level of at
least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, and a
pharmaceutically acceptable diluent, carrier or excipient. Such
compositions may contain an FGF21 analog peptide at a concentration
of at least A, wherein A is 0.001 mg/ml, 0.01 mg/ml, 0.1 mg/ml, 0.5
mg/ml, 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7
mg/ml, 8 mg/ml, 9 mg/ml, 10 mg/ml, 11 mg/ml, 12 mg/ml, 13 mg/ml, 14
mg/ml, 15 mg/ml, 16 mg/ml, 17 mg/ml, 18 mg/ml, 19 mg/ml, 20 mg/ml,
21 mg/ml, 22 mg/ml, 23 mg/ml, 24 mg/ml, 25 mg/ml or higher. In
other embodiments, such compositions may contain an FGF21 analog at
a concentration of at most B, wherein B is 30 mg/ml, 25 mg/ml, 24
mg/ml, 23, mg/ml, 22 mg/ml, 21 mg/ml, 20 mg/ml, 19 mg/ml, 18 mg/ml,
17 mg/ml, 16 mg/ml, 15 mg/ml, 14 mg/ml, 13 mg/ml, 12 mg/ml, 11
mg/ml 10 mg/ml, 9 mg/ml, 8 mg/ml, 7 mg/ml, 6 mg/ml, 5 mg/ml, 4
mg/ml, 3 mg/ml, 2 mg/ml, 1 mg/ml, or 0.1 mg/ml. In some
embodiments, the compositions may contain an FGF21 analog at a
concentration range of A to B mg/ml, for example, 0.001 to 30.0
mg/ml. In one embodiment the pharmaceutical compositions comprise
aqueous solutions that are sterilized and optionally stored within
various containers. The compounds of the present invention can be
used in some embodiments to prepare pre-formulated solutions ready
for injection. In other embodiments the pharmaceutical compositions
comprise a lyophilized powder. The pharmaceutical compositions can
be further packaged as part of a kit that includes a disposable
device for administering the composition to a patient. The
containers or kits may be labeled for storage at ambient room
temperature or at refrigerated temperature.
[0219] The FGF21 analog peptides can be administered to a patient
using any standard route of administration, including parenterally,
such as intravenously, intraperitoneally, subcutaneously or
intramuscularly, intrathecally, transdermally, rectally, orally,
nasally or by inhalation. In one embodiment the composition is
administered subcutaneously or intramuscularly.
[0220] In one embodiment the kit is provided with a device for
administering the FGF21 analog composition to a patient, e.g.
syringe needle, pen device, jet injector or other needle-free
injector. The kit may alternatively or in addition include one or
more containers, e.g., vials, tubes, bottles, single or
multi-chambered pre-filled syringes, cartridges, infusion pumps
(external or implantable), jet injectors, pre-filled pen devices
and the like, optionally containing the FGF21 analog in a
lyophilized form or in an aqueous solution. Preferably, the kits
will also include instructions for use. In some embodiments the
device of the kit is an aerosol dispensing device, wherein the
composition is prepackaged within the aerosol device. In another
embodiment the kit comprises a syringe and a needle, and in one
embodiment the sterile composition comprising the FGF21 analog is
prepackaged within the syringe.
[0221] In accordance with one embodiment a pharmaceutical
composition is provided wherein the composition comprises an FGF21
analog of the present disclosure, or pharmaceutically acceptable
salt thereof, and a pharmaceutically acceptable carrier. The
pharmaceutical composition can comprise any pharmaceutically
acceptable ingredient, including, for example, acidifying agents,
additives, adsorbents, aerosol propellants, air displacement
agents, alkalizing agents, anticaking agents, anticoagulants,
antimicrobial preservatives, antioxidants, antiseptics, bases,
binders, buffering agents, chelating agents, coating agents,
coloring agents, desiccants, detergents, diluents, disinfectants,
disintegrants, dispersing agents, dissolution enhancing agents,
dyes, emollients, emulsifying agents, emulsion stabilizers,
fillers, film forming agents, flavor enhancers, flavoring agents,
flow enhancers, gelling agents, granulating agents, humectants,
lubricants, mucoadhesives, ointment bases, ointments, oleaginous
vehicles, organic bases, pastille bases, pigments, plasticizers,
polishing agents, preservatives, sequestering agents, skin
penetrants, solubilizing agents, solvents, stabilizing agents,
suppository bases, surface active agents, surfactants, suspending
agents, sweetening agents, therapeutic agents, thickening agents,
tonicity agents, toxicity agents, viscosity-increasing agents,
water-absorbing agents, water-miscible cosolvents, water softeners,
or wetting agents. The instant compositions may further comprise,
for example, micelles or liposomes, or some other encapsulated
form, or may be administered in an extended release form to provide
a prolonged storage and/or delivery effect. In certain embodiments,
the pharmaceutical compositions may comprise buffering agents to
achieve a physiological compatible pH.
[0222] The disclosed pharmaceutical formulations may be
administered according to any regime including, for example, daily
(1 time per day, 2 times per day, 3 times per day, 4 times per day,
5 times per day, 6 times per day), every two days, every three
days, every four days, every five days, every six days, weekly,
bi-weekly, every three weeks, monthly, or bi-monthly.
[0223] In some embodiments, a method of treating hyperglycemia, or
a method of reducing weight gain or inducing weight loss in a
patient is provided, which involves administering to the patient an
effective amount of an aqueous solution comprising an FGF21 analog
as disclosed herein. In further embodiments, methods of treating
diabetes involving co-administering a conventional dose or a
reduced dose of insulin and an FGF21 analog as disclosed herein are
provided. Methods of treating diabetes with an FGF21 analog of the
present disclosure, without co-administering insulin are also
provided.
[0224] Methods for treating hyperglycemia are expected to be useful
for a variety of types of hyperglycemia, including diabetes,
diabetes mellitus type I, diabetes mellitus type II, or gestational
diabetes, either insulin-dependent or non-insulin-dependent, and
reducing complications of diabetes including nephropathy,
retinopathy and vascular disease.
[0225] Methods for reducing appetite or promoting loss of body
weight are expected to be useful in reducing body weight,
preventing weight gain, or treating obesity of various causes,
including drug-induced obesity, and reducing complications
associated with obesity including vascular disease (coronary artery
disease, stroke, peripheral vascular disease, ischemia reperfusion,
etc.), hypertension, onset of diabetes type II, hyperlipidemia and
musculoskeletal diseases.
[0226] Metabolic Syndrome, also known as metabolic syndrome X,
insulin resistance syndrome or Reaven's syndrome, is a disorder
that affects over 50 million Americans. Metabolic Syndrome is
typically characterized by a clustering of at least three or more
of the following risk factors: (1) abdominal obesity (excessive fat
tissue in and around the abdomen), (2) atherogenic dyslipidemia
(blood fat disorders including high triglycerides, low HDL
cholesterol and high LDL cholesterol that enhance the accumulation
of plaque in the artery walls), (3) elevated blood pressure, (4)
insulin resistance or glucose intolerance, (5) prothrombotic state
(e.g. high fibrinogen or plasminogen activator inhibitor-1 in
blood), and (6) pro-inflammatory state (e.g. elevated C-reactive
protein in blood). Other risk factors may include aging, hormonal
imbalance and genetic predisposition.
[0227] In accordance with one embodiment, a method of preventing or
treating Metabolic Syndrome, or reducing one, two, three or more
risk factors thereof, in a subject, is provided wherein the method
comprises administering to the subject an FGF21 analog described
herein in an amount effective to prevent or treat Metabolic
Syndrome, or one or more risk factors thereof.
[0228] Nonalcoholic fatty liver disease (NAFLD) refers to a wide
spectrum of liver disease ranging from simple fatty liver
(steatosis), to nonalcoholic steatohepatitis (NASH), to cirrhosis
(irreversible, advanced scarring of the liver). All of the stages
of NAFLD have in common the accumulation of fat (fatty
infiltration) in the liver cells (hepatocytes). Simple fatty liver
is the abnormal accumulation of a certain type of fat,
triglyceride, in the liver cells with no inflammation or scarring.
In NASH, the fat accumulation is associated with varying degrees of
inflammation (hepatitis) and scarring (fibrosis) of the liver. The
inflammatory cells can destroy the liver cells (hepatocellular
necrosis). In the terms "steatohepatitis" and "steatonecrosis",
steato refers to fatty infiltration, hepatitis refers to
inflammation in the liver, and necrosis refers to destroyed liver
cells. Accordingly, the present disclosure also provides a method
of preventing or treating Alcoholic Liver Disease, NAFLD, or any
stage thereof, in a subject comprising administering to a subject
an FGF21 analog described herein in an amount effective to prevent
or treat Alcoholic Liver Disease, NAFLD, or any stage thereof. Such
treatment methods include reduction in one, two, three or more of
the following: liver fat content, incidence or progression of
cirrhosis, incidence of hepatocellular carcinoma, signs of
inflammation, e.g. abnormal hepatic enzyme levels (e.g., aspartate
aminotransferase AST and/or alanine aminotransferase ALT, or LDH),
elevated serum ferritin, elevated serum bilirubin, and/or signs of
fibrosis, e.g. elevated TGF-beta levels.
[0229] The FGF21 analogs disclosed herein may be administered alone
or in combination with other anti-diabetic or anti-obesity agents.
Anti-diabetic agents known in the art or under investigation
include insulin, sulfonylureas, such as tolbutamide (Orinase),
acetohexamide (Dymelor), tolazamide (Tolinase), chlorpropamide
(Diabinese), glipizide (Glucotrol), glyburide (Diabeta, Micronase,
Glynase), glimepiride (Amaryl), or gliclazide (Diamicron);
meglitinides, such as repaglinide (Prandin) or nateglinide
(Starlix); biguanides such as metformin (Glucophage) or phenformin;
thiazolidinediones such as rosiglitazone (Avandia), pioglitazone
(Actos), or troglitazone (Rezulin), or other PPARy inhibitors;
alpha glucosidase inhibitors that inhibit carbohydrate digestion,
such as miglitol (Glyset), acarbose (Precose/Glucobay); exenatide
(Byetta) or pramlintide; Dipeptidyl peptidase-4 (DPP-4) inhibitors
such as vildagliptin or sitagliptin; SGLT (sodium-dependent glucose
transporter 1) inhibitors; glucokinase activators (GKA); glucagon
receptor antagonists (GRA); or FBPase (fructose 1,6-bisphosphatase)
inhibitors.
[0230] Anti-obesity agents known in the art or under investigation
include, Leptin and Fibroblast Growth Factor 21 (FGF-21), appetite
suppressants, such as phenethylamine type stimulants, phentermine
(optionally with fenfluramine or dexfenfluramine), diethylpropion
(Tenuate.RTM.), phendimetrazine (Prelu-2.RTM., Bontril.RTM.),
benzphetamine (Didrex.RTM.), sibutramine (Meridia.RTM.,
Reductil.RTM.); rimonabant (Acomplia.RTM.), other cannabinoid
receptor antagonists; oxyntomodulin; fluoxetine hydrochloride
(Prozac); Qnexa (topiramate and phentermine), Excalia (bupropion
and zonisamide) or Contrave (bupropion and naltrexone); or lipase
inhibitors, similar to xenical (Orlistat) or Cetilistat (also known
as ATL-962), or GT 389-255.
[0231] Additional conjugates can be formed between the FGF21
analogs disclosed herein (and peptide fragments thereof) and other
bioactive peptides such as insulin or nuclear hormones to mediated
selective delivery of the conjugates to the liver.
[0232] In accordance with one embodiment a peptide conjugate is
provided comprising the C-terminal 25 amino acids of FGF21 (SEQ ID
NO: 166) or a derivative of that sequence linked to a bioactive
agent. In one embodiment the conjugate comprises a compound of the
general formula: Q-L-Y, wherein Q is a bioactive peptide, including
for example a peptide selected from the group consisting of
insulin, FGF1, FGF2, and a nuclear hormone; Y is a peptide
comprising the sequence of SEQ ID NO: 166 or a modified peptide
that differs from SEQ ID NO: 166 by 1, 2, 3, 4 or 5 amino acid
substitution at amino acid positions selected from any of positions
3, 4, 6, 8, 9, 10, 12, 13, 20, 21 and 23 of SEQ ID NO: 166; and L
is a linking group or a bond. In accordance with one embodiment Y
is a peptide comprising a sequence selected from the group
consisting of
[0233] LETDSMDPFGLVTGLEAVRSPSFEA (SEQ ID NO: 188),
[0234] PPDVGSSDPLSMVGPSQGRSPSYAA (SEQ ID NO: 191),
[0235] PPDVGSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 180),
[0236] PLETDSMDPFGLVGPSQGRSPSFEA (SEQ ID NO: 179),
[0237] PDVGSMDPFGLVTGLEAVRSPSYAA (SEQ ID NO: 234),
[0238] PPDVG SMDPF GLVGR SQGRS PSFEA (SEQ ID NO: 237),
[0239] PPDVF SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 238),
[0240] PPDVL SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 239),
[0241] PPDVS SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 240), and
[0242] PPDVG SSDPF GLVGP SQGRS PSFEA (SEQ ID NO: 241).
[0243] In accordance with one embodiment an FGF21 analog is
provided comprising the sequence of SEQ ID NO: 167 modified by one
or more amino acid substitutions at positions selected from the
group consisting of positions 159, 160, 162, 164, 165,166, 168,
169, 176, 177, and 179 relative to SEQ ID NO: 167. In one
embodiment the substitutions are replacement of the native amino
acid with its corresponding D-stereoisomer. In an alternative
embodiment the substitutions are replacement of the native amino
acid with a corresponding amino acid mimetic of the native amino
acid at that position.
[0244] In one embodiment conjugates of the FGF21 C-terminal peptide
(SEQ ID NO: 166 and derivative disclosed herein) and other
bioactive peptides (e.g., FGF1, FGF2 and insulin) are prepared as a
means of directing the activity of those bioactive peptides to
adipose and liver. Conjugates of the FGF21 based peptide can also
be used to restrict the pharmacology of nuclear hormones as a means
to enhance their safety without lessening their proven
pharmacology, thus rendering them suitable for chronic use.
[0245] Disclosed herein are FGF21 based peptides conjugated
comprising an insulin-like peptide, insulin peptide or a NHR
ligand. In one embodiment the NHR ligand is an NHR agonist. In one
embodiment the NHR ligand is selected from the group consisting of
a steroid that exhibits an EC.sub.50 of about 1 .mu.M or less when
unconjugated to Q-L, and has a molecular weight of up to about 1000
daltons. In one embodiment the NHR ligand is a ligand that
activates the thyroid hormone receptor or a ligand that activates
the peroxisome proliferator-activated receptors (PPAR).
[0246] In one embodiment Q is a glucagon peptide comprising a
sequence from the group consisting of
[0247] HX.sub.1QGTFTSDKSKYLDX.sub.2RAAQDFVQWLMDT (SEQ ID NO:
202,
[0248] X.sub.3AQGTFTSDKSKYLDERAAQDFVQWLLEGGPSSGAPPPS (SEQ ID NO:
197),
[0249] X.sub.4AQGTFTSDKSKYLDERAAQDFVQWLLEGGPSSGAPPPS (SEQ ID NO:
198),
[0250] X.sub.5AQGTFTSDKSKYLDERAAQDFVQWLLEGGPSSGAPPPS (SEQ ID NO:
199),
[0251] X.sub.6AQGTFTSDKSKYLDERAAQDFVQWLLDAGPSSGAPPPS (SEQ ID NO:
200) and
[0252] X.sub.7AQGTFTSDKSKYLDERAAQDFVQWLLEAGPSSGAPPPS (SEQ ID NO:
201)
[0253] wherein
[0254] X.sub.1 and X.sub.2 are both Aib;
[0255] X.sub.3 is Acetyl D-Tyr;
[0256] X.sub.4 is Acetyl D-His;
[0257] X.sub.5 is Acetyl D-thio Ala, and
[0258] X.sub.6 and X.sub.7 are both acetyl-D-Tyr
[0259] In some embodiments the NHR ligand is an NHR agonist. In one
embodiment the NHR agonist has activity at a Type I NHR when bound
to Q-L. In one embodiment the NHR agonist has activity at a Type II
NHR when bound to Q-L. In one embodiment the NHR ligand is [0260]
i) a steroid that exhibits an EC.sub.50 of about 1 .mu.M or less
when unconjugated to Q-L, and further has a molecular weight of up
to about 1000 daltons; or [0261] ii) a ligand that activates the
thyroid hormone receptor; or [0262] iii) a ligand that activates
the peroxisome proliferator-activated receptors (PPAR).
[0263] In one embodiment the NHR ligand of the conjugate is
selected from the group consisting of estradiol and derivatives
thereof, estrone and derivatives thereof, testosterone and
derivatives thereof, and cortisol and derivatives thereof. In one
embodiment the NHR ligand is dexamethasone.
[0264] In accordance with one embodiment the NHR ligand of the
FGF21 based conjugate is a thyroid hormone receptor agonist having
the general structure
##STR00001##
[0265] wherein
[0266] R.sub.15 is C.sub.1-C.sub.4 alkyl, --CH.sub.2(pyridazinone),
--CH.sub.2(OH)(phenyl)F, --CH(OH)CH.sub.3, halo or H;
[0267] R.sub.20 is halo, CH.sub.3 or H;
[0268] R.sub.21 is halo, CH.sub.3 or H;
[0269] R.sub.22 is H, OH, halo, --CH.sub.2(OH)(C.sub.6 aryl)F, or
C.sub.1-C.sub.4 alkyl; and
[0270] R.sub.23 is --CH.sub.2CH(NH.sub.2)COOH, --OCH.sub.2COOH,
--NHC(O)COOH, --CH.sub.2COOH,
[0271] --NHC(O)CH.sub.2COOH, --CH.sub.2CH.sub.2COOH, or
--OCH.sub.2PO.sub.3.sup.2-. In one embodiment the thyroid hormone
receptor agonist has the general structure of Formula I:
##STR00002##
[0272] wherein
[0273] R.sub.20, R.sub.21, and R.sub.22 are independently selected
from the group consisting of H, OH, halo and C.sub.1-C.sub.4 alkyl;
and
[0274] R.sub.15 is halo or H. In one embodiment the thyroid hormone
receptor agonist is selected from the group consisting of thyroxine
T4 (3,5,3',5'-tetra-iodothyronine), and 3,5,3'-triiodo
L-thyronine.
[0275] In one embodiment the NHR ligand is an agonist of a PPAR. In
one embodiment the PPAR agonist is selected from the group
consisting of Tesaglitazar, Aleglitazar and thiazolidinediones. In
one embodiment the PPAR agonist is Tesaglitazar or Aleglitazar.
[0276] In one embodiment the insulin-like peptide of the FGF21
based conjugate Q-L-Y is a peptide selected from IGF I, IGF II, an
insulin like peptide 3, 4, 5 or 6, or a Relaxin-1, 2 or 3. In one
embodiment the insulin-like peptide of the FGF21 based conjugate
Q-L-Y is an insulin like peptide or a Relaxin peptide.
[0277] In one embodiment the insulin peptide of the FGF21 based
conjugate Q-L-Y is a native insulin peptide or any insulin receptor
agonist known to those skilled in the art. In one embodiment the
insulin peptide (Q) comprises an A chain and a B chain wherein said
A chain comprises a sequence
[0278]
GIVX.sub.4X.sub.5CCX.sub.8X.sub.9X.sub.10CX.sub.12LX.sub.14X.sub.15-
LX.sub.17X.sub.18YCX.sub.21--R.sub.53 (SEQ ID NO: 19), and said B
chain comprises a sequence
R.sub.62-X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGX.sub.41X.sub-
.42GFX.sub.45 (SEQ ID NO: 20), wherein [0279] X.sub.4 is glutamic
acid or aspartic acid; [0280] X.sub.5 is glutamine or glutamic acid
[0281] X.sub.8 is histidine, threonine or phenylalanine; [0282]
X.sub.9 is serine, arginine, lysine, ornithine or alanine; [0283]
X.sub.10 is isoleucine or serine; [0284] X.sub.12 is serine or
aspartic acid; [0285] X.sub.14 is tyrosine, arginine, lysine,
ornithine or alanine; [0286] X.sub.15 is glutamine, glutamic acid,
arginine, alanine, lysine, ornithine or leucine; [0287] X.sub.17 is
glutamic acid, aspartic acid, asparagine, lysine, ornithine or
glutamine; [0288] X.sub.18 is methionine, asparagine, glutamine,
aspartic acid, glutamic acid or threonine; [0289] X.sub.21 is
selected from the group consisting of alanine, glycine, serine,
valine, threonine, isoleucine, leucine, glutamine, glutamic acid,
asparagine, aspartic acid, histidine, tryptophan, tyrosine, and
methionine; [0290] X.sub.25 is histidine or threonine; [0291]
X.sub.29 is selected from the group consisting of alanine, glycine
and serine; [0292] X.sub.30 is selected from the group consisting
of histidine, aspartic acid, glutamic acid, homocysteic acid and
cysteic acid; [0293] X.sub.33 is selected from the group consisting
of aspartic acid and glutamic acid; [0294] X.sub.34 is selected
from the group consisting of alanine and threonine; [0295] X.sub.41
is selected from the group consisting of glutamic acid, aspartic
acid or asparagine; [0296] X.sub.42 is selected from the group
consisting of alanine, ornithine, lysine and arginine; [0297]
X.sub.45 is tyrosine or phenylalanine; [0298] R.sub.62 is selected
from the group consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID
NO: 12), PGPE (SEQ ID NO: 11), a tripeptide
glycine-proline-glutamic acid, a tripeptide
valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a
dipeptide asparagine-glutamine, glutamine, glutamic acid and an
N-terminal amine; and [0299] R.sub.53 is COOH or CONH.sub.2. In one
embodiment the insulin peptide is a two chain insulin analog. In
another embodiment the insulin peptide is a single chain insulin
analog wherein the carboxy terminus of the B chain is linked to the
amino terminus of the A chain via a peptide linker. Any of the
previous disclosed single chain insulin analogs having activity at
the insulin receptor and known to those skilled in the art are
encompassed by the present disclosure.
[0300] In one embodiment the insulin peptide of the conjugate is a
two chain insulin wherein the A and B chains are linked by
interchain disulfide bonds, wherein the A chain comprises the
sequence GIVEQCCX.sub.8X.sub.9ICSLYQLENYCX.sub.21--R.sub.53 (SEQ ID
NO: 73) and the B chain comprises a sequence
R.sub.62-X.sub.25LCGAX.sub.30LVDALYLVCGDX.sub.42GFY (SEQ ID NO:
75), wherein [0301] X.sub.8 is histidine or threonine; [0302]
X.sub.9 is serine, lysine, or alanine; [0303] X.sub.21 is alanine,
glycine or asparagine; [0304] X.sub.25 is histidine or threonine;
[0305] X.sub.30 is selected from the group consisting of histidine,
aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
[0306] X.sub.42 is selected from the group consisting of alanine
ornithine and arginine; and R.sub.53 is COOH or CONH.sub.2; [0307]
R.sub.62 is selected from the group consisting of FVNQ (SEQ ID NO:
12), a tripeptide valine-asparagine-glutamine, a dipeptide
asparagine-glutamine, glutamine, and an N-terminal amine; and
[0308] R.sub.53 is COOH or CONH.sub.2. In one embodiment the A
chain comprises the sequence
GIVEQCCX.sub.8X.sub.9ICSLYQLENYCX.sub.21--R.sub.53 (SEQ ID NO: 73)
and the B chain comprises
[0309] the B chain sequence comprises the sequence
FVKQX.sub.25LCGSHLVEALYLVCGERGFF-R.sub.63 (SEQ ID NO: 147), or
FVNQX.sub.25LCGSHLVEALYLVCGERGFF-R.sub.63 (SEQ ID NO: 148),
wherein
[0310] X.sub.8 is histidine or threonine; [0311] X.sub.9 is serine,
lysine, or alanine; [0312] X.sub.21 is alanine, glycine or
asparagine;
[0313] X.sub.25 is selected from the group consisting of histidine
and threonine; and
[0314] R.sub.63 is selected from the group consisting of
YTX.sub.28KT (SEQ ID NO: 149), YTKPT (SEQ ID NO: 150), YTX.sub.28K
(SEQ ID NO: 152), YTKP (SEQ ID NO: 151), YTPK (SEQ ID NO: 70),
YTX.sub.28, YT, Y and a bond.
[0315] In one embodiment the A chain comprises the sequence
GIVEQCCX.sub.8SICSLYQLENYCX.sub.21-R.sub.53 (SEQ ID NO: 153) or
GIVEQCCTSICSLYQLENYCN-R.sub.53 (SEQ ID NO: 1) and the B chain
comprises the sequence FVKQX.sub.25LCGSHLVEALYLVCGERGFFYTEKT (SEQ
ID NO: 154), FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTDKT (SEQ ID NO:
155), FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 156) or
FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 157) wherein
[0316] X.sub.8 is histidine or threonine; [0317] X.sub.21 is
alanine, glycine or asparagine; X.sub.25 is selected from the group
consisting of histidine and threonine and R.sub.53 is COOH or
CONH.sub.2. In one embodiment the A chain comprises a sequence
GIVEQCCTSICSLYQLENYCN-R.sub.53 (SEQ ID NO: 1) and said B chain
comprises a sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2)
wherein R.sub.53 is COOH or CONH.sub.2.
[0318] In one embodiment the insulin peptide is a single chain
insulin analog. In one embodiment the peptide linker joining the B
and A chains is selected from the group consisting of
SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 158),
SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 159),
GAGSSSX.sub.57X.sub.58 (SEQ ID NO: 76), GYGSSSX.sub.57X.sub.58 (SEQ
ID NO: 21) and GYGSSSX.sub.57X.sub.58APQT; (SEQ ID NO: 77), wherein
X.sub.57 and X.sub.58 are independently arginine, lysine or
ornithine. In one embodiment both X.sub.57 and X.sub.58 are
independently arginine. In one embodiment the peptide linking
moiety joining the insulin A and B chains to form a single chain
insulin analog is a peptide sequence
[0319] consisting of GYGSSSRR (SEQ ID NO: 18) GAGSSSRR (SEQ ID NO:
22) or GAGSSSRRAPQT (SEQ ID NO: 23).
[0320] In accordance with one embodiment, the linker (L in the
formula Q-L-Y) is a linking group or a bond that covalently links
the insulin peptide to the NHR ligand. In one embodiment the NHR
ligand is linked to the side chain of an amino acid at position B28
or B29 of the insulin peptide. In one embodiment the amino acid at
position B28 or B29 of the insulin peptide is lysine and the NHR
ligand is linked to the side chain of the lysine. In one embodiment
the NHR ligand is linked to the insulin peptide via the N-terminal
alpha amine of the insulin A or B chain. In one embodiment the NHR
ligand is linked to the insulin peptide via an amid bond formed
between an amino group of the insulin peptide and a carboxy group
of the NHR ligand, optionally through a spacer moiety.
[0321] In one embodiment the linker (L in the formula Q-L-Y) is a
linking group wherein L is stable in vivo, hydrolyzable in vivo, or
metastable in vivo. In one embodiment L comprises an ether moiety,
or an amide moiety, an ester moiety, an acid-labile moiety, a
reduction-labile moiety, an enzyme-labile moiety, a hydrazone
moiety, a disulfide moiety, or a cathepsin-cleavable moiety.
[0322] Structure of the NHR Ligand (Q)
[0323] The NHR ligand of the FGF21 based conjugates is partly or
wholly non-peptidic and is hydrophobic or lipophilic. In some
embodiments, the NHR ligand has a molecular weight that is about
5000 daltons or less, or about 4000 daltons or less, or about 3000
daltons or less, or about 2000 daltons or less, or about 1750
daltons or less, or about 1500 daltons or less, or about 1250
daltons or less, or about 1000 daltons or less, or about 750
daltons or less, or about 500 daltons or less, or about 250 daltons
or less. The structure of Q can be in accordance with any of the
teachings disclosed herein.
[0324] In the embodiments described herein, Q is conjugated to L
(e.g. when L is a linking group) or Y (e.g. when L is a bond) at
any position of Q that is capable of reacting with Y or L. One
skilled in the art could readily determine the position and means
of conjugation in view of general knowledge and the disclosure
provided herein.
[0325] In any of the embodiments described herein wherein Q
comprises a tetracyclic skeleton having three 6-membered rings
joined to one 5-membered ring or a variation thereof (e.g. a Q that
acts at the vitamin D receptor), the carbon atoms of the skeleton
are referred to by position number, as shown below:
##STR00003##
[0326] For example, a modification having a ketone at position-6
refers to the following structure:
##STR00004##
[0327] NHR Ligand that Acts on a Type I Nuclear Hormone
Receptor
[0328] In some embodiments of the invention, the NHR ligand (Q)
acts on a Type I nuclear hormone receptor. In some embodiments, Q
can have any structure that permits or promotes agonist activity
upon binding of the ligand to a Type I nuclear hormone receptor,
while in other embodiments Q is an antagonist of the Type I nuclear
hormone receptor.
[0329] In exemplary embodiments, Q comprises a structure as shown
in Formula A:
##STR00005##
[0330] wherein R.sup.1 and R.sup.2, when present, are independently
moieties that permit or promote agonist or antagonist activity upon
binding of the compound of Formula A to the Type I nuclear hormone
receptor; R.sup.3 and R.sup.4 are independently moieties that
permit or promote agonist or antagonist activity upon binding of
the compound of Formula A to the Type I nuclear hormone receptor;
and each dashed line represents an optional double bond. Formula A
may further comprise one or more substituents at one or more of
positions 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12, 14, 15, 16, 17, 18,
and 19. Contemplated optional substituents include, but are not
limited to, OH, NH.sub.2, ketone, and C.sub.1-C.sub.18 alkyl
groups.
[0331] In some embodiments, Q comprises a structure of Formula A
wherein
[0332] R.sup.1 is present and is hydrogen, C.sub.1-C.sub.7 alkyl;
(C.sub.0-C.sub.3 alkyl)C(O)C.sub.1-C.sub.7 alkyl, (C.sub.0-C.sub.3
alkyl)C(O)aryl, or SO.sub.3H;
[0333] R.sup.2 is present and is hydrogen, halo, OH, or
C.sub.1-C.sub.7 alkyl;
[0334] R.sup.3 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0335] R.sup.4 is hydrogen, (C.sub.0-C.sub.8 alkyl)halo,
C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8 alkenyl, C.sub.2-18 alkynyl,
heteroalkyl, (C.sub.0-C.sub.8 alkyl)aryl, (C.sub.0-C.sub.8
alkyl)heteroaryl, (C.sub.0-C.sub.8 alkyl)OC.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)OC.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)OH,
(C.sub.0-C.sub.8 alkyl)SH, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24H.sub.2, (C.sub.0-C.sub.8 alkyl)C(O)C.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)C.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)H, (C.sub.0-C.sub.8 alkyl)C(O)aryl,
(C.sub.0-C.sub.8 alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)OH,
(C.sub.0-C.sub.8 alkyl)C(O)O aryl, (C.sub.0-C.sub.8 alkyl)C(O)O
heteroaryl, (C.sub.0-C.sub.8 alkyl)OC(O)C.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)OC(O)C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)OC(O)C.sub.2-C.sub.18 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkenyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)OH, (C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)OC(O)OH, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.8 alkynyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OH; and,
[0336] R.sup.24 is hydrogen or C.sub.1-C.sub.7 alkyl.
[0337] In some embodiments, R.sup.1 is hydrogen, propionate,
acetate, benzoate, or sulfate; R.sup.2 is hydrogen or methyl;
R.sup.3 is hydrogen or methyl; and R.sup.4 is acetate, cypionate,
hemisucciniate, enanthate, or propionate.
[0338] In embodiments wherein Q comprises a structure of Formula A,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula A that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula A and means of
conjugation of Formula A to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula A is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 of Formula A. In some
embodiments, Formula A is conjugated to L or Y at position 1, 3, 6,
7, 12, 10, 13, 16, 17, or 19 of Formula A.
[0339] In some embodiments, Q acts at an estrogen receptor (e.g.
ER.alpha., ER.beta.). In some embodiments, Q permits or promotes
agonist activity at the estrogen receptor, while in other
embodiments Q is an antagonist of ER. In exemplary embodiments, Q
can have a structure of Formula B:
##STR00006##
[0340] wherein R.sup.1, R.sup.5 and R.sup.6 are moieties that
permit or promote agonist or antagonist activity upon binding of
the compound of Formula B to the estrogen receptor. In some
embodiments, Formula B further comprises one or more substituents
at one or more of positions 1, 2, 4, 6, 7, 8, 9, 11, 12, 14, 15,
and 16 (e.g. a ketone at position-6).
[0341] In some embodiments when Q comprises a structure of Formula
B, wherein R.sup.1 is hydrogen, C.sub.1-C.sub.7 alkyl;
(C.sub.0-C.sub.3 alkyl)C(O)C.sub.1-C.sub.7 alkyl, (C.sub.0-C.sub.3
alkyl)C(O)aryl, or SO.sub.3H;
[0342] R.sup.5 is hydrogen, (C.sub.0-C.sub.8 alkyl)halo,
C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8 alkenyl, C.sub.2-18 alkynyl,
heteroalkyl, (C.sub.0-C.sub.8 alkyl)aryl, (C.sub.0-C.sub.8
alkyl)heteroaryl, (C.sub.0-C.sub.8 alkyl)OC.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)OC.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)OH,
(C.sub.0-C.sub.8 alkyl)SH, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24H.sub.2, (C.sub.0-C.sub.8 alkyl)C(O)C.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)C.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)H, (C.sub.0-C.sub.8 alkyl)C(O)aryl,
(C.sub.0-C.sub.8 alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)OH,
(C.sub.0-C.sub.8 alkyl)C(O)O aryl, (C.sub.0-C.sub.8 alkyl)C(O)O
heteroaryl, (C.sub.0-C.sub.8 alkyl)OC(O)C.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)OC(O)C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)OC(O)C.sub.2-C.sub.18 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkenyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)OH, (C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)OC(O)OH, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.8 alkynyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OH;
[0343] R.sup.6 is hydrogen, C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8
alkenyl, C.sub.2-C.sub.8 alkynyl, heteroalkyl, (C.sub.0-C.sub.8
alkyl)aryl, (C.sub.0-C.sub.8 alkyl)heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)H,
(C.sub.0-C.sub.8 alkyl)C(O)aryl, (C.sub.0-C.sub.8
alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)OH, C.sub.0-C.sub.8 alkyl)C(O)O aryl,
(C.sub.0-C.sub.8 alkyl)C(O)O heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, or (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl; and
[0344] R.sup.24 is hydrogen or C.sub.1-C.sub.7 alkyl.
[0345] For example, R.sup.1 is hydrogen, propionate, acetate,
benzoate, or sulfate; R.sup.5 is hydrogen, ethynyl, hydroxyl; and
R.sup.6 is acetate, cypionate, hemisucciniate, enanthate, or
propionate.
[0346] Nonlimiting examples of the compound of Formula B include
17.beta.-estradiol, modified forms of estradiol such as
.beta.-estradiol 17-acetate, .beta.-estradiol 17-cypionate,
.beta.-estradiol 17-enanthate, .beta.-estradiol 17-valerate,
.beta.-estradiol 3,17-diacetate, .beta.-estradiol
3,17-dipropionate, .beta.-estradiol 3-benzoate, .beta.-estradiol
3-benzoate 17-n-butyrate, .beta.-estradiol 3-glycidyl ether,
.beta.-estradiol 3-methyl ether, .beta.-estradiol 6-one,
.beta.-estradiol 3-glycidyl, .beta.-estradiol 6-one
6-(O-carboxymethyloxime), 16-epiestriol, 17-epiestriol, 2-methoxy
estradiol, 4-methoxy estradiol, estradiol 17-phenylpropionate, and
17.beta.-estradiol 2-methyl ether, 17.alpha.-ethynylestradiol,
megestrol acetate, estriol, and derivatives thereof. In some
embodiments, carbon 17 has a ketone substitutent and R.sup.5 and
R.sup.6 are absent (e.g. estrone). Some of the aforementioned
compounds of Formula B are shown below:
##STR00007##
[0347] In embodiments wherein Q comprises a structure of Formula B,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula B that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula B and means of
conjugation of Formula B to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula B is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 of Formula B. In some
embodiments, Formula B is conjugated to L or Y at position 3 or 17
of Formula B.
[0348] In other embodiments, Q acts at an estrogen receptor but is
not encompassed by Formula B. Nonlimiting examples of ligands that
act at an estrogen receptor that are not encompassed by Formula B
are shown below:
##STR00008##
[0349] In some embodiments, Q acts at a glucocorticoid receptor
(GR). In some embodiments, Q comprises any structure that permits
or promotes agonist activity at the GR, while in other embodiments
Q is an antagonist of GR. In exemplary embodiments, Q comprises a
structure of Formula C:
##STR00009##
[0350] wherein R.sup.2, R.sup.3, R.sup.6, R.sup.7, R.sup.8,
R.sup.9, and R.sup.10 are each independently moieties that permit
or promote agonist or antagonist activity upon the binding of the
compound of Formula C to the GR; and each dash represents an
optional double bond. In some embodiments, Formula C further
comprises one or more substituents at one or more of positions 1,
2, 4, 5, 6, 7, 8, 9, 11, 12, 14, and 15 (e.g. hydroxyl or ketone at
position-11).
[0351] In some embodiments, Q comprises a structure of Formula C
wherein
[0352] R.sup.2 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0353] R.sup.3 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0354] R.sup.6 is hydrogen, C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8
alkenyl, C.sub.2-C.sub.8 alkynyl, heteroalkyl, (C.sub.0-C.sub.8
alkyl)aryl, (C.sub.0-C.sub.8 alkyl)heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)H,
(C.sub.0-C.sub.8 alkyl)C(O)aryl, (C.sub.0-C.sub.8
alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)OH, C.sub.0-C.sub.8 alkyl)C(O)O aryl,
(C.sub.0-C.sub.8 alkyl)C(O)O heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, or (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl;
[0355] R.sup.7 is hydrogen, C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8
alkenyl, C.sub.2-C.sub.8 alkynyl, heteroalkyl, (C.sub.0-C.sub.8
alkyl)aryl, (C.sub.0-C.sub.8 alkyl)heteroaryl, (C.sub.0
alkyl)C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0 alkyl)C(O)C.sub.2-C.sub.8
alkenyl, (C.sub.0 alkyl)C(O)C.sub.2-C.sub.8 alkynyl,
(C.sub.0)C(O)aryl, (C.sub.0)C(O)heteroaryl,
(C.sub.0)C(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0
alkyl)C(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0
alkyl)C(O)OC.sub.2-C.sub.8 alkynyl, or (C.sub.0 alkyl)C(O)OH;
[0356] R.sup.8 is hydrogen or C.sub.1-C.sub.7 alkyl;
[0357] R.sup.9 is hydrogen or C.sub.1-C.sub.7 alkyl;
[0358] R.sup.10 is hydrogen or OH; and
[0359] R.sup.24 is hydrogen or C.sub.1-C.sub.7 alkyl.
[0360] For example, R.sup.2 is hydrogen or methyl; R.sup.3 is
hydrogen, fluoro, chloro, or methyl; R.sup.6 is hydrogen or C(O)
C.sub.1-C.sub.7 alkyl; R.sup.7 is hydrogen, C(O)CH.sub.3, or
C(O)CH.sub.2CH.sub.3; R.sup.8 is hydrogen or methyl; R.sup.9 is
hydrogen or methyl; and R.sup.10 is hydroxyl.
[0361] Nonlimiting examples of structures of Formula C include:
##STR00010## ##STR00011##
[0362] and derivatives thereof.
[0363] In embodiments wherein Q comprises a structure of Formula C,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula C that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula C and means of
conjugation of Formula C to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula C is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 of
Formula C. In some embodiments, Formula C is conjugated to L or Y
at position 3, 10, 16 or 17 of Formula C.
[0364] In some embodiments, Q acts at a mineralcorticoid receptor
(MR). In some embodiments, Q comprises any structure that permits
or promotes agonist activity at the MR, while in other embodiments
Q is an antagonist of MR. In exemplary embodiments, Q comprises a
structure of Formula D:
##STR00012##
[0365] wherein R.sup.2, R.sup.3, R.sup.7 and R.sup.10 are each
independently a moiety that permits or promotes agonist or
antagonist activity upon binding of the compound of Formula D to
the MR; and the dashed line indicates an optional double bond. In
some embodiments, Formula D further comprises one or more
substituents at one or more of positions 1, 2, 4, 5, 6, 7, 8, 11,
12, 14, 15, 16, and 17.
[0366] In some embodiments, Q comprises a structure of Formula D
wherein
[0367] R.sup.2 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0368] R.sup.3 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0369] R.sup.7 is hydrogen, C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8
alkenyl, C.sub.2-C.sub.8 alkynyl, heteroalkyl, (C.sub.0-C.sub.8
alkyl)aryl, (C.sub.0-C.sub.8 alkyl)heteroaryl, (C.sub.0
alkyl)C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0 alkyl)C(O)C.sub.2-C.sub.8
alkenyl, (C.sub.0 alkyl)C(O)C.sub.2-C.sub.8 alkynyl,
(C.sub.0)C(O)aryl, (C.sub.0)C(O)heteroaryl,
(C.sub.0)C(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0
alkyl)C(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0
alkyl)C(O)OC.sub.2-C.sub.8 alkynyl, or (C.sub.0 alkyl)C(O)OH;
[0370] R.sup.10 is hydrogen or OH; and
[0371] R.sup.24 is hydrogen or C.sub.1-C.sub.7 alkyl.
[0372] For example, R.sup.2 is hydrogen or methyl; R.sup.3 is
hydrogen, fluoro, chloro, or methyl; R.sup.7 is hydrogen,
C(O)CH.sub.3, or C(O)CH.sub.2CH.sub.3; and R.sup.10 is
hydroxyl.
[0373] Nonlimiting examples of compounds of Formula D include:
##STR00013##
and derivatives thereof.
[0374] In embodiments wherein Q comprises a structure of Formula D,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula D that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula D and means of
conjugation of Formula D to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula D is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 of
Formula D. In some embodiments, Formula D is conjugated to L or Y
at position 3, 10, 13, or 17 of Formula D.
[0375] In some embodiments, Q acts at a progesterone receptor (PR).
In some embodiments, Q comprises any structure that permits or
promotes agonist activity at the PR, while in other embodiments Q
is an antagonist of PR. In exemplary embodiments, Q comprises a
structure of Formula E:
##STR00014##
[0376] wherein R.sup.2, R.sup.3, R.sup.4, and R.sup.7 are each
independently moieties that permit or promote agonist or antagonist
activity upon binding of the compound of Formula E to the PR; and
the dashed line indicates an optional double bond. In some
embodiments, Formula E further comprises one or more substituents
at one or more of positions 1, 2, 4, 5, 6, 7, 8, 11, 12, 14, 15,
16, and 17 (e.g. a methyl group at position 6).
[0377] In some embodiments, Q comprises a structure of Formula E
wherein
[0378] R.sup.2 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0379] R.sup.3 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0380] R.sup.4 is hydrogen, (C.sub.0-C.sub.8 alkyl)halo,
C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8 alkenyl, C.sub.2-18 alkynyl,
heteroalkyl, (C.sub.0-C.sub.8 alkyl)aryl, (C.sub.0-C.sub.8
alkyl)heteroaryl, (C.sub.0-C.sub.8 alkyl)OC.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)OC.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)OH,
(C.sub.0-C.sub.8 alkyl)SH, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24H.sub.2, (C.sub.0-C.sub.8 alkyl)C(O)C.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)C.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)H, (C.sub.0-C.sub.8 alkyl)C(O)aryl,
(C.sub.0-C.sub.8 alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)OC.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)OH,
(C.sub.0-C.sub.8 alkyl)C(O)O aryl, (C.sub.0-C.sub.8 alkyl)C(O)O
heteroaryl, (C.sub.0-C.sub.8 alkyl)OC(O)C.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)OC(O)C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)OC(O)C.sub.2-C.sub.18 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.1-C.sub.8 alkyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkenyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)OH, (C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)OC(O)OC.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)OC(O)OH, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.8 alkynyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OH;
[0381] R.sup.7 is hydrogen, C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8
alkenyl, C.sub.2-C.sub.8 alkynyl, heteroalkyl, (C.sub.0-C.sub.8
alkyl)aryl, (C.sub.0-C.sub.8 alkyl)heteroaryl, (C.sub.0
alkyl)C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0 alkyl)C(O)C.sub.2-C.sub.8
alkenyl, (C.sub.0 alkyl)C(O)C.sub.2-C.sub.8 alkynyl,
(C.sub.0)C(O)aryl, (C.sub.0)C(O)heteroaryl,
(C.sub.0)C(O)OC.sub.1-C.sub.8 alkyl, (C.sub.0
alkyl)C(O)OC.sub.2-C.sub.8 alkenyl, (C.sub.0
alkyl)C(O)OC.sub.2-C.sub.8 alkynyl, or (C.sub.0 alkyl)C(O)OH;
and
[0382] R.sup.24 is hydrogen or C.sub.1-C.sub.7 alkyl.
[0383] For example, R.sup.2 is hydrogen or methyl; R.sup.3 is
hydrogen or methyl; R.sup.4 is (C.sub.1 alkyl)C(O)C.sub.1-C.sub.4
alkyl, acetate, cypionate, hemisucciniate, enanthate, or
propionate; and R.sup.7 is hydrogen, C(O)CH.sub.3, or
C(O)CH.sub.2CH.sub.3
[0384] Nonlimiting examples of compounds of Formula E include:
##STR00015##
and derivatives thereof.
[0385] In embodiments wherein Q comprises a structure of Formula E,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula E that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula E and means of
conjugation of Formula E to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula E is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 of
Formula E. In some embodiments, Formula E is conjugated to L or Y
through position 3 or 17 of Formula E.
[0386] In other embodiments, Q acts at a progesterone receptor but
is not encompassed by Formula E. For example, Q can comprise the
below structure and analogs thereof:
##STR00016##
[0387] In some embodiments, Q acts at an androgen receptor (AR). In
some embodiments, Q comprises any structure that permits or
promotes agonist activity at the AR, while in other embodiments Q
is an antagonist of AR. In exemplary embodiments, Q comprises a
structure of Formula F:
##STR00017##
[0388] wherein R.sup.1, when present, R.sup.2, R.sup.3 and R.sup.6
are each independently a moiety that permits or promotes agonist or
antagonist activity upon binding of the compound of Formula F to
the AR; and each dashed line represents an optional double bond,
with the proviso that no more than one of the optional
carbon-carbon double bond is present at position 5. In some
embodiments, Formula F further comprises one or more substituents
at one or more of positions 1, 2, 4, 5, 6, 7, 8, 11, 12, 14, 15,
16, and 17.
[0389] In some embodiments, Q comprises a structure of Formula F
wherein
[0390] R.sup.1 is hydrogen, C.sub.1-C.sub.7 alkyl; (C.sub.0-C.sub.3
alkyl)C(O)C.sub.1-C.sub.7 alkyl, (C.sub.0-C.sub.3 alkyl)C(O)aryl,
or SO.sub.3H;
[0391] R.sup.2 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0392] R.sup.3 is hydrogen, halo, OH, or C.sub.1-C.sub.7 alkyl;
[0393] R.sup.6 is hydrogen, C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8
alkenyl, C.sub.2-C.sub.8 alkynyl, heteroalkyl, (C.sub.0-C.sub.8
alkyl)aryl, (C.sub.0-C.sub.8 alkyl)heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)H,
(C.sub.0-C.sub.8 alkyl)C(O)aryl, (C.sub.0-C.sub.8
alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.1-C.sub.8
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.8 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.8 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)OH, C.sub.0-C.sub.8 alkyl)C(O)O aryl,
(C.sub.0-C.sub.8 alkyl)C(O)O heteroaryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.1-C.sub.8 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.8 alkynyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, or (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl; and
[0394] R.sup.24 is hydrogen or C.sub.1-C.sub.7 alkyl.
[0395] For example, R.sup.1 is hydrogen or absent; R.sup.2 is
hydrogen or methyl; R.sup.3 is hydrogen or methyl; and R.sup.6 is H
or absent.
[0396] Nonlimiting examples of compounds of Formula F include:
##STR00018##
and derivatives thereof.
[0397] In embodiments wherein Q comprises a structure of Formula F,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula F that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula F and means of
conjugation of Formula F to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula F is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 of Formula F.
In some embodiments, Formula F is conjugated to L or Y at position
3 or 17 of Formula F.
[0398] In some embodiments, the binding of the NHR ligand to the
Type I nuclear hormone receptor results in agonist activity (or
antagonist activity) in some but not all cells or tissues
expressing the Type I nuclear hormone receptor.
[0399] NHR Ligand that Acts on a Type II Nuclear Hormone
Receptor
[0400] In some embodiments of the invention, the NHR ligand (Q)
acts on a Type II nuclear hormone receptor. In some embodiments, Q
can have any structure that permits or promotes agonist activity
upon binding of the ligand to a Type II nuclear hormone receptor,
while in other embodiments Q is an antagonist of the Type II
nuclear hormone receptor. In exemplary embodiments, Q exhibits
agonist (or antagonist) activity at a thyroid hormone receptor
(TR), retinoic acid receptor (RAR), peroxisome proliferator
activated receptor (PPAR), Liver X Receptor (LXR), farnesoid X
receptor (FXR), vitamin D receptor (VDR), and/or pregnane X
receptor (PXR).
[0401] In some embodiments, Q acts at a thyroid hormone receptor
(e.g. TR.alpha., TR.beta.). In some embodiments, Q comprises any
structure that permits or promotes agonist activity at the TR,
while in other embodiments Q is an antagonist of TR. In one
embodiment a thyroid hormone receptor agonist is provided having
the general structure of
##STR00019##
[0402] wherein
[0403] R.sub.15 is C.sub.1-C.sub.4 alkyl, --CH.sub.2(pyridazinone),
--CH.sub.2(OH)(phenyl)F, --CH(OH)CH.sub.3, halo or H;
[0404] R.sub.20 is halo, CH.sub.3 or H;
[0405] R.sub.21 is halo, CH.sub.3 or H;
[0406] R.sub.22 is H, OH, halo, --CH.sub.2(OH)(C.sub.6 aryl)F, or
C.sub.1-C.sub.4 alkyl; and
[0407] R.sub.23 is --CH.sub.2CH(NH.sub.2)COOH, --OCH.sub.2COOH,
--NHC(O)COOH, --CH.sub.2COOH,
[0408] --NHC(O)CH.sub.2COOH, --CH.sub.2CH.sub.2COOH, or
--OCH.sub.2PO.sub.3.sup.2-.
[0409] In accordance with one embodiment the thyroid hormone
receptor agonist is a compound of the general structure
##STR00020##
[0410] wherein
[0411] R.sub.15 is C.sub.1-C.sub.4 alkyl, --CH(OH)CH.sub.3, I or
H
[0412] R.sub.20 is I, Br, CH.sub.3 or H;
[0413] R.sub.21 is I, Br, CH.sub.3 or H;
[0414] R.sub.22 is H, OH, I, or C.sub.1-C.sub.4 alkyl; and
[0415] R.sub.23 is --CH.sub.2CH(NH.sub.2)COOH, --OCH.sub.2COOH,
--NHC(O)COOH, --CH.sub.2COOH,
[0416] --NHC(O)CH.sub.2COOH, --CH.sub.2CH.sub.2COOH, or
--OCH.sub.2PO.sub.3.sup.2-. In one embodiment R.sub.23 is
--CH.sub.2CH(NH.sub.2)COOH.
[0417] In accordance with one embodiment the thyroid hormone
receptor agonist is a compound of the general structure
##STR00021##
[0418] wherein
[0419] R.sub.15 is isopropyl, --CH(OH)CH.sub.3, I or H
[0420] R.sub.20 is I, Br, Cl, or CH.sub.3;
[0421] R.sub.21 is I, Br, Cl, or CH.sub.3;
[0422] R.sub.22 is H; and
[0423] R.sub.23 is --OCH.sub.2COOH, --CH.sub.2COOH,
--NHC(O)CH.sub.2COOH, or --CH.sub.2CH.sub.2COOH.
[0424] In accordance with one embodiment the thyroid hormone
receptor agonist is a compound of the general structure of Formula
I:
##STR00022##
[0425] wherein
[0426] R.sub.20, R.sub.21, and R.sub.22 are independently selected
from the group consisting of H, OH, halo and C.sub.1-C.sub.4 alkyl;
and
[0427] R.sub.15 is halo or H. In one embodiment R.sub.20 and
R.sub.21 are each CH.sub.3, R.sub.15 is H and R.sub.22 are
independently selected from the group consisting of H, OH, halo and
C.sub.1-C.sub.4 alkyl. In one embodiment R.sub.20, R.sub.21 and
R.sub.22 are each halo and R.sub.15 is H or halo. In a further
embodiment R.sub.20, R.sub.21 and R.sub.22 are each I, and R.sub.15
is H or I. In accordance with one embodiment Q is selected from the
group consisting of thyroxine T4 (3,5,3',5'-tetraiodothyronine) and
3,5,3'-triiodo L-thyronine.
[0428] In one embodiment, the thyroid hormone receptor ligand (Y)
of the Q-L-Y conjugates, is an indole derivative of thyroxine,
including for example, compounds disclosed in U.S. Pat. No.
6,794,406 and US published application no. US 2009/0233979, the
disclosures of which are incorporated herein. In one embodiment the
indole derivative of thyroxine comprises a compound of the general
structure of Formula II:
##STR00023##
[0429] wherein
[0430] R.sub.13 is H or C.sub.1-C.sub.4 alkyl;
[0431] R.sub.14 is C.sub.1-C.sub.8 alkyl;
[0432] R.sub.15 is H or C.sub.1-C.sub.4 alkyl; and
[0433] R.sub.16 and R.sub.17 are independently halo or
C.sub.1-C.sub.4 alkyl.
[0434] In one embodiment, the thyroid receptor ligand (Y) of the
Q-L-Y conjugates, is an indole derivative of thyroxine as disclosed
in WO97/21993 (U. Cal SF), WO99/00353 (KaroBio), GB98/284425
(KaroBio), and U.S. Provisional Application 60/183,223, the
disclosures of which are incorporated by reference herein. In one
embodiment the thyroid receptor ligand comprises the general
structure of Formula III:
##STR00024##
[0435] wherein X is oxygen, sulfur, carbonyl, methylene, or NH;
[0436] Y is (CH.sub.2).sub.n, where n is an integer from 1 to 5, or
C.dbd.C;
[0437] R.sub.1 is halogen, trifluoromethyl, or C.sub.1-C.sub.6
alkyl or C.sub.3-C.sub.7 cycloalkyl;
[0438] R.sub.2 and R.sub.3 are the same or different and are
hydrogen, halogen, C.sub.1-C.sub.6 alkyl or C.sub.3-C.sub.7
cycloalkyl, with the proviso that at least one of R.sub.2 and
R.sub.3 being other than hydrogen;
[0439] R.sub.4 is hydrogen or C.sub.1-C.sub.4 alkyl;
[0440] R.sub.5 is hydrogen or C.sub.1-C.sub.4 alkyl;
[0441] R.sub.6 is carboxylic acid, or ester thereof;
[0442] R.sub.7 is hydrogen, or an alkanoyl or aroyl group.
[0443] Nonlimiting examples of Q include the following
compounds:
##STR00025##
and derivatives thereof.
[0444] In embodiments wherein Q comprises a structure that permits
or promotes agonist or antagonist activity at a TR, Q is conjugated
to L (e.g. when L is a linking group) or Y (e.g. when L is a bond)
at any position of Q that is capable of reacting with Y or L. One
skilled in the art could readily determine the position of
conjugation on Q and means of conjugation of Q to Y or L in view of
general knowledge and the disclosure provided herein. In some
embodiments, Q is conjugated to L or Y through any position of Q.
In some embodiments, Q is conjugated to L or Y through the
carboxylic acid or amine moieties, as indicated below:
##STR00026##
[0445] In some embodiments, Q acts at a retinoic acid receptor
(e.g. RAR.alpha., RAR.beta., RAR.gamma.). In some embodiments, Q
comprises any structure that permits or promotes agonist activity
at the RAR, while in other embodiments Q is an antagonist of RAR.
In exemplary embodiments, Q comprises a structure of Formula G:
##STR00027##
[0446] wherein R.sup.11 is a moiety that permits or promotes
agonist or antagonist activity upon the binding of the compound of
Formula G to a RAR, and represents either E or Z
stereochemistry.
[0447] In some embodiments, Q comprises a structure of Formula G
wherein R.sup.11 is C(O)OH, CH.sub.2OH, or C(O)H. In some
embodiments, Q comprises a structure of Formula G wherein R.sup.11
is a carboxylic acid derivative (e.g. acyl chloride, anhydride, and
ester).
[0448] Nonlimiting examples of the compound of Formula G
include:
##STR00028##
and derivatives thereof.
[0449] In embodiments wherein Q comprises a structure of Formula G,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula G that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Q and means of conjugation
of Q to Y or L in view of general knowledge and the disclosure
provided herein. In some embodiments, Q is conjugated to L or Y
through any position of Q. In some embodiments, Formula G is
conjugated to L or Y at R.sup.11.
[0450] In some embodiments, Q acts at a peroxisome proliferator
activated receptor (e.g. PPAR.alpha., PPAR.beta./.delta.,
PPAR.gamma.). In some embodiments, Q acts at PPAR.gamma.. In some
embodiments, Q comprises any structure that permits or promotes
agonist activity at the PPAR, while in other embodiments Q is an
antagonist of PPAR. In some embodiments, Q is a saturated or
unsaturated, halogenated or nonhalogenated free fatty acid (FFA) as
described by Formula H:
##STR00029##
[0451] wherein n is 0-26 and each R.sup.12, when present, is
independently a moiety that permits or promotes agonist or
antagonist activity upon binding of the compound of Formula H to a
PPAR.
[0452] In some embodiments, Q comprises a structure of Formula H,
wherein n is 0-26 and each R.sup.12, when present, is independently
hydrogen, C.sub.1-C.sub.7 alkyl, or halogen. In some embodiments
Formula B is saturated such as, for example, formic acid, acetic
acid, n-caproic acid, heptanoic acid, caprylic acid, nonanoic acid,
capric acid, undecanoic acid, lauric acid, tridecanoic acid,
myristic acid, pentadeconoic acid, palmitic acid, heptadecanoic
acid, stearic acid, nonadecanoic acid, arachidic acid,
heneicosanoic acid, behenic acid, tricosanoic acid,
perfluorononanoic acid (see below), perfluorooctanoic acid (see
below), and derivatives thereof. In some embodiments Formula H is
unsaturated with either cis or trans stereochemistry such as, for
example, mead acid, myristoleic acid, palmitoleic acid, sapienic
acid, oleic acid, linoleic acid, .alpha.-linolenic acid, elaidic
acid, petroselinic acid, arachidonic acid,
dihydroxyeicosatetraenoic acid (DiHETE), octadecynoic acid,
eicosatriynoic acid, eicosadienoic acid, eicosatrienoic acid,
eicosapentaenoic acid, erucic acid, dihomolinolenic acid,
docosatrienoic acid, docosapentaenoic acid, docosahexaenoic acid,
adrenic acid, and derivatives thereof, including for example:
##STR00030##
[0453] In embodiments wherein Q comprises a structure of Formula H,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula H that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula H and means of
conjugation of Formula H to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula H is
conjugated to L or Y at any position on Formula H. In some
embodiments, Formula H is conjugated to L or Y through the terminal
carboxylic acid moiety.
[0454] In some of these embodiments, Q is an eiconsanoid. In
specific embodiments, Q is a prostaglandin or a leukotriene. In
some exemplary embodiments, Q is a prostaglandin having a structure
as described by Formula J1-J6:
##STR00031##
[0455] wherein each R.sup.13 is independently a moiety that permits
or promotes agonist or antagonist activity upon the binding of the
compound of Formula J to a PPAR (e.g. PGJ2 as shown below):
##STR00032##
[0456] In some embodiments when Q comprises a structure of any one
of Formula J146, each R.sup.13 is independently C.sub.7-C.sub.8
alkyl, C.sub.7-C.sub.8 alkenyl, C.sub.7-C.sub.8 alkynyl, or
heteroalkyl.
[0457] In embodiments wherein Q is an eicosanoid, Q is conjugated
to L (e.g. when L is a linking group) or Y (e.g. when L is a bond)
at any position of the eicosanoid that is capable of reacting with
Y or L. One skilled in the art could readily determine the position
of conjugation on Q and means of conjugation of Q to Y or L in view
of general knowledge and the disclosure provided herein. In some
embodiments, Q is conjugated to L or Y through any position of Q.
In some embodiments, the eicosanoid is conjugated to L or Y through
a terminal carboxylic acid moiety or through a pendant alcohol
moiety.
[0458] In some exemplary embodiments, Q is a leukotriene having a
structure as described by Formula K or a derivatized form of
Formula K:
##STR00033##
[0459] wherein each R.sup.14 is independently a moiety that permits
or promotes agonist or antagonist activity upon the binding of the
compound of Formula K to a PPAR (e.g. leukotriene B4 as shown
below):
##STR00034##
[0460] In some embodiments when Q comprises a structure of Formula
K, each R.sup.14 is independently C.sub.3-C.sub.13 alkyl,
C.sub.3-C.sub.13 alkenyl, C.sub.3-C.sub.13 alkynyl, or
heteroalkyl.
[0461] In embodiments wherein Q comprises a structure of Formula K,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula K that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula K and means of
conjugation of Formula K to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula K is
conjugated to L or Y at any position on Formula K. In some
embodiments, Formula K is conjugated to L or Y through the terminal
carboxylic acid moiety or through a pendant alcohol moiety.
[0462] In some exemplary embodiments, Q is a thiazolidinedione
comprising a structure as described by Formula L:
##STR00035##
[0463] Nonlimiting examples of the compound of Formula L
include:
##STR00036##
and derivatives thereof.
[0464] In embodiments wherein Q comprises a structure of Formula L,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula L that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula L and means of
conjugation of Formula L to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula L is
conjugated to L or Y at any position on Formula L, such as, for
example, a pendant alcohol moiety, or through an aromatic
substituent.
[0465] In one embodiment wherein Y is Tesaglitzar or
Aleglitazar:
##STR00037##
[0466] In embodiments wherein Q comprises Tesaglitzar or
Aleglitazar, Q is conjugated to L (e.g. when L is a linking group)
or Y (e.g. when L is a bond) at any position that is capable of
reacting with Y or L. In one embodiment, Tesaglitzar or Aleglitazar
is conjugated to L or Y through the carboxylic acid moiety of the
compound.
[0467] In some embodiments, Q acts at a RAR-related orphan receptor
(e.g. ROR.alpha., ROR.beta., ROR.gamma.). In some embodiments, Q
comprises any structure that permits or promotes agonist activity
at the ROR, while in other embodiments Q is an antagonist of
ROR.
[0468] Nonlimiting examples of Q include:
##STR00038##
and derivatives thereof.
[0469] In embodiments wherein Q acts at a ROR, Q is conjugated to L
(e.g. when L is a linking group) or Y (e.g. when L is a bond) at
any position of Q that is capable of reacting with Y or L. One
skilled in the art could readily determine the position of
conjugation on Y and means of conjugation of Q to Y or L in view of
general knowledge and the disclosure provided herein. In some
embodiments, Q is conjugated to L or Y through any position of Q,
such as, for example, any of the positions previously described
herein.
[0470] In some embodiments, Q acts at a liver X receptor
(LXR.alpha., LXR.beta.). In some embodiments, Q comprises any
structure that permits or promotes agonist activity at the LXR,
while in other embodiments Q is an antagonist of LXR. In exemplary
embodiments, Q is an oxysterol (i.e. oxygenated derivative of
cholesterol). Nonlimiting examples of Q in these embodiments
include 22(R)-hydroxycholesterol (see below),
24(S)-hydroxycholesterol (see below), 27-hydroxycholesterol,
cholestenoic acid, and derivatives thereof.
##STR00039##
[0471] In embodiments wherein Q acts at a LXR, Q is conjugated to L
(e.g. when L is a linking group) or Y (e.g. when L is a bond) at
any position of Y that is capable of reacting with Y or L. One
skilled in the art could readily determine the position of
conjugation on Y and means of conjugation of Q to Y or L in view of
general knowledge and the disclosure provided herein. In some
embodiments, Q is conjugated to L or Y at any of positions 1, 2, 3,
4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, or 26 of Formula F. In some embodiments, Formula F
is conjugated to L or Y at position 3 or 17 of Formula F.
[0472] In some embodiments, Q acts at the farnesoid X receptor
(FXR). In some embodiments, Q comprises any structure that permits
or promotes agonist activity at the FXR, while in other embodiments
Q is an antagonist of FXR. In some of these embodiments, Q is a
bile acid. In exemplary embodiments, Q has a structure of Formula
M:
##STR00040##
[0473] wherein each of R.sup.15, R.sup.16, and R.sup.17 are
independently moieties that permit or promote agonist or antagonist
activity upon binding of the compound of Formula M to a FXR.
[0474] In some embodiments when Q comprises a structure of Formula
M, each of R.sup.15 and R.sup.16 are independently hydrogen,
(C.sub.0-C.sub.8 alkyl)halo, C.sub.1-C.sub.18 alkyl,
C.sub.2-C.sub.18 alkenyl, C.sub.2-C.sub.18 alkynyl, heteroalkyl, or
(C.sub.0-C.sub.8 alkyl)OH; and R.sup.17 is OH, (C.sub.0-C.sub.8
alkyl)NH(C.sub.1-C.sub.4 alkyl)SO.sub.3H, or (C.sub.0-C.sub.8
alkyl)NH(C.sub.1-C.sub.4 alkyl)COOH.
[0475] In some embodiments when Q comprises a structure of Formula
M, each of R.sup.15 and R.sup.16 are independently hydrogen or OH;
and R.sup.17 is OH, NH(C.sub.1-C.sub.2 alkyl)SO.sub.3H, or
NH(C.sub.1-C.sub.2 alkyl)COOH.
[0476] Nonlimiting examples of the compound of Formula M
include:
##STR00041##
and derivatives thereof.
[0477] In embodiments wherein Q comprises a structure of Formula M,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula M that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula M and means of
conjugation of Formula M to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula M is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25
of Formula M. In some embodiments, Formula M is conjugated to L or
Y at position 3, 7, 12 or 17 of Formula M.
[0478] In some embodiments, Q acts at the vitamin D receptor (VDR).
In some embodiments, Q comprises any structure that permits or
promotes agonist activity at the VDR, while in other embodiments Q
is an antagonist of VDR. In exemplary embodiments, Q has a
structure of Formula N:
##STR00042##
[0479] wherein each of R.sup.18, R.sup.19, R.sup.20, R.sup.21,
R.sup.22, and R.sup.23 are moieties that permit or promote agonist
or antagonist activity upon binding of the compound of Formula N to
the VDR such as, for example, any of the vitamin D compounds found
in Bouillon et al., Endocrine Reviews, 16(2):200-257 (1995).
[0480] In some embodiments wherein Q comprises a structure of
Formula N,
[0481] R.sup.18 and R.sup.19 are each independently hydrogen,
(C.sub.0-C.sub.8 alkyl)halo, (C.sub.0-C.sub.8 alkyl)heteroaryl, or
(C.sub.0-C.sub.8 alkyl)OH;
[0482] both of R.sup.20 are hydrogen or both of R.sup.20 are taken
together to form .dbd.CH.sub.2;
[0483] each of R.sup.21 and R.sup.22 are independently
C.sub.1-C.sub.4 alkyl; and
[0484] R.sup.23 is C.sub.4-C.sub.18 alkyl, C.sub.4-C.sub.18
alkenyl, C.sub.4-C.sub.18 alkynyl, heteroalkyl, (C.sub.4-C.sub.18
alkyl)aryl, (C.sub.4-C.sub.18 alkyl)heteroaryl, (C.sub.0-C.sub.8
alkyl)OC.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkenyl)OC.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkynyl)OC.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)OC.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)OC.sub.2-C.sub.18 alkynyl, (C.sub.6-C.sub.18 alkyl)OH,
(C.sub.6-C.sub.18 alkyl)SH, (C.sub.6-C.sub.18 alkenyl)OH,
(C.sub.6-C.sub.18 alkynyl)OH, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkenyl)NR.sup.24C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkynyl)NR.sup.24C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)C.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8 alkyl)C(O)H,
(C.sub.0-C.sub.8 alkyl)C(O)aryl, (C.sub.0-C.sub.8
alkyl)C(O)heteroaryl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.1-C.sub.18
alkyl, (C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.18 alkenyl,
(C.sub.0-C.sub.8 alkyl)C(O)OC.sub.2-C.sub.18 alkynyl,
(C.sub.0-C.sub.8 alkyl)C(O)OH, (C.sub.0-C.sub.8 alkyl)C(O)O aryl,
(C.sub.0-C.sub.8 alkyl)C(O)O heteroaryl, (C.sub.0-C.sub.8
alkyl)OC(O)C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)OC(O)C.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)OC(O)C.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24C.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24aryl, (C.sub.0-C.sub.8
alkyl)C(O)NR.sup.24heteroaryl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.8 alkenyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)C.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24C(O)OH, (C.sub.0-C.sub.8
alkyl)OC(O)OC.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)OC(O)OC.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)OC(O)OC.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8
alkyl)OC(O)OH, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24C.sub.2-C.sub.18 alkynyl, (C.sub.0-C.sub.8
alkyl)OC(O)NR.sup.24H.sub.2, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.1-C.sub.18 alkyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.18 alkenyl, (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OC.sub.2-C.sub.18 alkynyl, or (C.sub.0-C.sub.8
alkyl)NR.sup.24(O)OH; and
[0485] R.sup.24 is hydrogen or C.sub.1-C.sub.18 alkyl.
[0486] Nonlimiting examples of the compound of Formula N
include:
##STR00043##
and derivatives thereof.
[0487] In embodiments wherein Q comprises a structure of Formula N,
Q is conjugated to L (e.g. when L is a linking group) or Y (e.g.
when L is a bond) at any position of Formula N that is capable of
reacting with Y or L. One skilled in the art could readily
determine the position of conjugation on Formula N and means of
conjugation of Formula N to Y or L in view of general knowledge and
the disclosure provided herein. In some embodiments, Formula N is
conjugated to L or Y at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or
26 of Formula N. In some embodiments, Formula N is conjugated to L
or Y at position 1, 3, 19, or 25 of Formula N.
[0488] In some embodiments, Q acts at the pregnane X receptor
(PXR). In some embodiments, Q comprises any structure that permits
or promotes agonist activity at the PXR, while in other embodiments
Q is an antagonist of PXR. In some embodiments, Q is a steroid,
antibiotic, antimycotic, bile acid, hyperforin, or a herbal
compound. In exemplary embodiments, Q is compound that is able to
induce CYP3A4, such as dexamethasone and rifampicin. In embodiments
wherein Q comprises a structure that acts at the PXR, Q is
conjugated to L (e.g. when L is a linking group) or Y (e.g. when L
is a bond) at any position of Q that is capable of reacting with Y
or L. One skilled in the art could readily determine the position
of conjugation on Y and means of conjugation of Q to Y or L in view
of general knowledge and the disclosure provided herein. In some
embodiments, Q is conjugated to L or Y at any of positions on
Q.
[0489] Modification of the NHR Ligand (O)
[0490] In some embodiments, the NHR ligand is derivatized or
otherwise chemically modified to comprise a reactive moiety that is
capable of reacting with the insulin peptide (Y) or the linking
group (L). In the embodiments described herein, Q is derivatized at
any position of Q that is capable of reacting with Y or L. The
position of derivatization on Q is apparent to one skilled in the
art and depends on the type of NHR ligand used and the activity
that is desired. For example, in embodiments wherein Q has a
structure comprising a tetracyclic skeleton having three 6-membered
rings joined to one 5-membered ring or a variation thereof, Q can
be derivatized at any of positions 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25.
Other positions of derivatization can be as previously described
herein.
[0491] The NHR ligand can be derivatized using any agent known to
one skilled in the art or described herein. For example, estradiol
can be derivatized with succinic acid, succinic anhydride, benzoic
acid, ethyl 2-bromoacetate, or iodoacetic acid to form the below
derivatives of estradiol that are capable of conjugating to Q or
L.
##STR00044##
[0492] Similarly, any of the aforementioned NHR ligands can be
derivatized by methods known in the art. Additionally, certain
derivatized ligands are commercially available and can be purchased
from chemical companies such as Sigma-Aldrich.
[0493] In accordance with one embodiment Q is selected from the
group consisting of estradiol and derivatives thereof, estrone and
derivatives thereof, testosterone and derivatives thereof, and
cortisol and derivatives thereof. In one embodiment Q is
dexamethasone. In one embodiment Q is selected from the group
consisting of thyroxine T4 (3,5,3',5'-tetra-iodothyronine),
3,5,3'-triiodo L-thyronine, Tesaglitazar, Aleglitazar and
thiazolidinediones. In one embodiment Q is selected from the group
consisting of thyroxine T4 (3,5,3',5'-tetra-iodothyronine), and
3,5,3'-triiodo L-thyronine. In one embodiment Q is selected from
the group consisting of Tesaglitazar and Aleglitazar.
[0494] Structure of the Insulin Peptide
[0495] In some embodiments, the insulin peptide of the presently
disclosed conjugates is native insulin, comprising the A chain of
SEQ ID NO: 1 and the B chain of SEQ ID NO: 2, or an analog of
native insulin, including for example a single-chain insulin analog
comprising SEQ ID NOS: 1 and 2. In accordance with the present
disclosure analogs of insulin encompass polypeptides comprising an
A chain and a B chain wherein the insulin analogs differ from
native insulin by one or more amino acid substitutions at positions
selected from A5, A8, A9, A10, A12, A14, A15, A17, A18, A21, B1,
B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26,
B27, B28, B29 and B30 or deletions of any or all of positions B1-4
and B26-30.
[0496] In one embodiment the insulin peptide is an insulin analog
wherein: [0497] (a) the amino acid residue at position B28 is
substituted with Asp, Lys, Leu, Val, or Ala, and the amino acyl
residue at position B29 is Lys or Pro; [0498] (b) the amino acid
residues at any of positions B27, B28, B29, and B30 are deleted or
substituted with a nonnative amino acid. In one embodiment an
insulin analog is provided comprising an Asp substituted at
position B28 or a Lys substituted at position 28 and a proline
substituted at position B29. Additional insulin analogs are
disclosed in Chance, et al., U.S. Pat. No. 5,514,646; Chance, et
al., U.S. patent application Ser. No. 08/255,297; Brems, et al.,
Protein Engineering, 5:527-533 (1992); Brange, et al., EPO
Publication No. 214,826 (published Mar. 18, 1987); and Brange, et
al., Current Opinion in Structural Biology, 1:934-940 (1991). The
disclosures of which are expressly incorporated herein by
reference.
[0499] Insulin analogs may also have replacements of the amidated
amino acids with acidic forms. For example, Asn may be replaced
with Asp or Glu. Likewise, Gln may be replaced with Asp or Glu. In
particular, Asn(A18), Asn(A21), or Asp(B3), or any combination of
those residues, may be replaced by Asp or Glu. Also, Gln(A15) or
Gln(B4), or both, may be replaced by either Asp or Glu.
[0500] As disclosed herein single chain insulin agonists are
provided comprising a B chain and an A chain of human insulin, or
analogs or derivative thereof, wherein the carboxy terminus of the
B chain is linked to the amino terminus of the A chain via a
linking moiety. In one embodiment the A chain is an amino acid
sequence selected from the group consisting of
GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1), GIVDECCFRSCDLRRLEMYCA (SEQ ID
NO: 5) or GIVEECCFRSCDLALLETYCA (SEQ ID NO: 7) and the B chain
comprises the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO:
2), GPETLCGAELVDALYLVCGDRGFYFNKPT (SEQ ID NO: 6) or
AYRPSETLCGGELVDTLYLVCGDRGFYFSRPA (SEQ ID NO: 8), or a carboxy
shortened sequence thereof having one to five amino acids
corresponding to B26, B27, B28, B29 and B30 deleted, and analogs of
those sequences wherein each sequence is modified to comprise one
to five amino acid substitutions at positions corresponding to
native insulin positions (see peptide alignment shown in FIG. 5)
selected from A5, A8, A9, A10, A14, A15, A17, A18, A21, B1, B2, B3,
B4, B5, B9, B10, B13, B14, B20, B22, B23, B26, B27, B28, B29 and
B30. In one embodiment the amino acid substitutions are
conservative amino acid substitutions. Suitable amino acid
substitutions at these positions that do not adversely impact
insulin's desired activities are known to those skilled in the art,
as demonstrated, for example, in Mayer, et al., Insulin Structure
and Function, Biopolymers. 2007; 88(5):687-713, the disclosure of
which is incorporated herein by reference.
[0501] Additional amino acid sequences can be added to the amino
terminus of the B chain or to the carboxy terminus of the A chain
of the single chain insulin agonists of the present invention. For
example, a series of negatively charged amino acids can be added to
the amino terminus of the B chain, including for example a peptide
of 1 to 12, 1 to 10, 1 to 8 or 1 to 6 amino acids in length and
comprising one or more negatively charged amino acids including for
example glutamic acid and aspartic acid. In one embodiment the B
chain amino terminal extension comprises 1 to 6 charged amino
acids. In one embodiment the B chain amino terminal extension
comprises the sequence GX.sub.61X.sub.62X.sub.63X.sub.64X.sub.65K
(SEQ ID NO: 26) or X.sub.61X.sub.62X.sub.63X.sub.64X.sub.65RK (SEQ
ID NO: 27), wherein X.sub.61, X.sub.62, X.sub.63 X.sub.64 and
X.sub.65 are independently glutamic acid or aspartic acid. In one
embodiment the B chain comprises the sequence
GEEEEEKGPEHLCGAHLVDALYLVCGDX.sub.42GFY (SEQ ID NO: 28), wherein
X.sub.42 is selected from the group consisting of alanine lysine,
ornithine and arginine.
[0502] High potencyFGF21 based insulin conjugates can also be
prepared based on using a modified IGF I and IGF II sequence
described in published International application no. WO
2010/080607, the disclosure of which is expressly incorporated
herein by reference, as the insulin peptide component. More
particularly, analogs of IGF I and IGF II that comprise a
substitution of a tyrosine leucine dipeptide for the native IGF
amino acids at positions corresponding to B16 and B17 of native
insulin have a tenfold increase in potency at the insulin
receptor.
[0503] In accordance with one embodiment the insulin peptide for
use in the present disclosure comprises a B chain sequence of
R.sub.62-X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGX.sub.41X.sub-
.42GFX.sub.45 (SEQ ID NO: 20) and an A chain sequence of
GIVX.sub.4X.sub.5CCX.sub.8X.sub.9X.sub.10CX.sub.12LX.sub.14X.sub.15LX.sub-
.17X.sub.18X.sub.19CX.sub.21--R.sub.53 (SEQ ID NO: 29) wherein
[0504] X.sub.4 is glutamic acid or aspartic acid; [0505] X.sub.5 is
glutamine or glutamic acid [0506] X.sub.8 is histidine, threonine
or phenylalanine; [0507] X.sub.9 is serine, arginine, lysine,
ornithine or alanine; [0508] X.sub.10 is isoleucine or serine;
[0509] X.sub.12 is serine or aspartic acid [0510] X.sub.14 is
tyrosine, arginine, lysine, ornithine or alanine; [0511] X.sub.15
is glutamine, glutamic acid, arginine, alanine, lysine, ornithine
or leucine; [0512] X.sub.17 is glutamine, glutamic acid, arginine,
aspartic acid or lysine, ornithine [0513] X.sub.18 is methionine,
asparagine, glutamine, aspartic acid, glutamic acid or threonine;
[0514] X.sub.19 is tyrosine, 4-methoxy-phenylalanine or 4-amino
phenylalanine; [0515] X.sub.21 is selected from the group
consisting of alanine, glycine, serine, valine, threonine,
isoleucine, leucine, glutamine, glutamic acid, asparagine, aspartic
acid, histidine, tryptophan, tyrosine, and methionine; [0516]
X.sub.25 is histidine or threonine; [0517] X.sub.29 is selected
from the group consisting of alanine, glycine and serine; [0518]
X.sub.30 is selected from the group consisting of histidine,
aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
[0519] X.sub.33 is selected from the group consisting of aspartic
acid, glutamine and glutamic acid; [0520] X.sub.34 is selected from
the group consisting of alanine and threonine; [0521] X.sub.41 is
selected from the group consisting of glutamic acid, aspartic acid
or asparagine; [0522] X.sub.42 is selected from the group
consisting of alanine, lysine, ornithine and arginine; [0523]
X.sub.45 is tyrosine, histidine, asparagine or phenylalanine;
[0524] R.sub.62 is selected from the group consisting of AYRPSE
(SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a
tripeptide glycine-proline-glutamic acid, a tripeptide
valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a
dipeptide asparagine-glutamine, glutamine, glutamic acid and a
bond; and R.sub.53 is COOH or CONH.sub.2. In one embodiment the A
chain and the B chain are linked to one another by interchain
disulfide bonds, including those that form between the A and B
chains of native insulin. In an alternative embodiment the A and B
chains are linked together as a linear single chain-insulin
peptide.
[0525] In one embodiment the conjugates comprise an insulin peptide
wherein the A chain comprises a sequence of
GIVEQCCX.sub.1SICSLYQLENX.sub.2CX.sub.3 (SEQ ID NO: 30) and said B
chain sequence comprises a sequence of
X.sub.4LCGX.sub.5X.sub.6LVEALYLVCGERGFF (SEQ ID NO: 31), wherein
[0526] X.sub.1 is selected from the group consisting of threonine
and histidine; [0527] X.sub.2 is tyrosine, 4-methoxy-phenylalanine
or 4-amino phenylalanine; [0528] X.sub.3 is selected from the group
consisting of asparagine and glycine; [0529] X.sub.4 is selected
from the group consisting of histidine and threonine; [0530]
X.sub.5 is selected from the group consisting of alanine, glycine
and serine; [0531] X.sub.6 is selected from the group consisting of
histidine, aspartic acid, glutamic acid, homocysteic acid and
cysteic acid.
[0532] In accordance with one embodiment an insulin analog is
provided wherein the A chain of the insulin peptide comprises the
sequence GIVEQCCX.sub.8X.sub.9ICSLYQLENYCX.sub.21--R.sub.53 (SEQ ID
NO: 73) or GIVEQCCX.sub.8SICSLYQLX.sub.17NYCX.sub.21 (SEQ ID NO:
32) and the B chain comprising the sequence
R.sub.62-X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGX.sub.41X.sub-
.42GFX.sub.45YT-Z.sub.1-B.sub.1 (SEQ ID NO: 142), wherein [0533]
X.sub.8 is selected from the group consisting of threonine and
histidine; [0534] X.sub.9 is valine or tyrosine; [0535] X.sub.17 is
glutamine or glutamic acid; [0536] X.sub.21 is asparagine or
glycine; [0537] X.sub.25 is histidine or threonine; [0538] X.sub.29
is selected from the group consisting of alanine, glycine and
serine; [0539] X.sub.30 is selected from the group consisting of
histidine, aspartic acid, glutamic acid, homocysteic acid and
cysteic acid; [0540] X.sub.33 is selected from the group consisting
of aspartic acid and glutamic acid; [0541] X.sub.34 is selected
from the group consisting of alanine and threonine; [0542] X.sub.41
is selected from the group consisting of glutamic acid, aspartic
acid or asparagine; [0543] X.sub.42 is selected from the group
consisting of alanine, ornithine, lysine and arginine; [0544]
X.sub.45 is tyrosine or phenylalanine; [0545] R.sub.62 is selected
from the group consisting of FVNQ (SEQ ID NO: 12), a tripeptide
valine-asparagine-glutamine, a dipeptide asparagine-glutamine,
glutamine and an N-terminal amine [0546] Z.sub.1 is a dipeptide
selected from the group consisting of aspartate-lysine,
lysine-proline, and proline-lysine; and [0547] B.sub.1 is selected
from the group consisting of threonine, alanine or a
threonine-arginine-arginine tripeptide.
[0548] In accordance with one embodiment an insulin analog is
provided wherein the A chain of the insulin peptide comprises the
sequence GIVEQCCX.sub.8SICSLYQLX.sub.17NX.sub.19CX.sub.21 (SEQ ID
NO: 32) and the B chain comprising the sequence
X.sub.25LCGX.sub.29X.sub.30LVEALYLVCGERGFF (SEQ ID NO: 33) wherein
[0549] X.sub.8 is selected from the group consisting of threonine
and histidine; [0550] X.sub.17 is glutamic acid or glutamine;
[0551] X.sub.19 is tyrosine, 4-methoxy-phenylalanine or 4-amino
phenylalanine; [0552] X.sub.21 is asparagine or glycine; [0553]
X.sub.25 is selected from the group consisting of histidine and
threonine; [0554] X.sub.29 is selected from the group consisting of
alanine, glycine and serine; [0555] X.sub.30 is selected from the
group consisting of histidine, aspartic acid, glutamic acid,
homocysteic acid and cysteic acid. In a further embodiment the B
chain comprises the sequence
X.sub.22VNQX.sub.25LCGX.sub.29X.sub.30LVEALYLVCGERGFFYT-Z.sub.1-B.sub.1
(SEQ ID NO: 34) wherein [0556] X.sub.22 is selected from the group
consisting of phenylalanine and desamino-phenylalanine; [0557]
X.sub.25 is selected from the group consisting of histidine and
threonine; [0558] X.sub.29 is selected from the group consisting of
alanine, glycine and serine; [0559] X.sub.30 is selected from the
group consisting of histidine, aspartic acid, glutamic acid,
homocysteic acid and cysteic acid; [0560] Z.sub.1 is a dipeptide
selected from the group consisting of aspartate-lysine,
lysine-proline, and proline-lysine; and [0561] B.sub.1 is selected
from the group consisting of threonine, alanine or a
threonine-arginine-arginine tripeptide.
[0562] In accordance with some embodiments the A chain comprises
the sequence GIVEQCCX.sub.8SICSLYQLX.sub.17NX.sub.19CX.sub.23 (SEQ
ID NO: 32) or
GIVDECCX.sub.8X.sub.9SCDLX.sub.14X.sub.15LX.sub.17X.sub.18
X.sub.19CX.sub.21-R.sub.53 (SEQ ID NO: 35), and the B chain
comprises the sequence
X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGDX.sub.42GFX.-
sub.45 (SEQ ID NO: 36) wherein [0563] X.sub.8 is histidine or
phenylalanine; [0564] X.sub.9 and X.sub.14 are independently
selected from arginine, lysine, ornithine or alanine; [0565]
X.sub.15 is arginine, lysine, ornithine or leucine; [0566] X.sub.17
is glutamic acid or glutamine; [0567] X.sub.18 is methionine,
asparagine or threonine; [0568] X.sub.19 is tyrosine,
4-methoxy-phenylalanine or 4-amino phenylalanine; [0569] X.sub.21
is alanine, glycine or asparagine; [0570] X.sub.23 is asparagine or
glycine; [0571] X.sub.25 is selected from the group consisting of
histidine and threonine; [0572] X.sub.29 is selected from the group
consisting of alanine, glycine and serine; [0573] X.sub.30 is
selected from the group consisting of histidine, aspartic acid,
glutamic acid, homocysteic acid and cysteic acid; [0574] X.sub.33
is selected from the group consisting of aspartic acid and glutamic
acid; [0575] X.sub.34 is selected from the group consisting of
alanine and threonine; [0576] X.sub.42 is selected from the group
consisting of alanine, lysine, ornithine and arginine; [0577]
X.sub.45 is tyrosine; and [0578] R.sub.53 is COOH or
CONH.sub.2.
[0579] In a further embodiment the A chain comprises the sequence
GIVDECCX.sub.8X.sub.9SCDLX.sub.14X.sub.15LX.sub.17X.sub.18
X.sub.19CX.sub.21--R.sub.53 (SEQ ID NO: 35), and the B chain
comprises the sequence
X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGDX.sub.42GFX.sub.45
(SEQ ID NO: 36) wherein [0580] X.sub.8 is histidine; [0581] X.sub.9
and X.sub.14 are independently selected from arginine, lysine,
ornithine or alanine; [0582] X.sub.15 is arginine, lysine,
ornithine or leucine; [0583] X.sub.17 is glutamic acid, aspartic
acid, asparagine, lysine, ornithine or glutamine; [0584] X.sub.18
is methionine, asparagine or threonine; [0585] X.sub.19 is
tyrosine, 4-methoxy-phenylalanine or 4-amino phenylalanine; [0586]
X.sub.21 is alanine, glycine or asparagine; [0587] X.sub.23 is
asparagine or glycine; [0588] X.sub.25 is selected from the group
consisting of histidine and threonine; [0589] X.sub.29 is selected
from the group consisting of alanine, glycine and serine; [0590]
X.sub.30 is selected from the group consisting of histidine,
aspartic acid, glutamic acid, homocysteic acid and cysteic acid;
[0591] X.sub.33 is selected from the group consisting of aspartic
acid and glutamic acid; [0592] X.sub.34 is selected from the group
consisting of alanine and threonine; [0593] X.sub.42 is selected
from the group consisting of alanine, lysine, ornithine and
arginine; [0594] X.sub.45 is tyrosine or phenylalanine and [0595]
R.sub.53 is COOH or CONH.sub.2. In a further embodiment the A chain
comprises the sequence
GIVDECCHX.sub.9SCDLX.sub.14X.sub.15LX.sub.17MX.sub.19CX.sub.21--R.sub.53
(SEQ ID NO: 37), and the B chain comprises the sequence
X.sub.25LCGAX.sub.30LVDALYLVCGDX.sub.42GFX.sub.45 (SEQ ID NO: 38)
wherein [0596] X.sub.9, X.sub.14 and X.sub.15 are independently
ornithine, lysine or arginine; [0597] X.sub.17 is glutamic acid or
glutamine; [0598] X.sub.19 is tyrosine, 4-methoxy-phenylalanine or
4-amino phenylalanine; [0599] X.sub.21 is alanine, glycine or
asparagine; [0600] X.sub.25 is selected from the group consisting
of histidine and threonine; [0601] X.sub.30 is selected from the
group consisting of histidine, aspartic acid and glutamic acid;
[0602] X.sub.42 is selected from the group consisting of alanine,
lysine, ornithine and arginine; [0603] X.sub.45 is tyrosine or
phenylalanine and [0604] R.sub.53 is COOH or CONH.sub.2. In one
embodiment the B chain is selected from the group consisting of
HLCGAELVDALYLVCGDX.sub.42GFY (SEQ ID NO: 39),
GPEHLCGAELVDALYLVCGDX.sub.42GFY (SEQ ID NO: 40),
GPEHLCGAELVDALYLVCGDX.sub.42GFYFNPKT (SEQ ID NO: 41) and
GPEHLCGAELVDALYLVCGDX.sub.42GFYFNKPT (SEQ ID NO: 42), wherein
X.sub.42 is selected from the group consisting of ornithine, lysine
and arginine. In a further embodiment the A chain comprises the
sequence GIVDECCHX.sub.9SCDLX.sub.14X.sub.15LQMYCN-R.sub.53 (SEQ ID
NO: 43), wherein X.sub.9, X.sub.14 and X.sub.15 are independently
ornithine, lysine or arginine.
[0605] In another embodiment the A chain comprises the sequence
GIVDECCX.sub.8RSCDLYQLENX.sub.19CN-R.sub.53 (SEQ ID NO: 44) and the
B chain comprises the sequence
R.sub.62-X.sub.25LCGSHLVDALYLVCGDX.sub.42GFX.sub.45 (SEQ ID NO: 45)
[0606] wherein [0607] X.sub.8 is threonine, histidine or
phenylalanine; [0608] X.sub.19 is tyrosine, 4-methoxy-phenylalanine
or 4-amino phenylalanine; [0609] X.sub.25 is histidine or
threonine; [0610] X.sub.42 is alanine, ornithine or arginine;
[0611] X.sub.45 is tyrosine histidine, asparagine or phenylalanine;
[0612] R.sub.62 is selected from the group consisting of AYRPSE
(SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), a
tripeptide glycine-proline-glutamic acid, a tripeptide
valine-asparagine-glutamine, a dipeptide proline-glutamic acid, a
dipeptide asparagine-glutamine, glutamine, glutamic acid and a
bond; and R.sub.53 is COOH or CONH.sub.2. and [0613] R.sub.53 is
COOH or CONH.sub.2. In a further embodiment X.sub.19 is Tyr.
[0614] In another embodiment the A chain comprises the sequence
GIVEQCCHSICSLYQLENX.sub.19CX.sub.21-R.sub.53 (SEQ ID NO: 46) or
GIVDECCHRSCDLRRLEMX.sub.19CX.sub.21-R.sub.53 (SEQ ID NO: 47); and
the B chain comprises the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT
(SEQ ID NO: 2), or
[0615] GPETLCGAELVDALYLVCGDRGFYFNPKT (SEQ ID NO: 48)
[0616] wherein [0617] X.sub.19 is tyrosine, 4-methoxy phenylalanine
or 4-amino-phenylalanine; and [0618] X.sub.21 is alanine, glycine
or asparagine.
[0619] In another embodiment, the A chain comprises the sequence
GIVEQCCHSICSLYQLENYCX.sub.21-R.sub.53 (SEQ ID NO: 160) and the B
chain comprises the sequence
FVKQX.sub.25LCGSHLVEALYLVCGERGFF-R.sub.63 (SEQ ID NO: 147), or
FVNQX.sub.25LCGSHLVEALYLVCGERGFF-R.sub.63 (SEQ ID NO: 148),
wherein
[0620] X.sub.21 is alanine, glycine or asparagine; and
[0621] X.sub.25 is selected from the group consisting of histidine
and threonine; [0622] X.sub.28 is proline, aspartic acid or
glutamic acid; and
[0623] R.sub.63 is selected from the group consisting of
YTX.sub.28KT (SEQ ID NO: 149), YTKPT (SEQ ID NO: 150), YTX.sub.28K
(SEQ ID NO: 152), YTKP (SEQ ID NO: 151), YTPK (SEQ ID NO: 70),
YTX.sub.28, YT, Y and a bond. In one embodiment the B chain
comprises the sequence FVKQX.sub.25LCGSHLVEALYLVCGERGFFYTEKT (SEQ
ID NO: 162), FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTDKT (SEQ ID NO:
164), FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 165) or
FVNQX.sub.25LCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 161) wherein
[0624] X.sub.25 is selected from the group consisting of histidine
and threonine.
[0625] Single Chain Insulin Peptide Agonists
[0626] As disclosed herein linking moieties can be used to link
human insulin A and B chains, or analogs or derivatives thereof,
wherein the carboxy terminus of the B25 amino acid of the B chain
is directly linked to a first end of a linking moiety, wherein the
second end of the linking moiety is directly linked to the amino
terminus of the A1 amino acid of the A chain via the intervening
linking moiety.
[0627] In accordance with one embodiment the insulin peptide is a
single chain insulin agonist that comprises the general structure
B-LM-A wherein B represents an insulin B chain, A represents an
insulin A chain, and LM represents a linking moiety linking the
carboxy terminus of the B chain to the amino terminus of the A
chain. Suitable linking moieties for joining the B chain to the A
chain are disclosed herein under the header Linking Moieties for
Single Chain-Insulin Analogs and the respective subheaders "Peptide
linkers". In one embodiment the linking moiety comprises a linking
peptide, and more particularly, in one embodiment the peptide
represents an analog of the IGF-1 C peptide. Additional exemplary
peptide linkers include but are not limited to the sequence
X.sub.51X.sub.52GSSSX.sub.57X.sub.58 (SEQ ID NO: 49) or
X.sub.51X.sub.52GSSSX.sub.57X.sub.58APQT (SEQ ID NO: 50) wherein
X.sub.51 is selected from the group consisting of glycine, alanine,
valine, leucine, isoleucine and proline, X.sub.52 is alanine,
valine, leucine, isoleucine or proline and X.sub.57 or X.sub.58 are
independently arginine, lysine, cysteine, homocysteine,
acetyl-phenylalanine or ornithine, optionally with a hydrophilic
moiety linked to the side chain of the amino acid at position 7 or
8 of the linking moiety (i.e., at the X.sub.57 or X.sub.58
position). Amino acid positions of the linking moiety are
designated based on the corresponding position in the native C
chain of IGF 1 (SEQ ID NO: 17). In another embodiment the peptide
linking moiety comprises a 29 contiguous amino acid sequence having
greater than 70%, 80%, 90% sequence identity to
SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.51 (SEQ ID NO: 68),
wherein X.sub.50 and X.sub.51 are independently selected from
arginine and lysine. In one embodiment the linking moiety is a
non-peptide linker comprising a relatively short bifunctional
non-peptide polymer linker that approximates the length of an 8-16
amino acid sequence. In one embodiment the non-peptide linker has
the structure:
##STR00045##
wherein m is an integer ranging from 10 to 14 and the linking
moiety is linked directly to the B25 amino acid of the B chain. In
accordance with one embodiment the non-peptide linking moiety is a
polyethylene glycol linker of approximately 4 to 20, 8 to 18, 8 to
16, 8 to 14, 8 to 12, 10 to 14, 10 to 12 or 11 to 13 monomers.
[0628] In one embodiment a FGF21 based insulin conjugate is
provided that comprises an insulin peptide having the structure:
IB-LM-IA, wherein IB comprises the sequence
R.sub.62-X.sub.25LCGX.sub.29X.sub.30LVX.sub.33X.sub.34LYLVCGX.sub.41X.sub-
.42GFX.sub.45 (SEQ ID NO: 20), LM is a linking moiety as disclosed
herein that covalently links IB to IA, and IA comprises the
sequence
GIVX.sub.4X.sub.5CCX.sub.8X.sub.9X.sub.10CX.sub.12LX.sub.14X.sub.15LX.sub-
.17X.sub.18X.sub.19CX.sub.21--R.sub.53(SEQ ID NO: 29), wherein
[0629] X.sub.4 is glutamic acid or aspartic acid; [0630] X.sub.5 is
glutamine or glutamic acid; [0631] X.sub.8 is histidine or
phenylalanine; [0632] X.sub.9 and X.sub.14 are independently
selected from arginine, lysine, ornithine or alanine; [0633]
X.sub.10 is isoleucine or serine; [0634] X.sub.12 is serine or
aspartic acid; [0635] X.sub.14 is tyrosine, arginine, lysine,
ornithine or alanine; [0636] X.sub.15 is arginine, lysine,
ornithine or leucine; [0637] X.sub.17 is glutamic acid or
glutamine; [0638] X.sub.18 is methionine, asparagine or threonine;
[0639] X.sub.19 is tyrosine, 4-methoxy-phenylalanine or 4-amino
phenylalanine; [0640] X.sub.21 is alanine, glycine or asparagine;
[0641] X.sub.25 is selected from the group consisting of histidine
and threonine; [0642] X.sub.29 is selected from the group
consisting of alanine, glycine and serine; [0643] X.sub.30 is
selected from the group consisting of histidine, aspartic acid,
glutamic acid, homocysteic acid and cysteic acid; [0644] X.sub.33
is selected from the group consisting of aspartic acid and glutamic
acid; [0645] X.sub.34 is selected from the group consisting of
alanine and threonine; [0646] X.sub.41 is selected from the group
consisting of glutamic acid, aspartic acid or asparagine; [0647]
X.sub.42 is selected from the group consisting of alanine, lysine,
ornithine and arginine; [0648] R.sub.62 is selected from the group
consisting of AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE
(SEQ ID NO: 11), a tripeptide glycine-proline-glutamic acid, a
tripeptide valine-asparagine-glutamine, a dipeptide
proline-glutamic acid, a dipeptide asparagine-glutamine, glutamine,
glutamic acid and an N-terminal amine; and [0649] R.sub.53 is COOH
or CONH.sub.2, further wherein the amino acid at the designation
X.sub.45 is directly bound to the linking moiety, LM (i.e., the
designation IB-LM-IA as used herein is intended to represent that
the B chain carboxyl terminus and the amino terminus of the A chain
are directly linked to the linking moiety LM without any further
intervening amino acids).
[0650] In one embodiment the linking moiety (LM) comprises an amino
acid sequence of no more than 17 amino acids in length. In one
embodiment the linking moiety comprises the sequence
X.sub.51X.sub.52GSSSX.sub.57X.sub.58 (SEQ ID NO: 49) or
X.sub.51X.sub.52GSSSX.sub.57X.sub.58APQT (SEQ ID NO: 50) wherein
X.sub.51 is selected from the group consisting of glycine, alanine,
valine, leucine, isoleucine and proline, X.sub.52 is alanine,
valine, leucine, isoleucine or proline and X.sub.57 or X.sub.58 are
independently arginine, lysine, cysteine, homocysteine,
acetyl-phenylalanine or ornithine, optionally with a hydrophilic
moiety linked to the side chain of the amino acid at position 7 or
8 of the linking moiety (i.e., at the X.sub.57 or X.sub.58
position). Amino acid positions of the linking moiety are
designated based on the corresponding position in the native C
chain of IGF 1 (SEQ ID NO: 17). In one embodiment LM is
GAGSSSRRAPQT (SEQ ID NO: 23) or GAGSSSRR (SEQ ID NO: 22).
[0651] In another embodiment the linking moiety comprises a 29
contiguous amino acid sequence, directly linked to the carboxy
terminal amino acid of the B chain, wherein said 29 contiguous
amino acid sequence has greater than 70%, 80%, 90% sequence
identity to SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.51 (SEQ ID NO:
68), wherein X.sub.50 and X.sub.51 are independently selected from
arginine and lysine. In one embodiment the linking peptide
comprises a total of 29 to 158 or 29 to 58 amino acids and
comprises the sequence of SEQ ID NO: 68. In another embodiment the
linking moiety comprises a 29 contiguous amino acid sequence,
directly linked to the carboxy terminal amino acid of the B chain,
wherein said 29 contiguous amino acid sequence has greater than 90%
sequence identity to SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.51
(SEQ ID NO: 68), wherein X.sub.50 and X.sub.51 are independently
selected from arginine and lysine. In one embodiment the linking
moiety comprises the sequence SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID
NO: 51) or SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) optionally
with one or two amino acid substitutions.
[0652] In accordance with one embodiment a single chain insulin
agonist polypeptide is provided comprising a B chain and A chain of
human insulin, or analogs or derivative thereof, wherein the last
five carboxy amino acids of the native B chain are deleted (i.e.,
B26-B30), and amino acid B25 is linked to amino acid A1 of the A
chain via an intervening linking moiety. In one embodiment the
linking moiety comprises the structure:
##STR00046##
wherein m is an integer ranging from 10 to 14 and the linking
moiety is linked directly to the B25 amino acid of the B chain.
[0653] In one embodiment an FGF21 based insulin conjugate is
provided comprising an insulin peptide having the general formula
IB-LM-IA wherein IB comprises the sequence
GPEHLCGAX.sub.30LVDALYLVCGDX.sub.42GFYFNX.sub.48X.sub.49 (SEQ ID
NO: 163);
[0654] LM comprises the sequence SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ
ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52), GYGSSSRR
(SEQ ID NO: 18), GAGSSSRRAPQT (SEQ ID NO: 23) or GAGSSSRR (SEQ ID
NO: 22); and
[0655] IA comprises the sequence
GIVDECCX.sub.8X.sub.9SCDLX.sub.14X.sub.15LX.sub.17X.sub.18X.sub.19CX.sub.-
21--R.sub.53 (SEQ ID NO: 35) wherein [0656] X.sub.8 is histidine or
phenylalanine; [0657] X.sub.9 is arginine, ornithine or alanine;
[0658] X.sub.14 and X.sub.15 are both arginine; [0659] X.sub.17 is
glutamic acid; [0660] X.sub.19 is tyrosine, 4-methoxy-phenylalanine
or 4-amino phenylalanine; [0661] X.sub.21 is alanine or asparagine;
[0662] X.sub.25 is histidine or threonine; [0663] X.sub.30 is
selected from the group consisting of histidine, aspartic acid,
glutamic acid, homocysteic acid and cysteic acid; [0664] X.sub.42
is selected from the group consisting of alanine, ornithine and
arginine; [0665] R.sub.53 is COOH.
[0666] Linking Moieties for Single Chain Insulin Analogs
[0667] Peptide Linkers
[0668] In accordance with one embodiment the linking moiety is a
peptide or peptidomimetic of 6-18, 8-18, 8-17, 8-12, 8-10, 13-17 or
13-15 amino acids (or amino acid analogs or derivatives thereof).
In one embodiment the linking moiety is 8 to 17 amino acids in
length and comprises the sequence X.sub.51X.sub.52GSSSRR (SEQ ID
NO: 53) wherein X.sub.51 is selected from the group consisting of
glycine, alanine, valine, leucine, isoleucine, proline and
methionine, and X.sub.52 is a non-aromatic amino acid, including
for example, alanine. In one embodiment the linking moiety is 8 to
17 amino acids in length and comprises a sequence that differs from
X.sub.51X.sub.52GSSSRR (SEQ ID NO: 53) by a single amino acid
substitution wherein the amino acid substitution is an amino acid
that is pegylated at its side chain, further wherein X.sub.51 is
selected from the group consisting of glycine, alanine, valine,
leucine, isoleucine, proline and methionine, and X.sub.52 is a
non-aromatic amino acid, including for example, alanine.
[0669] In accordance with one embodiment the linking moiety is a
derivative of the IGF 1 C chain sequence (GYGSSSRRAPQT; SEQ ID NO:
17). In one embodiment the derivative is a peptide that differs
from SEQ ID NO: 17 by a single amino acid substitution of a lysine,
cysteine ornithine, homocysteine, or acetyl-phenylalanine residue,
and in a further embodiment the lysine, cysteine ornithine,
homocysteine, or acetyl-phenylalanine amino acid is pegylated. In
one further embodiment the linking moiety is a peptide that differs
from SEQ ID NO: 17 by a single lysine substitution. In one specific
embodiment the substitution is made at position 8 of SEQ ID NO: 17.
Applicants have discovered that use of the IGF 1 C chain sequence
and analogs thereof as a linking moiety will generate a single
chain insulin polypeptide that has near wild type insulin activity.
Furthermore, use of a IGF 1 C chain sequence analog as the linking
moiety, wherein position 2 of the IGF 1 C chain sequence is
modified, or the carboxy terminal four amino acids are deleted from
the IGF 1 C chain sequence, produces a single chain insulin
polypeptide that is selective for insulin (i.e., has a higher
binding and/or activity at the insulin receptor compared to the
IGF-1 receptor). In one embodiment the single chain insulin
polypeptide has 5.times., 10.times., 20.times., 30.times.,
40.times., or 50.times. higher affinity or activity at the insulin
receptor relative to the IGF-1 receptor.
[0670] In accordance with one embodiment the linking moiety is a
derivative of the IGF 1 C chain sequence (GYGSSSRRAPQT; SEQ ID NO:
17) and comprises a non-native sequence that differs from GYGSSSRR
(SEQ ID NO: 18) or GAGSSSRRAPQT (SEQ ID NO: 23) by 1 to 3 amino
acid substitutions, or 1 to 2 amino acid substitutions. In one
embodiment at least one of the amino acid substitutions is a lysine
or cysteine substitution, and in one embodiment the amino acid
substitutions are conservative amino acid substitutions. In one
embodiment the linking moiety is a peptide (or peptidomimetic) of 8
to 17 amino acids comprising a non-native amino acid sequence that
differs from GYGSSSRR (SEQ ID NO: 18) or GAGSSSRRAPQT (SEQ ID NO:
23) by 1 amino acid substitution, including for example
substitution with a lysine or cysteine. In one embodiment the
linking moiety comprises the sequence GYGSSSRR (SEQ ID NO: 18) or
GAGSSSRRAPQT (SEQ ID NO: 23). In one embodiment the linking moiety
comprises the sequence GAGSSSRX.sub.58APQT (SEQ ID NO: 54),
GYGSSSX.sub.57X.sub.58APQT (SEQ ID NO: 69), or an amino acid that
differs from SEQ ID NO: 54 by a single amino acid substitution,
wherein X.sub.57 is arginine and X.sub.58 is arginine, ornithine or
lysine, and in a further embodiment a polyethylene glycol chain is
linked to the side chain of the amino acid at position 8 of said
linking moiety. In another embodiment the linking moiety comprises
the sequence GX.sub.52GSSSRX.sub.58APQT (SEQ ID NO: 55), wherein
X.sub.52 is any non-aromatic amino acid, including for example,
alanine, valine, leucine, isoleucine or proline, and X.sub.58
represents an amino acid that has a polyethylene chain covalently
linked to its side chain. In one embodiment X.sub.58 is a pegylated
lysine.
[0671] In another embodiment, the linking moiety is an 8 to 17
amino acid sequence comprising the sequence GX.sub.52GSSSRR (SEQ ID
NO: 56), wherein X.sub.52 is any amino acid, a peptidomimetic of
SEQ ID NO: 31, or an analog thereof that differs from SEQ ID NO: 31
by a single amino acid substitution at any of positions 1, 3, 4, 5,
6, 7 or 8 of SEQ ID NO: 31, with the proviso that when the linking
peptide is longer than 8 amino acids X.sub.52 is other than
tyrosine. In accordance with one embodiment the linking moiety
comprises an 8-17 amino acid sequence selected from the group
consisting of GYGSSSRR (SEQ ID NO: 18), GAGSSSRR (SEQ ID NO: 22),
GAGSSSRRA (SEQ ID NO: 57), GAGSSSRRAP (SEQ ID NO: 58), GAGSSSRRAPQ
(SEQ ID NO: 59), GAGSSSRRAPQT (SEQ ID NO: 23), PYGSSSRR (SEQ ID NO:
61), PAGSSSRR (SEQ ID NO: 62), PAGSSSRRA (SEQ ID NO: 63),
PAGSSSRRAP (SEQ ID NO: 64), PAGSSSRRAPQ (SEQ ID NO: 65),
PAGSSSRRAPQT (SEQ ID NO: 66). In accordance with one embodiment the
linking moiety comprises an amino acid sequence that differs from
GYGSSSRR (SEQ ID NO: 18), GAGSSSRR (SEQ ID NO: 22), GAGSSSRRA (SEQ
ID NO: 57), GAGSSSRRAP (SEQ ID NO: 58), GAGSSSRRAPQ (SEQ ID NO:
59), GAGSSSRRAPQT (SEQ ID NO: 23), PYGSSSRR (SEQ ID NO: 61),
PAGSSSRR (SEQ ID NO: 62), PAGSSSRRA (SEQ ID NO: 63), PAGSSSRRAP
(SEQ ID NO: 64), PAGSSSRRAPQ (SEQ ID NO: 65), PAGSSSRRAPQT (SEQ ID
NO: 66) by a single pegylated amino acid including for example a
pegylated lysine or pegylated cysteine amino acid substitution. In
one embodiment the pegylated amino acid is at position 8 of the
linking moiety.
[0672] In one embodiment a peptide sequence named C-terminal
peptide (CTP: SSSSKAPPPSLPSPSRLPGPSDTPILPQR; SEQ ID NO: 52), which
is prone to O-linked hyperglycosylation when the protein is
expressed in a eukaryotic cellular expression system, can be used
as a linker peptide. Surprisingly, applicants have discovered that
the CTP peptide can be used to connect the B and A chains of
insulin to form a single chain insulin analog while still
maintaining high in vitro potency in a manner that the native
proinsulin C-peptide cannot. In one embodiment a FGF21 based
insulin conjugate is prepared comprising an insulin peptide having
the carboxy terminus of the B chain linked to the amino terminus of
the A chain via a CTP peptide. In another embodiment an insulin
analog is provided as a two-chain construct with the CTP covalently
linked to the C-terminus of the B-chain and/or the amino terminus
of the B chain. In vitro and in vivo characterization reveals the
CTP modified insulin analogs to have high potency in the absence of
glycosylation, thus providing a mechanism to extend insulin action
that is based on glycosylation, a natural approach to longer
duration proteins.
[0673] Applicants have discovered that the primary sequence of the
CTP peptide does not appear to be critical. Accordingly, in one
embodiment the linking moiety comprises a peptide having a length
of at least 18 amino acids that shares a similar amino acid
content. In one embodiment the linking moiety comprises an analog
of (SEQ ID NO: 68), wherein said analog differs from (SEQ ID NO:
68) by 1, 2, 3, 4, 5 or 6 amino acid substitutions. In one
embodiment the linking peptide comprises a CTP peptide wherein
amino acid substitutions are made at one or more positions selected
from positions 1, 2, 3, 4, 10, 13, 15, and 21 of (SEQ ID NO: 68).
In one embodiment the linking moiety comprises a 29 contiguous
amino acid sequence, directly linked to the carboxy terminal amino
acid of the B chain, wherein said 29 contiguous amino acid sequence
has greater than 60, 80 or 90% sequence identity to
SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.5i (SEQ ID NO: 68), with
the proviso that the sequence does not comprise a 15 amino acid
sequence identical to a 15 amino acid sequence contained within SEQ
ID NO 53. In another embodiment the linking moiety comprises a 29
contiguous amino acid sequence, directly linked to the carboxy
terminal amino acid of the B chain, wherein at least 58% of the
amino acids comprising the 29 contiguous amino acid sequence are
selected from the group consisting of serine and proline.
[0674] In another embodiment the linking moiety comprises a 29
contiguous amino acid sequence, directly linked to the carboxy
terminal amino acid of the B chain, wherein said 29 contiguous
amino acid sequence has greater than 70%, 80%, 90% sequence
identity to SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.5i (SEQ ID NO:
68), wherein X.sub.50 and X.sub.51 are independently selected from
arginine and lysine, with the proviso that the sequence does not
comprise a 15 amino acid sequence identical to a 15 amino acid
sequence contained within SEQ ID NO 53. In another embodiment the
linking moiety comprises a 29 contiguous amino acid sequence,
directly linked to the carboxy terminal amino acid of the B chain,
wherein said 29 contiguous amino acid sequence is an analog of (SEQ
ID NO: 52), wherein said analog differs from (SEQ ID NO: 52) only
by 1, 2, 3, 4, 5 or 6 amino acid modification, and in a further
embodiment the amino acid modifications are conservative amino acid
substitutions. In another embodiment the linking moiety comprises a
29 contiguous amino acid sequence, directly linked to the carboxy
terminal amino acid of the B chain, wherein said 29 contiguous
amino acid sequence is an analog of (SEQ ID NO: 52), wherein said
analog differs from (SEQ ID NO: 52) only by 1, 2 or 3 amino acid
substitutions.
[0675] Applicants have also found that multiple copies of the CTP
peptide can be used as the linking peptide in single chain analogs
and/or linked to the amino terminus of the B chain in single chain
or two chain insulin analogs. The multiple copies of the CTP
peptide can be identical or can differ in sequence and can be
arranged in a head to tail or head to head orientation. In
accordance with one embodiment an insulin analog is provided
comprising a CTP peptide having the sequence
(SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.51).sub.n(SEQ ID NO: 68),
wherein n is an integer selected from the group consisting of 1, 2,
3 and 4 and X.sub.50 and X.sub.51 are independently selected from
arginine and lysine.
[0676] In one embodiment the CTP peptide comprises the sequence
SSSSX.sub.50APPPSLPSPSRLPGPSDTPILPQX.sub.51 (SEQ ID NO: 68),
wherein X.sub.50 and X.sub.51 are independently selected from
arginine and lysine. In another embodiment the CTP peptide
comprises a sequence selected from the group consisting of
SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51),
SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) or
SSSSRAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 67), and in a further
embodiment the CTP peptide comprises the sequence
SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51).
[0677] Structure of L
[0678] In some embodiments, L is a bond. In these embodiments, Q
and Y are conjugated together by reacting a nucleophilic reactive
moiety on Q with and electrophilic reactive moiety on Y. In
alternative embodiments, Q and Y are conjugated together by
reacting an electrophilic reactive moiety on Q with a nucleophilic
moiety on Y. In exemplary embodiments, L is an amide bond that
forms upon reaction of an amine on Q (e.g. an .epsilon.-amine of a
lysine residue) with a carboxyl group on Y. In alternative
embodiments, Q and or Y are derivatized with a derivatizing agent
before conjugation.
[0679] In some embodiments, L is a linking group. In some
embodiments, L is a bifunctional linker and comprises only two
reactive groups before conjugation to Q and Y. In embodiments where
both Q and Y have electrophilic reactive groups, L comprises two of
the same or two different nucleophilic groups (e.g. amine,
hydroxyl, thiol) before conjugation to Q and Y. In embodiments
where both Q and Y have nucleophilic reactive groups, L comprises
two of the same or two different electrophilic groups (e.g.
carboxyl group, activated form of a carboxyl group, compound with a
leaving group) before conjugation to Q and Y. In embodiments where
one of Q or Y has a nucleophilic reactive group and the other of Q
or Y has an electrophilic reactive group, L comprises one
nucleophilic reactive group and one electrophilic group before
conjugation to Q and Y.
[0680] L can be any molecule with at least two reactive groups
(before conjugation to Q and Y) capable of reacting with each of Q
and Y. In some embodiments L has only two reactive groups and is
bifunctional. L (before conjugation to the peptides) can be
represented by Formula VI:
##STR00047##
[0681] wherein W and J are independently nucleophilic or
electrophilic reactive groups. In some embodiments W and J are
either both nucleophilic groups or both electrophilic groups. In
some embodiments one of W or J is a nucleophilic group and the
other of W or J is an electrophilic group.
[0682] In some embodiments, L comprises a chain of atoms from 1 to
about 60, or 1 to 30 atoms or longer, 2 to 5 atoms, 2 to 10 atoms,
5 to 10 atoms, or 10 to 20 atoms long. In some embodiments, the
chain atoms are all carbon atoms. In some embodiments, the chain
atoms in the backbone of the linker are selected from the group
consisting of C, O, N, and S. Chain atoms and linkers may be
selected according to their expected solubility (hydrophilicity) so
as to provide a more soluble conjugate. In some embodiments, L
provides a functional group that is subject to cleavage by an
enzyme or other catalyst or hydrolytic conditions found in the
target tissue or organ or cell. In some embodiments, the length of
L is long enough to reduce the potential for steric hindrance.
[0683] In some embodiments, the linking group is hydrophilic such
as, for example, polyalkylene glycol. Before conjugation to the
peptides of the composition, the hydrophilic linking group
comprises at least two reactive groups (W and J), as described
herein and as shown below:
##STR00048##
[0684] In specific embodiments, the linking group is polyethylene
glycol (PEG). The PEG in certain embodiments has a molecular weight
of about 100 Daltons to about 10,000 Daltons, e.g. about 500
Daltons to about 5000 Daltons. The PEG in some embodiments has a
molecular weight of about 10,000 Daltons to about 40,000
Daltons.
[0685] In some embodiments, the hydrophilic linking group comprises
either a maleimido or an iodoacetyl group and either a carboxylic
acid or an activated carboxylic acid (e.g. NHS ester) as the
reactive groups. In these embodiments, the maleimido or iodoacetyl
group can be coupled to a thiol moiety on Q or Y and the carboxylic
acid or activated carboxylic acid can be coupled to an amine on Q
or Y with or without the use of a coupling reagent. Any appropriate
coupling agent known to one skilled in the art can be used to
couple the carboxylic acid with the amine. In some embodiments, the
linking group is maleimido-PEG(20 kDa)-COOH, iodoacetyl-PEG(20
kDa)-COOH, maleimido-PEG(20 kDa)-NHS, or iodoacetyl-PEG(20
kDa)-NHS.
[0686] In some embodiments, the linking group is comprised of an
amino acid, a dipeptide, a tripeptide, or a polypeptide, wherein
the amino acid, dipeptide, tripeptide, or polypeptide comprises at
least two activating groups, as described herein. In some
embodiments, the linking group (L) comprises a moiety selected from
the group consisting of: amino, ether, thioether, maleimido,
disulfide, amide, ester, thioester, alkene, cycloalkene, alkyne,
trizoyl, carbamate, carbonate, cathepsin B-cleavable, and
hydrazone. In some embodiments, the linking group is an amino acid
selected from the group Asp, Glu, homoglutamic acid, homocysteic
acid, cysteic acid, gamma-glutamic acid. In some embodiments, the
linking group is a dipeptide selected from the group consisting of:
Ala-Ala, .beta.-Ala-.beta.-Ala, Leu-Leu, Pro-Pro,
.gamma.-aminobutyric acid-.gamma.-aminobutyric acid, and
.gamma.-Glu-.gamma.-Glu. In one embodiment L comprises
gamma-glutamic acid.
[0687] In embodiments where Q and Y are conjugated together by
reacting a carboxylic acid with an amine, an activating agent can
be used to form an activated ester of the carboxylic acid. The
activated ester of the carboxylic acid can be, for example,
N-hydroxysuccinimide (NHS), tosylate (Tos), mesylate, triflate, a
carbodiimide, or a hexafluorophosphate. In some embodiments, the
carbodiimide is 1,3-dicyclohexylcarbodiimide (DCC),
1,1'-carbonyldiimidazole (CDI),
1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (EDC),
or 1,3-diisopropylcarbodiimide (DICD). In some embodiments, the
hexafluorophosphate is selected from a group consisting of
hexafluorophosphate
benzotriazol-1-yl-oxy-tris(dimethylamino)phosphonium
hexafluorophosphate (BOP),
benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate
(PyBOP), 2-(1H-7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyl uronium
hexafluorophosphate (HATU), and
o-benzotriazole-N,N,N',N'-tetramethyl-uronium-hexafluoro-phosphate
(HBTU).
[0688] In some embodiments, Q comprises a nucleophilic reactive
group (e.g. the amino group, thiol group, or hydroxyl group of the
side chain of lysine, cysteine or serine) that is capable of
conjugating to an electrophilic reactive group on Y or L. In some
embodiments, Q comprises an electrophilic reactive group (e.g. the
carboxylate group of the side chain of Asp or Glu) that is capable
of conjugating to a nucleophilic reactive group on Y or L. In some
embodiments, Q is chemically modified to comprise a reactive group
that is capable of conjugating directly to Y or to L. In some
embodiments, Q is modified at the C-terminal to comprise a natural
or nonnatural amino acid with a nucleophilic side chain, such as an
amino acid represented by Formula I, Formula II, or Formula III, as
previously described herein (see Acylation and alkylation). In
exemplary embodiments, the C-terminal amino acid of Q is selected
from the group consisting of lysine, ornithine, serine, cysteine,
and homocysteine. For example, the C-terminal amino acid of Q can
be modified to comprise a lysine residue. In some embodiments, Q is
modified at the C-terminal amino acid to comprise a natural or
nonnatural amino acid with an electrophilic side chain such as, for
example, Asp and Glu. In some embodiments, an internal amino acid
of Q is substituted with a natural or nonnatural amino acid having
a nucleophilic side chain, such as an amino acid represented by
Formula I, Formula II, or Formula III, as previously described
herein (see Acylation and alkylation). In exemplary embodiments,
the internal amino acid of Q that is substituted is selected from
the group consisting of lysine, ornithine, serine, cysteine, and
homocysteine. For example, an internal amino acid of Q can be
substituted with a lysine residue. In some embodiments, an internal
amino acid of Q is substituted with a natural or nonnatural amino
acid with an electrophilic side chain, such as, for example, Asp
and Glu.
[0689] In some embodiments, Y comprises a reactive group that is
capable of conjugating directly to Q or to L. In some embodiments,
Y comprises a nucleophilic reactive group (e.g. amine, thiol,
hydroxyl) that is capable of conjugating to an electrophilic
reactive group on Q or L. In some embodiments, Y comprises
electrophilic reactive group (e.g. carboxyl group, activated form
of a carboxyl group, compound with a leaving group) that is capable
of conjugating to a nucleophilic reactive group on Q or L.
[0690] Stability of L In Vivo
[0691] In some embodiments, L is stable in vivo. In some
embodiments, L is stable in blood serum for at least 5 minutes,
e.g. less than 25%, 20%, 15%, 10% or 5% of the conjugate is cleaved
when incubated in serum for a period of 5 minutes. In other
embodiments, L is stable in blood serum for at least 10, or 20, or
25, or 30, or 60, or 90, or 120 minutes, or 3, 4, 5, 6, 7, 8, 9,
10, 12, 15, 18 or 24 hours. In these embodiments, L does not
comprise a functional group that is capable of undergoing
hydrolysis in vivo. In some exemplary embodiments, L is stable in
blood serum for at least about 72 hours. Nonlimiting examples of
functional groups that are not capable of undergoing significant
hydrolysis in vivo include amides, ethers, and thioethers. For
example, the following compound is not capable of undergoing
significant hydrolysis in vivo:
##STR00049##
[0692] In some embodiments, L is hydrolyzable in vivo. In these
embodiments, L comprises a functional group that is capable of
undergoing hydrolysis in vivo. Nonlimiting examples of functional
groups that are capable of undergoing hydrolysis in vivo include
esters, anhydrides, and thioesters. For example the following
compound is capable of undergoing hydrolysis in vivo because it
comprises an ester group:
##STR00050##
[0693] In some exemplary embodiments L is labile and undergoes
substantial hydrolysis within 3 hours in blood plasma at 37.degree.
C., with complete hydrolysis within 6 hours. In some exemplary
embodiments, L is not labile.
[0694] In some embodiments, L is metastable in vivo. In these
embodiments, L comprises a functional group that is capable of
being chemically or enzymatically cleaved in vivo (e.g., an
acid-labile, reduction-labile, or enzyme-labile functional group),
optionally over a period of time. In these embodiments, L can
comprise, for example, a hydrazone moiety, a disulfide moiety, or a
cathepsin-cleavable moiety. When L is metastable, and without
intending to be bound by any particular theory, the Q-L-Y conjugate
is stable in an extracellular environment, e.g., stable in blood
serum for the time periods described above, but labile in the
intracellular environment or conditions that mimic the
intracellular environment, so that it cleaves upon entry into a
cell. In some embodiments when L is metastable, L is stable in
blood serum for at least about 24, 25, 26, 27, 28, 29, 30, 31, 32,
33, 34, 35, 36, 42, or 48 hours, for example, at least about 48,
54, 60, 66, or 72 hours, or about 24-48, 48-72, 24-60, 36-48,
36-72, or 48-72 hours.
[0695] Pegylation of Insulin Peptides
[0696] Applicants have discovered that covalent linkage of a
hydrophilic moiety to the insulin analogs disclosed herein provide
analogs having slower onset, extended duration and exhibit a basal
profile of activity. In one embodiment, the insulin peptides
disclosed herein are further modified to comprise a hydrophilic
moiety covalently linked to the side chain of an amino acid at a
position selected from the group consisting of A9, A14 and A15 of
the A chain or at the N-terminal alpha amine of the B chain (e.g.
at position B1 for insulin based B chain or position B2 for IGF-1
based B chain) or at the side chain of an amino acid at position
B1, B2, B10, B22, B28 or B29 of the B chain or at any position of
the linking moiety that links the A chain and B chain. In exemplary
embodiments, this hydrophilic moiety is covalently linked to a Lys,
Cys, Orn, homocysteine, or acetyl-phenylalanine residue at any of
these positions. In one embodiment the hydrophilic moiety is
covalently linked to the side chain of an amino acid of the linking
moiety.
[0697] Exemplary hydrophilic moieties include polyethylene glycol
(PEG), for example, of a molecular weight of about 1,000 Daltons to
about 40,000 Daltons, or about 20,000 Daltons to about 40,000
Daltons. Additional suitable hydrophilic moieties include,
polypropylene glycol, polyoxyethylated polyols (e.g., POG),
polyoxyethylated sorbitol, polyoxyethylated glucose,
polyoxyethylated glycerol (POG), polyoxyalkylenes, polyethylene
glycol propionaldehyde, copolymers of ethylene glycol/propylene
glycol, monomethoxy-polyethylene glycol, mono-(C1-C10) alkoxy- or
aryloxy-polyethylene glycol, carboxymethylcellulose, polyacetals,
polyvinyl alcohol (PVA), polyvinyl pyrrolidone, poly-1,
3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride
copolymer, poly (beta-amino acids) (either homopolymers or random
copolymers), poly(n-vinyl pyrrolidone)polyethylene glycol,
propropylene glycol homopolymers (PPG) and other polyakylene
oxides, polypropylene oxide/ethylene oxide copolymers, colonic
acids or other polysaccharide polymers, Ficoll or dextran and
mixtures thereof.
[0698] Hydrophilic moieties such as polyethylene glycol can be
attached to the FGF21 based conjugates of the present disclosure
under any suitable conditions used to react a protein with an
activated polymer molecule. Any means known in the art can be used,
including via acylation, reductive alkylation, Michael addition,
thiol alkylation or other chemoselective conjugation/ligation
methods through a reactive group on the PEG moiety (e.g., an
aldehyde, amino, ester, thiol, .alpha.-haloacetyl, maleimido or
hydrazino group) to a reactive group on the target compound (e.g.,
an aldehyde, amino, ester, thiol, .alpha.-haloacetyl, maleimido or
hydrazino group). Activating groups which can be used to link the
water soluble polymer to one or more proteins include without
limitation sulfone, maleimide, sulfhydryl, thiol, triflate,
tresylate, azidirine, oxirane and 5-pyridyl. If attached to the
peptide by reductive alkylation, the polymer selected should have a
single reactive aldehyde so that the degree of polymerization is
controlled. See, for example, Kinstler et al., Adv. Drug. Delivery
Rev. 54: 477-485 (2002); Roberts et al., Adv. Drug Delivery Rev.
54: 459-476 (2002); and Zalipsky et al., Adv. Drug Delivery Rev.
16: 157-182 (1995).
[0699] Acylation
[0700] In some embodiments, the FGF21 based conjugate is modified
to comprise an acyl group. The acyl group can be covalently linked
directly to an amino acid of the bioactive component of the
conjugate (ie., the NHR ligand or the insulin component of
conjugate), or indirectly to an amino acid of the NHR ligand or
insulin peptide via a spacer, wherein the spacer is positioned
between the amino acid of the bioactive component of the conjugate
and the acyl group. The conjugate may be acylated at the same amino
acid position where a hydrophilic moiety is linked, or at a
different amino acid position. For example, acylation may occur at
any position including any of amino acid of the conjugate, provided
that the activity exhibited by the non-acylated conjugate is
retained upon acylation.
[0701] In one specific aspect of the invention, an FGF21 based
insulin conjugate is modified to comprise an acyl group by direct
acylation of an amine, hydroxyl, or thiol of a side chain of an
amino acid of the FGF21 based insulin conjugate. In some
embodiments, the conjugate is directly acylated through the side
chain amine, hydroxyl, or thiol of an amino acid. In some
embodiments, acylation is at position B28 or B29 of the insulin
moiety of the conjugate (according to the amino acid numbering of
the native insulin A and B chain sequences). In this regard, an
insulin analog can be provided that has been modified by one or
more amino acid substitutions in the A or B chain sequence,
including for example at positions A14, A15, B1, B2, B10, B22, B28
or B29 (according to the amino acid numbering of the native insulin
A and B chain sequences) or at any position of the linking moiety
with an amino acid comprising a side chain amine, hydroxyl, or
thiol. In some specific embodiments of the invention, the direct
acylation of the insulin peptide occurs through the side chain
amine, hydroxyl, or thiol of the amino acid at position B28 or B29
(according to the amino acid numbering of the native insulin A and
B chain sequences).
[0702] In accordance with one embodiment, the acylated conjugates
comprise a spacer between the peptide and the acyl group. In some
embodiments, the FGF21 based conjugate is covalently bound to the
spacer, which is covalently bound to the acyl group. In some
exemplary embodiments, the conjugate is modified to comprise an
acyl group by acylation of an amine, hydroxyl, or thiol of a
spacer, which spacer is attached to a side chain of an amino acid
of the conjugate. The amino acid of the FGF21 based conjugate to
which the spacer is attached can be any amino acid comprising a
moiety which permits linkage to the spacer. For example, an amino
acid comprising a side chain --NH.sub.2, --OH, or --COOH (e.g.,
Lys, Orn, Ser, Asp, or Glu) is suitable.
[0703] In some embodiments, the spacer between the FGF21 based
conjugate and the acyl group is an amino acid comprising a side
chain amine, hydroxyl, or thiol (or a dipeptide or tripeptide
comprising an amino acid comprising a side chain amine, hydroxyl,
or thiol). In some embodiments, the spacer comprises a hydrophilic
bifunctional spacer. In a specific embodiment, the spacer comprises
an amino poly(alkyloxy)carboxylate. In this regard, the spacer can
comprise, for example,
NH.sub.2(CH.sub.2CH.sub.2O).sub.n(CH.sub.2).sub.mCOOH, wherein m is
any integer from 1 to 6 and n is any integer from 2 to 12, such as,
e.g., 8-amino-3,6-dioxaoctanoic acid, which is commercially
available from Peptides International, Inc. (Louisville, Ky.). In
one embodiment, the hydrophilic bifunctional spacer comprises two
or more reactive groups, e.g., an amine, a hydroxyl, a thiol, and a
carboxyl group or any combinations thereof. In certain embodiments,
the hydrophilic bifunctional spacer comprises a hydroxyl group and
a carboxylate. In other embodiments, the hydrophilic bifunctional
spacer comprises an amine group and a carboxylate. In other
embodiments, the hydrophilic bifunctional spacer comprises a thiol
group and a carboxylate.
[0704] In some embodiments, the spacer between peptide the FGF21
based conjugate and the acyl group is a hydrophobic bifunctional
spacer. Hydrophobic bifunctional spacers are known in the art. See,
e.g., Bioconjugate Techniques, G. T. Hermanson (Academic Press, San
Diego, Calif., 1996), which is incorporated by reference in its
entirety. In accordance with certain embodiments the bifunctional
spacer can be a synthetic or naturally occurring amino acid
comprising an amino acid backbone that is 3 to 10 atoms in length
(e.g., 6-amino hexanoic acid, 5-aminovaleric acid, 7-aminoheptanoic
acid, and 8-aminooctanoic acid). Alternatively, the spacer can be a
dipeptide or tripeptide spacer having a peptide backbone that is 3
to 10 atoms (e.g., 6 to 10 atoms) in length. Each amino acid of the
dipeptide or tripeptide spacer attached to the FGF21 based insulin
conjugate can be independently selected from the group consisting
of: naturally-occurring and/or non-naturally occurring amino acids,
including, for example, any of the D or L isomers of the
naturally-occurring amino acids (Ala, Cys, Asp, Glu, Phe, Gly, His,
Ile, Lys, Leu, Met, Asn, Pro, Arg, Ser, Thr, Val, Trp, Tyr), or any
D or L isomers of the non-naturally occurring amino acids selected
from the group consisting of: .beta.-alanine (.beta.-Ala),
N-.alpha.-methyl-alanine (Me-Ala), aminobutyric acid (Abu),
.alpha.-aminobutyric acid (.gamma.-Abu), aminohexanoic acid
(.epsilon.-Ahx), aminoisobutyric acid (Aib), aminomethylpyrrole
carboxylic acid, aminopiperidinecarboxylic acid, aminoserine (Ams),
aminotetrahydropyran-4-carboxylic acid, arginine N-methoxy-N-methyl
amide, .beta.-aspartic acid (.beta.-Asp), azetidine carboxylic
acid, 3-(2-benzothiazolyl)alanine, .alpha.-tert-butylglycine,
2-amino-5-ureido-n-valeric acid (citrulline, Cit),
.beta.-Cyclohexylalanine (Cha), acetamidomethyl-cysteine,
diaminobutanoic acid (Dab), diaminopropionic acid (Dpr),
dihydroxyphenylalanine (DOPA), dimethylthiazolidine (DMTA),
.gamma.-Glutamic acid (.gamma.-Glu), homoserine (Hse),
hydroxyproline (Hyp), isoleucine N-methoxy-N-methyl amide,
methyl-isoleucine (MeIle), isonipecotic acid (Isn), methyl-leucine
(MeLeu), methyl-lysine, dimethyl-lysine, trimethyl-lysine,
methanoproline, methionine-sulfoxide (Met(O)), methionine-sulfone
(Met(O2)), norleucine (Nle), methyl-norleucine (Me-Nle), norvaline
(Nva), ornithine (Orn), para-aminobenzoic acid (PABA),
penicillamine (Pen), methylphenylalanine (MePhe),
4-Chlorophenylalanine (Phe(4-Cl)), 4-fluorophenylalanine
(Phe(4-F)), 4-nitrophenylalanine (Phe(4-NO2)), 4-cyanophenylalanine
((Phe(4-CN)), phenylglycine (Phg), piperidinylalanine,
piperidinylglycine, 3,4-dehydroproline, pyrrolidinylalanine,
sarcosine (Sar), selenocysteine (Sec), U-Benzyl-phosphoserine,
4-amino-3-hydroxy-6-methylheptanoic acid (Sta),
4-amino-5-cyclohexyl-3-hydroxypentanoic acid (ACHPA),
4-amino-3-hydroxy-5-phenylpentanoic acid (AHPPA),
1,2,3,4,-tetrahydro-isoquinoline-3-carboxylic acid (Tic),
tetrahydropyranglycine, thienylalanine (Thi),
U-Benzyl-phosphotyrosine, O-Phosphotyrosine, methoxytyrosine,
ethoxytyrosine, O-(bis-dimethylamino-phosphono)-tyrosine, tyrosine
sulfate tetrabutylamine, methyl-valine (MeVal),
1-amino-1-cyclohexane carboxylic acid (Acx), aminovaleric acid,
beta-cyclopropyl-alanine (Cpa), propargylglycine (Prg),
allylglycine (Alg), 2-amino-2-cyclohexyl-propanoic acid (2-Cha),
tertbutylglycine (Tbg), vinylglycine (Vg), 1-amino-1-cyclopropane
carboxylic acid (Acp), 1-amino-1-cyclopentane carboxylic acid
(Acpe), alkylated 3-mercaptopropionic acid, 1-amino-1-cyclobutane
carboxylic acid (Acb). In some embodiments the dipeptide spacer is
selected from the group consisting of: Ala-Ala,
.beta.-Ala-.beta.-Ala, Leu-Leu, Pro-Pro, .gamma.-aminobutyric
acid-.gamma.-aminobutyric acid, and .gamma.-Glu-.gamma.-Glu.
[0705] The FGF21 based conjugate can be modified to comprise an
acyl group by acylation of a long chain alkane of any size and can
comprise any length of carbon chain. The long chain alkane can be
linear or branched. In certain aspects, the long chain alkane is a
C.sub.4 to C.sub.30 alkane. For example, the long chain alkane can
be any of a C.sub.4 alkane, C.sub.6 alkane, C.sub.8 alkane,
C.sub.10 alkane, C.sub.12 alkane, C.sub.14 alkane, C.sub.16 alkane,
C.sub.18 alkane, C.sub.20 alkane, C.sub.22 alkane, C.sub.24 alkane,
C.sub.26 alkane, C.sub.28 alkane, or a C.sub.30 alkane. In some
embodiments, the long chain alkane comprises a C.sub.8 to C.sub.20
alkane, e.g., a C.sub.14 alkane, C.sub.16 alkane, or a C.sub.18
alkane.
[0706] In some embodiments, an amine, hydroxyl, or thiol group of
the FGF21 based conjugate is acylated with a cholesterol acid. In a
specific embodiment, the peptide is linked to the cholesterol acid
through an alkylated des-amino Cys spacer, i.e., an alkylated
3-mercaptopropionic acid spacer. Suitable methods of peptide
acylation via amines, hydroxyls, and thiols are known in the art.
See, for example, Miller, Biochem Biophys Res Commun 218: 377-382
(1996); Shimohigashi and Stammer, Int J Pept Protein Res 19: 54-62
(1982); and Previero et al., Biochim Biophys Acta 263: 7-13 (1972)
(for methods of acylating through a hydroxyl); and San and Silvius,
J Pept Res 66: 169-180 (2005) (for methods of acylating through a
thiol); Bioconjugate Chem. "Chemical Modifications of Proteins:
History and Applications" pages 1, 2-12 (1990); Hashimoto et al.,
Pharmacuetical Res. "Synthesis of Palmitoyl Derivatives of Insulin
and their Biological Activity" Vol. 6, No: 2 pp. 171-1'76
(1989).
[0707] The acyl group of the acylated peptide the FGF21 based
conjugate can be of any size, e.g., any length carbon chain, and
can be linear or branched. In some specific embodiments of the
invention, the acyl group is a C.sub.4 to C.sub.30 fatty acid. For
example, the acyl group can be any of a C.sub.4 fatty acid, C.sub.6
fatty acid, C.sub.8 fatty acid, C.sub.10 fatty acid, C.sub.12 fatty
acid, C.sub.14 fatty acid, C.sub.16 fatty acid, C.sub.18 fatty
acid, C.sub.20 fatty acid, C.sub.22 fatty acid, C.sub.24 fatty
acid, C.sub.26 fatty acid, C.sub.28 fatty acid, or a C.sub.30 fatty
acid. In some embodiments, the acyl group is a C.sub.8 to C.sub.20
fatty acid, e.g., a C.sub.14 fatty acid or a C.sub.16 fatty
acid.
[0708] In an alternative embodiment, the acyl group is a bile acid.
The bile acid can be any suitable bile acid, including, but not
limited to, cholic acid, chenodeoxycholic acid, deoxycholic acid,
lithocholic acid, taurocholic acid, glycocholic acid, and
cholesterol acid.
[0709] Alkylation
[0710] In some embodiments, the FGF21 based conjugate is modified
to comprise an alkyl group. The alkyl group can be covalently
linked directly to an amino acid of the conjugate analog, or
indirectly to an amino acid of the FGF21 based conjugate via a
spacer, wherein the spacer is positioned between the amino acid of
the FGF21 based conjugate and the alkyl group. The alkyl group can
be attached to the FGF21 based conjugate via an ether, thioether,
or amino linkage. For example, the FGF21 based conjugate may be
alkylated at the same amino acid position where a hydrophilic
moiety is linked, or at a different amino acid position.
[0711] Alkylation can be carried out at any position within the
FGF21 based conjugate, including for example in the C-terminal
region of the B chain or at a position in the linking moiety,
provided that FGF activity is retained. In a specific aspect of the
invention, the FGF21 based conjugate is modified to comprise an
alkyl group by direct alkylation of an amine, hydroxyl, or thiol of
a side chain of an amino acid of the FGF21 based conjugate. In some
embodiments, the FGF21 based conjugate is directly alkylated
through the side chain amine, hydroxyl, or thiol of an amino acid.
In some specific embodiments of the invention, the direct
alkylation of an FGF21 based insulin conjugate occurs through the
side chain amine, hydroxyl, or thiol of the amino acid at position
A14, A15, B1 (for insulin based B chains), B2 (for IGF-1 based B
chains), B10, B22, B28 or B29 (according to the amino acid
numbering of the A and B chain of native insulin).
[0712] In some embodiments of the invention, the FGF21 based
conjugate comprises a spacer between the peptide and the alkyl
group. In some embodiments, the FGF21 based conjugate is covalently
bound to the spacer, which is covalently bound to the alkyl group.
In some exemplary embodiments, the FGF21 based conjugate is
modified to comprise an alkyl group by alkylation of an amine,
hydroxyl, or thiol of a spacer, wherein the spacer is attached to a
side chain of an amino acid of the conjugate. The amino acid of the
FGF21 based conjugate to which the spacer is attached can be any
amino acid (e.g., a singly .alpha.-substituted amino acid or an
.alpha.,.alpha.-disubstituted amino acid) comprising a moiety which
permits linkage to the spacer. An amino acid of the FGF21 based
conjugate comprising a side chain --NH.sub.2, --OH, or --COOH
(e.g., Lys, Orn, Ser, Asp, or Glu) is suitable. In some
embodiments, the spacer between the peptide the FGF21 based
conjugate and the alkyl group is an amino acid comprising a side
chain amine, hydroxyl, or thiol or a dipeptide or tripeptide
comprising an amino acid comprising a side chain amine, hydroxyl,
or thiol.
[0713] In the instance in which the alpha amine is alkylated, the
spacer amino acid can be any amino acid. For example, the spacer
amino acid can be a hydrophobic amino acid, e.g., Gly, Ala, Val,
Leu, Ile, Trp, Met, Phe, Tyr. Alternatively, the spacer amino acid
can be an acidic residue, e.g., Asp and Glu. In exemplary
embodiments, the spacer amino acid can be a hydrophobic amino acid,
e.g., Gly, Ala, Val, Leu, Be, Trp, Met, Phe, Tyr, 6-amino hexanoic
acid, 5-aminovaleric acid, 7-aminoheptanoic acid, 8-aminooctanoic
acid. Alternatively, the spacer amino acid can be an acidic
residue, e.g., Asp and Glu, provided that the alkylation occurs on
the alpha amine of the acidic residue. In the instance in which the
side chain amine of the spacer amino acid is alkylated, the spacer
amino acid is an amino acid comprising a side chain amine, e.g., an
amino acid of Formula I (e.g., Lys or Orn). In this instance, it is
possible for both the alpha amine and the side chain amine of the
spacer amino acid to be alkylated, such that the peptide is
dialkylated. Embodiments of the invention include such dialkylated
molecules.
[0714] In some embodiments, the spacer comprises a hydrophilic
bifunctional spacer. In a specific embodiment, the spacer comprises
an amino poly(alkyloxy)carboxylate. In this regard, the spacer can
comprise, for example,
NH.sub.2(CH.sub.2CH.sub.2O).sub.n(CH.sub.2).sub.mCOOH, wherein m is
any integer from 1 to 6 and n is any integer from 2 to 12, such as,
e.g., 8-amino-3,6-dioxaoctanoic acid, which is commercially
available from Peptides International, Inc. (Louisville, Ky.). In
some embodiments, the spacer between peptide the FGF21 based
conjugate and the alkyl group is a hydrophilic bifunctional spacer.
In certain embodiments, the hydrophilic bifunctional spacer
comprises two or more reactive groups, e.g., an amine, a hydroxyl,
a thiol, and a carboxyl group or any combinations thereof. In
certain embodiments, the hydrophilic bifunctional spacer comprises
a hydroxyl group and a carboxylate. In other embodiments, the
hydrophilic bifunctional spacer comprises an amine group and a
carboxylate. In other embodiments, the hydrophilic bifunctional
spacer comprises a thiol group and a carboxylate.
[0715] The spacer (e.g., amino acid, dipeptide, tripeptide,
hydrophilic bifunctional spacer, or hydrophobic bifunctional
spacer) is 3 to 10 atoms (e.g., 6 to 10 atoms, (e.g., 6, 7, 8, 9,
or 10 atoms)) in length. In more specific embodiments, the spacer
is about 3 to 10 atoms (e.g., 6 to 10 atoms) in length and the
alkyl is a C.sub.12 to C.sub.18 alkyl group, e.g., C.sub.14 alkyl
group, C.sub.16 alkyl group, such that the total length of the
spacer and alkyl group is 14 to 28 atoms, e.g., about 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 atoms. In some
embodiments the length of the spacer and alkyl is 17 to 28 (e.g.,
19 to 26, 19 to 21) atoms.
[0716] In accordance with one embodiment the bifunctional spacer is
a synthetic or non-naturally occurring amino acid comprising an
amino acid backbone that is 3 to 10 atoms in length (e.g., 6-amino
hexanoic acid, 5-aminovaleric acid, 7-aminoheptanoic acid, and
8-aminooctanoic acid). Alternatively, the spacer can be a dipeptide
or tripeptide spacer having a peptide backbone that is 3 to 10
atoms (e.g., 6 to 10 atoms) in length. The dipeptide or tripeptide
spacer attached to the FGF21 based conjugate can be composed of
naturally-occurring and/or non-naturally occurring amino acids,
including, for example, any of the amino acids taught herein. In
some embodiments the spacer comprises an overall negative charge,
e.g., comprises one or two negatively charged amino acids. In some
embodiments the dipeptide spacer is selected from the group
consisting of: Ala-Ala, .beta.-Ala-.beta.-Ala, Leu-Leu, Pro-Pro,
.gamma.-aminobutyric acid-.gamma.-aminobutyric acid, and
.gamma.-Glu-.gamma.-Glu. In one embodiment the dipeptide spacer is
.gamma.-Glu-.gamma.-Glu.
[0717] Suitable methods of peptide alkylation via amines,
hydroxyls, and thiols are known in the art. For example, a
Williamson ether synthesis can be used to form an ether linkage
between the insulin peptide and the alkyl group. Also, a
nucleophilic substitution reaction of the peptide with an alkyl
halide can result in any of an ether, thioether, or amino linkage.
The alkyl group of the alkylated peptide the FGF21 based conjugate
can be of any size, e.g., any length carbon chain, and can be
linear or branched. In some embodiments of the invention, the alkyl
group is a C.sub.4 to C.sub.30 alkyl. For example, the alkyl group
can be any of a C.sub.4 alkyl, C.sub.6 alkyl, C.sub.8 alkyl,
C.sub.10 alkyl, C.sub.12 alkyl, C.sub.14 alkyl, C.sub.16 alkyl,
C.sub.18 alkyl, C.sub.20 alkyl, C.sub.22 alkyl, C.sub.24 alkyl,
C.sub.26 alkyl, C.sub.28 alkyl, or a C.sub.30 alkyl. In some
embodiments, the alkyl group is a C.sub.8 to C.sub.20 alkyl, e.g.,
a C.sub.14 alkyl or a C.sub.16 alkyl.
[0718] In some specific embodiments, the alkyl group comprises a
steroid moiety of a bile acid, e.g., cholic acid, chenodeoxycholic
acid, deoxycholic acid, lithocholic acid, taurocholic acid,
glycocholic acid, and cholesterol acid.
[0719] When a long chain alkane is alkylated by the FGF21 based
conjugate or the spacer, the long chain alkane may be of any size
and can comprise any length of carbon chain. The long chain alkane
can be linear or branched. In certain aspects, the long chain
alkane is a C.sub.4 to C.sub.30 alkane. For example, the long chain
alkane can be any of a C.sub.4 alkane, C.sub.6 alkane, C.sub.8
alkane, C.sub.10 alkane, C.sub.12 alkane, C.sub.14 alkane, C.sub.16
alkane, C.sub.18 alkane, C.sub.20 alkane, C.sub.22 alkane, C.sub.24
alkane, C.sub.26 alkane, C.sub.28 alkane, or a C.sub.30 alkane. In
some embodiments the long chain alkane comprises a C.sub.8 to
C.sub.20 alkane, e.g., a C.sub.14 alkane, C.sub.16 alkane, or a
C.sub.18 alkane.
[0720] Also, in some embodiments alkylation can occur between the
insulin analog and a cholesterol moiety. For example, the hydroxyl
group of cholesterol can displace a leaving group on the long chain
alkane to form a cholesterol-insulin peptide product.
[0721] Self Cleaving Dipeptide Element
[0722] In accordance with one embodiment the insulin peptide of the
conjugates disclosed herein are further modified to comprise a self
cleaving dipeptide element. In one embodiment the dipeptide element
comprises the structure U-J, wherein U is an amino acid or a
hydroxyl acid and J is an N-alkylated amino acid. In one embodiment
one or more dipeptide elements are linked to the FGF21 based
insulin conjugate through an amide bond formed through one or more
amino groups selected from the N-terminal amino group of the A or B
chain of the insulin component, or the side chain amino group of an
amino acid present in the conjugate. In accordance with one
embodiment one or more dipeptide elements are linked to the FGF21
based insulin conjugate at an amino group selected from the
N-terminal amino group of the conjugate, or the side chain amino
group of an aromatic amine of a 4-amino-phenylalanine residue
present at a position corresponding to position A19, B16 or B25 of
native insulin, or a side chain of an amino acid of the linking
moiety of a single chain insulin analog.
[0723] In one embodiment the dipeptide prodrug element comprises
the general structure of Formula X:
##STR00051## [0724] wherein [0725] R.sub.1, R.sub.2, R.sub.4 and
R.sub.8 are independently selected from the group consisting of H,
C.sub.1-C.sub.18 alkyl, C.sub.2-C.sub.18 alkenyl, (C.sub.1-C.sub.18
alkyl)OH, (C.sub.1-C.sub.18 alkyl)SH, (C.sub.2-C.sub.3
alkyl)SCH.sub.3, (C.sub.1-C.sub.4 alkyl)CONH.sub.2,
(C.sub.1-C.sub.4 alkyl)COOH, (C.sub.1-C.sub.4 alkyl)NH.sub.2,
(C.sub.1-C.sub.4 alkyl)NHC(NH.sub.2.sup.+)NH.sub.2,
(C.sub.0-C.sub.4 alkyl)(C.sub.3-C.sub.6 cycloalkyl),
(C.sub.0-C.sub.4 alkyl)(C.sub.2-C.sub.5 heterocyclic),
(C.sub.0-C.sub.4 alkyl)(C.sub.6-C.sub.10 aryl)R.sub.7,
(C.sub.1-C.sub.4 alkyl)(C.sub.3-C.sub.9 heteroaryl), and
C.sub.1-C.sub.12 alkyl(W)C.sub.1-C.sub.12 alkyl, wherein W is a
heteroatom selected from the group consisting of N, S and O, or
R.sub.1 and R.sub.2 together with the atoms to which they are
attached form a C.sub.3-C.sub.12 cycloalkyl or aryl; or R.sub.4 and
R.sub.8 together with the atoms to which they are attached form a
C.sub.3-C.sub.6 cycloalkyl; [0726] R.sub.3 is selected from the
group consisting of C.sub.1-C.sub.18 alkyl, (C.sub.1-C.sub.18
alkyl)OH, (C.sub.1-C.sub.18 alkyl)NH.sub.2, (C.sub.1-C.sub.18
alkyl)SH, (C.sub.0-C.sub.4 alkyl)(C.sub.3-C.sub.6)cycloalkyl,
(C.sub.0-C.sub.4 alkyl)(C.sub.2-C.sub.5 heterocyclic),
(C.sub.0-C.sub.4 alkyl)(C.sub.6--C.sub.10 aryl)R.sub.7, and
(C.sub.1-C.sub.4 alkyl)(C.sub.3-C.sub.9 heteroaryl) or R.sub.4 and
R.sub.3 together with the atoms to which they are attached form a
4, 5 or 6 member heterocyclic ring; [0727] R.sub.5 is NHR.sub.6 or
OH; [0728] R.sub.6 is H, C.sub.1-C.sub.8 alkyl or R.sub.6 and
R.sub.2 together with the atoms to which they are attached form a
4, 5 or 6 member heterocyclic ring; and [0729] R.sub.7 is selected
from the group consisting of H and OH. In one embodiment when the
prodrug element is linked to the N-terminal amine of the FGF21
based insulin conjugate and R.sub.4 and R.sub.3 together with the
atoms to which they are attached form a 4, 5 or 6 member
heterocyclic ring, then at least one of R.sub.1 and R.sub.2 are
other than H.
[0730] In one embodiment a complex is provided comprising the
general structure A-B-Y A-B-(Q-L-Y), wherein Y represents any of
the FGF21 analogs as described elsewhere in this disclosure, Q-L-Y
comprises any of the conjugates as described elsewhere in this
disclosure and A-B is a dipeptide that is linked via an amide bond
to an amine of Y or the Q-L-Y conjugate. In one embodiment A-B is
linked to amine present on the insulin peptide of an FGF21 analog
insulin conjugate. In one embodiment A-B is linked to the
N-terminal alpha amine of the A or B chain of the insulin peptide
of the FGF21 analog conjugate.
[0731] In one embodiment the dipeptide A-B (having the structure of
Formula IV) is covalently linked to the alpha amine of an FGF21
analog comprising the sequence of SEQ ID NO: 192, SEQ ID NO: 193,
SEQ ID NO: 204, SEQ ID NO: 205, SEQ ID NO: 247, SEQ ID NO: 248, SEQ
ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 251 and SEQ ID NO: 252.
[0732] In one embodiment, a complex of the structure A-B-(Q-L-Y) is
provided, wherein Q-L-Y comprises any of the structures as
described elsewhere in this disclosure and wherein
[0733] A is an amino acid or a hydroxy acid;
[0734] B is an N-alkylated amino acid linked to Q through an amide
bond between a carboxyl moiety of B and an amine of Q; and
[0735] A-B comprises the structure:
##STR00052##
[0736] wherein [0737] (a) R.sup.1, R.sup.2, R.sup.4 and R.sup.8 are
independently selected from the group consisting of H, C1-C18
alkyl, C2-C18 alkenyl, (C1-C18 alkyl)OH, (C1-C18 alkyl)SH, (C2-C3
alkyl)SCH.sub.3, (C1-C4 alkyl)CONH.sub.2, (C1-C4 alkyl)COOH, (C1-C4
alkyl)NH.sub.2, (C1-C4 alkyl)NHC(NH.sub.2.sup.+)NH.sub.2, (C0-C4
alkyl)(C3-C6 cycloalkyl), (C0-C4 alkyl)(C2-C5 heterocyclic), (C0-C4
alkyl)(C6-C10 aryl)R.sup.7, (C1-C4 alkyl)(C3-C9 heteroaryl), and
C1-C12 alkyl(W1)C1-C12 alkyl, wherein W1 is a heteroatom selected
from the group consisting of N, S and O, or [0738] (ii) R.sup.1 and
R.sup.2 together with the atoms to which they are attached form a
C3-C12 cycloalkyl or aryl; or [0739] (iii) R.sup.4 and R.sup.8
together with the atoms to which they are attached form a C3-C6
cycloalkyl; [0740] (b) R.sup.3 is selected from the group
consisting of C1-C18 alkyl, (C1-C18 alkyl)OH, (C1-C18
alkyl)NH.sub.2, (C1-C18 alkyl)SH, (C0-C4 alkyl)(C3-C6)cycloalkyl,
(C0-C4 alkyl)(C2-C5 heterocyclic), (C0-C4 alkyl)(C6-C10
aryl)R.sup.7, and (C1-C4 alkyl)(C3-C9 heteroaryl) or R.sup.4 and
R.sup.3 together with the atoms to which they are attached form a
4, 5 or 6 member heterocyclic ring; [0741] (c) R.sup.5 is NHR.sup.6
or OH; [0742] (d) R.sup.6 is H, C.sub.1-C.sub.8 alkyl; and [0743]
(e) R.sup.7 is selected from the group consisting of H and OH
[0744] wherein the chemical cleavage half-life (t.sub.1/2) of A-B
from Q or Y is at least about 1 hour to about 1 week in PBS under
physiological conditions.
[0745] In a further embodiment, A-B comprises the structure:
##STR00053##
[0746] wherein [0747] R.sub.1 and R.sub.8 are independently H or
C.sub.1-C.sub.8 alkyl; [0748] R.sub.2 and R.sub.4 are independently
selected from the group consisting of H, C.sub.1-C.sub.8 alkyl,
(C.sub.1-C.sub.4 alkyl)OH, (C.sub.1-C.sub.4 alkyl)SH,
(C.sub.2-C.sub.3 alkyl)SCH.sub.3, (C.sub.1-C.sub.4
alkyl)CONH.sub.2, (C.sub.1-C.sub.4 alkyl)COOH, (C.sub.1-C.sub.4
alkyl)NH.sub.2, and (C.sub.1-C.sub.4 alkyl)(C.sub.6 aryl)R.sub.7;
[0749] R.sub.3 is C.sub.1-C.sub.6 alkyl; [0750] R.sub.5 is
NH.sub.2; and [0751] R.sub.7 is selected from the group consisting
of hydrogen, and OH.
[0752] In a further embodiment, A-B comprises the structure:
##STR00054##
[0753] wherein [0754] R.sub.1 is H; [0755] R.sub.2 is H,
C.sub.1-C.sub.4 alkyl, (CH.sub.2 alkyl)OH, (C.sub.1-C.sub.4
alkyl)NH.sub.2, or (CH.sub.2)(C.sub.6 aryl)R.sub.7; [0756] R.sub.3
is C.sub.1-C.sub.6 alkyl; [0757] R.sub.4 is H, C.sub.1-C.sub.4
alkyl, or (CH.sub.2)(C.sub.6 aryl)R.sub.7; [0758] R.sub.5 is
NH.sub.2; [0759] R.sub.8 is hydrogen; and [0760] R.sub.7 is H or
OH.
[0761] In a further embodiment, A-B comprises the structure:
##STR00055##
[0762] wherein [0763] R.sub.1 is H or C.sub.1-C.sub.4 alkyl; [0764]
R.sub.2 is H, C.sub.1-C.sub.4 alkyl, or (C.sub.1-C.sub.4
alkyl)NH.sub.2; [0765] R.sub.3 is C.sub.1-C.sub.6 alkyl; [0766]
R.sub.4 is H, or C.sub.1-C.sub.4 alkyl; [0767] R.sub.5 is NH.sub.2;
and [0768] R.sub.8 is hydrogen.
[0769] Pharmaceutical compositions comprising the FGF21 based
conjugates disclosed herein can be formulated and administered to
patients using standard pharmaceutically acceptable carriers and
routes of administration known to those skilled in the art.
Accordingly, the present disclosure also encompasses pharmaceutical
compositions comprising one or more of the FGF21 based conjugates
disclosed herein or a pharmaceutically acceptable salt thereof, in
combination with a pharmaceutically acceptable carrier. In one
embodiment the pharmaceutical composition comprises a 1 mg/ml
concentration of the FGF21 based conjugate at a pH of about 4.0 to
about 7.0 in a phosphate buffer system. The pharmaceutical
compositions may comprise the FGF21 based conjugate as the sole
pharmaceutically active component, or the FGF21 based conjugate
peptide can be combined with one or more additional active
agents.
[0770] All therapeutic methods, pharmaceutical compositions, kits
and other similar embodiments described herein contemplate that
FGF21 based conjugate peptides include all pharmaceutically
acceptable salts thereof.
[0771] In one embodiment the kit is provided with a device for
administering the FGF21 based conjugate to a patient. The kit may
further include a variety of containers, e.g., vials, tubes,
bottles, and the like. Preferably, the kits will also include
instructions for use. In accordance with one embodiment the device
of the kit is an aerosol dispensing device, wherein the composition
is prepackaged within the aerosol device. In another embodiment the
kit comprises a syringe and a needle, and in one embodiment the
FGF21 based conjugate composition is prepackaged within the
syringe.
[0772] The compounds of this invention may be prepared by standard
synthetic methods, recombinant DNA techniques, or any other methods
of preparing peptides and fusion proteins. Although certain
non-natural amino acids cannot be expressed by standard recombinant
DNA techniques, techniques for their preparation are known in the
art. Compounds of this invention that encompass non-peptide
portions may be synthesized by standard organic chemistry
reactions, in addition to standard peptide chemistry reactions when
applicable.
Exemplary Embodiments
Embodiment 1
[0773] A peptide exhibiting antagonist activity against Klotho (3,
said peptide comprising an amino acid sequence of
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5SX.sub.7DPX.sub.10X.sub.11X.sub.12VX.s-
ub.14GX.sub.16X.sub.17X.sub.18X.sub.19RSPSX.sub.24X.sub.25X.sub.26
(SEQ ID NO: 235),
[0774] wherein
[0775] X.sub.1 is Pro or absent;
[0776] X.sub.2 is Pro or Leu;
[0777] X.sub.3 is Asp or Glu;
[0778] X.sub.4 is Val or Thr;
[0779] X.sub.5 is Gly, Asp, Phe, Leu or Ser;
[0780] X.sub.7 is Ser or Met;
[0781] X.sub.10 is Leu or Phe;
[0782] X.sub.11 is Ser or Gly;
[0783] X.sub.12 is Met or Leu;
[0784] X.sub.14 is absent or Thr;
[0785] X.sub.16 is Pro, Leu, Arg, Glu, or Gly;
[0786] X.sub.17 is Ser or Glu;
[0787] X.sub.18 is Gln or Ala;
[0788] X.sub.19 is Gly or Val;
[0789] X.sub.24 is Tyr or Phe;
[0790] X.sub.25 is Ala or Glu; and
[0791] X.sub.26 is an aliphatic amino acid selected from Gly, Ala,
Val, Leu, Ser, or Ile, optionally comprising up to 5 further amino
acid substitutions.
Embodiment 2
[0792] The peptide according to embodiment 1, wherein the peptide
of SEQ ID NO: 235 comprises up to 4 further amino acid
substitutions.
Embodiment 3
[0793] The peptide according to any one of the preceding
embodiments wherein the peptide of SEQ ID NO: 235 comprises up to 3
further amino acid substitutions.
Embodiment 4
[0794] The peptide according to any one of the preceding
embodiments wherein the peptide of SEQ ID NO: 235 comprises up to 2
further amino acid substitutions.
Embodiment 5
[0795] The peptide according to any one of the preceding
embodiments wherein the peptide of SEQ ID NO: 235 comprises up to 1
further amino acid substitutions.
Embodiment 6
[0796] The peptide according to any one of the preceding
embodiments comprising the sequence wherein
[0797]
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5SX.sub.7DPX.sub.10X.sub.11X.sub.-
12VX.sub.14GX.sub.16X.sub.17X.sub.18X.sub.19RSPSX.sub.24X.sub.25X.sub.26
(SEQ ID NO: 235),
[0798] wherein
[0799] X.sub.1 is Pro or absent;
[0800] X.sub.2 is Pro or Leu;
[0801] X.sub.3 is Asp or Glu;
[0802] X.sub.4 is Val or Thr;
[0803] X.sub.5 is Gly, Asp, Phe, Leu or Ser;
[0804] X.sub.7 is Ser or Met;
[0805] X.sub.10 is Leu or Phe;
[0806] X.sub.11 is Ser or Gly;
[0807] X.sub.12 is Met or Leu;
[0808] X.sub.14 is absent or Thr;
[0809] X.sub.16 is Pro, Leu, or Arg;
[0810] X.sub.17 is Ser or Glu;
[0811] X.sub.18 is Gln or Ala;
[0812] X.sub.19 is Gly or Val;
[0813] X.sub.24 is Tyr or Phe;
[0814] X.sub.25 is Ala or Glu; and
[0815] X.sub.26 is an aliphatic amino acid selected from Gly, Ala,
Val, Leu, Ser, or Ile.
Embodiment 7
[0816] The peptide according to any one of the preceding
embodiments comprising the sequence
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5SX.sub.7DPX.sub.10X.sub.11X.sub.12VX.s-
ub.14GX.sub.16X.sub.17X.sub.18X.sub.19RSPSX.sub.24X.sub.25A (SEQ ID
NO: 236),
[0817] wherein
[0818] X.sub.1 is Pro or absent;
[0819] X.sub.2 is Pro or Leu;
[0820] X.sub.3 is Asp or Glu;
[0821] X.sub.4 is Val or Thr;
[0822] X.sub.5 is Gly, Asp, Phe, Leu or Ser;
[0823] X.sub.7 is Ser or Met;
[0824] X.sub.10 is Leu or Phe;
[0825] X.sub.11 is Ser or Gly;
[0826] X.sub.12 is Met or Leu;
[0827] X.sub.14 is absent or Thr;
[0828] X.sub.16 is Pro, Leu, or Arg;
[0829] X.sub.17 is Ser or Glu;
[0830] X.sub.18 is Gln or Ala;
[0831] X.sub.19 is Gly or Val;
[0832] X.sub.24 is Tyr or Phe; and
[0833] X.sub.25 is Ala or Glu.
Embodiment 8
[0834] The peptide according to any one of the preceding
embodiments wherein X.sub.1 is Pro.
Embodiment 9
[0835] The peptide according to any one of the preceding
embodiments wherein X.sub.1 is absent.
Embodiment 10
[0836] The peptide according to any one of the preceding
embodiments wherein X.sub.2 is Pro.
Embodiment 11
[0837] The peptide according to any one of the preceding
embodiments wherein X.sub.2 is Leu.
Embodiment 12
[0838] The peptide according to any one of the preceding
embodiments wherein X.sub.3 is Asp.
Embodiment 13
[0839] The peptide according to any one of the preceding
embodiments wherein X.sub.3 is Glu.
Embodiment 14
[0840] The peptide according to any one of the preceding
embodiments wherein X.sub.4 is Val.
Embodiment 15
[0841] The peptide according to any one of the preceding
embodiments wherein X.sub.4 is Thr.
Embodiment 16
[0842] The peptide according to any one of the preceding
embodiments wherein X.sub.5 is Gly.
Embodiment 17
[0843] The peptide according to any one of the preceding
embodiments wherein X.sub.5 is Asp.
Embodiment 18
[0844] The peptide according to any one of the preceding
embodiments wherein X.sub.5 is Phe.
Embodiment 19
[0845] The peptide according to any one of the preceding
embodiments wherein X.sub.5 is Leu.
Embodiment 20
[0846] The peptide according to any one of the preceding
embodiments wherein X.sub.5 is Ser.
Embodiment 21
[0847] The peptide according to any one of the preceding
embodiments wherein X.sub.7 is Ser.
Embodiment 22
[0848] The peptide according to any one of the preceding
embodiments wherein X.sub.7 is Met.
Embodiment 23
[0849] The peptide according to any one of the preceding
embodiments wherein X.sub.10 is Leu.
Embodiment 24
[0850] The peptide according to any one of the preceding
embodiments wherein X.sub.10 is Phe.
Embodiment 25
[0851] The peptide according to any one of the preceding
embodiments wherein X.sub.11 is Ser.
Embodiment 26
[0852] The peptide according to any one of the preceding
embodiments wherein X.sub.11 is Gly.
Embodiment 27
[0853] The peptide according to any one of the preceding
embodiments wherein X.sub.12 is Met.
Embodiment 28
[0854] The peptide according to any one of the preceding
embodiments wherein X.sub.12 is Leu.
Embodiment 29
[0855] The peptide according to any one of the preceding
embodiments wherein X.sub.14 is absent.
Embodiment 30
[0856] The peptide according to any one of the preceding
embodiments wherein X.sub.14 is Thr.
Embodiment 31
[0857] The peptide according to any one of the preceding
embodiments wherein X.sub.16 is Pro.
Embodiment 32
[0858] The peptide according to any one of the preceding
embodiments wherein X.sub.16 is Leu.
Embodiment 33
[0859] The peptide according to any one of the preceding
embodiments wherein X.sub.16 is Arg.
Embodiment 34
[0860] The peptide according to any one of the preceding
embodiments wherein X.sub.16 is Glu.
Embodiment 35
[0861] The peptide according to any one of the preceding
embodiments wherein X.sub.16 is Gly.
Embodiment 36
[0862] The peptide according to any one of the preceding
embodiments wherein X.sub.17 is Ser.
Embodiment 37
[0863] The peptide according to any one of the preceding
embodiments wherein X.sub.17 is Glu.
Embodiment 38
[0864] The peptide according to any one of the preceding
embodiments wherein X.sub.18 is Gln.
Embodiment 39
[0865] The peptide according to any one of the preceding
embodiments wherein X.sub.18 is Ala.
Embodiment 40
[0866] The peptide according to any one of the preceding
embodiments wherein X.sub.19 is Gly.
Embodiment 41
[0867] The peptide according to any one of the preceding
embodiments wherein X.sub.19 is Val.
Embodiment 42
[0868] The peptide according to any one of the preceding
embodiments wherein X.sub.24 is Tyr.
Embodiment 43
[0869] The peptide according to any one of the preceding
embodiments wherein X.sub.24 is Phe.
Embodiment 44
[0870] The peptide according to any one of the preceding
embodiments wherein X.sub.25 is Ala.
Embodiment 45
[0871] The peptide according to any one of the preceding
embodiments wherein X.sub.25 is Glu.
Embodiment 46
[0872] The peptide according to any one of the preceding
embodiments wherein X.sub.26 is Gly.
Embodiment 47
[0873] The peptide according to any one of the preceding
embodiments wherein X.sub.26 is Ala.
Embodiment 48
[0874] The peptide according to any one of the preceding
embodiments wherein X.sub.26 is Val.
Embodiment 49
[0875] The peptide according to any one of the preceding
embodiments wherein X.sub.26 is Leu.
Embodiment 50
[0876] The peptide according to any one of the preceding
embodiments wherein X.sub.26 is Ser.
Embodiment 51
[0877] The peptide according to any one of the preceding
embodiments wherein X.sub.26 is Be.
Embodiment 52
[0878] The peptide according to any one of the preceding
embodiments wherein
X.sub.1 is Pro or absent;
X.sub.2 is Pro or Leu;
X.sub.3 is Asp or Glu;
X.sub.4 is Val or Thr;
X.sub.5 is Gly or Asp;
X.sub.7 is Ser or Met;
X.sub.10 is Leu or Phe;
X.sub.11 is Ser or Gly;
X.sub.12 is Met or Leu;
[0879] X.sub.14 is absent or Thr;
X.sub.16 is Pro or Leu;
X.sub.17 is Ser or Glu;
X.sub.18 is Gln or Ala;
X.sub.19 is Gly or Val;
X.sub.24 is Tyr or Phe; and
X.sub.25 is Ala or Glu.
Embodiment 53
[0880] The peptide according to any one of the preceding
embodiments wherein
X.sub.1 is Pro;
X.sub.2 is Pro;
X.sub.3 is Asp;
X.sub.4 is Val;
X.sub.10 is Phe;
X.sub.11 is Gly;
X.sub.12 is Leu;
[0881] X.sub.14 is absent;
X.sub.16 is Pro;
X.sub.17 is Ser;
X.sub.18 is Gln;
X.sub.19 is Gly;
X.sub.24 is Phe and
X.sub.25 is Glu.
Embodiment 54
[0882] The peptide according to any one of the preceding
embodiments comprising a sequence selected from the group
consisting of
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180),
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237),
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238),
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239),
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240),
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241),
PPDVG SSDPL SMVGP SQGRS PSYAA (FGF21 C25; SEQ ID NO: 191),
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178),
PLETD SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 179),
PPDVG SMDPF GLVTG LEAVR SPSYA A (SEQ ID NO: 182),
PPDVG SSDPL SMVTG LEAVR SPSFE A (0435; SEQ ID NO: 184), and
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 55
[0883] The peptide according to any one of the preceding
embodiments comprising a sequence selected from the group
consisting of
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180),
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237),
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238),
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239),
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240), and
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241).
Embodiment 56
[0884] The peptide according to any one of the preceding
embodiments comprising a sequence selected from the group
consisting of
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178),
PLETD SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 179), and
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 57
[0885] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180).
Embodiment 58
[0886] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237).
Embodiment 59
[0887] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238).
Embodiment 60
[0888] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239).
Embodiment 61
[0889] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240).
Embodiment 62
[0890] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241).
Embodiment 63
[0891] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVG SSDPL SMVGP SQGRS PSYAA (FGF21 C25; SEQ ID NO: 191).
Embodiment 64
[0892] The peptide according to any one of the preceding
embodiments comprising the sequence
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178).
Embodiment 65
[0893] The peptide according to any one of the preceding
embodiments comprising the sequence
PLETD SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 179).
Embodiment 66
[0894] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVG SMDPF GLVTG LEAVR SPSYA A (SEQ ID NO: 182).
Embodiment 67
[0895] The peptide according to any one of the preceding
embodiments comprising the sequence
PPDVGSSDPLSMVTGLEAVRSPSFE A (0435; SEQ ID NO: 184).
Embodiment 68
[0896] The peptide according to any one of the preceding
embodiments comprising the sequence
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 69
[0897] An FGF21 peptide comprising the structure of A-B wherein A
is a peptide according to SEQ ID NO: 195, optionally comprising up
to 10 further amino acid modifications, and B is a peptide of any
one of embodiments 1 to 68.
Embodiment 70
[0898] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 9 further amino acid modifications.
Embodiment 71
[0899] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 8 further amino acid modifications.
Embodiment 72
[0900] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 7 further amino acid modifications.
Embodiment 73
[0901] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 6 further amino acid modifications.
Embodiment 74
[0902] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 5 further amino acid modifications.
Embodiment 75
[0903] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 4 further amino acid modifications.
Embodiment 76
[0904] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 3 further amino acid modifications.
Embodiment 77
[0905] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises up to 2 further amino acid modifications.
Embodiment 78
[0906] The FGF21 peptide according to embodiment 69 wherein A
optionally comprises 1 further amino acid modification.
Embodiment 79
[0907] The FGF21 peptide according to any one of embodiments 69 to
78 wherein A is a peptide according to SEQ ID NO: 194.
Embodiment 80
[0908] The FGF21 peptide according to any one of embodiments 69 to
78 wherein A comprises one or more of amino acid modifications
A31C, G43C, L98D, L100K, N121D, and/or D127K.
Embodiment 81
[0909] The FGF21 peptide according to any one of embodiments 69 to
78 wherein A comprises the amino acid modifications A31C, G43C,
L98D, L100K, N121D, and D127K (SEQ ID NO: 196).
Embodiment 82
[0910] The FGF21 peptide according to any one of embodiments 69 to
78 wherein A is a peptide according to SEQ ID NO: 195.
Embodiment 83
[0911] The FGF21 peptide according to any one of embodiments 69 to
78 wherein A is a peptide according to SEQ ID NO: 195 and B is
selected from the list consisting of
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180)
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237),
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238),
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239),
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240),
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241),
PPDVG SSDPL SMVGP SQGRS PSYAA (FGF21 C25; SEQ ID NO: 191),
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178),
PLETD SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 179),
PPDVG SMDPF GLVTG LEAVR SPSYA A (SEQ ID NO: 182),
PPDVG SSDPL SMVTG LEAVR SPSFE A (0435; SEQ ID NO: 184), and
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 84
[0912] The FGF21 peptide according to any one of embodiments 69 to
78 wherein A is a peptide according to SEQ ID NO: 195 and B is
selected from the group consisting of
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180),
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237),
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238),
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239),
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240), and
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241).
Embodiment 85
[0913] The FGF21 peptide according to any one of embodiments 69 to
78 wherein
A is a peptide according to SEQ ID NO: 195 and B is selected from
the group consisting of
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178)
PLETDSMDPFGLVGPSQGRSPSFEA (0430; SEQ ID NO: 179)
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188)
Embodiment 86
[0914] The FGF21 peptide according to any one of embodiments 69 to
78 wherein
A is a peptide according to SEQ ID NO: 195 and
B is LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 87
[0915] The FGF21 peptide according to any one of embodiments 69 to
78 wherein
A is a peptide according to SEQ ID NO: 196 and B is selected from
the list consisting of
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180)
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237),
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238),
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239),
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240),
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241),
PPDVG SSDPL SMVGP SQGRS PSYAA (FGF21 C25; SEQ ID NO: 191),
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178),
PLETD SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 179),
PPDVG SMDPF GLVTG LEAVR SPSYA A (SEQ ID NO: 182),
PPDVGSSDPLSMVTGLEAVRSPSFE A (0435; SEQ ID NO: 184), and
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188)
Embodiment 88
[0916] The FGF21 peptide according to any one of embodiments 69 to
78 wherein
A is a peptide according to SEQ ID NO: 196 and B is selected from
the group consisting of
PPDVG SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 180)
PPDVG SMDPF GLVGR SQGRS PSFEA (0470; SEQ ID NO: 237),
PPDVF SMDPF GLVGP SQGRS PSFEA (0480; SEQ ID NO: 238),
PPDVL SMDPF GLVGP SQGRS PSFEA (0481; SEQ ID NO: 239),
PPDVS SMDPF GLVGP SQGRS PSFEA (0482; SEQ ID NO: 240), and
PPDVG SSDPF GLVGP SQGRS PSFEA (0486; SEQ ID NO: 241).
Embodiment 89
[0917] The FGF21 peptide according to any one of embodiments 69 to
78 wherein
A is a peptide according to SEQ ID NO: 196 and B is selected from
the group consisting of
PLETD SMDPF GLVTG LEAVR SPSFE A (FGF19 A25; SEQ ID NO: 178),
PLETD SMDPF GLVGP SQGRS PSFEA (SEQ ID NO: 179), and
LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 90
[0918] The FGF21 peptide according to any one of embodiments 69 to
78 wherein
A is a peptide according to SEQ ID NO: 196 and
B is LETDS MDPFG LVTGL EAVRS PSFEA (SEQ ID NO: 188).
Embodiment 91
[0919] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of SEQ ID NO: 192.
Embodiment 92
[0920] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of SEQ ID NO: 193.
Embodiment 93
[0921] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of SEQ ID NO: 206.
Embodiment 94
[0922] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of SEQ ID NO: 207.
Embodiment 95
[0923] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of SEQ ID NO: 208.
Embodiment 96
[0924] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of SEQ ID NO: 209.
Embodiment 97
[0925] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of the sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLKA
LKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGL
PLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSMDPFGLVGRS
QGRSPSFEA (0470; SEQ ID NO: 242).
Embodiment 98
[0926] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of the sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLKA
LKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGL
PLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVFSMDPFGLVGPSQ
GRSPSFEA (0480; SEQ ID NO: 243).
Embodiment 99
[0927] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of the sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLKA
LKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGL
PLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVLSMDPFGLVGPS Q
GRSPSFEA (0481; SEQ ID NO: 244).
Embodiment 100
[0928] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of the sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLKA
LKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGL
PLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVSSMDPFGLVGPSQ
GRSPSFEA (0482; SEQ ID NO: 245).
Embodiment 101
[0929] The FGF21 peptide according to any one of embodiments 69 to
90 wherein the peptide consists of the sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLKA
LKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGL
PLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPFGLVGPSQ
GRSPSFEA (0486; SEQ ID NO: 246).
Embodiment 102
[0930] A pharmaceutical composition comprising the FGF21 peptide
according to any one of embodiments 69 to 101 and pharmaceutically
acceptable excipient.
Embodiment 103
[0931] The FGF21 peptide according to any one of embodiments 69 to
101 for use as a medicament.
Embodiment 104
[0932] The FGF21 peptide according to any one of embodiments 69 to
101 for use in the treatment of diabetes.
Embodiment 105
[0933] The FGF21 peptide according to any one of embodiments 69 to
101 for use in the treatment of obesity.
Embodiment 106
[0934] The FGF21 peptide according to any one of embodiments 69 to
101 for use in reducing weight gain and inducing weight loss.
Example 1
[0935] Fibroblast growth factor-21 (FGF21) has been intensively
studied as a metabolic hormone with a particular interest in its
therapeutic potential. At the cellular level, FGF21 interacts with
a complex of fibroblast growth factor receptor (FGFR) and a tissue
specific co-receptor Klotho .beta. (KLB). The N- and C-termini of
FGF21 are vital for effective biochemical signaling. The deletion
of the seventeen N-terminal residues of FGF21 (FGF21 18-181)
inactivates the molecule to generate a competitive antagonist of
the native hormone. Here, we have demonstrated that the C-terminal
fragment of FGF21 as well as FGF19 are capable of fully
antagonizing the native FGF21 in vitro signaling.
[0936] Materials & Methods
[0937] Protein Synthesis:
[0938] The human FGF21 or FGF19 gene sequence was inserted in
modified expression pET21b vector containing yeast small
ubiquitin-like modifier (SUMO) sequence after 6.times.His tag,
using In-Fusion HD EcoDry Cloning Plus kit. For the generation of
point mutant analogs, corresponding primers were obtained from
Integrated DNA technologies and mutagenesis was performed by
standard PCR method. E. coli OrigamiB(DE3) cells were transformed
with modified pET vector containing the gene of interest fused to a
His.sub.6-sumo tag. FGF21 protein expression was induced overnight
and the cells were harvested. The soluble whole cell lysate was
applied to a nickel affinity chromatography column for enrichment
of the desired protein. Subsequently, the tag was cleaved and pure
protein was obtained by anion exchange chromatography.
[0939] Cell Culture:
[0940] Cells were cultured in 10% Fetal Bovine Serum containing
DMEM High glucose GlutaMAX at 37 r, 95% humidity, 5% CO.sub.2. For
generating the cell line with stable expression, human KLB gene was
synthesized by Genscript and subcloned into pcDNA3.1(+) with Zeocin
resistance vector (Invitrogen) by NheI and NotI restriction enzyme
sites. HEK 293T cells were obtained from ATCC and were transiently
transfected at 80% confluency using Lipofectamine 3000
(Invitrogen). Selection for KLB-expressing cells was initiated 48
hours post-transfection in the growth media containing 100 .mu.g/ml
of Zeocin (Gibco) and continued for 4 weeks with fresh media added
every third day. Human KLB expression in pooled cells was confirmed
by Western blot and a functional FGF21 MAPK phosphorylation
assay.
[0941] Erk1/2 Phosphorylation Assay:
[0942] 293 HEK cells expressing hKLB were plated to 90% confluency
in 96 well plates coated with poly-D-Lysine. Cells were serum
starved for three hours in 0.1% BSA containing media prior to
stimulation with protein and/or an antagonist peptide for ten
minutes at 37.degree. C. The cell lysate was used for the detection
of phospho-Erk1/2 levels by AlphaSureFire kit using the prescribed
protocol. The degree of biochemical activation was recorded and
analyzed using Origin software by logistic curve fitting. Tests at
each concentration were done in triplicates, and the standard
deviation is as shown in the graphs. The calculation of maximal
activities was done keeping the FGF21 157-181 or FGF19 169-194
peptide activity as standard. The difference between the Erk1/2
phosphorylation signal for the highest (10 .mu.M) and the lowest (0
.mu.M) tested dose for native peptide was considered as 100% and
accordingly all the other values were assigned.
[0943] Peptide Synthesis:
[0944] Synthesis was achieved using a Chemmatrix Rink amide resin
using an automated ABI433A or Symphony peptide synthesizer that
employed Fmoc/HOBT/DIC coupling protocols. The peptides were
cleaved from the solid-support using TFA/TIS/H.sub.2O (95:2.5:2.5)
for two hours. Following ether precipitation the peptide was
solubilized in 20% CH.sub.3CN and lyophilized. These peptides were
purified by Waters Symmetry Preparative C8 column with a linear
gradient from aqueous CAN in 0.1% TFA. The purity within the set of
site-specific alanine mutated peptides was assessed by LCMS and
concentrations were adjusted accordingly for the in vitro
assay.
[0945] Circular Dichroism:
[0946] The CD properties of FGF-proteins were recorded using a
Jasco J-715 instrument. The mean residue ellipticity was calculated
and plotted as a function of wavelength using Origin software.
[0947] Results
[0948] We observed that the C-terminal portion of FGF 19 or 21 can
antagonize native FGF21 signaling in similar fashion to the known,
and much longer fragment 18-181. (see FIG. 1). The minimum
effective length for FGF21 antagonism was determined to be 25 amino
acids, representing residues 157-181 of the FGF21 protein (SEQ ID
NO: 2), see the data presented in FIGS. 2 & 3A. The
corresponding 26 residues of FGF19 (169-194) (FIG. 3B) were
sufficient in replicating the effect that FGF21 18-181 elicits in
vitro. Both FGF21 and FGF19 C-terminal peptides were equally
effective antagonists of FGF21 activity, suggesting that these
peptides interact with the receptor complex with same ability.
Peptides shorter than 23 amino acids in length were found to be
non-functional. A representative example of non-functional smaller
fragments is demonstrated by the FGF21 162-181 peptide (FIG. 2).
FGF21 159-181 peptide (23-amino acid) demonstrated weak antagonism
and further extension by one residue to FGF21 160-181 peptide
(24-amino acid) dramatically improved its antagonistic potential,
attaining the optimal performance at 25-amino acid length. Peptides
beyond the 25-mer were equally effective antagonists, not better,
hence all further analyses were carried out with the 25-mer peptide
as the standard. It was confirmed that the phenomenon was
KLB-receptor complex specific, since these peptides could not
antagonize FGF1 activity in a similar setup for FGF23 in
KL-expressing cells.
[0949] To gain more insight into the specific amino acid
requirements for each peptide antagonist, we performed a complete
alanine scan of the FGF21 157-181 peptide and identified several
sites with significantly altered antagonistic activity (FIGS. 3A
& 4). More particularly, Table 1 provides a summary of the
complete alanine scan of FGF21 157-181 and FGF19 169-194 peptide
sequences. Each peptide was tested for its ability to antagonize
native FGF21 response by measuring the change in phosphorylation
status of Erk1/2. The efficacy of each peptide is represented as %
maximal activity, with native sequence attaining 100% response.
[0950] Table 2(A) lists a subset of peptides that achieve 95% or
greater maximal activity. Table 2(B) lists a subset of peptides
that were not able to achieve a full response shown with their
corresponding % maximal activity. NC: Not calculated by the
logistic curve fitting used. The peptides of Group A in Table 2(A)
depicts the set of peptides that showed complete antagonism to the
native FGF21 signaling and thus represent amino acids positions
that were tolerant to the individual alanine substitutions, with
some having marginally improved or worse potencies with one
exception; FGF19 169-194 K194A. Group B in Table 2(B) represents
the peptides had a profound deleterious impact on their
antagonistic ability, such that they were unable to achieve full
antagonist response to native FGF21. The listed peptides of Table
2(B) were significantly weaker antagonists or inactive (maximal
activity<95% and/or IC-50 values>1 .mu.M).
TABLE-US-00001 TABLE 1 Alanine Scan of FGF21 25mer Modifi- IC-50 %
max Peptide cation (nM) activity PPDVG SSDPL SMVGP SQGRS PSYAS (SEQ
ID NO: 191) C25 168 .+-. 83 100.0 APDVG SSDPL SMVGP SQGRS PSYAS
(SEQ ID NO: 210) A1 33.0 100 PADVG SSDPL SMVGP SQGRS PSYAS (SEQ ID
NO: 211) A2 137.3 98.5 PPAVG SSDPL SMVGP SQGRS PSYAS (SEQ ID NO:
212) A3 2283.2 87.8 PPDAG SSDPL SMVGP SQGRS PSYAS (SEQ ID NO: 213)
A4 5926.4 63.6 PPDVA SSDPL SMVGP SQGRS PSYAS (SEQ ID NO: 214) A5
90.1 102.5 PPDVG ASDPL SMVGP SQGRS PSYAS (SEQ ID NO: 215) A6 2647.4
89.2 PPDVG SADPL SMVGP SQGRS PSYAS (SEQ ID NO: 216) A7 359.2 94.5
PPDVG SSAPL SMVGP SQGRS PSYAS (SEQ ID NO: 217) A8 PPDVG SSAPL SMVGP
SQGRS PSYAS (SEQ ID NO: 218) A9 PPDVG SSDPA SMVGP SQGRS PSYAS (SEQ
ID NO: 219) A10 3315.9 76.0 PPDVG SSDPL AMVGP SQGRS PSYAS (SEQ ID
NO: 220) A11 101.6 98.0 PPDVG SSDPL SAVGP SQGRS PSYAS (SEQ ID NO:
221) A12 PPDVG SSDPL SMAGP SQGRS PSYAS (SEQ ID NO: 222) A13 2106.1
87.9 PPDVG SSDPL SMVAP SQGRS PSYAS (SEQ ID NO: 223) A14 135.6 97.7
PPDVG SSDPL SMVGA SQGRS PSYAS (SEQ ID NO: 224) A15 134.3 93.9 PPDVG
SSDPL SMVGP AQGRS PSYAS (SEQ ID NO: 225) A16 120.3 101.4 PPDVG
SSDPL SMVGP SAGRS PSYAS (SEQ ID NO: 226) A17 138.9 99.7 PPDVG SSDPL
SMVGP SQARS PSYAS (SEQ ID NO: 227) A18 139.0 102.9 PPDVG SSDPL
SMVGP SQGAS PSYAS (SEQ ID NO: 228) A19 102.1 100.1 PPDVG SSDPL
SMVGP SQGRA PSYAS (SEQ ID NO: 229) A20 3228.4 73.5 PPDVG SSDPL
SMVGP SQGRS ASYAS (SEQ ID NO: 230) A21 2242.5 70.5 PPDVG SSDPL
SMVGP SQGRS PAYAS (SEQ ID NO: 231) A22 752.1 78.5 PPDVG SSDPL SMVGP
SQGRS PSAAS (SEQ ID NO: 232) A23 3984.2 73.6 PPDVG SSDPL SMVGP
SQGRS PSYAA (SEQ ID NO: 233) A25 45.0 99.0
TABLE-US-00002 TABLE 2(A) .gtoreq.95% Maximal activity FGF21 FGF19
Position IC-50 (.mu.M) Position IC-50 (.mu.M) WT 0.16 .+-. 0.05 WT
0.27 .+-. 0.09 P157 0.39 P169 0.21 P158 0.62 E171 0.12 G161 0.09
D173 0.46 S163 0.36 M175 0.15 S167 0.15 T182 0.52 G170 0.13 G183
0.40 P171 0.12 L184 0.20 S172 0.11 E185 0.43 Q173 0.13 V187 0.69
G174 0.15 R188 0.38 R175 0.10 E193 0.85 S181 0.06 K194 0.005
TABLE-US-00003 TABLE 2(B) <95% Maximal activity FGF21 FGF19
Position IC-50 (.mu.M) Position IC-50 (.mu.M) D159 1.50 L170 2.17
V160 2.69 T172 1.40 S162 2.44 S174 3.39 D164 NC D176 NC P165 NC
P177 NC L166 2.75 F178 NC M168 NC G179 1.93 V169 4.60 L180 NC S176
2.21 V181 1.81 P177 2.57 S189 >2.00 S178 0.67 P190 >2.00 Y179
4.16 S191 >2.00 F192 2.97
[0951] Additionally, we tested the ability of FGF19 169-194 K194A
peptide to antagonize FGF21 activity in Hep3B cells, and found that
this peptide was a superior antagonist compared to the native
sequence as seen in the engineered 293T HEK hKLB cells (FIG. 7C).
We tested the ability of FGF21/FGF19 C-terminal peptides to
antagonize native FGF19 function Hep3B cells and found them to be
effective antagonists, and again the FGF19 169-194 K194A peptide
was observed to be a superior antagonist (FIG. 7C).
[0952] FGF21 analogs with site-specific alanine mutations predicted
by the peptide antagonist screen were synthesized and assessed for
agonist activity. We chose one mutation which debilitates the
antagonism by substituting alanine at position 164, and another
which preserves the antagonistic function at position 171. Both the
site specific alanine FGF21 analogs were tested for their ability
to induce Erk1/2 phosphorylation in comparison to the native FGF21.
We found that the observed agonistic activity was indeed in
complete agreement with the antagonist activity seen by the short
peptides. The results validated the ability to translate from one
molecular format to another.
[0953] To confirm that the FGF21 D164A analog was not compromised
in its activity due to a substantial change in its secondary
structure we recorded the CD spectra of the FGF21 D164A and
compared it to the native FGF21 signature. The CD spectra of the
Ala164 FGF21 is comparable to native FGF21, which implies that the
inability to biochemically signal is a function of local and not
systemic change to the protein structure. (FIG. 5). FGF19 & 21
share high identity in their C-terminal sequences (FIG. 6). This
region based upon analogy with FGF23 is suspected to be of
importance in binding to KLB. The results demonstrate that a
peptide fragment representing as little as 15% of the full length
protein is fully effective in antagonizing native FGF21 in vitro
signaling at .about.10.times. molar concentration. A complete
alanine scan of the peptide revealed a number of sites that sharply
differed in antagonistic effectiveness. The most debilitating
alanine mutations occurred in residues that were identical among
FGF19 and 21, and a specific example is position 164 (FIG. 4).
These results define the precise positions that constitute the high
affinity interactions of FGF21 with its co-receptor KLB, and
provide a basis for optimizing protein agonism through analysis of
peptide-based antagonism (FIG. 6; Table 1).
[0954] Positions 8, 9 and 12 were found to be critical residues,
whereas positions 3, 4, 6, 10, 13, 20, 21 and 23 were found to be
positions impacting activity. The low activity associated with
peptides comprising these specific amino acid substitutions (when
mutated to alanine) identifies these amino acids as part of the
putative binding domain for KLB. Eleven of the twenty-five residues
within this C-terminal peptide demonstrated more than a 10.times.
reduction in potency when mutated to alanine.
Example 2
[0955] Further modifications to the FGF19 and FGF21 C-terminal
sequences.
[0956] The initial alanine scan of the FGF19 169-194 K194A peptide
fragment revealed that substitution of the C-terminal amino acid
with an alanine (K194A for FGF19 and S181A for FGF21) significantly
enhanced the antagonist properties of the peptide (see Table 2(A)).
Furthermore, the creation of a full length FGF19 analog comprising
the FGF19 169-194 K194A fragment demonstrated that the FGF29 analog
was indeed an improved analog in the engineered 293T HEK hKLB cells
(FIG. 7C).
[0957] To assess the activity of the best antagonist peptide as its
agonist counterpart, we generated a chimeric analog which had the
core of FGF21 1-156 and an extension of the FGF19 169-194 K194A
peptide, and evaluated its activity. We found this to be
approximately 5-fold more potent than native FGF21 (FIG. 7C). This
fortifies our previous observations that there is a firm
correlation between the KLB-binding ability of the C-terminal
peptides in isolation and their corresponding function as
agonists.
Example 3
[0958] Further Mutational Analysis
[0959] The results of a D-amino acid scan of the FGF21 C-terminal
25 amino acid peptide (SEQ ID NO: 191) are presented in Table 3.
The activity of each peptide (all having the primary sequence of
SEQ ID NO: 191) was determined using the assay described in Example
1. Stepwise D-isomer mutations within the 25-terminal amino acids
of FGF21 (SEQ ID NO: 191) largely mimicked the results of the
alanine scan. Two mutations at S11 and R19, however significantly
increased antagonistic potency of the peptide over the native
terminus by 5- and 2-fold respectively.
TABLE-US-00004 TABLE 3 D11 and D19 increased the potency of C25
peptide. Sample ID Sequences IC50 (nM) % Activity vs C25 C25 PPDVG
SSDPL SMVGP SQGRS PSYAS 283.48 .+-. 135.61 100.000 (SEQ ID NO: 191)
d1 pPDVG SSDPL SMVGP SQGRS PSYAS 876.53 .+-. 537.33 54.16 .+-.
24.05 d2 PpDVG SSDPL SMVGP SQGRS PSYAS 4718.00 .+-. 2988.67 7.61
.+-. 1.78 d3 PPdVG SSDPL SMVGP SQGRS PSYAS 6101.50 .+-. 6479.22
15.63 .+-. 20.51 d4 PPDvG SSDPL SMVGP SQGRS PSYAS Ambiguous
Ambiguous d6 PPDVG sSDPL SMVGP SQGRS PSYAS 1981.85 .+-. 2045.17
32.49 .+-. 42.20 d7 PPDVG SsDPL SMVGP SQGRS PSYAS Ambiguous
Ambiguous d8 PPDVG SSdPL SMVGP SQGRS PSYAS Ambiguous Ambiguous d9
PPDVG SSDpL SMVGP SQGRS PSYAS Ambiguous Ambiguous d10 PPDVG SSDPI
SMVGP SQGRS PSYAS Ambiguous Ambiguous d11 PPDVG SSDPL sMVGP SQGRS
PSYAS 57.32 .+-. 31.13 596.16 .+-. 211.38 d12 PPDVG SSDPL SmVGP
SQGRS PSYAS Ambiguous Ambiguous d13 PPDVG SSDPL SMvGP SQGRS PSYAS
Ambiguous Ambiguous d15 PPDVG SSDPL SMVGp SQGRS PSYAS 374.95 .+-.
188.36 66.84 .+-. 34.79 d16 PPDVG SSDPL SMVGP sQGRS PSYAS 530.58
.+-. 289.19 45.98 .+-. 16.23 d17 PPDVG SSDPL SMVGP SqGRS PSYAS
262.48 .+-. 143.30 90.34 .+-. 24.24 d19 PPDVG SSDPL SMVGP SQGrS
PSYAS 151.78 .+-. 151.66 270.70 .+-. 136.83 d20 PPDVG SSDPL SMVGP
SQGRs PSYAS 33700.00 .+-. 44510.18 2.30 .+-. 1.83 d21 PPDVG SSDPL
SMVGP SQGRS pSYAS 7799.67 .+-. 1501.53 3.80 .+-. 0.87 d22 PPDVG
SSDPL SMVGP SQGRS PsYAS Ambiguous Ambiguous d23 PPDVG SSDPL SMVGP
SQGRS PSyAS Ambiguous Ambiguous d24 PPDVG SSDPL SMVGP SQGRS PSYaS
1133.67 .+-. 435.35 32.29 .+-. 13.52 d25 PPDVG SSDPL SMVGP SQGRS
PSYAs 263.50 .+-. 120.11 118.62 .+-. 38.73
[0960] Combining the mutations that were identified by the alanine
and D-isomer scan into a single peptide resulted in antagonists
that had elevated potency compared to the native C-terminal
peptides (see Table 4; lowercase letters identifying amino acids in
D-isomer conformation).
TABLE-US-00005 TABLE 4 Double mutations of FGF21 and 19 have
additive affects increasing potency ~10 fold over native peptide.
Peptide Sequence IC50 (nM) FGF21 D11 PPDVG SSDPL sMVGP SQGRS PSYAS
19.9 .+-. 5.24 (SEQ ID NO: 185) FGF21 D19 PPDVG SSDPL SMVGP SQGrS
PSYAS 52.55 .+-. 10.82 (SEQ ID NO: 186) FGF21 D11D19 PPDVG SSDPL
sMVGP SQGrS PSYAS 14.13 .+-. 3.87 (SEQ ID NO: 187) FGF19 A26 LETDS
MDPFG LVTGL EAVRS PSFEA 17.89 .+-. 4.57 (SEQ ID NO: 188) FGF19 S10
LETDS MDPFs LVTGL EAVRS PSFES 194.34 .+-. 81.39 (SEQ ID NO: 189)
FGF19 S10A26 LETDS MDPFs LVTGL EAVRS PSFEA 10.92 .+-. 6.33 (SEQ ID
NO: 190) FGF21 C25 PPDVG SSDPL SMVGP SQGRS PSYAS 182.34 .+-. 56.35
(SEQ ID NO: 191)
Example 4
[0961] FGF19/FGF21 Chimeric Peptides
[0962] Chimeric peptides we prepared and tested for their ability
to antagonize native FGF21 signaling using the method of Example 1.
The results of these experiments are provided in Table 5. In
summary, the results indicate that maximal activity is obtained in
the 25mer C-terminal peptide that comprises FGF19 amino acids at
positions 6-13 with a non-charged amino acid (e.g., alanine) at
position 25. More particularly, FGF21 based C-terminal peptide
fragments having a terminal alanine at position 25 and the amino
acids 6-13 of FGF19 retained the enhanced potency of native FGF19
with the terminal alanine.
TABLE-US-00006 TABLE 5 Peptide Sequence IC50 FGF21
PPDVGSSDPLSMVGPSQGRSPSYAS 115.9 .+-. 4 C25 (SEQ ID NO: 177) FGF19
PLETDSMDPFGLVTGLEAVRSPSFEA 19.1 .+-. 1.5 A25 (SEQ ID NO: 178) 0430
PLETDSMDPFGLVGPSQGRSPSFEA 15.9 .+-. 1.1 (SEQ ID NO: 179) 0431
PPDVGSMDPFGLVGPSQGRSPSFEA 4.1 .+-. 0.1 (SEQ ID NO: 180) 0432
PLETDSSDPLSMVGPSQGRSPSFEA 119.8 .+-. 6.3 (SEQ ID NO: 181) 0433
PPDVGSMDPFGLVTGLEAVRSPSYAA 10.7 .+-. 0.7 (SEQ ID NO: 182) 0434
PLETDSSDPLSMVTGLEAVRSPSYAA 263.6 .+-. 78.8 (SEQ ID NO: 183) 0435
PPDVGSSDPLSMVTGLEAVRSPSFEA 65.1 .+-. 4.8 (SEQ ID NO: SEQ ID NO:
184)
[0963] Modifying FGF21 by substituting the native C-terminal 25
amino acids of FGF21 with the potent FGF19 A26 antagonistic 25mer
peptide significantly increases agonism at both human and mouse KLB
(See FIGS. 11A and 11B). A fusion of the N-terminus of FGF21 and
highly potent C-terminal peptide FGF19 A26 was synthesized (SEQ ID
NO: 192). This fusion, called 0268-1A, was confirmed to have
enhanced potency (1.82.+-.0.37 & 2.15.+-.0.54) compared to both
FGF21 (8.42.+-.4.1 & 3.96.+-.1.51) and 19 (65.78.+-.58.19 &
25.67.+-.21.32) in cells that overexpressed both human (FIG. 11A)
and mouse (FIG. 11B) KLB. Further modification of 0278-1A, by
adding six mutations based on published data (A31C, G43C, L98D,
L100K, N121D, D127K), produced V2 0278-1A (SEQ ID NO: 193). The
peptide of V2 0278-1A having the 6 amino acid substitutions in the
N-terminus 0278-1A exhibited increased potency relative to 0278-1A
(See FIG. 12). V2-0278-1A displays .about.2-3.times. higher potency
(0.35.+-.0.12 nM) versus 0278-1A (1.13.+-.0.28) in cells
overexpressing human KLB (B).
[0964] Additional peptides derived from SEQ ID NO: 180 were
investigated for their activity as antagonists of FGF21 receptor
activity. Table 6 provides the results of further derivatives of
SEQ ID NO: 180 including amino acid substitutions at positions 5, 7
and 15. All tested peptides had similar activities as the peptide
of SEQ ID NO: 180.
TABLE-US-00007 TABLE 6 Peptide Sequence IC50 0431
PPDVGSMDPFGLVGPSQGRSPSFEA 7.1 .+-. 3 (SEQ ID NO: 180) 0470 PPDVG
SMDPF GLVGR SQGRS PSFEA 4.9 .+-. 1.1 (SEQ ID NO: 237) 0480 PPDVF
SMDPF GLVGP SQGRS PSFEA 2.6 .+-. 0.5 (SEQ ID NO: 238) 0481 PPDVL
SMDPF GLVGP SQGRS PSFEA 2.6 .+-. 0.8 (SEQ ID NO: 239) 0482 PPDVS
SMDPF GLVGP SQGRS PSFEA 3.0 .+-. 1.3 (SEQ ID NO: 240) 0486 PPDVG
SSDPF GLVGP SQGRS PSFEA 4.7 .+-. 1.6 SEQ ID NO: 2411
[0965] A fusion of the N-terminus of FGF21 (modified to comprise
the substitutions A31C, G43C, L98D, L100K, N121D, and D127K) and
highly potent C-terminal peptides of Table 6 produced the following
compounds:
TABLE-US-00008 (''FGF21 431A''; SEQ ID NO: 247)
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVG
CAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVGSMDPFGLVGPSQGRSPSFEA; (''FGF21 470A''; SEQ ID
NO: 248) HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVG
CAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVG SMDPF GLVGR SQGRS PSFEA; (''FGF21 480A''; SEQ
ID NO: 249) HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVG
CAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVF SMDPF GLVGP SQGRS PSFEA; (''FGF21 481A''; SEQ
ID NO: 250) HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVG
CAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVL SMDPF GLVGP SQGRS PSFEA; (''FGF21 482A''; SEQ
ID NO: 251) HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVG
CAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVS SMDPF GLVGP SQGRS PSFEA; and (''FGF21 486A'';
SEQ ID NO: 252) HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVG
CAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGL
PPALPEPPGILAPQPPDVGSSDPF GLVGP SQGRS PSFEA.
Each of these FGF21 analogs were tested for activity at the FGF21
receptor using the cell based assay disclosed in Example 1. The
polypeptides of SEQ ID NOs 247-252, along with analog of those
peptides where the C-terminal alanine is replace with a lysine were
tested along with the native FGF21 polypeptide for activity at the
FGF21 receptor. Each compound was tested in triplicate and the
average IC50 was determined. The results are indicated below:
TABLE-US-00009 FGF21 5.11 .+-. 0.55 FGF21 480K 1.62 .+-. 0.54 FGF21
480A 0.43 .+-. 0.04 FGF21 6.35 .+-. 3 FGF21 470K 6.14 .+-. 1.93
FGF21 470A 0.61 .+-. 0.06 FGF21 5.39 .+-. 3.19 FGF21 431K 4.3 .+-.
0.07 FGF21 431A 0.51 .+-. 0.21 FGF21 2.67 .+-. 0.9 FGF21 481K 0.56
.+-. 0.06 FGF21 481A 0.19 .+-. 0.08 FGF21 4.24 .+-. 1.07 FGF21 482K
1.81 .+-. 0.18 FGF21 482A 0.22 .+-. 0.03 FGF21 2.03 .+-. 0.86 FGF21
486K 3.16 .+-. 0.56 FGF21 486A 0.21 .+-. 0.03
Example 5
[0966] In Vivo Administration of FGF Analogs to Mice
[0967] Animals.
[0968] C57Bl/6 mice were obtained from Jackson Laboratories and fed
a diabetogenic diet from Research Diets: a high-sucrose diet with
58% kcal from fat. Mice were group-housed on a 12:12-h light-dark
cycle at 22.degree. C. with free access to food and water. All
studies were approved by and performed according to the guidelines
of the Institutional Animal Care and Use Committee of the
University of Cincinnati. All mice were treated by daily
subcutaneous injections delivered in physiologically buffered
saline at a dose of 0.3 or 1 mg/kg. Animals were weighed and food
consumption was measured each day.
[0969] Statistical Analyses.
[0970] Unless indicated otherwise, all statistical analyses were
performed using GraphPad Prism. The analysis of the results
obtained in the in vivo experiments was performed using one-way
ANOVAs followed by Tukey post hoc tests. P values lower than 0.05
were considered significant. The results are presented as
means.+-.s.e.m. of 7-8 replicates per group. Receptor activation
data is .+-.s.d.
[0971] The effect of FGF analog V2-0278-1A on mice was investigated
by administering either vehicle, FGF21 (at 0.3 mg/kg or 1.0 mg/kg)
or V2-0278-1A (at 0.3 mg/kg or 1.0 mg/kg) and monitoring weight
over the course of 6 days of treatment. FIGS. 13A and 13B
demonstrate enhanced weight loss in mice receiving FGF analog
V2-0278-1A relative to native FGF21. FIG. 13C demonstrates that
mice receiving FGF analog V2-0278-1A had a reduced food intake
relative to native FGF21.
Sequence CWU 1
1
252121PRTHomo sapiens 1Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys
Ser Leu Tyr Gln Leu1 5 10 15Glu Asn Tyr Cys Asn 20230PRTHomo
sapiens 2Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala
Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro Lys
Thr 20 25 30370PRTHomo sapiens 3Gly Pro Glu Thr Leu Cys Gly Ala Glu
Leu Val Asp Ala Leu Gln Phe1 5 10 15Val Cys Gly Asp Arg Gly Phe Tyr
Phe Asn Lys Pro Thr Gly Tyr Gly 20 25 30Ser Ser Ser Arg Arg Ala Pro
Gln Thr Gly Ile Val Asp Glu Cys Cys 35 40 45Phe Arg Ser Cys Asp Leu
Arg Arg Leu Glu Met Tyr Cys Ala Pro Leu 50 55 60Lys Pro Ala Lys Ser
Ala65 70467PRTHomo sapiens 4Ala Tyr Arg Pro Ser Glu Thr Leu Cys Gly
Gly Glu Leu Val Asp Thr1 5 10 15Leu Gln Phe Val Cys Gly Asp Arg Gly
Phe Tyr Phe Ser Arg Pro Ala 20 25 30Ser Arg Val Ser Arg Arg Ser Arg
Gly Ile Val Glu Glu Cys Cys Phe 35 40 45Arg Ser Cys Asp Leu Ala Leu
Leu Glu Thr Tyr Cys Ala Thr Pro Ala 50 55 60Lys Ser Glu65521PRTHomo
sapiens 5Gly Ile Val Asp Glu Cys Cys Phe Arg Ser Cys Asp Leu Arg
Arg Leu1 5 10 15Glu Met Tyr Cys Ala 20630PRTHomo sapiens 6Phe Gly
Pro Glu Thr Leu Cys Gly Ala Glu Leu Val Asp Ala Leu Tyr1 5 10 15Leu
Val Cys Gly Asp Arg Gly Phe Tyr Phe Asn Lys Pro Thr 20 25
30721PRTHomo sapiens 7Gly Ile Val Glu Glu Cys Cys Phe Arg Ser Cys
Asp Leu Ala Leu Leu1 5 10 15Glu Thr Tyr Cys Ala 20832PRTHomo
sapiens 8Ala Tyr Arg Pro Ser Glu Thr Leu Cys Gly Gly Glu Leu Val
Asp Thr1 5 10 15Leu Gln Phe Val Cys Gly Asp Arg Gly Phe Tyr Phe Ser
Arg Pro Ala 20 25 3098PRTArtificial Sequencespacer
sequenceMISC_FEATURE(1)..(1)The Xaa at position 1 represents an
amino acid selected from glycine, alanine, valine, leucine,
isoleucine, proline, phenylalanine and
methionineMISC_FEATURE(2)..(2)The Xaa at position 2 represents any
amino acid other than tyrosineMISC_FEATURE(3)..(6)The Xaas at
positions 3-6 are independently any amino
acidMISC_FEATURE(7)..(8)The Xaas at positions 7 and 8 are
independently selected from arginine, lysine or ornithine 9Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa1 5108PRTArtificial Sequencespacer
sequenceMISC_FEATURE(1)..(1)The Xaa at position 1 represents an
amino acid selected from glycine, alanine, valine, leucine,
isoleucine, proline, phenylalanine and
methionineMISC_FEATURE(2)..(2)The Xaa at position 2 represents any
amino acid other than tyrosineMISC_FEATURE(3)..(6)The Xaas at
positions 3-6 are independently any amino acid 10Xaa Xaa Xaa Xaa
Xaa Xaa Arg Arg1 5114PRTArtificial Sequencespacer sequence 11Pro
Gly Pro Glu1124PRTArtificial Sequencespacer sequence 12Phe Val Asn
Gln1135PRTArtificial Sequencespacer sequenceMISC_FEATURE(1)..(5)The
Xaas at positions 1-5 are independently any amino acid 13Xaa Xaa
Xaa Xaa Xaa1 5146PRTArtificial Sequencespacer sequence 14Ala Tyr
Arg Pro Ser Glu1 5154PRTArtificial Sequencespacer
sequenceMISC_FEATURE(1)..(4)The Xaas at positions 1-4 are
independently any amino acid 15Xaa Xaa Xaa Xaa1165PRTArtificial
Sequencespacer sequence 16Tyr Thr Pro Lys Thr1 51712PRTHomo sapiens
17Gly Tyr Gly Ser Ser Ser Arg Arg Ala Pro Gln Thr1 5 10188PRTHomo
sapiens 18Gly Tyr Gly Ser Ser Ser Arg Arg1 51921PRTArtificial
SequenceAnalog of the insulin A chainMISC_FEATURE(4)..(4)Xaa at
position 4 is aspartic acid or glutamic acidMISC_FEATURE(5)..(5)Xaa
at position 5 is glutamine or glutamic acidMISC_FEATURE(8)..(8)Xaa
at position 8 is histidine, threonine or
phenylalanineMISC_FEATURE(9)..(9)Xaa at position 9 is serine,
arginine, ornithine, lysine or alanineMISC_FEATURE(10)..(10)Xaa at
position 10 is isoleucine or serineMISC_FEATURE(12)..(12)Xaa at
position 12 is aspartic acid or serineMISC_FEATURE(14)..(14)Xaa at
position 14 is tyrosine, arginine, ornathine, lysine or
alanineMISC_FEATURE(15)..(15)Xaa at position 15 is glutamine,
glutamic acid, arginine, ornithine, alanine, lysine or
leucineMISC_FEATURE(17)..(17)Xaa at position 17 is glutamine or
glutamic acidMISC_FEATURE(18)..(18)Xaa at position 18 is
methionine, asparagine, glutamine, glutamic acid, aspartic acid or
threonineMISC_FEATURE(21)..(21)Xaa at position 21 is alanine,
glycine, serine, valine, threonine, isoleucine, leucine, glutamine,
glutamic acid, asparagine, aspartic acid, histidine, tryptophan,
tyrosine, or methionine 19Gly Ile Val Xaa Xaa Cys Cys Xaa Xaa Xaa
Cys Xaa Leu Xaa Xaa Leu1 5 10 15Xaa Xaa Tyr Cys Xaa
202021PRTArtificial SequenceAnalog of the insulin B
chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine or
threonineMISC_FEATURE(5)..(5)Xaa at position 5 is alanine, glycine
or serineMISC_FEATURE(6)..(6)Xaa at position 6 is histidine,
aspartic acid, glutamic acid, homocysteic acid or cysteic
acidMISC_FEATURE(9)..(9)Xaa at position 9 is aspartic acid,
glutamine or glutamic acidMISC_FEATURE(10)..(10)Xaa at position 10
is alanine or threonineMISC_FEATURE(17)..(17)Xaa at position 12 is
glutamic acid, aspartic acid or asparagineMISC_FEATURE(18)..(18)Xaa
at position 18 is alanine, ornithine, lysine or
arginineMISC_FEATURE(21)..(21)Xaa at position 21 is tyrosine or
4-amino-phenylalanine 20Xaa Leu Cys Gly Xaa Xaa Leu Val Xaa Xaa Leu
Tyr Leu Val Cys Gly1 5 10 15Xaa Xaa Gly Phe Xaa 20218PRTArtificial
Sequenceanalog of IGF-1 C peptideMISC_FEATURE(7)..(8)The Xaas at
positions 7 and 8 are independently arginine, lysine or ornithine
21Gly Tyr Gly Ser Ser Ser Xaa Xaa1 5228PRTArtificial SequenceAnalog
of IGF-1 C peptide 22Gly Ala Gly Ser Ser Ser Arg Arg1
52312PRTArtificial Sequencelinker sequence 23Gly Ala Gly Ser Ser
Ser Arg Arg Ala Pro Gln Thr1 5 10248PRTHomo sapiens 24Ser Arg Val
Ser Arg Arg Ser Arg1 52521PRTArtificial SequenceAnalog of the
insulin B chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine
or threonineMISC_FEATURE(5)..(5)Xaa at position 5 is alanine,
glycine or serineMISC_FEATURE(6)..(6)Xaa at position 6 is
histidine, aspartic acid, glutamic acid, homocysteic acid or
cysteic acidMISC_FEATURE(9)..(9)Xaa at position 9 is aspartic acid
or glutamic acidMISC_FEATURE(10)..(10)Xaa at position 10 is alanine
or threonineMISC_FEATURE(18)..(18)Xaa at position 18 is alanine,
ornithine, lysine or arginineMISC_FEATURE(21)..(21)Xaa at position
21 is tyrosine or phenylalanine 25Xaa Leu Cys Gly Xaa Xaa Leu Val
Xaa Xaa Leu Tyr Leu Val Cys Gly1 5 10 15Asp Xaa Gly Phe Xaa
20267PRTArtificial Sequenceamino acid terminal extension for
insulinMISC_FEATURE(2)..(6)the Xaas at positions 2-6 are
independently glutamic acid or aspartic acid 26Gly Xaa Xaa Xaa Xaa
Xaa Lys1 5277PRTArtificial Sequenceamio acid terminal extension for
insulinMISC_FEATURE(1)..(5)the Xaas at positions 1-5 are
independently glutamic acid or aspartic acid 27Xaa Xaa Xaa Xaa Xaa
Arg Lys1 52831PRTArtificial SequenceAnalog of IGF-1 B
chainMISC_FEATURE(28)..(28)The Xaa at position 28 is alanine
lysine, ornithine or arginine 28Gly Glu Glu Glu Glu Glu Lys Gly Pro
Glu His Leu Cys Gly Ala His1 5 10 15Leu Val Asp Ala Leu Tyr Leu Val
Cys Gly Asp Xaa Gly Phe Tyr 20 25 302921PRTArtificial
SequenceAnalog of the insulin A chainMISC_FEATURE(4)..(4)Xaa at
position 4 is aspartic acid or glutamic acidMISC_FEATURE(5)..(5)Xaa
at position 5 is glutamine or glutamic acidMISC_FEATURE(8)..(8)Xaa
at position 8 is histidine, threonine or
phenylalanineMISC_FEATURE(9)..(9)Xaa at position 9 is serine,
arginine, ornithine, lysine or alanineMISC_FEATURE(10)..(10)Xaa at
position 10 is isoleucine or serineMISC_FEATURE(12)..(12)Xaa at
position 12 is aspartic acid or serineMISC_FEATURE(14)..(14)Xaa at
position 14 is tyrosine, arginine, ornathine, lysine or
alanineMISC_FEATURE(15)..(15)Xaa at position 15 is glutamine,
glutamic acid, arginine, ornithine, alanine, lysine or
leucineMISC_FEATURE(17)..(17)Xaa at position 17 is glutamine or
glutamic acidMISC_FEATURE(18)..(18)Xaa at position 18 is
methionine, asparagine, glutamine, glutamic acid, aspartic acid or
threonineMISC_FEATURE(19)..(19)Xaa at position 19 is tyrosine,
4-methoxy phenylalanine or
4-amino-phenylalanineMISC_FEATURE(21)..(21)Xaa at position 21 is
alanine, glycine, serine, valine, threonine, isoleucine, leucine,
glutamine, glutamic acid, asparagine, aspartic acid, histidine,
tryptophan, tyrosine, or methionine 29Gly Ile Val Xaa Xaa Cys Cys
Xaa Xaa Xaa Cys Xaa Leu Xaa Xaa Leu1 5 10 15Xaa Xaa Xaa Cys Xaa
203021PRTArtificial SequenceAnalog of insulin A
chainMISC_FEATURE(8)..(8)Xaa at position 8 is threonine or
histidineMISC_FEATURE(19)..(19)Xaa at position 19 is tyrosine,
4-methoxy-phenylalanine or 4-amino
phenylalanineMISC_FEATURE(21)..(21)Xaa at position 21 is asparagine
or glycine 30Gly Ile Val Glu Gln Cys Cys Xaa Ser Ile Cys Ser Leu
Tyr Gln Leu1 5 10 15Glu Asn Xaa Cys Xaa 203121PRTArtificial
SequenceAnalog of insulin B chainMISC_FEATURE(1)..(1)Xaa at
position 1 is histidine or threonineMISC_FEATURE(5)..(5)Xaa at
position 5 is alanine, glycine or serineMISC_FEATURE(6)..(6)Xaa at
position 6 is histidine, aspartic acid, glutamic acid, homocysteic
acid or cysteic acid 31Xaa Leu Cys Gly Xaa Xaa Leu Val Glu Ala Leu
Tyr Leu Val Cys Gly1 5 10 15Glu Arg Gly Phe Phe 203221PRTArtificial
SequenceAnalog of the insulin A chainMISC_FEATURE(8)..(8)Xaa at
position 8 is histidine or threonineMISC_FEATURE(17)..(17)Xaa at
position 17 is glutamine or glutamic acidMISC_FEATURE(21)..(21)Xaa
at position 21 is asparagine or glycine 32Gly Ile Val Glu Gln Cys
Cys Xaa Ser Ile Cys Ser Leu Tyr Gln Leu1 5 10 15Xaa Asn Tyr Cys Xaa
203321PRTArtificial SequenceAnalog of the insulin B
chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine or
threonineMISC_FEATURE(5)..(5)Xaa at position 5 is alanine, glycine
or serineMISC_FEATURE(6)..(6)Xaa at position 6 is histidine,
aspartic acid, glutamic acid, homocysteic acid or cysteic acid
33Xaa Leu Cys Gly Xaa Xaa Leu Val Glu Ala Leu Tyr Leu Val Cys Gly1
5 10 15Glu Arg Gly Phe Phe 203427PRTArtificial SequenceAnalog of
the insulin B chainMISC_FEATURE(1)..(1)Xaa at position 1 is
phenylalanine and desamino-phenylalanineMISC_FEATURE(5)..(5)Xaa at
position 5 is histidine and threonineMISC_FEATURE(9)..(9)Xaa at
position 9 is alanine, glycine or serineMISC_FEATURE(10)..(10)Xaa
at position 10 is histidine, aspartic acid, glutamic acid,
homocysteic acid or cysteic acid 34Xaa Val Asn Gln Xaa Leu Cys Gly
Xaa Xaa Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly
Phe Phe Tyr Thr 20 253521PRTArtificial SequenceAnalog of the
insulin A chainMISC_FEATURE(8)..(8)Xaa at position 8 is histidine
or phenylalnineMISC_FEATURE(9)..(9)Xaa at position 9 is arginine,
lysine, ornithine or alanineMISC_FEATURE(14)..(14)Xaa at position
14 is arginine, lysine, ornithine or
alanineMISC_FEATURE(15)..(15)Xaa at position 15 is arginine,
lysine, ornithine or leucineMISC_FEATURE(17)..(17)Xaa at position
17 is glutamine or glutamic acidMISC_FEATURE(18)..(18)Xaa at
position 18 is methionine, asparagine or
threonineMISC_FEATURE(19)..(19)Xaa at position 19 is tyrosine,
4-methoxy phenylalanine or
4-amino-phenylalanineMISC_FEATURE(21)..(21)Xaa at position 21 is
alanine, glycine or asparagine 35Gly Ile Val Asp Glu Cys Cys Xaa
Xaa Ser Cys Asp Leu Xaa Xaa Leu1 5 10 15Xaa Xaa Xaa Cys Xaa
203621PRTArtificial SequenceAnalog of the insulin B
chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine or
threonineMISC_FEATURE(5)..(5)Xaa at position 5 is alanine, glycine
or serineMISC_FEATURE(6)..(6)Xaa at position 6 is histidine,
aspartic acid, glutamic acid, homocysteic acid or cysteic
acidMISC_FEATURE(9)..(9)Xaa at position 9 is aspartic acid or
glutamic acidMISC_FEATURE(10)..(10)Xaa at position 10 is alanine or
threonineMISC_FEATURE(18)..(18)Xaa at position 18 is alanine,
ornithine, lysine or arginineMISC_FEATURE(21)..(21)Xaa at position
21 is tyrosine or phenylalanine 36Xaa Leu Cys Gly Xaa Xaa Leu Val
Xaa Xaa Leu Tyr Leu Val Cys Gly1 5 10 15Asp Xaa Gly Phe Xaa
203721PRTArtificial SequenceAnalog of the insulin A
chainMISC_FEATURE(9)..(9)Xaa at position 9 is arginine, ornithine,
or lysineMISC_FEATURE(14)..(14)Xaa at position 14 is arginine,
ornithine, or lysineMISC_FEATURE(15)..(15)Xaa at position 15 is
arginine, ornithine, or lysineMISC_FEATURE(17)..(17)Xaa at position
17 is glutamine or glutamic acidMISC_FEATURE(19)..(19)Xaa at
position 19 is tyrosine, 4-methoxy phenylalanine or
4-amino-phenylalanineMISC_FEATURE(21)..(21)Xaa at position 21 is
alanine, glycine or asparagine 37Gly Ile Val Asp Glu Cys Cys His
Xaa Ser Cys Asp Leu Xaa Xaa Leu1 5 10 15Xaa Met Xaa Cys Xaa
203821PRTArtificial SequenceAnalog of the insulin B
chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine or
threonineMISC_FEATURE(6)..(6)Xaa at position 6 is histidine,
aspartic acid, or glutamic acidMISC_FEATURE(18)..(18)Xaa at
position 18 is alanine, ornithine, lysine or
arginineMISC_FEATURE(21)..(21)Xaa at position 21 is tyrosine or
phenylalanine 38Xaa Leu Cys Gly Ala Xaa Leu Val Asp Ala Leu Tyr Leu
Val Cys Gly1 5 10 15Asp Xaa Gly Phe Xaa 203921PRTArtificial
Sequenceanalog of insulin B chainMISC_FEATURE(18)..(18)The Xaa at
position 18 is ornithine, lysine or arginine 39His Leu Cys Gly Ala
Glu Leu Val Asp Ala Leu Tyr Leu Val Cys Gly1 5 10 15Asp Xaa Gly Phe
Tyr 204024PRTArtificial Sequenceanalog of IGF-1 B
chainMISC_FEATURE(21)..(21)The Xaa at position 21 is ornithine,
lysine or arginine 40Gly Pro Glu His Leu Cys Gly Ala Glu Leu Val
Asp Ala Leu Tyr Leu1 5 10 15Val Cys Gly Asp Xaa Gly Phe Tyr
204129PRTArtificial SequenceAnalog of IGF-1 B
chainMISC_FEATURE(21)..(21)The Xaa at position 21 is ornithine,
lysine or arginine 41Gly Pro Glu His Leu Cys Gly Ala Glu Leu Val
Asp Ala Leu Tyr Leu1 5 10 15Val Cys Gly Asp Xaa Gly Phe Tyr Phe Asn
Pro Lys Thr 20 254229PRTArtificial SequenceAnalog of IGF-1 B
chainMISC_FEATURE(21)..(21)The Xaa at position 21 is ornithine,
lysine or arginine 42Gly Pro Glu His Leu Cys Gly Ala Glu Leu Val
Asp Ala Leu Tyr Leu1 5 10 15Val Cys Gly Asp Xaa Gly Phe Tyr Phe Asn
Lys Pro Thr 20 254321PRTArtificial SequenceAnalog of the insulin A
chainMISC_FEATURE(9)..(9)Xaa at position 9 is arginine, ornithine,
or lysineMISC_FEATURE(14)..(14)Xaa at position 14 is arginine,
ornithine, or lysineMISC_FEATURE(15)..(15)Xaa at position 15 is
arginine, ornithine, or lysine 43Gly Ile Val Asp Glu Cys Cys His
Xaa Ser Cys Asp Leu Xaa Xaa Leu1 5 10 15Gln Met Tyr Cys Asn
204421PRTArtificial SequenceAnalog of the insulin A
chainMISC_FEATURE(8)..(8)Xaa at position 8 is threonine, histidine
or phenylalnineMISC_FEATURE(19)..(19)Xaa at position 19 is
tyrosine, 4-methoxy phenylalanine or 4-amino-phenylalanine 44Gly
Ile Val Asp Glu Cys Cys Xaa Arg Ser Cys Asp Leu Tyr Gln Leu1 5 10
15Glu Asn Xaa Cys Asn 204521PRTArtificial SequenceAnalog of the
insulin B chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine
or threonineMISC_FEATURE(18)..(18)Xaa at position 18 is alanine,
ornithine, lysine or arginineMISC_FEATURE(21)..(21)Xaa at position
21 is tyrosine, histidine, asparagine or phenylalanine 45Xaa Leu
Cys Gly Ser His Leu Val Asp Ala Leu Tyr Leu Val Cys Gly1 5 10
15Asp Xaa Gly Phe Xaa 204621PRTArtificial SequenceAnalog of the
insulin A chainMISC_FEATURE(19)..(19)Xaa at position 19 is
tyrosine, 4-methoxy phenylalanine or
4-amino-phenylalanineMISC_FEATURE(21)..(21)Xaa at position 21 is
alanine, glycine or asparagine 46Gly Ile Val Glu Gln Cys Cys His
Ser Ile Cys Ser Leu Tyr Gln Leu1 5 10 15Glu Asn Xaa Cys Xaa
204721PRTHomo sapiensMISC_FEATURE(19)..(19)The Xaa at position 19
is tyrosine, 4-methoxy-phenylalanine or 4-amino
phenylalanineMISC_FEATURE(21)..(21)The Xaa at position 21 is
alanine, glycine or asparagine 47Gly Ile Val Asp Glu Cys Cys His
Arg Ser Cys Asp Leu Arg Arg Leu1 5 10 15Glu Met Xaa Cys Xaa
204829PRTHomo sapiens 48Gly Pro Glu Thr Leu Cys Gly Ala Glu Leu Val
Asp Ala Leu Tyr Leu1 5 10 15Val Cys Gly Asp Arg Gly Phe Tyr Phe Asn
Pro Lys Thr 20 25498PRTArtificial Sequencelinker
sequenceMISC_FEATURE(1)..(1)Xaa at position1 is glycine, alanine,
valine, leucine, isoleucine, proline, phenylalanine and
methionineMISC_FEATURE(2)..(2)Xaa at position 2 is any non-aromatic
amino acidMISC_FEATURE(7)..(8)Xaas at positions 7 and 8 are
independently arginine, lysine or ornithine 49Xaa Xaa Gly Ser Ser
Ser Xaa Xaa1 55012PRTArtificial Sequencelinker
sequenceMISC_FEATURE(1)..(1)Xaa at position1 is glycine, alanine,
valine, leucine, isoleucine, proline, phenylalanine and
methionineMISC_FEATURE(2)..(2)Xaa at position 2 is any non-aromatic
amino acidMISC_FEATURE(7)..(8)Xaas at positions 7 and 8 are
independently arginine, lysine or ornithine 50Xaa Xaa Gly Ser Ser
Ser Xaa Xaa Ala Pro Gln Thr1 5 105129PRTHomo sapiens 51Ser Ser Ser
Ser Arg Ala Pro Pro Pro Ser Leu Pro Ser Pro Ser Arg1 5 10 15Leu Pro
Gly Pro Ser Asp Thr Pro Ile Leu Pro Gln Lys 20 255229PRTHomo
sapiens 52Ser Ser Ser Ser Lys Ala Pro Pro Pro Ser Leu Pro Ser Pro
Ser Arg1 5 10 15Leu Pro Gly Pro Ser Asp Thr Pro Ile Leu Pro Gln Arg
20 25538PRTArtificial Sequencelinker
sequenceMISC_FEATURE(1)..(1)Xaa at position 1 is glycine, alanine,
valine, leucine, isoleucine, proline, phenylalanine and
methionineMISC_FEATURE(2)..(2)Xaa at position 2 is any non-aromatic
amino acid 53Xaa Xaa Gly Ser Ser Ser Arg Arg1 55412PRTArtificial
SequenceAnalog of IGF-1 C peptideMISC_FEATURE(8)..(8)The Xaa at
positions 8 is arginine, lysine or ornithine 54Gly Ala Gly Ser Ser
Ser Arg Xaa Ala Pro Gln Thr1 5 105512PRTArtificial Sequencelinker
sequenceMISC_FEATURE(2)..(2)Xaa at position 2 is any non-aromatic
amino acidMISC_FEATURE(8)..(8)Xaa at position 8 is arginine, lysine
or ornithine 55Gly Xaa Gly Ser Ser Ser Arg Xaa Ala Pro Gln Thr1 5
10568PRTArtificial Sequencelinker sequenceMISC_FEATURE(2)..(2)Xaa
at position 2 is any non-aromatic amino acid 56Gly Xaa Gly Ser Ser
Ser Arg Arg1 5579PRTArtificial Sequencelinker sequence 57Gly Ala
Gly Ser Ser Ser Arg Arg Ala1 55810PRTArtificial Sequencelinker
sequence 58Gly Ala Gly Ser Ser Ser Arg Arg Ala Pro1 5
105911PRTArtificial SequenceAnalog of IGF-1 C peptide 59Gly Ala Gly
Ser Ser Ser Arg Arg Ala Pro Gln1 5 106012PRTArtificial
Sequencelinker sequence 60Gly Ala Gly Ser Ser Ser Arg Arg Ala Pro
Gln Thr1 5 10618PRTArtificial Sequencelinker sequence 61Pro Tyr Gly
Ser Ser Ser Arg Arg1 5628PRTArtificial Sequencelinker sequence
62Pro Ala Gly Ser Ser Ser Arg Arg1 5639PRTArtificial Sequencelinker
sequence 63Pro Ala Gly Ser Ser Ser Arg Arg Ala1 56410PRTArtificial
Sequencelinker sequence 64Pro Ala Gly Ser Ser Ser Arg Arg Ala Pro1
5 106511PRTArtificial Sequencelinker sequence 65Pro Ala Gly Ser Ser
Ser Arg Arg Ala Pro Gln1 5 106612PRTArtificial Sequencelinker
sequence 66Pro Ala Gly Ser Ser Ser Arg Arg Ala Pro Gln Thr1 5
106728PRTHomo sapiens 67Ser Ser Ser Ser Arg Ala Pro Pro Pro Ser Leu
Pro Ser Pro Ser Arg1 5 10 15Leu Pro Gly Pro Ser Asp Thr Pro Ile Leu
Pro Gln 20 256829PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at position
5 is lysine or ArginineMISC_FEATURE(29)..(29)Xaa at position 29 is
lysine or Arginine 68Ser Ser Ser Ser Xaa Ala Pro Pro Pro Ser Leu
Pro Ser Pro Ser Arg1 5 10 15Leu Pro Gly Pro Ser Asp Thr Pro Ile Leu
Pro Gln Xaa 20 256912PRTArtificial Sequencelinker
sequenceMISC_FEATURE(7)..(8)Xaas at positions 7 and 8 are
independently arginine, lysine or ornithine 69Gly Tyr Gly Ser Ser
Ser Xaa Xaa Ala Pro Gln Thr1 5 10704PRTHomo sapiens 70Tyr Thr Pro
Lys1714PRTHomo sapiens 71Phe Asn Lys Pro17229PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(1)..(1)Xaa at position 1 =
His, D-histidine, desaminohistidine, hydroxyl-histidine, acetyl-
histidine, homo-histidine or alpha, alpha-dimethyl imidiazole
acetic acid (DMIA), N-methyl histidine, alpha-methyl histidine, or
imidazole acetic acidMISC_FEATURE(2)..(2)Xaa at position 2 = Ser,
D-serine, Ala, D-alanine, Val, glycine, n-methyl serine,
aminoisobutyric acid (AIB) or N-methyl
alanineMISC_FEATURE(3)..(3)Xaa at position 3 is Gln, Glu, Orn or
NleMISC_FEATURE(10)..(10)Xaa at position 10 = Tyr, Val or
TrpMISC_FEATURE(12)..(12)Xaa at position 12 = Ser, Lys or
ArgMISC_FEATURE(15)..(15)Xaa at position 15 = Asp, Glu, cysteic
acid, homoglutamic acid and homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Gly, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(17)..(17)Xaa at
position 17 = Arg, Gln, Lys, Cys, Orn, homocycstein or acetyl
phenylalanineMISC_FEATURE(18)..(18)Xaa at position 18 = Arg,
Ala,Lys, Cys, Orn, homocycstein or acetyl
phenylalanineMISC_FEATURE(20)..(20)Xaa at position 20 = Gln, Lys,
arginine, ornithine or citrullineMISC_FEATURE(21)..(21)Xaa at
position 21 = Gln, Glu, Asp, Lys, Cys, Orn, homocycstein or acetyl
phenyalanineMISC_FEATURE(23)..(23)Xaa at position 23 is Val or
IleMISC_FEATURE(24)..(24)Xaa at position 24 = Ala, Gln, Glu, Lys,
Cys, Orn, homocycstein or acetyl
phenyalanineMISC_FEATURE(27)..(27)Xaa at position 27 = Met, Leu,
Val or NleMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Lys or
AspMISC_FEATURE(29)..(29)Xaa at position 29 is Thr, Gly, Lys, Cys,
Orn, homocycstein or acetyl phenyalanine 72Xaa Xaa Xaa Gly Thr Phe
Thr Ser Asp Xaa Ser Xaa Tyr Leu Xaa Xaa1 5 10 15Xaa Xaa Ala Xaa Xaa
Phe Xaa Xaa Trp Leu Xaa Xaa Xaa 20 257321PRTArtificial
SequenceAnalog of Insulin A chainMISC_FEATURE(8)..(8)Xaa at
position 8 is threonine or histidineMISC_FEATURE(9)..(9)Xaa at
position 9 is valine or tyrosineMISC_FEATURE(21)..(21)Xaa at
position 21 is asparagine or glycine 73Gly Ile Val Glu Gln Cys Cys
Xaa Xaa Ile Cys Ser Leu Tyr Gln Leu1 5 10 15Glu Asn Tyr Cys Xaa
207421PRTArtificial SequenceAnalog of the insulin A
chainMISC_FEATURE(8)..(8)Xaa at position 8 is histidine or
phenylalnineMISC_FEATURE(9)..(9)Xaa at position 9 is arginine,
lysine, ornithine or alanineMISC_FEATURE(19)..(19)Xaa at position
19 is tyrosine, 4-methoxy phenylalanine or
4-amino-phenylalanineMISC_FEATURE(21)..(21)Xaa at position 21 is
alanine, glycine or asparagine 74Gly Ile Val Asp Glu Cys Cys Xaa
Xaa Ser Cys Asp Leu Arg Arg Leu1 5 10 15Glu Met Xaa Cys Xaa
207521PRTArtificial SequenceAnalog of the insulin B
chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine or
threonineMISC_FEATURE(6)..(6)Xaa at position 6 is histidine,
aspartic acid, glutamic acid, homocysteic acid or cysteic
acidMISC_FEATURE(18)..(18)Xaa at position 18 is alanine, ornithine,
lysine or arginine 75Xaa Leu Cys Gly Ala Xaa Leu Val Asp Ala Leu
Tyr Leu Val Cys Gly1 5 10 15Asp Xaa Gly Phe Tyr 20768PRTArtificial
SequenceAnalog of IGF-1 C peptideMISC_FEATURE(7)..(8)The Xaas at
positions 7 and 8 are independently arginine, lysine or ornithine
76Gly Ala Gly Ser Ser Ser Xaa Xaa1 57712PRTArtificial
SequenceAnalog of IGF-1 C peptideMISC_FEATURE(7)..(8)The Xaas at
positions 7 and 8 are independently arginine, lysine or ornithine
77Gly Tyr Gly Ser Ser Ser Xaa Xaa Ala Pro Gln Thr1 5
107810PRTArtificial Sequencepeptide fragment representing the
carboxy terminal 10 amino acids of Exendin-4 78Gly Pro Ser Ser Gly
Ala Pro Pro Pro Ser1 5 107910PRTArtificial Sequencepeptide fragment
representing the carboxy terminal 10 amino acids of
Exendin-4MOD_RES(10)..(10)AMIDATION 79Gly Pro Ser Ser Gly Ala Pro
Pro Pro Ser1 5 108011PRTArtificial Sequencepeptide fragment
representing the carboxy terminal 10 amino acids of
Exendin-4MISC_FEATURE(11)..(11)pegylated 80Gly Pro Ser Ser Gly Ala
Pro Pro Pro Ser Cys1 5 108129PRTHomo
sapiensMISC_FEATURE(15)..(15)Xaa at position 15 = Asp, Glu,
homoglutamic acid, cysteic acid or homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = Gln or LysMISC_FEATURE(24)..(24)Xaa at position 24 =
Gln or GluMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Lys or an
acidic amino acidMISC_FEATURE(29)..(29)Xaa at position 29 = Thr,
Gly or an acidic amino acid 81His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Xaa Xaa1 5 10 15Arg Arg Ala Xaa Asp Phe Val Xaa
Trp Leu Met Xaa Xaa 20 258229PRTHomo
sapiensMISC_FEATURE(15)..(15)Xaa at position 15 = Asp, Glu, cysteic
acid, homoglutamic acid or homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = Gln or LysMISC_FEATURE(24)..(24)Xaa at position 24 =
Gln or GluMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Asp or
LysMISC_FEATURE(29)..(29)Xaa at position 29 is Thr or Gly 82His Ser
Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Xaa1 5 10 15Arg
Arg Ala Xaa Asp Phe Val Xaa Trp Leu Met Xaa Xaa 20
258329PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(3)..(3)Xaa at position 3= Glu, Orn or
NleMISC_FEATURE(15)..(15)Xaa at position 15 = Asp, Glu,
homoglutamic acid, cysteic acid or homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = Gln or LysMISC_FEATURE(24)..(24)Xaa at position 24 =
Gln or GluMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Lys or an
acidic amino acidMISC_FEATURE(29)..(29)Xaa at position 29 = Thr or
an acidic amino acid 83His Ser Xaa Gly Thr Phe Thr Ser Asp Tyr Ser
Lys Tyr Leu Xaa Xaa1 5 10 15Arg Arg Ala Xaa Asp Phe Val Xaa Trp Leu
Met Xaa Xaa 20 258429PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(15)..(15)Xaa at position 15 is Glu or
AspMISC_FEATURE(28)..(28)Xaa at position 28 is Glu or
AspMOD_RES(29)..(29)AMIDATION 84His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Xaa Glu1 5 10 15Arg Arg Ala Gln Asp Phe Val Gln
Trp Leu Met Xaa Thr 20 258529PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(12)..(16)lactam ring formed between side chain
of Lys 12 and Glu 16MISC_FEATURE(15)..(15)Xaa at position 15 is Glu
or AspMISC_FEATURE(28)..(28)Xaa at position 28 is Glu or
AspMOD_RES(29)..(29)AMIDATION 85His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Xaa Glu1 5 10 15Arg Arg Ala Gln Asp Phe Val Gln
Trp Leu Met Xaa Thr 20 258629PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(15)..(15)Xaa at position 15 is Glu or
AspMISC_FEATURE(16)..(20)lactam ring formed between side chain of
Glu 16 and Lys 20MISC_FEATURE(28)..(28)Xaa at position 28 is Glu or
AspMOD_RES(29)..(29)AMIDATION 86His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Xaa Glu1 5 10 15Arg Arg Ala Lys Asp Phe Val Gln
Trp Leu Met Xaa Thr 20 258729PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(15)..(15)Xaa at position 15 is Glu or
AspMISC_FEATURE(20)..(24)lactam ring formed between side chain of
Lys 20 and Glu 24MISC_FEATURE(28)..(28)Xaa at position 28 is Glu or
AspMOD_RES(29)..(29)AMIDATION 87His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Xaa Ser1 5 10 15Arg Arg Ala Lys Asp Phe Val Glu
Trp Leu Met Xaa Thr 20 258829PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(15)..(15)Xaa at position 15 is Glu or
AspMISC_FEATURE(24)..(28)lactam ring formed between side chain of
Glu 24 and Lys 28MISC_FEATURE(29)..(29)Xaa at position 29 is Glu or
ThrMOD_RES(29)..(29)AMIDATION 88His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Xaa Ser1 5 10 15Arg Arg Ala Gln Asp Phe Val Glu
Trp Leu Met Lys Xaa 20 258929PRTHomo
sapiensMISC_FEATURE(27)..(27)Xaa at position 27 is Met, Leu or Nle
89His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1
5 10 15Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Xaa Asn Thr 20
259029PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(16)..(16)Xaa is Glu, Gln, homoglutamic acid or
homocysteic acidMISC_FEATURE(17)..(17)Xaa is Arg, Cys, Orn,
homocysteine or acetyl phenylalanineMISC_FEATURE(27)..(27)Xaa at
position 27 is Met, Leu or Nle 90His Ser Gln Gly Thr Phe Thr Ser
Asp Tyr Ser Lys Tyr Leu Asp Xaa1 5 10 15Xaa Arg Ala Gln Asp Phe Val
Gln Trp Leu Xaa Asn Thr 20 259129PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(16)..(16)Xaa is Glu, Gln, homoglutamic acid or
homocysteic acidMISC_FEATURE(21)..(21)Xaa is Asp, Cys, Orn,
homocysteine or acetyl phenyalanineMISC_FEATURE(27)..(27)Xaa at
position 27 is Met, Leu or Nle 91His Ser Gln Gly Thr Phe Thr Ser
Asp Tyr Ser Lys Tyr Leu Asp Xaa1 5 10 15Arg Arg Ala Gln Xaa Phe Val
Gln Trp Leu Xaa Asn Thr 20 259229PRTArtificial Sequenceglucagon
analogMISC_FEATURE(16)..(16)Xaa is Glu, Gln, homoglutamic acid or
homocysteic acidMISC_FEATURE(24)..(24)Xaa is Gln, Cys, Orn,
homocysteine or acetyl phenylalanineMISC_FEATURE(27)..(27)Xaa at
postion 27 is Met, Leu or Nle 92His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Asp Xaa1 5 10 15Arg Arg Ala Gln Asp Phe Val Xaa
Trp Leu Xaa Asn Thr 20 259329PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(16)..(16)Xaa is Glu, Gln, homoglutamic acid or
homocysteic acidMISC_FEATURE(21)..(21)Xaa is Asp, Cys, Orn,
homocysteine or acetyl phenyalanineMISC_FEATURE(24)..(24)Xaa is
Gln, Cys, Orn, homocysteine or acetyl
phenyalanineMISC_FEATURE(27)..(27)Xaa at position 27 is Met, Leu or
Nle 93His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp
Xaa1 5 10 15Arg Arg Ala Gln Xaa Phe Val Xaa Trp Leu Xaa Asn Thr 20
259429PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(21)..(21)Xaa is Asp, Cys, Orn, homocysteine or
acetyl phenyalanineMISC_FEATURE(27)..(27)Xaa is Met, Leu or Nle
94His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1
5 10 15Arg Arg Ala Gln Xaa Phe Val Gln Trp Leu Xaa Asn Thr 20
259529PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(24)..(24)Xaa at position 24 is Gln, Cys, Orn,
homocysteine or acetyl phenylalanineMISC_FEATURE(27)..(27)Xaa at
position 27 is Met, Leu or Nle 95His Ser Gln Gly Thr Phe Thr Ser
Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Gln Asp Phe Val
Xaa Trp Leu Xaa Asn Thr 20 259629PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(16)..(16)Xaa at position 16 is Glu, Gln,
homoglutamic acid or homocysteic acid 96His
Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Xaa1 5 10
15Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr 20
259729PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(27)..(27)Xaa at position 27 = Met, Leu or Nle
97His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1
5 10 15Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Xaa Asn Thr 20
259829PRTArtificial SequenceGlucagon analogue 98His Ser Gln Gly Thr
Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Gln
Asp Phe Val Gln Trp Leu Met Asn Thr 20 259929PRTArtificial
SequenceGlucagon analogueMOD_RES(29)..(29)AMIDATION 99His Ser Gln
Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg
Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr 20 2510029PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(12)..(16)lactam ring formed
between side chain of Lys 12 and Glu 16 100His Ser Gln Gly Thr Phe
Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Gln Asp
Phe Val Gln Trp Leu Met Asn Thr 20 2510129PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(16)..(20)lactam ring formed
between side chain of Glu 16 and Lys 20 101His Ser Gln Gly Thr Phe
Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Lys Asp
Phe Val Gln Trp Leu Met Asn Thr 20 2510229PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(20)..(24)lactam ring formed
between side chain of Lys 20 and Glu 24 102His Ser Gln Gly Thr Phe
Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala Lys Asp
Phe Val Glu Trp Leu Met Asn Thr 20 2510329PRTHomo
sapiensMISC_FEATURE(24)..(28)lactam ring formed between side chain
of Glu 24 and Lys 28 103His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser
Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala Gln Asp Phe Val Glu Trp Leu
Met Lys Thr 20 2510429PRTHomo sapiensMISC_FEATURE(12)..(16)lactam
ring formed between side chain of Lys 12 and Glu
16MISC_FEATURE(20)..(24)lactam ring formed between side chain of
Lys 20 and Glu 24 104His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser
Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Lys Asp Phe Val Glu Trp Leu
Met Asn Thr 20 2510529PRTHomo sapiensMISC_FEATURE(16)..(20)lactam
ring formed between side chain of Lys 12 and Glu
16MISC_FEATURE(24)..(28)lactam ring formed between side chain of
Glu 24 and Lys 28 105His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser
Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Asp Asp Phe Val Glu Trp Leu
Met Lys Thr 20 2510629PRTHomo sapiensMISC_FEATURE(16)..(20)lactam
ring formed between side chain of Glu 16 and Lys
20MISC_FEATURE(24)..(28)lactam ring formed between side chain of
Glu 24 and Lys 28 106His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser
Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Lys Asp Phe Val Glu Trp Leu
Met Lys Thr 20 2510730PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(30)..(30)Xaa = any amino
acidMOD_RES(30)..(30)AMIDATION 107His Ser Gln Gly Thr Phe Thr Ser
Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Gln Asp Phe Val
Gln Trp Leu Met Asn Thr Xaa 20 25 3010829PRTHomo
sapiensMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = glutamine, lysine, arginine, ornithine or
citrullineMISC_FEATURE(24)..(24)Xaa at position 24 = Gln or
GluMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Asp or
LysMISC_FEATURE(29)..(29)Xaa at position 29 = Thr or Gly 108His Ser
Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Xaa1 5 10 15Arg
Arg Ala Xaa Asp Phe Val Xaa Trp Leu Met Xaa Xaa 20
2510929PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(12)..(16)lactam ring formed between side chain
of Lys 12 and Glu 16MISC_FEATURE(28)..(28)Xaa at position 28 is Asp
or AsnMISC_FEATURE(29)..(29)Xaa at position 29 is Thr or Gly 109His
Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10
15Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Xaa Xaa 20
2511029PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(16)..(20)lactam ring formed between side chain
of Glu 16 and Lys 20MISC_FEATURE(28)..(28)Xaa at position 28 is Asp
or AsnMISC_FEATURE(29)..(29)Xaa at position 29 is Thr or Gly 110His
Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10
15Arg Arg Ala Lys Asp Phe Val Gln Trp Leu Met Xaa Xaa 20
2511129PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(20)..(24)lactam ring formed between side chain
of Lys 20 and Glu 24MISC_FEATURE(28)..(28)Xaa at position 28 is Asp
or AsnMISC_FEATURE(29)..(29)Xaa at position 29 is Thr or Gly 111His
Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1 5 10
15Arg Arg Ala Lys Asp Phe Val Glu Trp Leu Met Xaa Xaa 20
2511229PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(24)..(28)lactam ring formed between side chain
of Glu 24 and Lys 28MISC_FEATURE(29)..(29)Xaa at position 29 is Thr
or Gly 112His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu
Asp Ser1 5 10 15Arg Arg Ala Gln Asp Phe Val Glu Trp Leu Met Lys Xaa
20 2511329PRTHomo sapiensMISC_FEATURE(16)..(16)Xaa at position 16 =
Ser, Glu, Gln, homoglutamic acid or homocysteic
acidMISC_FEATURE(20)..(20)Xaa at position 20 = glutamine, lysine,
arginine, ornithine or citrullineMISC_FEATURE(24)..(24)Xaa at
position 24 = Gln or GluMISC_FEATURE(28)..(28)Xaa at position 28 =
Asn, Asp or LysMISC_FEATURE(29)..(29)Xaa at position 29 = Thr or
Gly 113His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp
Xaa1 5 10 15Arg Arg Ala Xaa Asp Phe Val Xaa Trp Leu Met Xaa Xaa 20
2511429PRTHomo sapiens 114His Ser Gln Gly Thr Phe Thr Ser Asp Tyr
Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Lys Asp Phe Val Gln Trp
Leu Met Asn Thr 20 2511529PRTArtificial Sequenceglucagon analogue
115His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1
5 10 15Arg Arg Ala Lys Asp Phe Val Glu Trp Leu Met Asn Thr 20
2511629PRTArtificial Sequenceglucagon analogue 116His Ser Gln Gly
Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala
Gln Asp Phe Val Glu Trp Leu Met Lys Thr 20 251178PRTArtificial
Sequencepeptide fragment representing the carboxy terminal 8 amino
acids of oxyntomodulin 117Lys Arg Asn Arg Asn Asn Ile Ala1
51184PRTArtificial Sequencepeptide fragment representing the amino
4 amino acids of oxyntomodulin carboxy terminus of SEQ ID NO 27
118Lys Arg Asn Arg111929PRThomo sapiens 119His Ser Gln Gly Thr Phe
Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Lys Asp
Phe Val Gln Trp Leu Met Asn Thr 20 2512029PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(1)..(1)Xaa at position 1 =
His, D-histidine, desaminohistidine, hydroxyl-histidine, acetyl-
histidine, homo-histidine or alpha, alpha-dimethyl imidiazole
acetic acid (DMIA), N-methyl histidine, alpha-methyl histidine, or
imidazole acetic acidMISC_FEATURE(2)..(2)Xaa at position 2 = Ser,
D-serine, Ala, D-alanine, Val, glycine, n-methyl serine,
aminoisobutyric acid (AIB) or N-methyl
alanineMISC_FEATURE(3)..(3)Xaa at position 3 is Gln, Glu, Orn or
NleMISC_FEATURE(15)..(15)Xaa at position 15 = Asp, Glu, cysteic
acid, homoglutamic acid and homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = Gln, Lys, arginine, ornithine or
citrullineMISC_FEATURE(21)..(21)Xaa at position 21 = Gln, Glu, Asp,
Lys, Cys, Orn, homocycstein or acetyl
phenyalanineMISC_FEATURE(23)..(23)Xaa at position 23 is Val or
IleMISC_FEATURE(24)..(24)Xaa at position 24 = Ala, Gln, Glu, Lys,
Cys, Orn, homocycstein or acetyl
phenyalanineMISC_FEATURE(27)..(27)Xaa at position 27 = Met, Leu or
NleMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Lys or
AspMISC_FEATURE(29)..(29)Xaa at position 29 is Thr or Gly, Lys,
Cys, Orn, homocycstein or acetyl phenyalanine 120Xaa Xaa Xaa Gly
Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Xaa Xaa1 5 10 15Arg Arg Ala
Xaa Xaa Phe Xaa Xaa Trp Leu Xaa Xaa Xaa 20 2512138PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(15)..(15)Xaa at position 15 =
Asp, Glu, homoglutamic acid, cysteic acid or homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = Gln or LysMISC_FEATURE(24)..(24)Xaa at position 24 =
Gln or GluMISC_FEATURE(28)..(28)Xaa at position 28 = Asn, Lys or
Asp 121His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Xaa
Xaa1 5 10 15Arg Arg Ala Xaa Asp Phe Val Xaa Trp Leu Met Xaa Gly Gly
Pro Ser 20 25 30Ser Gly Pro Pro Pro Ser 3512229PRTArtificial
Sequenceglucagon analogueMISC_FEATURE(16)..(16)Xaa at position 16 =
Ser, Glu, Gln, homoglutamic acid or homocysteic
acidMISC_FEATURE(20)..(20)Xaa at position 20 = Gln or
LysMISC_FEATURE(21)..(21)Xaa at position 21 = Asp, Lys, Cys, Orn,
homocycstein or acetyl phenyalanineMISC_FEATURE(24)..(24)Xaa at
position 24 = Gln, Lys, Cys, Orn, homocycstein or acetyl
phenyalanineMISC_FEATURE(27)..(27)Xaa at position 27 = Met, Leu or
Nle 122His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp
Xaa1 5 10 15Arg Arg Ala Xaa Xaa Phe Val Xaa Trp Leu Xaa Asn Thr 20
2512329PRTArtificial Sequenceglucagon
analogueMISC_FEATURE(15)..(15)Xaa at position 15 = Asp, Glu,
homoglutamic acid, cysteic acid or homocysteic
acidMISC_FEATURE(16)..(16)Xaa at position 16 = Ser, Glu, Gln,
homoglutamic acid or homocysteic acidMISC_FEATURE(20)..(20)Xaa at
position 20 = Gln, Lys, Arg, Orn, or
citrullineMISC_FEATURE(21)..(21)Xaa at position 21 = Asp, Glu,
homoglutamic acid, or homocysteic acidMISC_FEATURE(24)..(24)Xaa at
position 24 = Gln or GluMISC_FEATURE(28)..(28)Xaa at position 28 =
Asn, Lys or an acidic amino acidMISC_FEATURE(29)..(29)Xaa at
position 29 = Thr, Gly or an acidic amino acid 123His Ser Gln Gly
Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Xaa Xaa1 5 10 15Arg Arg Ala
Xaa Xaa Phe Val Xaa Trp Leu Met Xaa Xaa 20 2512429PRTHomo sapiens
124His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1
5 10 15Arg Arg Ala Lys Asp Phe Val Gln Trp Leu Met Asn Thr 20
2512529PRTArtificial Sequenceglucagon analogue 125His Ser Gln Gly
Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala
Lys Asp Phe Val Glu Trp Leu Met Asn Thr 20 2512629PRTArtificial
Sequenceglucagon analogue 126His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala Gln Asp Phe Val Glu
Trp Leu Met Lys Thr 20 2512729PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(2)..(2)Xaa is d-serine, alanine, glycine,
n-methyl serine and aminoisobutyric acidMOD_RES(29)..(29)AMIDATION
127His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1
5 10 15Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr 20
2512829PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(2)..(2)Xaa is aminoisobutyric
acidMOD_RES(29)..(29)AMIDATION 128His Xaa Gln Gly Thr Phe Thr Ser
Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg Ala Gln Asp Phe Val
Gln Trp Leu Met Asn Thr 20 2512939PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(27)..(27)Xaa is Met, Leu or Nle 129His Ser Gln
Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg
Ala Gln Asp Phe Val Gln Trp Leu Xaa Asn Thr Gly Pro Ser 20 25 30Ser
Gly Ala Pro Pro Pro Ser 3513037PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(27)..(27)Xaa is Met, Leu or Nle 130His Ser Gln
Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg
Ala Gln Asp Phe Val Gln Trp Leu Xaa Asn Thr Lys Arg Asn 20 25 30Arg
Asn Asn Ile Ala 3513133PRTArtificial SequenceGlucagon
analogueMISC_FEATURE(27)..(27)Xaa is Met, Leu or Nle 131His Ser Gln
Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Arg
Ala Gln Asp Phe Val Gln Trp Leu Xaa Asn Thr Lys Arg Asn 20 25
30Arg13288PRTArtificial SequenceInsulin conjugate 132His Ala Glu
Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala
Ala Arg Glu Phe Ile Ala Trp Leu Val Arg Gly Arg Gly Gly 20 25 30Pro
Glu His Leu Cys Gly Ala His Leu Val Asp Ala Leu Tyr Leu Val 35 40
45Cys Gly Asp Arg Gly Phe Tyr Phe Asn Asp Arg Gly Ala Gly Ser Ser
50 55 60Ser Arg Arg Gly Ile Val Asp Glu Cys Cys His Arg Ser Cys Asp
Leu65 70 75 80Arg Arg Leu Glu Asn Tyr Cys Asn 8513388PRTArtificial
SequenceInsulin conjugate 133His Ala Glu Gly Thr Phe Thr Ser Asp
Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Arg Glu Phe Ile Ala
Trp Leu Val Arg Gly Arg Gly Gly 20 25 30Pro Glu His Leu Cys Gly Ala
His Leu Val Asp Ala Leu Tyr Leu Val 35 40 45Cys Gly Asp Arg Gly Phe
Tyr Phe Asn Asp Arg Gly Ala Gly Ser Ser 50 55 60Ser Arg Arg Gly Ile
Val Asp Glu Cys Cys His Arg Ser Cys Asp Leu65 70 75 80Arg Arg Leu
Glu Asn Ala Cys Asn 8513488PRTArtificial SequenceInsulin conjugate
134His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Arg Glu Ala Ile Ala Trp Leu Val Arg Gly Arg Gly
Gly 20 25 30Pro Glu His Leu Cys Gly Ala His Leu Val Asp Ala Leu Tyr
Leu Val 35 40 45Cys Gly Asp Arg Gly Phe Tyr Phe Asn Asp Arg Gly Ala
Gly Ser Ser 50 55 60Ser Arg Arg Gly Ile Val Asp Glu Cys Cys His Arg
Ser Cys Asp Leu65 70 75 80Arg Arg Leu Glu Asn Tyr Cys Asn
8513586PRTArtificial SequenceInsulin conjugate 135His Ser Gln Gly
Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala
Gln Asp Phe Val Gln Trp Leu Met Asn Thr Gly Pro Glu 20 25 30His Leu
Cys Gly Ala His Leu Val Asp Ala Leu Tyr Leu Val Cys Gly 35 40 45Asp
Arg Gly Phe Tyr Phe Asn Asp Arg Gly Ala Gly Ser Ser Ser Arg 50 55
60Arg Gly Ile Val Asp Glu Cys Cys His Arg Ser Cys Asp Leu Arg Arg65
70 75 80Leu Glu Asn Tyr Cys Asn 8513686PRTArtificial
SequenceInsulin conjugate 136His Ser Gln Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala Gln Asp Phe Val Gln
Trp Leu Met Asn Thr Gly Pro Glu 20 25 30His Leu Cys Gly Ala His Leu
Val Asp Ala Leu Tyr Leu Val Cys Gly 35 40 45Asp Arg Gly Phe Tyr Phe
Asn Asp Arg Gly Ala Gly Ser Ser Ser
Arg 50 55 60Arg Gly Ile Val Asp Glu Cys Cys His Arg Ser Cys Asp Leu
Arg Arg65 70 75 80Leu Glu Asn Ala Cys Asn 8513786PRTArtificial
SequenceInsulin conjugate 137His Ser Glu Gly Thr Phe Thr Ser Asp
Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala Gln Asp Phe Val Gln
Trp Leu Met Asn Thr Gly Pro Glu 20 25 30His Leu Cys Gly Ala His Leu
Val Asp Ala Leu Tyr Leu Val Cys Gly 35 40 45Asp Arg Gly Phe Tyr Phe
Asn Asp Arg Gly Ala Gly Ser Ser Ser Arg 50 55 60Arg Gly Ile Val Asp
Glu Cys Cys His Arg Ser Cys Asp Leu Arg Arg65 70 75 80Leu Glu Asn
Tyr Cys Asn 8513886PRTArtificial SequenceInsulin conjugate 138His
Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu1 5 10
15Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr Gly Pro Glu
20 25 30His Leu Cys Gly Ala His Leu Val Asp Ala Leu Tyr Leu Val Cys
Gly 35 40 45Asp Arg Gly Phe Tyr Phe Asn Asp Arg Gly Ala Gly Ser Ser
Ser Arg 50 55 60Arg Gly Ile Val Asp Glu Cys Cys His Arg Ser Cys Asp
Leu Arg Arg65 70 75 80Leu Glu Asn Tyr Cys Asn 8513990PRTArtificial
SequenceConjugate of GLP-1 and insulin 139His Ala Glu Gly Thr Phe
Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Arg Glu
Phe Ile Ala Trp Leu Val Arg Gly Arg Gly Phe 20 25 30Val Asn Gln His
Leu Cys Gly Ser His Leu Val Glu Ala Leu Tyr Leu 35 40 45Val Cys Gly
Glu Arg Gly Phe Phe Tyr Thr Pro Lys Thr Gly Ala Gly 50 55 60Ser Ser
Ser Arg Arg Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys65 70 75
80Ser Leu Tyr Gln Leu Glu Asn Tyr Cys Asn 85 9014088PRTArtificial
SequenceConjugate of glucagon and insulin 140His Ser Gln Gly Thr
Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser1 5 10 15Arg Arg Ala Gln
Asp Phe Val Gln Trp Leu Met Asn Thr Phe Val Asn 20 25 30Gln His Leu
Cys Gly Ser His Leu Val Glu Ala Leu Tyr Leu Val Cys 35 40 45Gly Glu
Arg Gly Phe Phe Tyr Thr Pro Lys Thr Gly Ala Gly Ser Ser 50 55 60Ser
Arg Arg Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys Ser Leu65 70 75
80Tyr Gln Leu Glu Asn Tyr Cys Asn 8514135PRTHomo sapiens 141Arg Arg
Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly1 5 10 15Gly
Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu 20 25
30Gln Lys Arg 3514223PRTArtificial SequenceAnalog of the insulin B
chainMISC_FEATURE(1)..(1)Xaa at position 1 is histidine or
threonineMISC_FEATURE(5)..(5)Xaa at position 5 is alanine, glycine
or serineMISC_FEATURE(6)..(6)Xaa at position 6 is histidine,
aspartic acid, glutamic acid, homocysteic acid or cysteic
acidMISC_FEATURE(9)..(9)Xaa at position 9 is aspartic acid,
glutamine or glutamic acidMISC_FEATURE(10)..(10)Xaa at position 10
is alanine or threonineMISC_FEATURE(17)..(17)Xaa at position 17 is
glutamic acid, aspartic acid or asparagineMISC_FEATURE(18)..(18)Xaa
at position 18 is alanine, ornithine, lysine or
arginineMISC_FEATURE(21)..(21)Xaa at position 21 is tyrosine or
4-amino-phenylalanine 142Xaa Leu Cys Gly Xaa Xaa Leu Val Xaa Xaa
Leu Tyr Leu Val Cys Gly1 5 10 15Xaa Xaa Gly Phe Xaa Tyr Thr
2014359PRTArtificial SequenceSingle chain insulin analog 143Phe Val
Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala Leu Tyr1 5 10 15Leu
Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro Lys Thr Gly Ala 20 25
30Gly Ser Ser Ser Arg Arg Gly Ile Val Glu Gln Cys Cys Thr Ser Ile
35 40 45Cys Ser Leu Tyr Gln Leu Glu Asn Tyr Cys Asn 50
5514457PRTArtificial SequenceSingle chain insulin
analogMISC_FEATURE(4)..(4)Xaa at position 4 is histidine or
threonineMISC_FEATURE(9)..(9)Xaa at position 9 is ihistidine,
aspartic acid, glutamic acid, homocysteic acid or cysteic
acidMISC_FEATURE(21)..(21)Xaa at position 21 is alanine ornithine
or arginineMISC_FEATURE(27)..(27)Xaa at position 27 is lysine or
aspartic acidMISC_FEATURE(28)..(28)Xaa at position 21 is proline,
ornithine or arginineMISC_FEATURE(44)..(44)Xaa at position 44 is
phenylalanine or histidine 144Gly Pro Glu Xaa Leu Cys Gly Ala Xaa
Leu Val Asp Ala Leu Tyr Leu1 5 10 15Val Cys Gly Asp Xaa Gly Phe Tyr
Phe Asn Xaa Xaa Gly Ala Gly Ser 20 25 30Ser Ser Arg Arg Gly Ile Val
Asp Glu Cys Cys Xaa Arg Ser Cys Asp 35 40 45Leu Arg Arg Leu Glu Asn
Tyr Cys Asn 50 5514557PRTArtificial SequenceSingle chain insulin
analog 145Gly Pro Glu His Leu Cys Gly Ala His Leu Val Asp Ala Leu
Tyr Leu1 5 10 15Val Cys Gly Asp Arg Gly Phe Tyr Phe Asn Asp Arg Gly
Ala Gly Ser 20 25 30Ser Ser Arg Arg Gly Ile Val Asp Glu Cys Cys His
Arg Ser Cys Asp 35 40 45Leu Arg Arg Leu Glu Asn Tyr Cys Asn 50
551464PRTArtificial Sequencepeptide linker 146Gly Gly Gly
Lys114725PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at position 5 is
histidine or threonine 147Phe Val Lys Gln Xaa Leu Cys Gly Ser His
Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe
20 2514825PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at position 5 is
histidine or threonine 148Phe Val Asn Gln Xaa Leu Cys Gly Ser His
Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe
20 251495PRTArtificial Sequencepeptide fragment of
insulinMISC_FEATURE(3)..(3)Xaa at position 3 is proline, aspartic
acid or glutamic acid 149Tyr Thr Xaa Lys Thr1 51505PRTArtificial
Sequencepeptide fragment of insulin 150Tyr Thr Lys Pro Thr1
51515PRTArtificial Sequencepeptide fragment of insulin 151Tyr Thr
Lys Pro Thr1 51524PRTArtificial Sequencepeptide fragment of
insulinMISC_FEATURE(3)..(3)Xaa at position 3 is proline, aspartic
acid or glutamic acid 152Tyr Thr Xaa Lys115321PRTArtificial
SequenceAnalog of the insulin A chainMISC_FEATURE(8)..(8)Xaa at
position 8 is threonine or histidineMISC_FEATURE(21)..(21)Xaa at
position 21 is asparagine, glycine, alanine, glutamine, glutamate,
threonine, or serine 153Gly Ile Val Glu Gln Cys Cys Xaa Ser Ile Cys
Ser Leu Tyr Gln Leu1 5 10 15Glu Asn Tyr Cys Xaa 2015430PRTHomo
sapiensMISC_FEATURE(5)..(5)Xaa at position 5 is histidine or
threonine 154Phe Val Asn Gln Xaa Leu Cys Gly Ser His Leu Val Glu
Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Glu
Lys Thr 20 25 3015530PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at
position 5 is histidine or threonine 155Phe Val Asn Gln Xaa Leu Cys
Gly Ser His Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg
Gly Phe Phe Tyr Thr Asp Lys Thr 20 25 3015630PRTHomo
sapiensMISC_FEATURE(5)..(5)Xaa at position 5 is histidine or
threonine 156Phe Val Asn Gln Xaa Leu Cys Gly Ser His Leu Val Glu
Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Lys
Pro Thr 20 25 3015730PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at
position 5 is histidine or threonine 157Phe Val Asn Gln Xaa Leu Cys
Gly Ser His Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg
Gly Phe Phe Tyr Thr Pro Lys Thr 20 25 3015829PRTHomo sapiens 158Ser
Ser Ser Ser Lys Ala Pro Pro Pro Ser Leu Pro Ser Pro Ser Arg1 5 10
15Leu Pro Gly Pro Ser Asp Thr Pro Ile Leu Pro Gln Lys 20
2515929PRTHomo sapiens 159Ser Ser Ser Ser Arg Ala Pro Pro Pro Ser
Leu Pro Ser Pro Ser Arg1 5 10 15Leu Pro Gly Pro Ser Asp Thr Pro Ile
Leu Pro Gln Lys 20 2516021PRTArtificial SequenceAnalog of the
insulin A chainMISC_FEATURE(21)..(21)Xaa at position 21 is alanine,
glycine or asparagine 160Gly Ile Val Glu Gln Cys Cys His Ser Ile
Cys Ser Leu Tyr Gln Leu1 5 10 15Glu Asn Tyr Cys Xaa 2016130PRTHomo
sapiensMISC_FEATURE(5)..(5)Xaa at position 5 is histidine or
threonine 161Phe Val Asn Gln Xaa Leu Cys Gly Ser His Leu Val Glu
Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro
Lys Thr 20 25 3016230PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at
position 5 is histidine or threonine 162Phe Val Asn Gln Xaa Leu Cys
Gly Ser His Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg
Gly Phe Phe Tyr Thr Glu Lys Thr 20 25 3016328PRTArtificial
SequenceSingle chain insulin analogMISC_FEATURE(4)..(4)Xaa at
position 4 is histidine or threonineMISC_FEATURE(9)..(9)Xaa at
position 9 is ihistidine, aspartic acid, glutamic acid, homocysteic
acid or cysteic acidMISC_FEATURE(21)..(21)Xaa at position 21 is
alanine ornithine or arginineMISC_FEATURE(27)..(27)Xaa at position
27 is lysine or aspartic acidMISC_FEATURE(28)..(28)Xaa at position
28 is proline, ornithine or arginineMISC_FEATURE(44)..(44)Xaa at
position 44 is phenylalanine or histidine 163Gly Pro Glu His Leu
Cys Gly Ala Xaa Leu Val Asp Ala Leu Tyr Leu1 5 10 15Val Cys Gly Asp
Xaa Gly Phe Tyr Phe Asn Xaa Xaa 20 2516430PRTHomo
sapiensMISC_FEATURE(5)..(5)Xaa at position 5 is histidine or
threonine 164Phe Val Asn Gln Xaa Leu Cys Gly Ser His Leu Val Glu
Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Asp
Lys Thr 20 25 3016530PRTHomo sapiensMISC_FEATURE(5)..(5)Xaa at
position 5 is histidine or threonine 165Phe Val Asn Gln Xaa Leu Cys
Gly Ser His Leu Val Glu Ala Leu Tyr1 5 10 15Leu Val Cys Gly Glu Arg
Gly Phe Phe Tyr Thr Lys Pro Thr 20 25 3016625PRTHomo sapiens 166Pro
Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10
15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20 25167209PRTHomo sapiens
167Met Asp Ser Asp Glu Thr Gly Phe Glu His Ser Gly Leu Trp Val Ser1
5 10 15Val Leu Ala Gly Leu Leu Leu Gly Ala Cys Gln Ala His Pro Ile
Pro 20 25 30Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val Arg Gln
Arg Tyr 35 40 45Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Ala His Leu
Glu Ile Arg 50 55 60Glu Asp Gly Thr Val Gly Gly Ala Ala Asp Gln Ser
Pro Glu Ser Leu65 70 75 80Leu Gln Leu Lys Ala Leu Lys Pro Gly Val
Ile Gln Ile Leu Gly Val 85 90 95Lys Thr Ser Arg Phe Leu Cys Gln Arg
Pro Asp Gly Ala Leu Tyr Gly 100 105 110Ser Leu His Phe Asp Pro Glu
Ala Cys Ser Phe Arg Glu Leu Leu Leu 115 120 125Glu Asp Gly Tyr Asn
Val Tyr Gln Ser Glu Ala His Gly Leu Pro Leu 130 135 140His Leu Pro
Gly Asn Lys Ser Pro His Arg Asp Pro Ala Pro Arg Gly145 150 155
160Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro Ala Leu Pro Glu
165 170 175Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val Gly Ser
Ser Asp 180 185 190Pro Leu Ser Met Val Gly Pro Ser Gln Gly Arg Ser
Pro Ser Tyr Ala 195 200 205Ser16825PRTHomo
sapiensmisc_feature(3)..(4)Xaa can be any naturally occurring amino
acidmisc_feature(6)..(6)Xaa can be any naturally occurring amino
acidmisc_feature(8)..(10)Xaa can be any naturally occurring amino
acidmisc_feature(12)..(13)Xaa can be any naturally occurring amino
acidmisc_feature(20)..(21)Xaa can be any naturally occurring amino
acidmisc_feature(23)..(23)Xaa can be any naturally occurring amino
acid 168Pro Pro Xaa Xaa Gly Xaa Ser Xaa Xaa Xaa Ser Xaa Xaa Gly Pro
Ser1 5 10 15Gln Gly Arg Xaa Xaa Ser Xaa Ala Ser 20 2516925PRTHomo
sapiensmisc_feature(8)..(9)Xaa can be any naturally occurring amino
acidmisc_feature(12)..(12)Xaa can be any naturally occurring amino
acid 169Pro Pro Asp Val Gly Ser Ser Xaa Xaa Leu Ser Xaa Val Gly Pro
Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20 25170216PRTHomo
sapiens 170Met Arg Ser Gly Cys Val Val Val His Val Trp Ile Leu Ala
Gly Leu1 5 10 15Trp Leu Ala Val Ala Gly Arg Pro Leu Ala Phe Ser Asp
Ala Gly Pro 20 25 30His Val His Tyr Gly Trp Gly Asp Pro Ile Arg Leu
Arg His Leu Tyr 35 40 45Thr Ser Gly Pro His Gly Leu Ser Ser Cys Phe
Leu Arg Ile Arg Ala 50 55 60Asp Gly Val Val Asp Cys Ala Arg Gly Gln
Ser Ala His Ser Leu Leu65 70 75 80Glu Ile Lys Ala Val Ala Leu Arg
Thr Val Ala Ile Lys Gly Val His 85 90 95Ser Val Arg Tyr Leu Cys Met
Gly Ala Asp Gly Lys Met Gln Gly Leu 100 105 110Leu Gln Tyr Ser Glu
Glu Asp Cys Ala Phe Glu Glu Glu Ile Arg Pro 115 120 125Asp Gly Tyr
Asn Val Tyr Arg Ser Glu Lys His Arg Leu Pro Val Ser 130 135 140Leu
Ser Ser Ala Lys Gln Arg Gln Leu Tyr Lys Asn Arg Gly Phe Leu145 150
155 160Pro Leu Ser His Phe Leu Pro Met Leu Pro Met Val Pro Glu Glu
Pro 165 170 175Glu Asp Leu Arg Gly His Leu Glu Ser Asp Met Phe Ser
Ser Pro Leu 180 185 190Glu Thr Asp Ser Met Asp Pro Phe Gly Leu Val
Thr Gly Leu Glu Ala 195 200 205Val Arg Ser Pro Ser Phe Glu Lys 210
215171209PRTHomo sapiens 171Met Asp Ser Asp Glu Thr Gly Phe Glu His
Ser Gly Leu Trp Val Ser1 5 10 15Val Leu Ala Gly Leu Leu Leu Gly Ala
Cys Gln Ala His Pro Ile Pro 20 25 30Asp Ser Ser Pro Leu Leu Gln Phe
Gly Gly Gln Val Arg Gln Arg Tyr 35 40 45Leu Tyr Thr Asp Asp Ala Gln
Gln Thr Glu Ala His Leu Glu Ile Arg 50 55 60Glu Asp Gly Thr Val Gly
Gly Ala Ala Asp Gln Ser Pro Glu Ser Leu65 70 75 80Leu Gln Leu Lys
Ala Leu Lys Pro Gly Val Ile Gln Ile Leu Gly Val 85 90 95Lys Thr Ser
Arg Phe Leu Cys Gln Arg Pro Asp Gly Ala Leu Tyr Gly 100 105 110Ser
Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg Glu Leu Leu Leu 115 120
125Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His Gly Leu Pro Leu
130 135 140His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro Ala Pro
Arg Gly145 150 155 160Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro
Pro Ala Leu Pro Glu 165 170 175Pro Pro Gly Ile Leu Ala Pro Gln Pro
Pro Asp Val Gly Ser Ser Asp 180 185 190Pro Leu Ser Met Val Gly Pro
Ser Gln Gly Arg Ser Pro Ser Tyr Ala 195 200 205Ser172250PRTHomo
sapiens 172Met Leu Gly Ala Arg Leu Arg Leu Trp Val Cys Ala Leu Cys
Ser Val1 5 10 15Cys Ser Met Ser Val Leu Arg Ala Tyr Pro Asn Ala Ser
Pro Leu Leu 20 25 30Gly Ser Ser Trp Gly Gly Leu Ile His Leu Tyr Thr
Ala Thr Ala Arg 35 40 45Asn Ser Tyr His Leu Gln Ile His Lys Asn Gly
His Val Asp Gly Ala 50 55
60Pro His Gln Thr Ile Tyr Ser Ala Leu Met Ile Arg Ser Glu Asp Ala65
70 75 80Gly Phe Val Val Ile Thr Gly Val Met Ser Arg Arg Tyr Leu Cys
Met 85 90 95Asp Phe Arg Gly Asn Ile Phe Gly Ser His Tyr Phe Asp Pro
Glu Asn 100 105 110Cys Arg Phe Gln His Gln Thr Leu Glu Asn Gly Tyr
Asp Val Tyr His 115 120 125Ser Pro Gln Tyr His Phe Leu Val Ser Leu
Gly Arg Ala Lys Arg Ala 130 135 140Phe Leu Pro Gly Met Asn Pro Pro
Pro Tyr Ser Gln Phe Leu Ser Arg145 150 155 160Arg Asn Glu Ile Pro
Leu Ile His Phe Asn Thr Pro Ile Pro Arg Arg 165 170 175His Thr Arg
Ser Ala Glu Asp Asp Ser Glu Arg Asp Pro Leu Asn Val 180 185 190Leu
Lys Pro Arg Ala Arg Met Thr Pro Ala Pro Ala Ser Cys Ser Gln 195 200
205Glu Leu Pro Ser Ala Glu Asp Asn Ser Pro Met Ala Ser Asp Pro Leu
210 215 220Gly Val Val Arg Gly Gly Arg Val Asn Thr His Ala Gly Gly
Thr Gly225 230 235 240Pro Glu Gly Cys Arg Pro Phe Ala Lys Phe 245
250173181PRTHomo sapiens 173His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Leu Leu
Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro
Asp Val145 150 155 160Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro
Ser Gln Gly Arg Ser 165 170 175Pro Ser Tyr Ala Ser 180174188PRTHomo
sapiens 174Asp Ala Gly Pro His Val His Tyr Gly Trp Gly Asp Pro Ile
Arg Leu1 5 10 15Arg His Leu Tyr Thr Ser Gly Pro His Gly Leu Ser Ser
Cys Phe Leu 20 25 30Arg Ile Arg Ala Asp Gly Val Val Asp Cys Ala Arg
Gly Gln Ser Ala 35 40 45His Ser Leu Leu Glu Ile Lys Ala Val Ala Leu
Arg Thr Val Ala Ile 50 55 60Lys Gly Val His Ser Val Arg Tyr Leu Cys
Met Gly Ala Asp Gly Lys65 70 75 80Met Gln Gly Leu Leu Gln Tyr Ser
Glu Glu Asp Cys Ala Phe Glu Glu 85 90 95Glu Ile Arg Pro Asp Gly Tyr
Asn Val Tyr Arg Ser Glu Lys His Arg 100 105 110Leu Pro Val Ser Leu
Ser Ser Ala Lys Gln Arg Gln Leu Tyr Lys Asn 115 120 125Arg Gly Phe
Leu Pro Leu Ser His Phe Leu Pro Met Leu Pro Met Val 130 135 140Pro
Glu Glu Pro Glu Asp Leu Arg Gly His Leu Glu Ser Asp Met Phe145 150
155 160Ser Ser Pro Leu Glu Thr Asp Ser Met Asp Pro Phe Gly Leu Val
Thr 165 170 175Gly Leu Glu Ala Val Arg Ser Pro Ser Phe Glu Lys 180
185175181PRTHomo sapiens 175His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Leu Leu
Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Leu Glu
Thr Asp145 150 155 160Ser Met Asp Pro Phe Gly Leu Val Thr Gly Leu
Glu Ala Val Arg Ser 165 170 175Pro Ser Phe Glu Ala 180176181PRTHomo
sapiensMISC_FEATURE(31)..(31)Xaa at position 31 is Alanine or
CysteineMISC_FEATURE(43)..(43)Xaa at position 43 is Glucine or
CysteineMISC_FEATURE(98)..(98)Xaa at position 98 is Leucine or
Aspartic AcidMISC_FEATURE(100)..(100)Xaa at position 100 is Leucine
or LysineMISC_FEATURE(121)..(121)Xaa at position 121 is Asparagine
or Aspartic AcidMISC_FEATURE(127)..(127)Xaa at position 127 is
Aspartic Acid or Lysine 176His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Xaa His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Xaa Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Xaa Leu
Xaa Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Xaa Lys Ser Pro His Arg Xaa Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Leu Glu
Thr Asp145 150 155 160Ser Met Asp Pro Phe Gly Leu Val Thr Gly Leu
Glu Ala Val Arg Ser 165 170 175Pro Ser Phe Glu Ala 18017725PRTHomo
sapiens 177Pro Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly
Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20
2517826PRTHomo sapiens 178Pro Leu Glu Thr Asp Ser Met Asp Pro Phe
Gly Leu Val Thr Gly Leu1 5 10 15Glu Ala Val Arg Ser Pro Ser Phe Glu
Ala 20 2517925PRTHomo sapiens 179Pro Leu Glu Thr Asp Ser Met Asp
Pro Phe Gly Leu Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Phe
Glu Ala 20 2518025PRTHomo sapiens 180Pro Pro Asp Val Gly Ser Met
Asp Pro Phe Gly Leu Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser
Phe Glu Ala 20 2518125PRTHomo sapiens 181Pro Leu Glu Thr Asp Ser
Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro
Ser Phe Glu Ala 20 2518226PRTHomo sapiens 182Pro Pro Asp Val Gly
Ser Met Asp Pro Phe Gly Leu Val Thr Gly Leu1 5 10 15Glu Ala Val Arg
Ser Pro Ser Tyr Ala Ala 20 2518326PRTHomo sapiens 183Pro Leu Glu
Thr Asp Ser Ser Asp Pro Leu Ser Met Val Thr Gly Leu1 5 10 15Glu Ala
Val Arg Ser Pro Ser Tyr Ala Ala 20 2518426PRTHomo sapiens 184Pro
Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Thr Gly Leu1 5 10
15Glu Ala Val Arg Ser Pro Ser Phe Glu Ala 20 2518525PRTHomo
sapiensMISC_FEATURE(11)..(11)Xaa at position 11 is D-serine 185Pro
Pro Asp Val Gly Ser Ser Asp Pro Leu Xaa Met Val Gly Pro Ser1 5 10
15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20 2518625PRTHomo
sapiensMISC_FEATURE(19)..(19)Xaa at position 19 is D-arginine
186Pro Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1
5 10 15Gln Gly Xaa Ser Pro Ser Tyr Ala Ser 20 2518725PRTHomo
sapiensMISC_FEATURE(11)..(11)Xaa at position 11 is
D-serineMISC_FEATURE(19)..(19)Xaa at position 19 is D-arginine
187Pro Pro Asp Val Gly Ser Ser Asp Pro Leu Xaa Met Val Gly Pro Ser1
5 10 15Gln Gly Xaa Ser Pro Ser Tyr Ala Ser 20 2518825PRTHomo
sapiens 188Leu Glu Thr Asp Ser Met Asp Pro Phe Gly Leu Val Thr Gly
Leu Glu1 5 10 15Ala Val Arg Ser Pro Ser Phe Glu Ala 20
2518925PRTHomo sapiensMISC_FEATURE(10)..(10)Xaa at position 10 is
D-serine 189Leu Glu Thr Asp Ser Met Asp Pro Phe Xaa Leu Val Thr Gly
Leu Glu1 5 10 15Ala Val Arg Ser Pro Ser Phe Glu Ser 20
2519025PRTHomo sapiensMISC_FEATURE(10)..(10)Xaa at position 10 is
D-serine 190Leu Glu Thr Asp Ser Met Asp Pro Phe Xaa Leu Val Thr Gly
Leu Glu1 5 10 15Ala Val Arg Ser Pro Ser Phe Glu Ala 20
2519125PRTHomo sapiens 191Pro Pro Asp Val Gly Ser Ser Asp Pro Leu
Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ala
20 25192181PRTHomo sapiens 192His Pro Ile Pro Asp Ser Ser Pro Leu
Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp
Asp Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp Gly
Thr Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln
Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys
Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr
Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Leu
Leu Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105
110Gly Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro
115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu
Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln
Leu Glu Thr Asp145 150 155 160Ser Met Asp Pro Phe Gly Leu Val Thr
Gly Leu Glu Ala Val Arg Ser 165 170 175Pro Ser Phe Glu Ala
180193181PRTHomo sapiens 193His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu
Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Leu Glu
Thr Asp145 150 155 160Ser Met Asp Pro Phe Gly Leu Val Thr Gly Leu
Glu Ala Val Arg Ser 165 170 175Pro Ser Phe Glu Ala 180194156PRTHomo
sapiensMISC_FEATURE(31)..(31)Xaa at position 31 is Alanine or
CysteineMISC_FEATURE(43)..(43)Xaa at position 43 is Glucine or
CysteineMISC_FEATURE(98)..(98)Xaa at position 98 is Leucine or
Aspartic AcidMISC_FEATURE(100)..(100)Xaa at position 100 is Leucine
or LysineMISC_FEATURE(121)..(121)Xaa at position 121 is Asparagine
or Aspartic AcidMISC_FEATURE(127)..(127)Xaa at position 127 is
Aspartic Acid or Lysine 194His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Xaa His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Xaa Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Xaa Leu
Xaa Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Xaa Lys Ser Pro His Arg Xaa Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln145 150
155195156PRTHomo sapiens 195His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Leu Leu
Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln145 150
155196156PRTHomo sapiens 196His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu
Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln145 150
15519739PRTArtificial SequenceSynthetic
peptideMISC_FEATURE(1)..(1)Xaa is Acetyl
D-TyrMISC_FEATURE(10)..(10)Covalently bound to a C16 fatty acyl
group via gamma-Glu spacerMISC_FEATURE(39)..(39)C-terminal
amidation 197Xaa Ala Gln Gly Thr Phe Thr Ser Asp Lys Ser Lys Tyr
Leu Asp Glu1 5 10 15Arg Ala Ala Gln Asp Phe Val Gln Trp Leu Leu Glu
Gly Gly Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser
3519839PRTArtificial SequenceSynthetic
peptideMISC_FEATURE(1)..(1)Xaa is Acetyl
D-HisMISC_FEATURE(10)..(10)Covalently bound to a C16 fatty acyl
group via gamma-Glu spacerMISC_FEATURE(39)..(39)C-terminal
amidation 198Xaa Ala Gln Gly Thr Phe Thr Ser Asp Lys Ser Lys Tyr
Leu Asp Glu1 5 10 15Arg Ala Ala Gln Asp Phe Val Gln Trp Leu Leu Glu
Gly Gly Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser
3519939PRTArtificial SequenceSynthetic
peptideMISC_FEATURE(1)..(1)Xaa is Acetyl D-thio
AlaMISC_FEATURE(10)..(10)Covalently bound to a C16 fatty acyl group
via gamma-Glu spacerMISC_FEATURE(39)..(39)C-terminal amidation
199Xaa Ala Gln Gly Thr Phe Thr Ser Asp Lys Ser Lys Tyr Leu Asp Glu1
5 10 15Arg Ala Ala Gln Asp Phe Val Gln Trp Leu Leu Glu Gly Gly Pro
Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser 3520039PRTArtificial
SequenceSynthetic peptideMISC_FEATURE(1)..(1)Xaa is
acetyl-D-TyrMISC_FEATURE(10)..(10)Covalently bound to a C16 fatty
acyl group via a gamma-Glu spacerMISC_FEATURE(39)..(39)C-terminal
amidation 200Xaa Ala Gln Gly Thr Phe Thr Ser Asp Lys Ser Lys Tyr
Leu Asp Glu1 5 10 15Arg Ala Ala Gln Asp Phe Val Gln Trp Leu Leu Asp
Ala Gly Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser
3520139PRTArtificial SequenceSynthetic
peptideMISC_FEATURE(1)..(1)Xaa is acetyl-D-Tyr 201Xaa Ala Gln Gly
Thr Phe Thr Ser Asp Lys Ser Lys Tyr Leu Asp Glu1 5 10 15Arg Ala Ala
Gln Asp Phe Val Gln Trp Leu Leu Glu Ala Gly Pro Ser 20 25 30Ser Gly
Ala Pro Pro Pro Ser 3520229PRTArtificial SequenceSynthetic
peptideMISC_FEATURE(2)..(2)Xaa at position 2 is
AibMISC_FEATURE(16)..(16)Xaa at position 16 is Aib 202His Xaa Gln
Gly Thr Phe Thr Ser Asp Lys Ser Lys Tyr Leu Asp Xaa1 5 10 15Arg Ala
Ala Gln Asp Phe Val Gln Trp Leu Met Asp Thr 20 2520325PRTHomo
sapiens 203Leu Glu Thr Asp Ser Met Asp Pro Phe Gly Leu Val Thr Gly
Leu Glu1 5 10 15Ala Val Arg Ser Pro Ser Phe Glu Lys 20
25204181PRTHomo sapiens 204His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Leu Leu
Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro
Asp Val145 150 155 160Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro
Ser Gln Gly Arg Ser 165 170 175Pro Ser Tyr Ala Ala 180205181PRTHomo
sapiens 205His Pro Ile Pro Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly
Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr
Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr Val Gly Cys Ala
Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys
Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu
Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly Ser Leu His Phe
Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly
Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly Leu Pro Leu His
Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120 125Ala Pro Arg
Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro 130 135 140Ala
Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val145 150
155 160Gly Ser Met Asp Pro Phe Gly Leu Val Gly Pro Ser Gln Val Arg
Ser 165 170 175Pro Ser Phe Glu Ala 180206181PRTHomo sapiens 206His
Pro Ile Pro Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10
15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Ala His
20 25 30Leu Glu Ile Arg Glu Asp Gly Thr Val Gly Gly Ala Ala Asp Gln
Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys Pro Gly Val
Ile Gln 50 55 60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu Cys Gln Arg
Pro Asp Gly65 70 75 80Ala Leu Tyr Gly Ser Leu His Phe Asp Pro Glu
Ala Cys Ser Phe Arg 85 90 95Glu Leu Leu Leu Glu Asp Gly Tyr Asn Val
Tyr Gln Ser Glu Ala His 100 105 110Gly Leu Pro Leu His Leu Pro Gly
Asn Lys Ser Pro His Arg Asp Pro 115 120 125Ala Pro Arg Gly Pro Ala
Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu
Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val145 150 155 160Gly
Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser Gln Gly Arg Ser 165 170
175Pro Ser Tyr Ala Ala 180207181PRTHomo sapiens 207His Pro Ile Pro
Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg
Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu
Ile Arg Glu Asp Gly Thr Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro
Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55
60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65
70 75 80Ala Leu Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe
Arg 85 90 95Glu Leu Leu Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu
Ala His 100 105 110Gly Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro
His Arg Asp Pro 115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro
Leu Pro Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile
Leu Ala Pro Gln Pro Pro Asp Val145 150 155 160Gly Ser Met Asp Pro
Phe Gly Leu Val Gly Pro Ser Gln Gly Arg Ser 165 170 175Pro Ser Phe
Glu Ala 180208181PRTHomo sapiens 208His Pro Ile Pro Asp Ser Ser Pro
Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr
Asp Asp Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp
Gly Thr Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu
Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val
Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu
Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu
Leu Leu Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105
110Gly Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro
115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu
Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln
Pro Leu Glu Thr145 150 155 160Asp Ser Met Asp Pro Phe Gly Leu Val
Gly Pro Ser Gln Gly Arg Ser 165 170 175Pro Ser Phe Glu Ala
180209181PRTHomo sapiens 209His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Ala His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Gly Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Leu Leu
Leu Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asn Lys Ser Pro His Arg Asp Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Asp
Val Gly145 150 155 160Ser Met Asp Pro Phe Gly Leu Val Thr Gly Leu
Glu Ala Val Arg Ser 165 170 175Pro Ser Tyr Ala Ala 18021025PRTHomo
sapiens 210Ala Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly
Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20
2521125PRTHomo sapiens 211Pro Ala Asp Val Gly Ser Ser Asp Pro Leu
Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser
20 2521225PRTHomo sapiens 212Pro Pro Ala Val Gly Ser Ser Asp Pro
Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala
Ser 20 2521325PRTHomo sapiens 213Pro Pro Asp Ala Gly Ser Ser Asp
Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr
Ala Ser 20 2521425PRTHomo sapiens 214Pro Pro Asp Val Ala Ser Ser
Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser
Tyr Ala Ser 20 2521525PRTHomo sapiens 215Pro Pro Asp Val Gly Ala
Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro
Ser Tyr Ala Ser 20 2521625PRTHomo sapiens 216Pro Pro Asp Val Gly
Ser Ala Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser
Pro Ser Tyr Ala Ser 20 2521725PRTHomo sapiens 217Pro Pro Asp Val
Gly Ser Ser Ala Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg
Ser Pro Ser Tyr Ala Ser 20 2521825PRTHomo sapiens 218Pro Pro Asp
Val Gly Ser Ser Asp Ala Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly
Arg Ser Pro Ser Tyr Ala Ser 20 2521925PRTHomo sapiens 219Pro Pro
Asp Val Gly Ser Ser Asp Pro Ala Ser Met Val Gly Pro Ser1 5 10 15Gln
Gly Arg Ser Pro Ser Tyr Ala Ser 20 2522025PRTHomo sapiens 220Pro
Pro Asp Val Gly Ser Ser Asp Pro Leu Ala Met Val Gly Pro Ser1 5 10
15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20 2522125PRTHomo sapiens
221Pro Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Ala Val Gly Pro Ser1
5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20 2522225PRTHomo
sapiens 222Pro Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Ala Gly
Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser 20
2522325PRTHomo sapiens 223Pro Pro Asp Val Gly Ser Ser Asp Pro Leu
Ser Met Val Ala Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ser
20 2522425PRTHomo sapiens 224Pro Pro Asp Val Gly Ser Ser Asp Pro
Leu Ser Met Val Gly Ala Ser1 5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala
Ser 20 2522525PRTHomo sapiens 225Pro Pro Asp Val Gly Ser Ser Asp
Pro Leu Ser Met Val Gly Pro Ala1 5 10 15Gln Gly Arg Ser Pro Ser Tyr
Ala Ser 20 2522625PRTHomo sapiens 226Pro Pro Asp Val Gly Ser Ser
Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Ala Gly Arg Ser Pro Ser
Tyr Ala Ser 20 2522725PRTHomo sapiens 227Pro Pro Asp Val Gly Ser
Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Ala Arg Ser Pro
Ser Tyr Ala Ser 20 2522825PRTHomo sapiens 228Pro Pro Asp Val Gly
Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Ala Ser
Pro Ser Tyr Ala Ser 20 2522925PRTHomo sapiens 229Pro Pro Asp Val
Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly Arg
Ala Pro Ser Tyr Ala Ser 20 2523025PRTHomo sapiens 230Pro Pro Asp
Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln Gly
Arg Ser Ala Ser Tyr Ala Ser 20 2523125PRTHomo sapiens 231Pro Pro
Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10 15Gln
Gly Arg Ser Pro Ala Tyr Ala Ser 20 2523225PRTHomo sapiens 232Pro
Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1 5 10
15Gln Gly Arg Ser Pro Ser Ala Ala Ser 20 2523325PRTHomo sapiens
233Pro Pro Asp Val Gly Ser Ser Asp Pro Leu Ser Met Val Gly Pro Ser1
5 10 15Gln Gly Arg Ser Pro Ser Tyr Ala Ala 20 2523425PRTHomo
sapiens 234Pro Asp Val Gly Ser Met Asp Pro Phe Gly Leu Val Thr Gly
Leu Glu1 5 10 15Ala Val Arg Ser Pro Ser Tyr Ala Ala 20
2523526PRTHomo sapiensMISC_FEATURE(1)..(1)Xaa at position 1 is Pro
or absentMISC_FEATURE(2)..(2)Xaa at position 2 is Pro or
LeuMISC_FEATURE(3)..(3)Xaa at position 3 is Asp or
GluMISC_FEATURE(4)..(4)Xaa at position 4 is Val or
ThrMISC_FEATURE(5)..(5)Xaa at position 5 is Gly, Asp, Phe, Leu or
SerMISC_FEATURE(7)..(7)Xaa at position 7 is Ser or
MetMISC_FEATURE(10)..(10)Xaa at position 10 is Leu or
PheMISC_FEATURE(11)..(11)Xaa at position 11 is Ser or
GlyMISC_FEATURE(12)..(12)Xaa at position 12 is Met or
LeuMISC_FEATURE(14)..(14)Xaa at position 14 is absent or
ThrMISC_FEATURE(16)..(16)Xaa at position 16 is Pro, Leu, Arg, Glu,
or GlyMISC_FEATURE(17)..(17)Xaa at position 17 is Ser or
GluMISC_FEATURE(18)..(18)Xaa at position 18 is Gln or
AlaMISC_FEATURE(19)..(19)Xaa at position 19 is Gly or
ValMISC_FEATURE(24)..(24)Xaa at position 24 is Tyr or
PheMISC_FEATURE(25)..(25)Xaa at position 25 is Ala or
GluMISC_FEATURE(26)..(26)Xaa at position 26 is an aliphatic amino
acid selected from Gly, Ala, Val, Leu, Ser, or Ile 235Xaa Xaa Xaa
Xaa Xaa Ser Xaa Asp Pro Xaa Xaa Xaa Val Xaa Gly Xaa1 5 10 15Xaa Xaa
Xaa Arg Ser Pro Ser Xaa Xaa Xaa 20 2523626PRTHomo
sapiensMISC_FEATURE(1)..(1)Xaa at position 1 is Pro or
absentMISC_FEATURE(2)..(2)Xaa at position 2 is Pro or
LeuMISC_FEATURE(3)..(3)Xaa at position 3 is Asp or
GluMISC_FEATURE(4)..(4)Xaa at position 4 is Val or
ThrMISC_FEATURE(5)..(5)Xaa at position 5 is Gly, Asp, Phe, Leu or
SerMISC_FEATURE(7)..(7)Xaa at position 7 is Ser or
MetMISC_FEATURE(10)..(10)Xaa at position 10 is Leu or
PheMISC_FEATURE(11)..(11)Xaa at position 11 is Ser or
GlyMISC_FEATURE(12)..(12)Xaa at position 12 is Met or
LeuMISC_FEATURE(14)..(14)Xaa at position 14 is absent or
ThrMISC_FEATURE(16)..(16)Xaa at position 16 is Pro, Leu, Arg, Glu,
or GlyMISC_FEATURE(17)..(17)Xaa at position 17 is Ser or
GluMISC_FEATURE(18)..(18)Xaa at position 18 is Gln or
AlaMISC_FEATURE(19)..(19)Xaa at position 19 is Gly or
ValMISC_FEATURE(24)..(24)Xaa at position 24 is Tyr or
PheMISC_FEATURE(25)..(25)Xaa at position 25 is Ala or Glu 236Xaa
Xaa Xaa Xaa Xaa Ser Xaa Asp Pro Xaa Xaa Xaa Val Xaa Gly Xaa1 5 10
15Xaa Xaa Xaa Arg Ser Pro Ser Xaa Xaa Ala 20 2523725PRTHomo sapiens
237Pro Pro Asp Val Gly Ser Met Asp Pro Phe Gly Leu Val Gly Arg Ser1
5 10 15Gln Gly Arg Ser Pro Ser Phe Glu Ala 20 2523825PRTHomo
sapiens 238Pro Pro Asp Val Phe Ser Met Asp Pro Phe Gly Leu Val Gly
Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Phe Glu Ala 20
2523925PRTHomo sapiens 239Pro Pro Asp Val Leu Ser Met Asp Pro Phe
Gly Leu Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Phe Glu Ala
20 2524025PRTHomo sapiens 240Pro Pro Asp Val Ser Ser Met Asp Pro
Phe Gly Leu Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Phe Glu
Ala 20 2524125PRTHomo sapiens 241Pro Pro Asp Val Gly Ser Ser Asp
Pro Phe Gly Leu Val Gly Pro Ser1 5 10 15Gln Gly Arg Ser Pro Ser Phe
Glu Ala 20 25242181PRTHomo sapiens 242His Pro Ile Pro Asp Ser Ser
Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr
Thr Asp Asp Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu
Asp Gly Thr Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu
Leu Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly
Val Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala
Leu Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90
95Glu Asp Leu Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His
100 105 110Gly Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg
Lys Pro 115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro
Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala
Pro Gln Pro Pro Asp Val145 150 155 160Gly Ser Met Asp Pro Phe Gly
Leu Val Gly Arg Ser Gln Val Arg Ser 165 170 175Pro Ser Phe Glu Ala
180243181PRTHomo sapiens 243His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu
Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro
Asp Val145 150 155 160Phe Ser Met Asp Pro Phe Gly Leu Val Gly Pro
Ser Gln Val Arg Ser 165 170 175Pro Ser Phe Glu Ala 180244181PRTHomo
sapiens 244His Pro Ile Pro Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly
Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr
Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr Val Gly Cys Ala
Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys
Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu
Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly Ser Leu His Phe
Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly
Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly Leu Pro Leu His
Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120 125Ala Pro Arg
Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro 130 135 140Ala
Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val145 150
155 160Leu Ser Met Asp Pro Phe Gly Leu Val Gly Pro Ser Gln Val Arg
Ser 165 170 175Pro Ser Phe Glu Ala 180245181PRTHomo sapiens 245His
Pro Ile Pro Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10
15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Cys His
20 25 30Leu Glu Ile Arg Glu Asp Gly Thr Val Gly Cys Ala Ala Asp Gln
Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys Pro Gly Val
Ile Gln 50 55 60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu Cys Gln Arg
Pro Asp Gly65 70 75 80Ala Leu Tyr Gly Ser Leu His Phe Asp Pro Glu
Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly Tyr Asn Val
Tyr Gln Ser Glu Ala His 100 105 110Gly Leu Pro Leu His Leu Pro Gly
Asp Lys Ser Pro His Arg Lys Pro 115 120 125Ala Pro Arg Gly Pro Ala
Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu
Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val145 150 155 160Ser
Ser Met Asp Pro Phe Gly Leu Val Gly Pro Ser Gln Val Arg Ser 165 170
175Pro Ser Phe Glu Ala 180246181PRTHomo sapiens 246His Pro Ile Pro
Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg
Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu
Ile Arg Glu Asp Gly Thr Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro
Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55
60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65
70 75 80Ala Leu Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe
Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu
Ala His 100 105 110Gly Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro
His Arg Lys Pro 115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro
Leu Pro Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile
Leu Ala Pro Gln Pro Pro Asp Val145 150 155 160Gly Ser Ser Asp Pro
Phe Gly Leu Val Gly Pro Ser Gln Val Arg Ser 165 170 175Pro Ser Phe
Glu Ala 180247181PRTHomo sapiens 247His Pro Ile Pro Asp Ser Ser Pro
Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr
Asp Asp Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp
Gly Thr Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu
Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val
Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu
Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu
Asp Leu Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105
110Gly Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro
115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu
Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln
Pro Pro Asp Val145 150 155 160Gly Ser Met Asp Pro Phe Gly Leu Val
Gly Pro Ser Gln Gly Arg Ser 165 170 175Pro Ser Phe Glu Ala
180248181PRTHomo sapiens 248His Pro Ile Pro Asp Ser Ser Pro Leu Leu
Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp
Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr
Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu
Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr
Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly
Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu
Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly
Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120
125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro
130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro
Asp Val145 150 155 160Gly Ser Met Asp Pro Phe Gly Leu Val Gly Arg
Ser Gln Gly Arg Ser 165 170 175Pro Ser Phe Glu Ala 180249181PRTHomo
sapiens 249His Pro Ile Pro Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly
Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr
Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp Gly Thr Val Gly Cys Ala
Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys
Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu
Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu Tyr Gly Ser Leu His Phe
Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly
Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105 110Gly Leu Pro Leu His
Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro 115 120 125Ala Pro Arg
Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro 130 135 140Ala
Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val145 150
155 160Phe Ser Met Asp Pro Phe Gly Leu Val Gly Pro Ser Gln Gly Arg
Ser 165 170 175Pro Ser Phe Glu Ala 180250181PRTHomo sapiens 250His
Pro Ile Pro Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10
15Arg Gln Arg Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Cys His
20 25 30Leu Glu Ile Arg Glu Asp Gly Thr Val Gly Cys Ala Ala Asp Gln
Ser 35 40 45Pro Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys Pro Gly Val
Ile Gln 50 55 60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu Cys Gln Arg
Pro Asp Gly65 70 75 80Ala Leu Tyr Gly Ser Leu His Phe Asp Pro Glu
Ala Cys Ser Phe Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly Tyr Asn Val
Tyr Gln Ser Glu Ala His 100 105 110Gly Leu Pro Leu His Leu Pro Gly
Asp Lys Ser Pro His Arg Lys Pro 115 120 125Ala Pro Arg Gly Pro Ala
Arg Phe Leu Pro Leu Pro Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu
Pro Pro Gly Ile Leu Ala Pro Gln Pro Pro Asp Val145 150 155 160Leu
Ser Met Asp Pro Phe Gly Leu Val Gly Pro Ser Gln Gly Arg Ser 165 170
175Pro Ser Phe Glu Ala 180251181PRTHomo sapiens 251His Pro Ile Pro
Asp Ser Ser Pro Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg
Tyr Leu Tyr Thr Asp Asp Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu
Ile Arg Glu Asp Gly Thr Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro
Glu Ser Leu Leu Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55
60Ile Leu Gly Val Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65
70 75 80Ala Leu Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe
Arg 85 90 95Glu Asp Leu Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu
Ala His 100 105 110Gly Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro
His Arg Lys Pro 115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro
Leu Pro Gly Leu Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile
Leu Ala Pro Gln Pro Pro Asp Val145 150 155 160Ser Ser Met Asp Pro
Phe Gly Leu Val Gly Pro Ser Gln Gly Arg Ser 165 170 175Pro Ser Phe
Glu Ala 180252181PRTHomo sapiens 252His Pro Ile Pro Asp Ser Ser Pro
Leu Leu Gln Phe Gly Gly Gln Val1 5 10 15Arg Gln Arg Tyr Leu Tyr Thr
Asp Asp Ala Gln Gln Thr Glu Cys His 20 25 30Leu Glu Ile Arg Glu Asp
Gly Thr Val Gly Cys Ala Ala Asp Gln Ser 35 40 45Pro Glu Ser Leu Leu
Gln Leu Lys Ala Leu Lys Pro Gly Val Ile Gln 50 55 60Ile Leu Gly Val
Lys Thr Ser Arg Phe Leu Cys Gln Arg Pro Asp Gly65 70 75 80Ala Leu
Tyr Gly Ser Leu His Phe Asp Pro Glu Ala Cys Ser Phe Arg 85 90 95Glu
Asp Leu Lys Glu Asp Gly Tyr Asn Val Tyr Gln Ser Glu Ala His 100 105
110Gly Leu Pro Leu His Leu Pro Gly Asp Lys Ser Pro His Arg Lys Pro
115 120 125Ala Pro Arg Gly Pro Ala Arg Phe Leu Pro Leu Pro Gly Leu
Pro Pro 130 135 140Ala Leu Pro Glu Pro Pro Gly Ile Leu Ala Pro Gln
Pro Pro Asp Val145 150 155 160Gly Ser Ser Asp Pro Phe Gly Leu Val
Gly Pro Ser Gln Gly Arg Ser 165 170 175Pro Ser Phe Glu Ala 180
* * * * *